4KSGA

Dna gyrase atp binding domain of enterococcus faecalis in complex with a small molecule inhibitor (4-[(1s,5r,6r)-6-amino-1-methyl-3-azabicyclo[3.2.0]hept-3-yl]-6-fluoro-n-methyl-2-[(2-methylpyrimidin-5-yl)oxy]-9h-pyrimido[4,5-b]indol-8-amine)
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
210
structure length
190
Chain Sequence
GLEAVRKRPGMYIGSTSGEGLHHLVWEIVDNSIDEALAGFAKSIQVIIEPDDSITVIDDGRGIPVGIQAKTGRPAVETVFTVLGSSVVNALSTSLDVRVYKDGKVYYQEYRRGAVVDDLKVIEETDRHGTTVHFIPDPEIFTETTVYDFDKLATRVRELAFLNRGLHISIEDRREGQEDKKEYHYEGLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A new class of type iia topoisomerase inhibitors with broad-spectrum antibacterial activity
rcsb
source organism Enterococcus faecalis
molecule tags Isomerase/isomerase inhibitor
molecule keywords DNA gyrase subunit B
total genus 62
structure length 190
sequence length 210
ec nomenclature ec 5.99.1.3: Transferred entry: 5.6.2.3.
pdb deposition date 2013-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 4ksgA00
1EI1A 4KSHA 3G7BA 4CWRA 2BYHA 1YERA 3G75A 1MX0A 4FMTA 2ZBKB 2WI6A 3T0ZA 2XABA 5C93A 1YESA 3HYZA 2YI6A 1UYHA 3R4MA 4KTNA 3QTFA 3CGYA 4E00A 4H7QA 4XIQA 4NH8A 2O1WA 4GFNA 1OSFA 4B6CA 2YEAA 3ZXQA 2YKCA 2XDKA 1H7SA 4MOTA 1TILA 5CF0A 4WUBA 1U0ZA 2YEJA 2YE4A 2YJXA 2BSMA 2WI4A 3HYYA 2BZ5A 3O2FA 5D6QA 5D7CA 3OWDA 4WUCA 3TZ0A 2BU2A 2VWCA 2YE7A 4CWNA 5CTYA 4AWQA 1L0OA 2BREA 2XJGA 2CH4A 3JZ3A 3TZ4A 4LWHA 2YK2A 2CCUA 2IORA 2YI7A 4XIPA 4MPCA 4YKYA 4GCZA 4ASFA 4URNA 2XDUA 4KSGA 4NH9A 5BODA 4XKAA 5CTWA 4FCQA 4R3MA 2YGAA 3B25A 1I5DA 5CPHA 3A0RA 4AWPA 3T0HA 4BIUA 4R3AA 2XCMA 4MBCA 4CWPA 1YETA 3VADA 1YT1A 4EMVA 4URLA 2IWSA 3CGZA 2YE3A 1UYGA 1ZXMA 2XHXA 3EKOA 3K60A 4XCJA 2XHRA 1I5AA 1B63A 4K4OA 2WEPA 3Q5KA 1I59A 1BXDA 1UY6A 4XE2A 1A4HA 4AS9A 2WERA 4MPEA 1TIDA 2YK9A 4EGKA 4LWGA 4MP7A 3D36A 4YKZA 5D6PA 2YEEA 4KP4A 4CWOA 4MP2A 3TZ5A 5M4NA 3VHDA 1ZWHA 4JQLA 4BAEA 1AMWA 1AJ6A 2GFDA 3FT8A 5M4HA 2WEQA 2AKPA 2HKJA 1Z59A 1YC4A 4O0BA 3R91A 2HCHA 4PRVA 3K99A 4BQGA 2CGFA 3VHCA 1UYFA 4L91A 3R4OA 3ZKBA 2CG9A 2BU7A 4YKXA 2FYPA 4ZVIA 1QZRA 2IWUA 3BMYA 4URMA 1THNA 2QG2A 2YEBA 1S14A 1Z5CA 3TZ2A 4JAUA 2XX4A 4MB9A 3GIGA 3HEKA 2WI5A 4XDMA 3ZKDA 4KQVA 4BIZA 4O05A 1QY8A 4ASGA 1ID0A 3OPDA 4LWIA 3HZ1A 1Z5AA 5FNDA 4V26A 3GIGB 2XJXA 5IDMA 4H81A 4CWSA 5CTUA 2PNRA 2BYIA 2YEFA 3WQ9A 2H55A 2YGEA 3B27A 4CE1A 2YEDA 2QG0A 4P7AA 3R92A 3EKRA 1Y8PA 2XD6A 3G7EA 2E0AA 2FXSA 4GQTA 2GQPA 4V25A 2YKJA 5F3KA 3U2DA 3H80A 3A0YA 4UROA 4P8OA 4MPNA 4QPJA 4XTJA 2Q8GA 1Y4UA 2ZKJA 4E02A 3R4NA 4JASA 1UYCA 1I5CA 4ASBA 1AH6A 3CWVA 1YSZA 4YKUA 2XX5A 4R1FA 2CCTA 1H7UA 3U67A 2IOQA 4LP0A 2HG1A 1Y8NA 3EHGA 4HZ5A 4HXWA 3IEDA 4FPPA 2FWYA 2BTZA 5M4PA 4XC0A 5IDJA 4W7TA 1QYEA 4L8ZA 3RKZA 1UY7A 2YE2A 4B7PA 3K98A 2BU6A 1EA6A 2YI0A 3HZ5A 4O07A 3OW6A 3B24A 4YKTA 2Q2EB 3Q5LA 2C2AA 2YE9A 4QPKA 3C0EA 4HY6A 2IWXA 2WI3A 4O09A 5M4EA 4U7NA 4XIRA 5FWKA 1U2OA 4EFUA 2Q8FA 1Y4SA 4DZYA 3D2RA 4KFGA 1AH8A 5FNCA 3RLQA 4CWQA 2ZDYA 5J6AA 1UYKA 3TTZA 4WUDA 3EHJA 4LWEA 3C11A 1KZNA 3VHAA 1PVGA 1YC1A 3T10A 4PRXA 2Q8HA 2XJJA 3K97A 2Q8IA 4HYMA 5CTXA 3RLRA 4EFTA 3LPSA 3A0XA 4YKQA 4ZKIA 5J71A 2XDSA 4CE3A 4I5SA 3GIFA 4I3HA 2IOPA 4FCRA 4XCLA 3O6OA 4PL9A 2VCIA 3A0TA 1AM1A 1US7A 4PU9A 4L94A 3BM9A 1ZXNA 4HY1A 3INWA 2YEGA 1BYQA 4U7OA 3T2SA 4BXIA 4XKOA 1UYLA 1I5BA 2BRCA 2QFOA 4GEEA 5L3JA 1UYMA 2ZDXA 4HYPA 1YT0A 3A0WA 1GKZA 2YE6A 2YKEA 2QF6A 5IN9A 2YE5A 2YE8A 3A0ZA 2WI7A 5M4MA 3WHAA 2VW5A 1TC6A 2BT0A 2H8MA 2WI1A 4LWFA 3B28A 4BQJA 4GGLA 3KE6A 4HZ0A 3ZXOA 2YJWA 4ASAA 1GJVA 5BOCA 5F5RA 3NMQA 4GT8A 4DUHA 2JJCA 2JKIA 5D7DA 1B62A 3DGEA 4NH7A 4CWFA 4X9LA 5GGZA 2ESAA 3LNUA 4LPBA 3EHHA 4EEHA 1NHJA 4U93A 3GIEA 1YT2A 3R4PA 1Y8OA 3TUHA 2XDLA 4EM7A 4AWOA 2BU5A 2YKBA 4XKKA 2XHTA 2O1UA 3INXA 3Q5JA 4O04A 3D0BA 3RLPA 3MNRP 3SL2A 4EGHA 1Z5BA 2YI5A 4YKRA 1MU5A 2XDXA 3PEHA 2UWDA 3O0IA 1UYIA 4YKWA 1ZW9A 1R62A 3U2KA 2BU8A 3B26A 2WI2A 1YSRA 2YECA 1NHIA 2XX2A 3T1KA 3OWBA 2FWZA 1YC3A 3FT5A 4JAVA 1BGQA 4CE2A 1GKXA 1TH8A 4EGIA 2O1VA 2EXLA 2YEHA 1UY9A 3HHUA 4XD8A 1UYDA 3CRKA 2VCJA 2YEIA 4L90A 4XITA 4Q20A 4E01A 4L93A 3FV5A 3ZM7A 5FNFA 2YKIA 5M4KA 4HXZA 1BKNA 1NHHA 3EHFA 3PEJA 1YS3A 2YGFA 1B3QA 3QDDA 1S16A 1KIJA 1UY8A 3H4LA 3CRLA 4H85A 4FCPA 1JM6A 3OMUA 1TBWA 1UYEA 5D7RA 2CCSA 1TC0A 1I58A 2XK2A 2K5BA 4CWTA
chains in the Genus database with same CATH superfamily
1EI1A 4KSHA 3G7BA 4CWRA 2BYHA 1YERA 3G75A 1MX0A 4FMTA 2ZBKB 2WI6A 3T0ZA 2XABA 5C93A 1YESA 3HYZA 2YI6A 1UYHA 3R4MA 4KTNA 3QTFA 3CGYA 4E00A 4H7QA 4XIQA 4NH8A 2O1WA 4GFNA 1OSFA 4B6CA 2YEAA 3ZXQA 2YKCA 2XDKA 1H7SA 4MOTA 1TILA 5CF0A 4WUBA 1U0ZA 2YEJA 2YE4A 2YJXA 2BSMA 2WI4A 3HYYA 2BZ5A 3O2FA 5D6QA 5D7CA 3OWDA 4WUCA 3TZ0A 2BU2A 2VWCA 2YE7A 3CYGA 4CWNA 5CTYA 4AWQA 1L0OA 2BREA 2XJGA 2CH4A 3JZ3A 3TZ4A 4LWHA 2YK2A 2CCUA 2IORA 2YI7A 3LMMA 4XIPA 4MPCA 4YKYA 4GCZA 4ASFA 4URNA 2XDUA 4KSGA 4NH9A 5BODA 4XKAA 5CTWA 4FCQA 4R3MA 2YGAA 3B25A 1I5DA 5CPHA 3A0RA 4AWPA 3T0HA 4BIUA 4R3AA 2XCMA 4MBCA 4CWPA 1YETA 3VADA 1YT1A 4EMVA 4URLA 2IWSA 3CGZA 2YE3A 1UYGA 1ZXMA 2XHXA 3EKOA 3K60A 4XCJA 2XHRA 1I5AA 1B63A 4K4OA 2WEPA 3Q5KA 1I59A 1BXDA 1UY6A 4XE2A 1A4HA 4AS9A 2WERA 4MPEA 1TIDA 2YK9A 4EGKA 4LWGA 3S5TA 4MP7A 3D36A 4YKZA 5D6PA 2YEEA 4KP4A 4CWOA 4MP2A 3TZ5A 5M4NA 1F51A 1ZWHA 3VHDA 4JQLA 4BAEA 1AMWA 1AJ6A 2GFDA 3FT8A 5M4HA 2WEQA 2AKPA 2HKJA 1Z59A 1YC4A 4O0BA 3R91A 2HCHA 4PRVA 3K99A 4BQGA 2CGFA 3VHCA 1UYFA 4L91A 3R4OA 3ZKBA 2CG9A 2BU7A 4YKXA 2FYPA 4ZVIA 1QZRA 2IWUA 3BMYA 4URMA 1THNA 2QG2A 2YEBA 1S14A 1Z5CA 3TZ2A 4JAUA 2XX4A 4MB9A 3GIGA 3HEKA 2WI5A 4XDMA 3ZKDA 4KQVA 4BIZA 4O05A 1QY8A 4ASGA 2C1GA 1ID0A 3OPDA 4LWIA 3HZ1A 1Z5AA 5FNDA 4V26A 3GIGB 2XJXA 5IDMA 4H81A 4CWSA 5CTUA 2PNRA 2BYIA 2YEFA 3WQ9A 2H55A 5JENA 2YGEA 3B27A 4CE1A 2YEDA 2QG0A 4P7AA 3R92A 3EKRA 1Y8PA 2XD6A 3G7EA 2E0AA 2FXSA 4GQTA 2GQPA 4V25A 2YKJA 5F3KA 3U2DA 3H80A 3A0YA 4UROA 4P8OA 4MPNA 4QPJA 4XTJA 2Q8GA 1Y4UA 2ZKJA 4E02A 3R4NA 4JASA 1UYCA 1I5CA 4ASBA 4E72A 2HHIA 2C1IA 1AH6A 3CWVA 1YSZA 4YKUA 2XX5A 4R1FA 2CCTA 1H7UA 3U67A 2IOQA 4LP0A 2HG1A 1Y8NA 3EHGA 4HZ5A 4HXWA 3IEDA 4FPPA 2FWYA 2BTZA 5M4PA 4XC0A 5IDJA 4W7TA 1QYEA 4L8ZA 3RKZA 1UY7A 2YE2A 4B7PA 3K98A 2BU6A 1EA6A 2YI0A 3HZ5A 4O07A 3OW6A 3B24A 2FTKA 4YKTA 2Q2EB 3Q5LA 2C2AA 2YE9A 4QPKA 3C0EA 4HY6A 2IWXA 2WI3A 4O09A 5M4EA 4U7NA 4XIRA 5FWKA 1U2OA 4EFUA 2Q8FA 1Y4SA 4DZYA 3D2RA 4KFGA 1AH8A 5FNCA 3RLQA 4CWQA 2ZDYA 5J6AA 1UYKA 3TTZA 4WUDA 3EHJA 4LWEA 3C11A 1KZNA 3VHAA 1PVGA 1YC1A 3T10A 4PRXA 2Q8HA 2XJJA 3K97A 2Q8IA 4HYMA 5CTXA 3RLRA 4EFTA 3LPSA 3A0XA 4YKQA 4ZKIA 5J71A 2XDSA 4CE3A 4I5SA 3GIFA 4I3HA 2IOPA 4FCRA 4XCLA 3O6OA 4PL9A 2VCIA 3A0TA 1AM1A 1US7A 4PU9A 4L94A 3BM9A 1ZXNA 4HY1A 3INWA 2YEGA 1BYQA 4U7OA 3T2SA 1IXMA 4BXIA 4XKOA 1UYLA 1I5BA 2BRCA 2QFOA 4GEEA 5L3JA 1UYMA 2ZDXA 4HYPA 1YT0A 3A0WA 1GKZA 2YE6A 2YKEA 2QF6A 5IN9A 2YE5A 2YE8A 3A0ZA 2WI7A 5M4MA 3WHAA 2VW5A 1TC6A 2BT0A 2H8MA 2WI1A 4LWFA 3B28A 4BQJA 4GGLA 3KE6A 4HZ0A 3ZXOA 2YJWA 4ASAA 1GJVA 5BOCA 5F5RA 3NMQA 4GT8A 4DUHA 2JJCA 2JKIA 5D7DA 1B62A 3DGEA 4NH7A 4CWFA 4X9LA 5GGZA 2ESAA 3LNUA 3EHHA 4LPBA 4EEHA 1NHJA 4U93A 3GIEA 1YT2A 3R4PA 1Y8OA 3TUHA 2XDLA 4EM7A 4AWOA 2BU5A 2YKBA 4XKKA 2XHTA 2O1UA 3INXA 3Q5JA 4O04A 3D0BA 3RLPA 3MNRP 3SL2A 4EGHA 1Z5BA 2YI5A 4YKRA 1MU5A 2XDXA 3PEHA 2UWDA 3O0IA 1UYIA 4YKWA 1ZW9A 1R62A 3U2KA 2BU8A 3B26A 2WI2A 1YSRA 2YECA 1NHIA 2XX2A 3T1KA 3OWBA 2FWZA 1YC3A 3FT5A 4JAVA 1BGQA 4CE2A 1GKXA 1TH8A 4EGIA 2O1VA 2EXLA 2YEHA 1UY9A 3HHUA 4XD8A 1UYDA 3CRKA 2VCJA 2YEIA 4L90A 4XITA 4Q20A 4E01A 4L93A 3FV5A 3ZM7A 5FNFA 2YKIA 5M4KA 4HXZA 1BKNA 1NHHA 3EHFA 3PEJA 1YS3A 2YGFA 1B3QA 3QDDA 1S16A 1KIJA 1UY8A 3H4LA 3CRLA 4H85A 4FCPA 1JM6A 3OMUA 1TBWA 1UYEA 5D7RA 2CCSA 1TC0A 1I58A 2XK2A 2K5BA 4CWTA
chains in the Genus database with same CATH topology
1EI1A 4KSHA 3G7BA 4CWRA 2BYHA 1YERA 3G75A 1MX0A 4FMTA 2ZBKB 2WI6A 3T0ZA 2XABA 5C93A 1YESA 3HYZA 2YI6A 1UYHA 3R4MA 4KTNA 3QTFA 3CGYA 4E00A 4H7QA 4XIQA 4NH8A 2O1WA 4GFNA 1OSFA 4B6CA 2YEAA 3ZXQA 2YKCA 2XDKA 1H7SA 4MOTA 1TILA 5CF0A 4WUBA 1U0ZA 2YEJA 2YE4A 2YJXA 2BSMA 2WI4A 3HYYA 2BZ5A 3O2FA 5D6QA 5D7CA 3OWDA 4WUCA 3TZ0A 2BU2A 2VWCA 2YE7A 4CWNA 5CTYA 4AWQA 1L0OA 2BREA 2XJGA 2CH4A 3JZ3A 3TZ4A 4LWHA 2YK2A 2CCUA 2IORA 2YI7A 4XIPA 4MPCA 4YKYA 4GCZA 4ASFA 4URNA 2XDUA 4KSGA 4NH9A 5BODA 4XKAA 5CTWA 4FCQA 4R3MA 2YGAA 3B25A 1I5DA 5CPHA 3A0RA 4AWPA 3T0HA 4BIUA 4R3AA 2XCMA 4MBCA 4CWPA 1YETA 3VADA 1YT1A 4EMVA 4URLA 2IWSA 3CGZA 2YE3A 1UYGA 1ZXMA 2XHXA 3EKOA 3K60A 4XCJA 2XHRA 1I5AA 1B63A 4K4OA 2WEPA 3Q5KA 1I59A 1BXDA 1UY6A 4XE2A 1A4HA 4AS9A 2WERA 4MPEA 1TIDA 2YK9A 4EGKA 4LWGA 4MP7A 3D36A 4YKZA 5D6PA 2YEEA 4KP4A 4CWOA 4MP2A 3TZ5A 5M4NA 3VHDA 1ZWHA 4JQLA 4BAEA 1AMWA 1AJ6A 2GFDA 3FT8A 5M4HA 2WEQA 2AKPA 2HKJA 1Z59A 1YC4A 4O0BA 3R91A 2HCHA 4PRVA 3K99A 4BQGA 2CGFA 3VHCA 1UYFA 4L91A 3R4OA 3ZKBA 2CG9A 2BU7A 4YKXA 2FYPA 4ZVIA 1QZRA 2IWUA 3BMYA 4URMA 1THNA 2QG2A 2YEBA 1S14A 1Z5CA 3TZ2A 4JAUA 2XX4A 4MB9A 3GIGA 3HEKA 2WI5A 4XDMA 3ZKDA 4KQVA 4BIZA 4O05A 1QY8A 4ASGA 1ID0A 3OPDA 4LWIA 3HZ1A 1Z5AA 5FNDA 4V26A 3GIGB 2XJXA 5IDMA 4H81A 4CWSA 5CTUA 2PNRA 2BYIA 2YEFA 3WQ9A 2H55A 2YGEA 3B27A 4CE1A 2YEDA 2QG0A 4P7AA 3R92A 3EKRA 1Y8PA 2XD6A 3G7EA 2E0AA 2FXSA 4GQTA 2GQPA 4V25A 2YKJA 5F3KA 3U2DA 3H80A 3A0YA 4UROA 4P8OA 4MPNA 4QPJA 4XTJA 2Q8GA 1Y4UA 2ZKJA 4E02A 3R4NA 4JASA 1UYCA 1I5CA 4ASBA 1AH6A 3CWVA 1YSZA 4YKUA 2XX5A 4R1FA 2CCTA 1H7UA 3U67A 2IOQA 4LP0A 2HG1A 1Y8NA 3EHGA 4HZ5A 4HXWA 3IEDA 4FPPA 2FWYA 2BTZA 5M4PA 4XC0A 5IDJA 4W7TA 1QYEA 4L8ZA 3RKZA 1UY7A 2YE2A 4B7PA 3K98A 2BU6A 1EA6A 2YI0A 3HZ5A 4O07A 3OW6A 3B24A 4YKTA 2Q2EB 3Q5LA 2C2AA 2YE9A 4QPKA 3C0EA 4HY6A 2IWXA 2WI3A 4O09A 5M4EA 4U7NA 4XIRA 5FWKA 1U2OA 4EFUA 2Q8FA 1Y4SA 4DZYA 3D2RA 4KFGA 1AH8A 5FNCA 3RLQA 4CWQA 2ZDYA 5J6AA 1UYKA 3TTZA 4WUDA 3EHJA 4LWEA 3C11A 1KZNA 3VHAA 1PVGA 1YC1A 3T10A 4PRXA 2Q8HA 2XJJA 3K97A 2Q8IA 4HYMA 5CTXA 3RLRA 4EFTA 3LPSA 3A0XA 4YKQA 4ZKIA 5J71A 2XDSA 4CE3A 4I5SA 3GIFA 4I3HA 2IOPA 4FCRA 4XCLA 3O6OA 4PL9A 2VCIA 3A0TA 1AM1A 1US7A 4PU9A 4L94A 3BM9A 1ZXNA 4HY1A 3INWA 2YEGA 1BYQA 4U7OA 3T2SA 4BXIA 4XKOA 1UYLA 1I5BA 2BRCA 2QFOA 4GEEA 5L3JA 1UYMA 2ZDXA 4HYPA 1YT0A 3A0WA 1GKZA 2YE6A 2YKEA 2QF6A 5IN9A 2YE5A 2YE8A 3A0ZA 2WI7A 5M4MA 3WHAA 2VW5A 1TC6A 2BT0A 2H8MA 2WI1A 4LWFA 3B28A 4BQJA 4GGLA 3KE6A 4HZ0A 3ZXOA 2YJWA 4ASAA 1GJVA 5BOCA 5F5RA 3NMQA 4GT8A 4DUHA 2JJCA 2JKIA 5D7DA 1B62A 3DGEA 4NH7A 4CWFA 4X9LA 5GGZA 2ESAA 3LNUA 4LPBA 3EHHA 4EEHA 1NHJA 4U93A 3GIEA 1YT2A 3R4PA 1Y8OA 3TUHA 2XDLA 4EM7A 4AWOA 2BU5A 2YKBA 4XKKA 2XHTA 2O1UA 3INXA 3Q5JA 4O04A 3D0BA 3RLPA 3MNRP 3SL2A 4EGHA 1Z5BA 2YI5A 4YKRA 1MU5A 2XDXA 3PEHA 2UWDA 3O0IA 1UYIA 4YKWA 1ZW9A 1R62A 3U2KA 2BU8A 3B26A 2WI2A 1YSRA 2YECA 1NHIA 2XX2A 3T1KA 3OWBA 2FWZA 1YC3A 3FT5A 4JAVA 1BGQA 4CE2A 1GKXA 1TH8A 4EGIA 2O1VA 2EXLA 2YEHA 1UY9A 3HHUA 4XD8A 1UYDA 3CRKA 2VCJA 2YEIA 4L90A 4XITA 4Q20A 4E01A 4L93A 3FV5A 3ZM7A 5FNFA 2YKIA 5M4KA 4HXZA 1BKNA 1NHHA 3EHFA 3PEJA 1YS3A 2YGFA 1B3QA 3QDDA 1S16A 1KIJA 1UY8A 3H4LA 3CRLA 4H85A 4FCPA 1JM6A 3OMUA 1TBWA 1UYEA 5D7RA 2CCSA 1TC0A 1I58A 2XK2A 2K5BA 4CWTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EI1 A;  4KSH A;  3G7B A;  4CWR A;  2BYH A;  1YER A;  3G75 A;  1MX0 A;  4FMT A;  2ZBK B;  2WI6 A;  3T0Z A;  2XAB A;  5C93 A;  1YES A;  3HYZ A;  2YI6 A;  1UYH A;  3R4M A;  4KTN A;  3QTF A;  3CGY A;  4E00 A;  4H7Q A;  4XIQ A;  4NH8 A;  2O1W A;  4GFN A;  1OSF A;  4B6C A;  2YEA A;  3ZXQ A;  2YKC A;  2XDK A;  1H7S A;  4MOT A;  1TIL A;  5CF0 A;  4WUB A;  1U0Z A;  2YEJ A;  2YE4 A;  2YJX A;  2BSM A;  2WI4 A;  3HYY A;  2BZ5 A;  3O2F A;  5D6Q A;  5D7C A;  3OWD A;  4WUC A;  3TZ0 A;  2BU2 A;  2VWC A;  2YE7 A;  4CWN A;  5CTY A;  4AWQ A;  1L0O A;  2BRE A;  2XJG A;  2CH4 A;  3JZ3 A;  3TZ4 A;  4LWH A;  2YK2 A;  2CCU A;  2IOR A;  2YI7 A;  4XIP A;  4MPC A;  4YKY A;  4GCZ A;  4ASF A;  4URN A;  2XDU A;  4KSG A;  4NH9 A;  5BOD A;  4XKA A;  5CTW A;  4FCQ A;  4R3M A;  2YGA A;  3B25 A;  1I5D A;  5CPH A;  3A0R A;  4AWP A;  3T0H A;  4BIU A;  4R3A A;  2XCM A;  4MBC A;  4CWP A;  1YET A;  3VAD A;  1YT1 A;  4EMV A;  4URL A;  2IWS A;  3CGZ A;  2YE3 A;  1UYG A;  1ZXM A;  2XHX A;  3EKO A;  3K60 A;  4XCJ A;  2XHR A;  1I5A A;  1B63 A;  4K4O A;  2WEP A;  3Q5K A;  1I59 A;  1BXD A;  1UY6 A;  4XE2 A;  1A4H A;  4AS9 A;  2WER A;  4MPE A;  1TID A;  2YK9 A;  4EGK A;  4LWG A;  4MP7 A;  3D36 A;  4YKZ A;  5D6P A;  2YEE A;  4KP4 A;  4CWO A;  4MP2 A;  3TZ5 A;  5M4N A;  3VHD A;  1ZWH A;  4JQL A;  4BAE A;  1AMW A;  1AJ6 A;  2GFD A;  3FT8 A;  5M4H A;  2WEQ A;  2AKP A;  2HKJ A;  1Z59 A;  1YC4 A;  4O0B A;  3R91 A;  2HCH A;  4PRV A;  3K99 A;  4BQG A;  2CGF A;  3VHC A;  1UYF A;  4L91 A;  3R4O A;  3ZKB A;  2CG9 A;  2BU7 A;  4YKX A;  2FYP A;  4ZVI A;  1QZR A;  2IWU A;  3BMY A;  4URM A;  1THN A;  2QG2 A;  2YEB A;  1S14 A;  1Z5C A;  3TZ2 A;  4JAU A;  2XX4 A;  4MB9 A;  3GIG A;  3HEK A;  2WI5 A;  4XDM A;  3ZKD A;  4KQV A;  4BIZ A;  4O05 A;  1QY8 A;  4ASG A;  1ID0 A;  3OPD A;  4LWI A;  3HZ1 A;  1Z5A A;  5FND A;  4V26 A;  3GIG B;  2XJX A;  5IDM A;  4H81 A;  4CWS A;  5CTU A;  2PNR A;  2BYI A;  2YEF A;  3WQ9 A;  2H55 A;  2YGE A;  3B27 A;  4CE1 A;  2YED A;  2QG0 A;  4P7A A;  3R92 A;  3EKR A;  1Y8P A;  2XD6 A;  3G7E A;  2E0A A;  2FXS A;  4GQT A;  2GQP A;  4V25 A;  2YKJ A;  5F3K A;  3U2D A;  3H80 A;  3A0Y A;  4URO A;  4P8O A;  4MPN A;  4QPJ A;  4XTJ A;  2Q8G A;  1Y4U A;  2ZKJ A;  4E02 A;  3R4N A;  4JAS A;  1UYC A;  1I5C A;  4ASB A;  1AH6 A;  3CWV A;  1YSZ A;  4YKU A;  2XX5 A;  4R1F A;  2CCT A;  1H7U A;  3U67 A;  2IOQ A;  4LP0 A;  2HG1 A;  1Y8N A;  3EHG A;  4HZ5 A;  4HXW A;  3IED A;  4FPP A;  2FWY A;  2BTZ A;  5M4P A;  4XC0 A;  5IDJ A;  4W7T A;  1QYE A;  4L8Z A;  3RKZ A;  1UY7 A;  2YE2 A;  4B7P A;  3K98 A;  2BU6 A;  1EA6 A;  2YI0 A;  3HZ5 A;  4O07 A;  3OW6 A;  3B24 A;  4YKT A;  2Q2E B;  3Q5L A;  2C2A A;  2YE9 A;  4QPK A;  3C0E A;  4HY6 A;  2IWX A;  2WI3 A;  4O09 A;  5M4E A;  4U7N A;  4XIR A;  5FWK A;  1U2O A;  4EFU A;  2Q8F A;  1Y4S A;  4DZY A;  3D2R A;  4KFG A;  1AH8 A;  5FNC A;  3RLQ A;  4CWQ A;  2ZDY A;  5J6A A;  1UYK A;  3TTZ A;  4WUD A;  3EHJ A;  4LWE A;  3C11 A;  1KZN A;  3VHA A;  1PVG A;  1YC1 A;  3T10 A;  4PRX A;  2Q8H A;  2XJJ A;  3K97 A;  2Q8I A;  4HYM A;  5CTX A;  3RLR A;  4EFT A;  3LPS A;  3A0X A;  4YKQ A;  4ZKI A;  5J71 A;  2XDS A;  4CE3 A;  4I5S A;  3GIF A;  4I3H A;  2IOP A;  4FCR A;  4XCL A;  3O6O A;  4PL9 A;  2VCI A;  3A0T A;  1AM1 A;  1US7 A;  4PU9 A;  4L94 A;  3BM9 A;  1ZXN A;  4HY1 A;  3INW A;  2YEG A;  1BYQ A;  4U7O A;  3T2S A;  4BXI A;  4XKO A;  1UYL A;  1I5B A;  2BRC A;  2QFO A;  4GEE A;  5L3J A;  1UYM A;  2ZDX A;  4HYP A;  1YT0 A;  3A0W A;  1GKZ A;  2YE6 A;  2YKE A;  2QF6 A;  5IN9 A;  2YE5 A;  2YE8 A;  3A0Z A;  2WI7 A;  5M4M A;  3WHA A;  2VW5 A;  1TC6 A;  2BT0 A;  2H8M A;  2WI1 A;  4LWF A;  3B28 A;  4BQJ A;  4GGL A;  3KE6 A;  4HZ0 A;  3ZXO A;  2YJW A;  4ASA A;  1GJV A;  5BOC A;  5F5R A;  3NMQ A;  4GT8 A;  4DUH A;  2JJC A;  2JKI A;  5D7D A;  1B62 A;  3DGE A;  4NH7 A;  4CWF A;  4X9L A;  5GGZ A;  2ESA A;  3LNU A;  4LPB A;  3EHH A;  4EEH A;  1NHJ A;  4U93 A;  3GIE A;  1YT2 A;  3R4P A;  1Y8O A;  3TUH A;  2XDL A;  4EM7 A;  4AWO A;  2BU5 A;  2YKB A;  4XKK A;  2XHT A;  2O1U A;  3INX A;  3Q5J A;  4O04 A;  3D0B A;  3RLP A;  3MNR P;  3SL2 A;  4EGH A;  1Z5B A;  2YI5 A;  4YKR A;  1MU5 A;  2XDX A;  3PEH A;  2UWD A;  3O0I A;  1UYI A;  4YKW A;  1ZW9 A;  1R62 A;  3U2K A;  2BU8 A;  3B26 A;  2WI2 A;  1YSR A;  2YEC A;  1NHI A;  2XX2 A;  3T1K A;  3OWB A;  2FWZ A;  1YC3 A;  3FT5 A;  4JAV A;  1BGQ A;  4CE2 A;  1GKX A;  1TH8 A;  4EGI A;  2O1V A;  2EXL A;  2YEH A;  1UY9 A;  3HHU A;  4XD8 A;  1UYD A;  3CRK A;  2VCJ A;  2YEI A;  4L90 A;  4XIT A;  4Q20 A;  4E01 A;  4L93 A;  3FV5 A;  3ZM7 A;  5FNF A;  2YKI A;  5M4K A;  4HXZ A;  1BKN A;  1NHH A;  3EHF A;  3PEJ A;  1YS3 A;  2YGF A;  1B3Q A;  3QDD A;  1S16 A;  1KIJ A;  1UY8 A;  3H4L A;  3CRL A;  4H85 A;  4FCP A;  1JM6 A;  3OMU A;  1TBW A;  1UYE A;  5D7R A;  2CCS A;  1TC0 A;  1I58 A;  2XK2 A;  2K5B A;  4CWT A; 
#chains in the Genus database with same CATH topology
 1EI1 A;  4KSH A;  3G7B A;  4CWR A;  2BYH A;  1YER A;  3G75 A;  1MX0 A;  4FMT A;  2ZBK B;  2WI6 A;  3T0Z A;  2XAB A;  5C93 A;  1YES A;  3HYZ A;  2YI6 A;  1UYH A;  3R4M A;  4KTN A;  3QTF A;  3CGY A;  4E00 A;  4H7Q A;  4XIQ A;  4NH8 A;  2O1W A;  4GFN A;  1OSF A;  4B6C A;  2YEA A;  3ZXQ A;  2YKC A;  2XDK A;  1H7S A;  4MOT A;  1TIL A;  5CF0 A;  4WUB A;  1U0Z A;  2YEJ A;  2YE4 A;  2YJX A;  2BSM A;  2WI4 A;  3HYY A;  2BZ5 A;  3O2F A;  5D6Q A;  5D7C A;  3OWD A;  4WUC A;  3TZ0 A;  2BU2 A;  2VWC A;  2YE7 A;  3CYG A;  4CWN A;  5CTY A;  4AWQ A;  1L0O A;  2BRE A;  2XJG A;  2CH4 A;  3JZ3 A;  3TZ4 A;  4LWH A;  2YK2 A;  2CCU A;  2IOR A;  2YI7 A;  3LMM A;  4XIP A;  4MPC A;  4YKY A;  4GCZ A;  4ASF A;  4URN A;  2XDU A;  4KSG A;  4NH9 A;  5BOD A;  4XKA A;  5CTW A;  4FCQ A;  4R3M A;  2YGA A;  3B25 A;  1I5D A;  5CPH A;  3A0R A;  4AWP A;  3T0H A;  4BIU A;  4R3A A;  2XCM A;  4MBC A;  4CWP A;  1YET A;  3VAD A;  1YT1 A;  4EMV A;  4URL A;  2IWS A;  3CGZ A;  2YE3 A;  1UYG A;  1ZXM A;  2XHX A;  3EKO A;  3K60 A;  4XCJ A;  2XHR A;  1I5A A;  1B63 A;  4K4O A;  2WEP A;  3Q5K A;  1I59 A;  1BXD A;  1UY6 A;  4XE2 A;  1A4H A;  4AS9 A;  2WER A;  4MPE A;  1TID A;  2YK9 A;  4EGK A;  4LWG A;  3S5T A;  4MP7 A;  3D36 A;  4YKZ A;  5D6P A;  2YEE A;  4KP4 A;  4CWO A;  4MP2 A;  3TZ5 A;  5M4N A;  1F51 A;  1ZWH A;  3VHD A;  4JQL A;  4BAE A;  1AMW A;  1AJ6 A;  2GFD A;  3FT8 A;  5M4H A;  2WEQ A;  2AKP A;  2HKJ A;  1Z59 A;  1YC4 A;  4O0B A;  3R91 A;  2HCH A;  4PRV A;  3K99 A;  4BQG A;  2CGF A;  3VHC A;  1UYF A;  4L91 A;  3R4O A;  3ZKB A;  2CG9 A;  2BU7 A;  4YKX A;  2FYP A;  4ZVI A;  1QZR A;  2IWU A;  3BMY A;  4URM A;  1THN A;  2QG2 A;  2YEB A;  1S14 A;  1Z5C A;  3TZ2 A;  4JAU A;  2XX4 A;  4MB9 A;  3GIG A;  3HEK A;  2WI5 A;  4XDM A;  3ZKD A;  4KQV A;  4BIZ A;  4O05 A;  1QY8 A;  4ASG A;  2C1G A;  1ID0 A;  3OPD A;  4LWI A;  3HZ1 A;  1Z5A A;  5FND A;  4V26 A;  3GIG B;  2XJX A;  5IDM A;  4H81 A;  4CWS A;  5CTU A;  2PNR A;  2BYI A;  2YEF A;  3WQ9 A;  2H55 A;  5JEN A;  2YGE A;  3B27 A;  4CE1 A;  2YED A;  2QG0 A;  4P7A A;  3R92 A;  3EKR A;  1Y8P A;  2XD6 A;  3G7E A;  2E0A A;  2FXS A;  4GQT A;  2GQP A;  4V25 A;  2YKJ A;  5F3K A;  3U2D A;  3H80 A;  3A0Y A;  4URO A;  4P8O A;  4MPN A;  4QPJ A;  4XTJ A;  2Q8G A;  1Y4U A;  2ZKJ A;  4E02 A;  3R4N A;  4JAS A;  1UYC A;  1I5C A;  4ASB A;  4E72 A;  2HHI A;  2C1I A;  1AH6 A;  3CWV A;  1YSZ A;  4YKU A;  2XX5 A;  4R1F A;  2CCT A;  1H7U A;  3U67 A;  2IOQ A;  4LP0 A;  2HG1 A;  1Y8N A;  3EHG A;  4HZ5 A;  4HXW A;  3IED A;  4FPP A;  2FWY A;  2BTZ A;  5M4P A;  4XC0 A;  5IDJ A;  4W7T A;  1QYE A;  4L8Z A;  3RKZ A;  1UY7 A;  2YE2 A;  4B7P A;  3K98 A;  2BU6 A;  1EA6 A;  2YI0 A;  3HZ5 A;  4O07 A;  3OW6 A;  3B24 A;  2FTK A;  4YKT A;  2Q2E B;  3Q5L A;  2C2A A;  2YE9 A;  4QPK A;  3C0E A;  4HY6 A;  2IWX A;  2WI3 A;  4O09 A;  5M4E A;  4U7N A;  4XIR A;  5FWK A;  1U2O A;  4EFU A;  2Q8F A;  1Y4S A;  4DZY A;  3D2R A;  4KFG A;  1AH8 A;  5FNC A;  3RLQ A;  4CWQ A;  2ZDY A;  5J6A A;  1UYK A;  3TTZ A;  4WUD A;  3EHJ A;  4LWE A;  3C11 A;  1KZN A;  3VHA A;  1PVG A;  1YC1 A;  3T10 A;  4PRX A;  2Q8H A;  2XJJ A;  3K97 A;  2Q8I A;  4HYM A;  5CTX A;  3RLR A;  4EFT A;  3LPS A;  3A0X A;  4YKQ A;  4ZKI A;  5J71 A;  2XDS A;  4CE3 A;  4I5S A;  3GIF A;  4I3H A;  2IOP A;  4FCR A;  4XCL A;  3O6O A;  4PL9 A;  2VCI A;  3A0T A;  1AM1 A;  1US7 A;  4PU9 A;  4L94 A;  3BM9 A;  1ZXN A;  4HY1 A;  3INW A;  2YEG A;  1BYQ A;  4U7O A;  3T2S A;  1IXM A;  4BXI A;  4XKO A;  1UYL A;  1I5B A;  2BRC A;  2QFO A;  4GEE A;  5L3J A;  1UYM A;  2ZDX A;  4HYP A;  1YT0 A;  3A0W A;  1GKZ A;  2YE6 A;  2YKE A;  2QF6 A;  5IN9 A;  2YE5 A;  2YE8 A;  3A0Z A;  2WI7 A;  5M4M A;  3WHA A;  2VW5 A;  1TC6 A;  2BT0 A;  2H8M A;  2WI1 A;  4LWF A;  3B28 A;  4BQJ A;  4GGL A;  3KE6 A;  4HZ0 A;  3ZXO A;  2YJW A;  4ASA A;  1GJV A;  5BOC A;  5F5R A;  3NMQ A;  4GT8 A;  4DUH A;  2JJC A;  2JKI A;  5D7D A;  1B62 A;  3DGE A;  4NH7 A;  4CWF A;  4X9L A;  5GGZ A;  2ESA A;  3LNU A;  3EHH A;  4LPB A;  4EEH A;  1NHJ A;  4U93 A;  3GIE A;  1YT2 A;  3R4P A;  1Y8O A;  3TUH A;  2XDL A;  4EM7 A;  4AWO A;  2BU5 A;  2YKB A;  4XKK A;  2XHT A;  2O1U A;  3INX A;  3Q5J A;  4O04 A;  3D0B A;  3RLP A;  3MNR P;  3SL2 A;  4EGH A;  1Z5B A;  2YI5 A;  4YKR A;  1MU5 A;  2XDX A;  3PEH A;  2UWD A;  3O0I A;  1UYI A;  4YKW A;  1ZW9 A;  1R62 A;  3U2K A;  2BU8 A;  3B26 A;  2WI2 A;  1YSR A;  2YEC A;  1NHI A;  2XX2 A;  3T1K A;  3OWB A;  2FWZ A;  1YC3 A;  3FT5 A;  4JAV A;  1BGQ A;  4CE2 A;  1GKX A;  1TH8 A;  4EGI A;  2O1V A;  2EXL A;  2YEH A;  1UY9 A;  3HHU A;  4XD8 A;  1UYD A;  3CRK A;  2VCJ A;  2YEI A;  4L90 A;  4XIT A;  4Q20 A;  4E01 A;  4L93 A;  3FV5 A;  3ZM7 A;  5FNF A;  2YKI A;  5M4K A;  4HXZ A;  1BKN A;  1NHH A;  3EHF A;  3PEJ A;  1YS3 A;  2YGF A;  1B3Q A;  3QDD A;  1S16 A;  1KIJ A;  1UY8 A;  3H4L A;  3CRL A;  4H85 A;  4FCP A;  1JM6 A;  3OMU A;  1TBW A;  1UYE A;  5D7R A;  2CCS A;  1TC0 A;  1I58 A;  2XK2 A;  2K5B A;  4CWT A; 
#chains in the Genus database with same CATH homology
 1EI1 A;  4KSH A;  3G7B A;  4CWR A;  2BYH A;  1YER A;  3G75 A;  1MX0 A;  4FMT A;  2ZBK B;  2WI6 A;  3T0Z A;  2XAB A;  5C93 A;  1YES A;  3HYZ A;  2YI6 A;  1UYH A;  3R4M A;  4KTN A;  3QTF A;  3CGY A;  4E00 A;  4H7Q A;  4XIQ A;  4NH8 A;  2O1W A;  4GFN A;  1OSF A;  4B6C A;  2YEA A;  3ZXQ A;  2YKC A;  2XDK A;  1H7S A;  4MOT A;  1TIL A;  5CF0 A;  4WUB A;  1U0Z A;  2YEJ A;  2YE4 A;  2YJX A;  2BSM A;  2WI4 A;  3HYY A;  2BZ5 A;  3O2F A;  5D6Q A;  5D7C A;  3OWD A;  4WUC A;  3TZ0 A;  2BU2 A;  2VWC A;  2YE7 A;  4CWN A;  5CTY A;  4AWQ A;  1L0O A;  2BRE A;  2XJG A;  2CH4 A;  3JZ3 A;  3TZ4 A;  4LWH A;  2YK2 A;  2CCU A;  2IOR A;  2YI7 A;  4XIP A;  4MPC A;  4YKY A;  4GCZ A;  4ASF A;  4URN A;  2XDU A;  4KSG A;  4NH9 A;  5BOD A;  4XKA A;  5CTW A;  4FCQ A;  4R3M A;  2YGA A;  3B25 A;  1I5D A;  5CPH A;  3A0R A;  4AWP A;  3T0H A;  4BIU A;  4R3A A;  2XCM A;  4MBC A;  4CWP A;  1YET A;  3VAD A;  1YT1 A;  4EMV A;  4URL A;  2IWS A;  3CGZ A;  2YE3 A;  1UYG A;  1ZXM A;  2XHX A;  3EKO A;  3K60 A;  4XCJ A;  2XHR A;  1I5A A;  1B63 A;  4K4O A;  2WEP A;  3Q5K A;  1I59 A;  1BXD A;  1UY6 A;  4XE2 A;  1A4H A;  4AS9 A;  2WER A;  4MPE A;  1TID A;  2YK9 A;  4EGK A;  4LWG A;  4MP7 A;  3D36 A;  4YKZ A;  5D6P A;  2YEE A;  4KP4 A;  4CWO A;  4MP2 A;  3TZ5 A;  5M4N A;  3VHD A;  1ZWH A;  4JQL A;  4BAE A;  1AMW A;  1AJ6 A;  2GFD A;  3FT8 A;  5M4H A;  2WEQ A;  2AKP A;  2HKJ A;  1Z59 A;  1YC4 A;  4O0B A;  3R91 A;  2HCH A;  4PRV A;  3K99 A;  4BQG A;  2CGF A;  3VHC A;  1UYF A;  4L91 A;  3R4O A;  3ZKB A;  2CG9 A;  2BU7 A;  4YKX A;  2FYP A;  4ZVI A;  1QZR A;  2IWU A;  3BMY A;  4URM A;  1THN A;  2QG2 A;  2YEB A;  1S14 A;  1Z5C A;  3TZ2 A;  4JAU A;  2XX4 A;  4MB9 A;  3GIG A;  3HEK A;  2WI5 A;  4XDM A;  3ZKD A;  4KQV A;  4BIZ A;  4O05 A;  1QY8 A;  4ASG A;  1ID0 A;  3OPD A;  4LWI A;  3HZ1 A;  1Z5A A;  5FND A;  4V26 A;  3GIG B;  2XJX A;  5IDM A;  4H81 A;  4CWS A;  5CTU A;  2PNR A;  2BYI A;  2YEF A;  3WQ9 A;  2H55 A;  2YGE A;  3B27 A;  4CE1 A;  2YED A;  2QG0 A;  4P7A A;  3R92 A;  3EKR A;  1Y8P A;  2XD6 A;  3G7E A;  2E0A A;  2FXS A;  4GQT A;  2GQP A;  4V25 A;  2YKJ A;  5F3K A;  3U2D A;  3H80 A;  3A0Y A;  4URO A;  4P8O A;  4MPN A;  4QPJ A;  4XTJ A;  2Q8G A;  1Y4U A;  2ZKJ A;  4E02 A;  3R4N A;  4JAS A;  1UYC A;  1I5C A;  4ASB A;  1AH6 A;  3CWV A;  1YSZ A;  4YKU A;  2XX5 A;  4R1F A;  2CCT A;  1H7U A;  3U67 A;  2IOQ A;  4LP0 A;  2HG1 A;  1Y8N A;  3EHG A;  4HZ5 A;  4HXW A;  3IED A;  4FPP A;  2FWY A;  2BTZ A;  5M4P A;  4XC0 A;  5IDJ A;  4W7T A;  1QYE A;  4L8Z A;  3RKZ A;  1UY7 A;  2YE2 A;  4B7P A;  3K98 A;  2BU6 A;  1EA6 A;  2YI0 A;  3HZ5 A;  4O07 A;  3OW6 A;  3B24 A;  4YKT A;  2Q2E B;  3Q5L A;  2C2A A;  2YE9 A;  4QPK A;  3C0E A;  4HY6 A;  2IWX A;  2WI3 A;  4O09 A;  5M4E A;  4U7N A;  4XIR A;  5FWK A;  1U2O A;  4EFU A;  2Q8F A;  1Y4S A;  4DZY A;  3D2R A;  4KFG A;  1AH8 A;  5FNC A;  3RLQ A;  4CWQ A;  2ZDY A;  5J6A A;  1UYK A;  3TTZ A;  4WUD A;  3EHJ A;  4LWE A;  3C11 A;  1KZN A;  3VHA A;  1PVG A;  1YC1 A;  3T10 A;  4PRX A;  2Q8H A;  2XJJ A;  3K97 A;  2Q8I A;  4HYM A;  5CTX A;  3RLR A;  4EFT A;  3LPS A;  3A0X A;  4YKQ A;  4ZKI A;  5J71 A;  2XDS A;  4CE3 A;  4I5S A;  3GIF A;  4I3H A;  2IOP A;  4FCR A;  4XCL A;  3O6O A;  4PL9 A;  2VCI A;  3A0T A;  1AM1 A;  1US7 A;  4PU9 A;  4L94 A;  3BM9 A;  1ZXN A;  4HY1 A;  3INW A;  2YEG A;  1BYQ A;  4U7O A;  3T2S A;  4BXI A;  4XKO A;  1UYL A;  1I5B A;  2BRC A;  2QFO A;  4GEE A;  5L3J A;  1UYM A;  2ZDX A;  4HYP A;  1YT0 A;  3A0W A;  1GKZ A;  2YE6 A;  2YKE A;  2QF6 A;  5IN9 A;  2YE5 A;  2YE8 A;  3A0Z A;  2WI7 A;  5M4M A;  3WHA A;  2VW5 A;  1TC6 A;  2BT0 A;  2H8M A;  2WI1 A;  4LWF A;  3B28 A;  4BQJ A;  4GGL A;  3KE6 A;  4HZ0 A;  3ZXO A;  2YJW A;  4ASA A;  1GJV A;  5BOC A;  5F5R A;  3NMQ A;  4GT8 A;  4DUH A;  2JJC A;  2JKI A;  5D7D A;  1B62 A;  3DGE A;  4NH7 A;  4CWF A;  4X9L A;  5GGZ A;  2ESA A;  3LNU A;  4LPB A;  3EHH A;  4EEH A;  1NHJ A;  4U93 A;  3GIE A;  1YT2 A;  3R4P A;  1Y8O A;  3TUH A;  2XDL A;  4EM7 A;  4AWO A;  2BU5 A;  2YKB A;  4XKK A;  2XHT A;  2O1U A;  3INX A;  3Q5J A;  4O04 A;  3D0B A;  3RLP A;  3MNR P;  3SL2 A;  4EGH A;  1Z5B A;  2YI5 A;  4YKR A;  1MU5 A;  2XDX A;  3PEH A;  2UWD A;  3O0I A;  1UYI A;  4YKW A;  1ZW9 A;  1R62 A;  3U2K A;  2BU8 A;  3B26 A;  2WI2 A;  1YSR A;  2YEC A;  1NHI A;  2XX2 A;  3T1K A;  3OWB A;  2FWZ A;  1YC3 A;  3FT5 A;  4JAV A;  1BGQ A;  4CE2 A;  1GKX A;  1TH8 A;  4EGI A;  2O1V A;  2EXL A;  2YEH A;  1UY9 A;  3HHU A;  4XD8 A;  1UYD A;  3CRK A;  2VCJ A;  2YEI A;  4L90 A;  4XIT A;  4Q20 A;  4E01 A;  4L93 A;  3FV5 A;  3ZM7 A;  5FNF A;  2YKI A;  5M4K A;  4HXZ A;  1BKN A;  1NHH A;  3EHF A;  3PEJ A;  1YS3 A;  2YGF A;  1B3Q A;  3QDD A;  1S16 A;  1KIJ A;  1UY8 A;  3H4L A;  3CRL A;  4H85 A;  4FCP A;  1JM6 A;  3OMU A;  1TBW A;  1UYE A;  5D7R A;  2CCS A;  1TC0 A;  1I58 A;  2XK2 A;  2K5B A;  4CWT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...