4KSGA

Dna gyrase atp binding domain of enterococcus faecalis in complex with a small molecule inhibitor (4-[(1s,5r,6r)-6-amino-1-methyl-3-azabicyclo[3.2.0]hept-3-yl]-6-fluoro-n-methyl-2-[(2-methylpyrimidin-5-yl)oxy]-9h-pyrimido[4,5-b]indol-8-amine)
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
210
structure length
190
Chain Sequence
GLEAVRKRPGMYIGSTSGEGLHHLVWEIVDNSIDEALAGFAKSIQVIIEPDDSITVIDDGRGIPVGIQAKTGRPAVETVFTVLGSSVVNALSTSLDVRVYKDGKVYYQEYRRGAVVDDLKVIEETDRHGTTVHFIPDPEIFTETTVYDFDKLATRVRELAFLNRGLHISIEDRREGQEDKKEYHYEGLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A new class of type iia topoisomerase inhibitors with broad-spectrum antibacterial activity
rcsb
source organism Enterococcus faecalis
molecule tags Isomerase/isomerase inhibitor
molecule keywords DNA gyrase subunit B
total genus 62
structure length 190
sequence length 210
ec nomenclature ec 5.99.1.3: Transferred entry: 5.6.2.3.
pdb deposition date 2013-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 4ksgA00
1H7SA 3B26A 3R4MA 3T2SA 4BAEA 3K97A 4BQJA 3VHCA 1PVGA 4O05A 4CWNA 2YEJA 2HKJA 3ZKBA 3R4OA 1NHJA 2ZBKB 3BMYA 3A0TA 3FT5A 2BRCA 4NH9A 1GKZA 3WQ9A 4Q20A 3GIEA 2HCHA 4GFNA 2WI3A 4O0BA 3ZM7A 1NHHA 2YE7A 4L94A 3OPDA 1US7A 4XITA 4KFGA 1I5DA 5D6PA 5L3JA 2XX5A 3D2RA 2YGAA 4LWIA 4I5SA 3HEKA 4MP7A 2ESAA 2BYIA 4BIZA 1UYEA 1OSFA 2YEDA 3EHHA 4EEHA 1UYDA 3JZ3A 4XKAA 1YT2A 1YT1A 3K60A 3Q5KA 4UROA 1THNA 4O04A 2YKBA 2XD6A 3ZXQA 2IWXA 1YC4A 4L91A 4XIQA 3ZXOA 4DZYA 3HYZA 2IWSA 4EMVA 1JM6A 4XCLA 3CRLA 4GGLA 4MPCA 1KZNA 4V26A 1AMWA 3B27A 3VADA 4EGKA 4KP4A 2ZDYA 4DUHA 1UYFA 3G7BA 4XC0A 1B63A 2XABA 1I59A 2BU7A 5C93A 2XX2A 4CWFA 2YKIA 3A0ZA 3CGYA 3O6OA 4LWEA 3EHGA 2YE2A 3QTFA 2XDLA 1R62A 4L8ZA 1Y4SA 1ZWHA 4JASA 5D6QA 5D7CA 4EM7A 4PRXA 3U67A 5J6AA 1YERA 2BU6A 2YI7A 2H8MA 3INWA 4URMA 2YI5A 1NHIA 3NMQA 4CE1A 2QF6A 5CTUA 3DGEA 1UYCA 3C11A 4QPKA 3H4LA 4W7TA 2Q8FA 1I5CA 2IORA 2WI5A 4EFTA 4GCZA 3PEHA 1YETA 4BIUA 3HYYA 3VHAA 2CG9A 1UY6A 2C2AA 3OMUA 3R4PA 4NH7A 4XKKA 1Z5BA 4LWGA 4YKUA 2QG2A 2WI4A 5M4KA 4XCJA 2WI2A 4L90A 1AJ6A 3K98A 2O1VA 4YKQA 3D36A 4KSHA 1Y4UA 2XDSA 3EHFA 4AWQA 3LPSA 3RLRA 1UYLA 3TUHA 5D7RA 4O07A 3ZKDA 2WEQA 4O09A 3CGZA 4I3HA 4H7QA 4BXIA 4XE2A 1ZXNA 2XHXA 4AS9A 2XDXA 4FCPA 4XTJA 1UYKA 4B6CA 4BQGA 2XHRA 1Y8PA 2Q8HA 1H7UA 4HY1A 4WUCA 3U2KA 2YECA 2XDUA 3HZ5A 4YKWA 3R4NA 4H81A 3GIGB 2XX4A 4YKTA 1QY8A 2Q8IA 3RLPA 2AKPA 3T0HA 3TZ2A 2BTZA 4QPJA 4MPEA 4FMTA 1L0OA 2YEHA 4FCRA 2YE4A 2HG1A 4JAUA 1Y8NA 4GEEA 1TBWA 2YI0A 3B24A 4KTNA 1YC1A 3TZ0A 2E0AA 4AWPA 1I58A 4U7NA 1YESA 1UY7A 2WI7A 4LP0A 3B28A 2YKEA 2YEAA 1UYGA 2YEBA 4YKXA 4WUDA 4PRVA 1QYEA 2YE5A 2YKCA 2YK2A 1BYQA 4PU9A 4CE3A 4FPPA 4HY6A 4CWOA 3R91A 1U0ZA 4E02A 3A0XA 2CH4A 3FV5A 1TIDA 2WEPA 4JQLA 3Q5JA 1I5BA 1AM1A 5M4NA 1Z5AA 2BU5A 3OW6A 5FNFA 1YSZA 2CCTA 2YEEA 3A0RA 3CWVA 5IDJA 4ASGA 2BYHA 1UY8A 3R92A 2QG0A 3EHJA 2JKIA 2YE6A 4LWHA 3QDDA 2O1WA 3A0YA 4B7PA 1UY9A 4WUBA 1S16A 4CWSA 3LNUA 1TC0A 1A4HA 5IDMA 4U93A 3IEDA 2ZKJA 4CWTA 2GFDA 4ZVIA 3TZ5A 4PL9A 3T0ZA 2YEGA 4ASFA 3FT8A 2WERA 2O1UA 4X9LA 2IWUA 2YE8A 1YSRA 1TC6A 4NH8A 1YS3A 4EGHA 1B3QA 4MBCA 2VCIA 4V25A 5BOCA 4FCQA 3C0EA 4XIRA 3H80A 4HZ0A 4AWOA 1B62A 1UYHA 2WI6A 2K5BA 4MB9A 5GGZA 3OWDA 3G7EA 2YE9A 5CF0A 2XJGA 1BKNA 1ID0A 3B25A 4CE2A 2FYPA 4HYMA 2XCMA 2BZ5A 3HHUA 3PEJA 4YKZA 4P8OA 2UWDA 3K99A 3G75A 1Y8OA 4XIPA 3GIGA 3EKRA 5M4PA 4L93A 3EKOA 4KSGA 1TILA 1QZRA 2YKJA 3INXA 5M4MA 2BU2A 2YJWA 3OWBA 4MPNA 1ZW9A 2XHTA 1GKXA 2YK9A 3CRKA 4R1FA 4R3AA 1MU5A 5IN9A 2FWZA 4GQTA 2FXSA 1BXDA 4XD8A 2VCJA 4K4OA 1ZXMA 2XJXA 3RLQA 2JJCA 4CWQA 4GT8A 5J71A 2H55A 5CTXA 3U2DA 3GIFA 4ASBA 5D7DA 2IOPA 4HYPA 1TH8A 3HZ1A 4LPBA 4H85A 3Q5LA 4URNA 2BREA 3WHAA 2XK2A 1YT0A 4XKOA 4MP2A 2XJJA 2Q2EB 1MX0A 1EI1A 1GJVA 4LWFA 2YE3A 4ASAA 4E01A 2BU8A 2FWYA 1BGQA 3T10A 2CCSA 3TZ4A 4E00A 5FWKA 2VW5A 2QFOA 3MNRP 3BM9A 1Z59A 5BODA 2IOQA 4ZKIA 3D0BA 2PNRA 1U2OA 2YGEA 2Q8GA 4URLA 4CWRA 1AH8A 3O2FA 4YKYA 2XDKA 5M4HA 2GQPA 2WI1A 5FNCA 2CGFA 4U7OA 2BSMA 1UYMA 3A0WA 4YKRA 4EFUA 5FNDA 2EXLA 4HZ5A 3RKZA 3T1KA 4P7AA 2VWCA 4MOTA 1YC3A 4EGIA 1EA6A 2ZDXA 5F3KA 1AH6A 3VHDA 1Z5CA 4JAVA 3KE6A 1S14A 1I5AA 4HXZA 4HXWA 2YI6A 4CWPA 5M4EA 3SL2A 1UYIA 2YGFA 2YEFA 5F5RA 4XDMA 1KIJA 3O0IA 5CTYA 4KQVA 5CTWA 2BT0A 4R3MA 3TTZA 2YJXA 2CCUA 2YEIA 5CPHA
chains in the Genus database with same CATH superfamily
1H7SA 3B26A 3R4MA 3T2SA 4BAEA 3K97A 4BQJA 3VHCA 1PVGA 4O05A 4CWNA 2YEJA 2HKJA 3ZKBA 3R4OA 1NHJA 2ZBKB 3BMYA 3A0TA 3FT5A 2BRCA 4NH9A 1GKZA 3WQ9A 4Q20A 3GIEA 2HCHA 4GFNA 2WI3A 4O0BA 3ZM7A 1NHHA 2YE7A 4L94A 3OPDA 1US7A 4XITA 4KFGA 1I5DA 5D6PA 5L3JA 2XX5A 3D2RA 2YGAA 4LWIA 4I5SA 3HEKA 4MP7A 2ESAA 2BYIA 4BIZA 1UYEA 1OSFA 2YEDA 3EHHA 4EEHA 1UYDA 3JZ3A 4XKAA 1YT2A 1YT1A 3K60A 3Q5KA 4UROA 1THNA 4O04A 2YKBA 2XD6A 3ZXQA 2IWXA 1YC4A 4L91A 4XIQA 3ZXOA 4DZYA 3HYZA 2IWSA 4EMVA 1JM6A 4XCLA 3CRLA 4GGLA 4MPCA 1KZNA 4V26A 1AMWA 3B27A 3VADA 4EGKA 4KP4A 2ZDYA 4DUHA 1UYFA 3G7BA 4XC0A 1B63A 2XABA 1I59A 2BU7A 5C93A 2XX2A 4CWFA 2YKIA 3A0ZA 3CGYA 3O6OA 4LWEA 3EHGA 2YE2A 3QTFA 2XDLA 1R62A 4L8ZA 1Y4SA 1ZWHA 4JASA 5D6QA 5D7CA 4EM7A 4PRXA 3U67A 5J6AA 1YERA 2BU6A 2YI7A 2H8MA 3INWA 4URMA 2YI5A 3S5TA 1NHIA 3NMQA 4CE1A 2QF6A 5CTUA 3DGEA 1UYCA 3C11A 2HHIA 4QPKA 3H4LA 4W7TA 2Q8FA 1I5CA 2IORA 2WI5A 4EFTA 4GCZA 3PEHA 1YETA 4BIUA 3HYYA 3VHAA 2CG9A 1UY6A 2C2AA 3OMUA 3R4PA 4NH7A 4XKKA 1Z5BA 4LWGA 4YKUA 2QG2A 2WI4A 5M4KA 4XCJA 2WI2A 4L90A 1AJ6A 3K98A 2O1VA 4YKQA 3D36A 4KSHA 1Y4UA 2XDSA 3EHFA 4AWQA 3LPSA 3RLRA 1UYLA 3TUHA 5D7RA 4O07A 3ZKDA 2WEQA 4O09A 3CGZA 4I3HA 4H7QA 4BXIA 4XE2A 1ZXNA 2XHXA 4AS9A 2XDXA 4FCPA 4XTJA 1UYKA 4B6CA 4BQGA 2XHRA 1Y8PA 2Q8HA 1H7UA 4HY1A 4WUCA 3U2KA 2YECA 2XDUA 3CYGA 3LMMA 3HZ5A 4YKWA 3R4NA 4H81A 2FTKA 3GIGB 2XX4A 4YKTA 1QY8A 2Q8IA 3RLPA 2AKPA 3T0HA 3TZ2A 2BTZA 4QPJA 4MPEA 4FMTA 1L0OA 2YEHA 4FCRA 2YE4A 2HG1A 4JAUA 1Y8NA 4GEEA 1TBWA 5JENA 2YI0A 3B24A 4KTNA 1YC1A 3TZ0A 2E0AA 4AWPA 1I58A 4U7NA 1YESA 1UY7A 2WI7A 4LP0A 3B28A 2YKEA 2YEAA 1UYGA 2YEBA 4YKXA 4WUDA 4PRVA 1QYEA 2YE5A 2YKCA 2YK2A 1BYQA 4PU9A 4CE3A 4FPPA 4HY6A 4CWOA 3R91A 1U0ZA 4E02A 3A0XA 2CH4A 3FV5A 1TIDA 2WEPA 4JQLA 3Q5JA 1I5BA 1AM1A 5M4NA 1Z5AA 2BU5A 3OW6A 5FNFA 1YSZA 2CCTA 2YEEA 3A0RA 3CWVA 5IDJA 4ASGA 2BYHA 1UY8A 3R92A 2QG0A 3EHJA 2JKIA 2YE6A 4LWHA 3QDDA 2O1WA 3A0YA 4B7PA 1UY9A 4WUBA 1S16A 4CWSA 3LNUA 1TC0A 1A4HA 5IDMA 4U93A 3IEDA 2ZKJA 4CWTA 2GFDA 4ZVIA 3TZ5A 4PL9A 3T0ZA 2YEGA 4ASFA 2C1IA 3FT8A 2WERA 2O1UA 4X9LA 2IWUA 2YE8A 1YSRA 1TC6A 4NH8A 1YS3A 4EGHA 1B3QA 4MBCA 2VCIA 4V25A 5BOCA 4FCQA 3C0EA 4XIRA 3H80A 4HZ0A 4AWOA 1B62A 1UYHA 2WI6A 2K5BA 4MB9A 5GGZA 3OWDA 3G7EA 2YE9A 5CF0A 2XJGA 1BKNA 1ID0A 3B25A 4CE2A 2FYPA 4HYMA 2XCMA 2BZ5A 3HHUA 3PEJA 4YKZA 4P8OA 2UWDA 3K99A 3G75A 1Y8OA 4XIPA 3GIGA 3EKRA 5M4PA 4L93A 3EKOA 4KSGA 1TILA 1QZRA 2YKJA 3INXA 1IXMA 5M4MA 2BU2A 2YJWA 3OWBA 4MPNA 4E72A 1ZW9A 2XHTA 1GKXA 2YK9A 3CRKA 4R1FA 4R3AA 1MU5A 5IN9A 2FWZA 4GQTA 2FXSA 1BXDA 4XD8A 2VCJA 4K4OA 1ZXMA 2XJXA 3RLQA 2JJCA 4CWQA 4GT8A 5J71A 2C1GA 2H55A 5CTXA 3U2DA 3GIFA 4ASBA 5D7DA 2IOPA 4HYPA 1TH8A 3HZ1A 4LPBA 4H85A 3Q5LA 4URNA 2BREA 3WHAA 2XK2A 1YT0A 4XKOA 4MP2A 2XJJA 2Q2EB 1MX0A 1EI1A 1GJVA 4LWFA 2YE3A 4ASAA 4E01A 2BU8A 2FWYA 1BGQA 3T10A 2CCSA 3TZ4A 4E00A 5FWKA 2VW5A 2QFOA 3MNRP 1F51A 3BM9A 1Z59A 5BODA 2IOQA 4ZKIA 3D0BA 2PNRA 1U2OA 2YGEA 2Q8GA 4URLA 4CWRA 1AH8A 3O2FA 4YKYA 2XDKA 5M4HA 2GQPA 2WI1A 5FNCA 2CGFA 4U7OA 2BSMA 1UYMA 3A0WA 4YKRA 4EFUA 5FNDA 2EXLA 4HZ5A 3RKZA 3T1KA 4P7AA 2VWCA 4MOTA 1YC3A 4EGIA 1EA6A 2ZDXA 5F3KA 1AH6A 3VHDA 1Z5CA 4JAVA 3KE6A 1S14A 1I5AA 4HXZA 4HXWA 2YI6A 4CWPA 5M4EA 3SL2A 1UYIA 2YGFA 2YEFA 5F5RA 4XDMA 1KIJA 3O0IA 5CTYA 4KQVA 5CTWA 2BT0A 4R3MA 3TTZA 2YJXA 2CCUA 2YEIA 5CPHA
chains in the Genus database with same CATH topology
1H7SA 3B26A 3R4MA 3T2SA 4BAEA 3K97A 4BQJA 3VHCA 1PVGA 4O05A 4CWNA 2YEJA 2HKJA 3ZKBA 3R4OA 1NHJA 2ZBKB 3BMYA 3A0TA 3FT5A 2BRCA 4NH9A 1GKZA 3WQ9A 4Q20A 3GIEA 2HCHA 4GFNA 2WI3A 4O0BA 3ZM7A 1NHHA 2YE7A 4L94A 3OPDA 1US7A 4XITA 4KFGA 1I5DA 5D6PA 5L3JA 2XX5A 3D2RA 2YGAA 4LWIA 4I5SA 3HEKA 4MP7A 2ESAA 2BYIA 4BIZA 1UYEA 1OSFA 2YEDA 3EHHA 4EEHA 1UYDA 3JZ3A 4XKAA 1YT2A 1YT1A 3K60A 3Q5KA 4UROA 1THNA 4O04A 2YKBA 2XD6A 3ZXQA 2IWXA 1YC4A 4L91A 4XIQA 3ZXOA 4DZYA 3HYZA 2IWSA 4EMVA 1JM6A 4XCLA 3CRLA 4GGLA 4MPCA 1KZNA 4V26A 1AMWA 3B27A 3VADA 4EGKA 4KP4A 2ZDYA 4DUHA 1UYFA 3G7BA 4XC0A 1B63A 2XABA 1I59A 2BU7A 5C93A 2XX2A 4CWFA 2YKIA 3A0ZA 3CGYA 3O6OA 4LWEA 3EHGA 2YE2A 3QTFA 2XDLA 1R62A 4L8ZA 1Y4SA 1ZWHA 4JASA 5D6QA 5D7CA 4EM7A 4PRXA 3U67A 5J6AA 1YERA 2BU6A 2YI7A 2H8MA 3INWA 4URMA 2YI5A 1NHIA 3NMQA 4CE1A 2QF6A 5CTUA 3DGEA 1UYCA 3C11A 4QPKA 3H4LA 4W7TA 2Q8FA 1I5CA 2IORA 2WI5A 4EFTA 4GCZA 3PEHA 1YETA 4BIUA 3HYYA 3VHAA 2CG9A 1UY6A 2C2AA 3OMUA 3R4PA 4NH7A 4XKKA 1Z5BA 4LWGA 4YKUA 2QG2A 2WI4A 5M4KA 4XCJA 2WI2A 4L90A 1AJ6A 3K98A 2O1VA 4YKQA 3D36A 4KSHA 1Y4UA 2XDSA 3EHFA 4AWQA 3LPSA 3RLRA 1UYLA 3TUHA 5D7RA 4O07A 3ZKDA 2WEQA 4O09A 3CGZA 4I3HA 4H7QA 4BXIA 4XE2A 1ZXNA 2XHXA 4AS9A 2XDXA 4FCPA 4XTJA 1UYKA 4B6CA 4BQGA 2XHRA 1Y8PA 2Q8HA 1H7UA 4HY1A 4WUCA 3U2KA 2YECA 2XDUA 3HZ5A 4YKWA 3R4NA 4H81A 3GIGB 2XX4A 4YKTA 1QY8A 2Q8IA 3RLPA 2AKPA 3T0HA 3TZ2A 2BTZA 4QPJA 4MPEA 4FMTA 1L0OA 2YEHA 4FCRA 2YE4A 2HG1A 4JAUA 1Y8NA 4GEEA 1TBWA 2YI0A 3B24A 4KTNA 1YC1A 3TZ0A 2E0AA 4AWPA 1I58A 4U7NA 1YESA 1UY7A 2WI7A 4LP0A 3B28A 2YKEA 2YEAA 1UYGA 2YEBA 4YKXA 4WUDA 4PRVA 1QYEA 2YE5A 2YKCA 2YK2A 1BYQA 4PU9A 4CE3A 4FPPA 4HY6A 4CWOA 3R91A 1U0ZA 4E02A 3A0XA 2CH4A 3FV5A 1TIDA 2WEPA 4JQLA 3Q5JA 1I5BA 1AM1A 5M4NA 1Z5AA 2BU5A 3OW6A 5FNFA 1YSZA 2CCTA 2YEEA 3A0RA 3CWVA 5IDJA 4ASGA 2BYHA 1UY8A 3R92A 2QG0A 3EHJA 2JKIA 2YE6A 4LWHA 3QDDA 2O1WA 3A0YA 4B7PA 1UY9A 4WUBA 1S16A 4CWSA 3LNUA 1TC0A 1A4HA 5IDMA 4U93A 3IEDA 2ZKJA 4CWTA 2GFDA 4ZVIA 3TZ5A 4PL9A 3T0ZA 2YEGA 4ASFA 3FT8A 2WERA 2O1UA 4X9LA 2IWUA 2YE8A 1YSRA 1TC6A 4NH8A 1YS3A 4EGHA 1B3QA 4MBCA 2VCIA 4V25A 5BOCA 4FCQA 3C0EA 4XIRA 3H80A 4HZ0A 4AWOA 1B62A 1UYHA 2WI6A 2K5BA 4MB9A 5GGZA 3OWDA 3G7EA 2YE9A 5CF0A 2XJGA 1BKNA 1ID0A 3B25A 4CE2A 2FYPA 4HYMA 2XCMA 2BZ5A 3HHUA 3PEJA 4YKZA 4P8OA 2UWDA 3K99A 3G75A 1Y8OA 4XIPA 3GIGA 3EKRA 5M4PA 4L93A 3EKOA 4KSGA 1TILA 1QZRA 2YKJA 3INXA 5M4MA 2BU2A 2YJWA 3OWBA 4MPNA 1ZW9A 2XHTA 1GKXA 2YK9A 3CRKA 4R1FA 4R3AA 1MU5A 5IN9A 2FWZA 4GQTA 2FXSA 1BXDA 4XD8A 2VCJA 4K4OA 1ZXMA 2XJXA 3RLQA 2JJCA 4CWQA 4GT8A 5J71A 2H55A 5CTXA 3U2DA 3GIFA 4ASBA 5D7DA 2IOPA 4HYPA 1TH8A 3HZ1A 4LPBA 4H85A 3Q5LA 4URNA 2BREA 3WHAA 2XK2A 1YT0A 4XKOA 4MP2A 2XJJA 2Q2EB 1MX0A 1EI1A 1GJVA 4LWFA 2YE3A 4ASAA 4E01A 2BU8A 2FWYA 1BGQA 3T10A 2CCSA 3TZ4A 4E00A 5FWKA 2VW5A 2QFOA 3MNRP 3BM9A 1Z59A 5BODA 2IOQA 4ZKIA 3D0BA 2PNRA 1U2OA 2YGEA 2Q8GA 4URLA 4CWRA 1AH8A 3O2FA 4YKYA 2XDKA 5M4HA 2GQPA 2WI1A 5FNCA 2CGFA 4U7OA 2BSMA 1UYMA 3A0WA 4YKRA 4EFUA 5FNDA 2EXLA 4HZ5A 3RKZA 3T1KA 4P7AA 2VWCA 4MOTA 1YC3A 4EGIA 1EA6A 2ZDXA 5F3KA 1AH6A 3VHDA 1Z5CA 4JAVA 3KE6A 1S14A 1I5AA 4HXZA 4HXWA 2YI6A 4CWPA 5M4EA 3SL2A 1UYIA 2YGFA 2YEFA 5F5RA 4XDMA 1KIJA 3O0IA 5CTYA 4KQVA 5CTWA 2BT0A 4R3MA 3TTZA 2YJXA 2CCUA 2YEIA 5CPHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H7S A;  3B26 A;  3R4M A;  3T2S A;  4BAE A;  3K97 A;  4BQJ A;  3VHC A;  1PVG A;  4O05 A;  4CWN A;  2YEJ A;  2HKJ A;  3ZKB A;  3R4O A;  1NHJ A;  2ZBK B;  3BMY A;  3A0T A;  3FT5 A;  2BRC A;  4NH9 A;  1GKZ A;  3WQ9 A;  4Q20 A;  3GIE A;  2HCH A;  4GFN A;  2WI3 A;  4O0B A;  3ZM7 A;  1NHH A;  2YE7 A;  4L94 A;  3OPD A;  1US7 A;  4XIT A;  4KFG A;  1I5D A;  5D6P A;  5L3J A;  2XX5 A;  3D2R A;  2YGA A;  4LWI A;  4I5S A;  3HEK A;  4MP7 A;  2ESA A;  2BYI A;  4BIZ A;  1UYE A;  1OSF A;  2YED A;  3EHH A;  4EEH A;  1UYD A;  3JZ3 A;  4XKA A;  1YT2 A;  1YT1 A;  3K60 A;  3Q5K A;  4URO A;  1THN A;  4O04 A;  2YKB A;  2XD6 A;  3ZXQ A;  2IWX A;  1YC4 A;  4L91 A;  4XIQ A;  3ZXO A;  4DZY A;  3HYZ A;  2IWS A;  4EMV A;  1JM6 A;  4XCL A;  3CRL A;  4GGL A;  4MPC A;  1KZN A;  4V26 A;  1AMW A;  3B27 A;  3VAD A;  4EGK A;  4KP4 A;  2ZDY A;  4DUH A;  1UYF A;  3G7B A;  4XC0 A;  1B63 A;  2XAB A;  1I59 A;  2BU7 A;  5C93 A;  2XX2 A;  4CWF A;  2YKI A;  3A0Z A;  3CGY A;  3O6O A;  4LWE A;  3EHG A;  2YE2 A;  3QTF A;  2XDL A;  1R62 A;  4L8Z A;  1Y4S A;  1ZWH A;  4JAS A;  5D6Q A;  5D7C A;  4EM7 A;  4PRX A;  3U67 A;  5J6A A;  1YER A;  2BU6 A;  2YI7 A;  2H8M A;  3INW A;  4URM A;  2YI5 A;  1NHI A;  3NMQ A;  4CE1 A;  2QF6 A;  5CTU A;  3DGE A;  1UYC A;  3C11 A;  4QPK A;  3H4L A;  4W7T A;  2Q8F A;  1I5C A;  2IOR A;  2WI5 A;  4EFT A;  4GCZ A;  3PEH A;  1YET A;  4BIU A;  3HYY A;  3VHA A;  2CG9 A;  1UY6 A;  2C2A A;  3OMU A;  3R4P A;  4NH7 A;  4XKK A;  1Z5B A;  4LWG A;  4YKU A;  2QG2 A;  2WI4 A;  5M4K A;  4XCJ A;  2WI2 A;  4L90 A;  1AJ6 A;  3K98 A;  2O1V A;  4YKQ A;  3D36 A;  4KSH A;  1Y4U A;  2XDS A;  3EHF A;  4AWQ A;  3LPS A;  3RLR A;  1UYL A;  3TUH A;  5D7R A;  4O07 A;  3ZKD A;  2WEQ A;  4O09 A;  3CGZ A;  4I3H A;  4H7Q A;  4BXI A;  4XE2 A;  1ZXN A;  2XHX A;  4AS9 A;  2XDX A;  4FCP A;  4XTJ A;  1UYK A;  4B6C A;  4BQG A;  2XHR A;  1Y8P A;  2Q8H A;  1H7U A;  4HY1 A;  4WUC A;  3U2K A;  2YEC A;  2XDU A;  3HZ5 A;  4YKW A;  3R4N A;  4H81 A;  3GIG B;  2XX4 A;  4YKT A;  1QY8 A;  2Q8I A;  3RLP A;  2AKP A;  3T0H A;  3TZ2 A;  2BTZ A;  4QPJ A;  4MPE A;  4FMT A;  1L0O A;  2YEH A;  4FCR A;  2YE4 A;  2HG1 A;  4JAU A;  1Y8N A;  4GEE A;  1TBW A;  2YI0 A;  3B24 A;  4KTN A;  1YC1 A;  3TZ0 A;  2E0A A;  4AWP A;  1I58 A;  4U7N A;  1YES A;  1UY7 A;  2WI7 A;  4LP0 A;  3B28 A;  2YKE A;  2YEA A;  1UYG A;  2YEB A;  4YKX A;  4WUD A;  4PRV A;  1QYE A;  2YE5 A;  2YKC A;  2YK2 A;  1BYQ A;  4PU9 A;  4CE3 A;  4FPP A;  4HY6 A;  4CWO A;  3R91 A;  1U0Z A;  4E02 A;  3A0X A;  2CH4 A;  3FV5 A;  1TID A;  2WEP A;  4JQL A;  3Q5J A;  1I5B A;  1AM1 A;  5M4N A;  1Z5A A;  2BU5 A;  3OW6 A;  5FNF A;  1YSZ A;  2CCT A;  2YEE A;  3A0R A;  3CWV A;  5IDJ A;  4ASG A;  2BYH A;  1UY8 A;  3R92 A;  2QG0 A;  3EHJ A;  2JKI A;  2YE6 A;  4LWH A;  3QDD A;  2O1W A;  3A0Y A;  4B7P A;  1UY9 A;  4WUB A;  1S16 A;  4CWS A;  3LNU A;  1TC0 A;  1A4H A;  5IDM A;  4U93 A;  3IED A;  2ZKJ A;  4CWT A;  2GFD A;  4ZVI A;  3TZ5 A;  4PL9 A;  3T0Z A;  2YEG A;  4ASF A;  3FT8 A;  2WER A;  2O1U A;  4X9L A;  2IWU A;  2YE8 A;  1YSR A;  1TC6 A;  4NH8 A;  1YS3 A;  4EGH A;  1B3Q A;  4MBC A;  2VCI A;  4V25 A;  5BOC A;  4FCQ A;  3C0E A;  4XIR A;  3H80 A;  4HZ0 A;  4AWO A;  1B62 A;  1UYH A;  2WI6 A;  2K5B A;  4MB9 A;  5GGZ A;  3OWD A;  3G7E A;  2YE9 A;  5CF0 A;  2XJG A;  1BKN A;  1ID0 A;  3B25 A;  4CE2 A;  2FYP A;  4HYM A;  2XCM A;  2BZ5 A;  3HHU A;  3PEJ A;  4YKZ A;  4P8O A;  2UWD A;  3K99 A;  3G75 A;  1Y8O A;  4XIP A;  3GIG A;  3EKR A;  5M4P A;  4L93 A;  3EKO A;  4KSG A;  1TIL A;  1QZR A;  2YKJ A;  3INX A;  5M4M A;  2BU2 A;  2YJW A;  3OWB A;  4MPN A;  1ZW9 A;  2XHT A;  1GKX A;  2YK9 A;  3CRK A;  4R1F A;  4R3A A;  1MU5 A;  5IN9 A;  2FWZ A;  4GQT A;  2FXS A;  1BXD A;  4XD8 A;  2VCJ A;  4K4O A;  1ZXM A;  2XJX A;  3RLQ A;  2JJC A;  4CWQ A;  4GT8 A;  5J71 A;  2H55 A;  5CTX A;  3U2D A;  3GIF A;  4ASB A;  5D7D A;  2IOP A;  4HYP A;  1TH8 A;  3HZ1 A;  4LPB A;  4H85 A;  3Q5L A;  4URN A;  2BRE A;  3WHA A;  2XK2 A;  1YT0 A;  4XKO A;  4MP2 A;  2XJJ A;  2Q2E B;  1MX0 A;  1EI1 A;  1GJV A;  4LWF A;  2YE3 A;  4ASA A;  4E01 A;  2BU8 A;  2FWY A;  1BGQ A;  3T10 A;  2CCS A;  3TZ4 A;  4E00 A;  5FWK A;  2VW5 A;  2QFO A;  3MNR P;  3BM9 A;  1Z59 A;  5BOD A;  2IOQ A;  4ZKI A;  3D0B A;  2PNR A;  1U2O A;  2YGE A;  2Q8G A;  4URL A;  4CWR A;  1AH8 A;  3O2F A;  4YKY A;  2XDK A;  5M4H A;  2GQP A;  2WI1 A;  5FNC A;  2CGF A;  4U7O A;  2BSM A;  1UYM A;  3A0W A;  4YKR A;  4EFU A;  5FND A;  2EXL A;  4HZ5 A;  3RKZ A;  3T1K A;  4P7A A;  2VWC A;  4MOT A;  1YC3 A;  4EGI A;  1EA6 A;  2ZDX A;  5F3K A;  1AH6 A;  3VHD A;  1Z5C A;  4JAV A;  3KE6 A;  1S14 A;  1I5A A;  4HXZ A;  4HXW A;  2YI6 A;  4CWP A;  5M4E A;  3SL2 A;  1UYI A;  2YGF A;  2YEF A;  5F5R A;  4XDM A;  1KIJ A;  3O0I A;  5CTY A;  4KQV A;  5CTW A;  2BT0 A;  4R3M A;  3TTZ A;  2YJX A;  2CCU A;  2YEI A;  5CPH A; 
#chains in the Genus database with same CATH topology
 1H7S A;  3B26 A;  3R4M A;  3T2S A;  4BAE A;  3K97 A;  4BQJ A;  3VHC A;  1PVG A;  4O05 A;  4CWN A;  2YEJ A;  2HKJ A;  3ZKB A;  3R4O A;  1NHJ A;  2ZBK B;  3BMY A;  3A0T A;  3FT5 A;  2BRC A;  4NH9 A;  1GKZ A;  3WQ9 A;  4Q20 A;  3GIE A;  2HCH A;  4GFN A;  2WI3 A;  4O0B A;  3ZM7 A;  1NHH A;  2YE7 A;  4L94 A;  3OPD A;  1US7 A;  4XIT A;  4KFG A;  1I5D A;  5D6P A;  5L3J A;  2XX5 A;  3D2R A;  2YGA A;  4LWI A;  4I5S A;  3HEK A;  4MP7 A;  2ESA A;  2BYI A;  4BIZ A;  1UYE A;  1OSF A;  2YED A;  3EHH A;  4EEH A;  1UYD A;  3JZ3 A;  4XKA A;  1YT2 A;  1YT1 A;  3K60 A;  3Q5K A;  4URO A;  1THN A;  4O04 A;  2YKB A;  2XD6 A;  3ZXQ A;  2IWX A;  1YC4 A;  4L91 A;  4XIQ A;  3ZXO A;  4DZY A;  3HYZ A;  2IWS A;  4EMV A;  1JM6 A;  4XCL A;  3CRL A;  4GGL A;  4MPC A;  1KZN A;  4V26 A;  1AMW A;  3B27 A;  3VAD A;  4EGK A;  4KP4 A;  2ZDY A;  4DUH A;  1UYF A;  3G7B A;  4XC0 A;  1B63 A;  2XAB A;  1I59 A;  2BU7 A;  5C93 A;  2XX2 A;  4CWF A;  2YKI A;  3A0Z A;  3CGY A;  3O6O A;  4LWE A;  3EHG A;  2YE2 A;  3QTF A;  2XDL A;  1R62 A;  4L8Z A;  1Y4S A;  1ZWH A;  4JAS A;  5D6Q A;  5D7C A;  4EM7 A;  4PRX A;  3U67 A;  5J6A A;  1YER A;  2BU6 A;  2YI7 A;  2H8M A;  3INW A;  4URM A;  2YI5 A;  3S5T A;  1NHI A;  3NMQ A;  4CE1 A;  2QF6 A;  5CTU A;  3DGE A;  1UYC A;  3C11 A;  2HHI A;  4QPK A;  3H4L A;  4W7T A;  2Q8F A;  1I5C A;  2IOR A;  2WI5 A;  4EFT A;  4GCZ A;  3PEH A;  1YET A;  4BIU A;  3HYY A;  3VHA A;  2CG9 A;  1UY6 A;  2C2A A;  3OMU A;  3R4P A;  4NH7 A;  4XKK A;  1Z5B A;  4LWG A;  4YKU A;  2QG2 A;  2WI4 A;  5M4K A;  4XCJ A;  2WI2 A;  4L90 A;  1AJ6 A;  3K98 A;  2O1V A;  4YKQ A;  3D36 A;  4KSH A;  1Y4U A;  2XDS A;  3EHF A;  4AWQ A;  3LPS A;  3RLR A;  1UYL A;  3TUH A;  5D7R A;  4O07 A;  3ZKD A;  2WEQ A;  4O09 A;  3CGZ A;  4I3H A;  4H7Q A;  4BXI A;  4XE2 A;  1ZXN A;  2XHX A;  4AS9 A;  2XDX A;  4FCP A;  4XTJ A;  1UYK A;  4B6C A;  4BQG A;  2XHR A;  1Y8P A;  2Q8H A;  1H7U A;  4HY1 A;  4WUC A;  3U2K A;  2YEC A;  2XDU A;  3CYG A;  3LMM A;  3HZ5 A;  4YKW A;  3R4N A;  4H81 A;  2FTK A;  3GIG B;  2XX4 A;  4YKT A;  1QY8 A;  2Q8I A;  3RLP A;  2AKP A;  3T0H A;  3TZ2 A;  2BTZ A;  4QPJ A;  4MPE A;  4FMT A;  1L0O A;  2YEH A;  4FCR A;  2YE4 A;  2HG1 A;  4JAU A;  1Y8N A;  4GEE A;  1TBW A;  5JEN A;  2YI0 A;  3B24 A;  4KTN A;  1YC1 A;  3TZ0 A;  2E0A A;  4AWP A;  1I58 A;  4U7N A;  1YES A;  1UY7 A;  2WI7 A;  4LP0 A;  3B28 A;  2YKE A;  2YEA A;  1UYG A;  2YEB A;  4YKX A;  4WUD A;  4PRV A;  1QYE A;  2YE5 A;  2YKC A;  2YK2 A;  1BYQ A;  4PU9 A;  4CE3 A;  4FPP A;  4HY6 A;  4CWO A;  3R91 A;  1U0Z A;  4E02 A;  3A0X A;  2CH4 A;  3FV5 A;  1TID A;  2WEP A;  4JQL A;  3Q5J A;  1I5B A;  1AM1 A;  5M4N A;  1Z5A A;  2BU5 A;  3OW6 A;  5FNF A;  1YSZ A;  2CCT A;  2YEE A;  3A0R A;  3CWV A;  5IDJ A;  4ASG A;  2BYH A;  1UY8 A;  3R92 A;  2QG0 A;  3EHJ A;  2JKI A;  2YE6 A;  4LWH A;  3QDD A;  2O1W A;  3A0Y A;  4B7P A;  1UY9 A;  4WUB A;  1S16 A;  4CWS A;  3LNU A;  1TC0 A;  1A4H A;  5IDM A;  4U93 A;  3IED A;  2ZKJ A;  4CWT A;  2GFD A;  4ZVI A;  3TZ5 A;  4PL9 A;  3T0Z A;  2YEG A;  4ASF A;  2C1I A;  3FT8 A;  2WER A;  2O1U A;  4X9L A;  2IWU A;  2YE8 A;  1YSR A;  1TC6 A;  4NH8 A;  1YS3 A;  4EGH A;  1B3Q A;  4MBC A;  2VCI A;  4V25 A;  5BOC A;  4FCQ A;  3C0E A;  4XIR A;  3H80 A;  4HZ0 A;  4AWO A;  1B62 A;  1UYH A;  2WI6 A;  2K5B A;  4MB9 A;  5GGZ A;  3OWD A;  3G7E A;  2YE9 A;  5CF0 A;  2XJG A;  1BKN A;  1ID0 A;  3B25 A;  4CE2 A;  2FYP A;  4HYM A;  2XCM A;  2BZ5 A;  3HHU A;  3PEJ A;  4YKZ A;  4P8O A;  2UWD A;  3K99 A;  3G75 A;  1Y8O A;  4XIP A;  3GIG A;  3EKR A;  5M4P A;  4L93 A;  3EKO A;  4KSG A;  1TIL A;  1QZR A;  2YKJ A;  3INX A;  1IXM A;  5M4M A;  2BU2 A;  2YJW A;  3OWB A;  4MPN A;  4E72 A;  1ZW9 A;  2XHT A;  1GKX A;  2YK9 A;  3CRK A;  4R1F A;  4R3A A;  1MU5 A;  5IN9 A;  2FWZ A;  4GQT A;  2FXS A;  1BXD A;  4XD8 A;  2VCJ A;  4K4O A;  1ZXM A;  2XJX A;  3RLQ A;  2JJC A;  4CWQ A;  4GT8 A;  5J71 A;  2C1G A;  2H55 A;  5CTX A;  3U2D A;  3GIF A;  4ASB A;  5D7D A;  2IOP A;  4HYP A;  1TH8 A;  3HZ1 A;  4LPB A;  4H85 A;  3Q5L A;  4URN A;  2BRE A;  3WHA A;  2XK2 A;  1YT0 A;  4XKO A;  4MP2 A;  2XJJ A;  2Q2E B;  1MX0 A;  1EI1 A;  1GJV A;  4LWF A;  2YE3 A;  4ASA A;  4E01 A;  2BU8 A;  2FWY A;  1BGQ A;  3T10 A;  2CCS A;  3TZ4 A;  4E00 A;  5FWK A;  2VW5 A;  2QFO A;  3MNR P;  1F51 A;  3BM9 A;  1Z59 A;  5BOD A;  2IOQ A;  4ZKI A;  3D0B A;  2PNR A;  1U2O A;  2YGE A;  2Q8G A;  4URL A;  4CWR A;  1AH8 A;  3O2F A;  4YKY A;  2XDK A;  5M4H A;  2GQP A;  2WI1 A;  5FNC A;  2CGF A;  4U7O A;  2BSM A;  1UYM A;  3A0W A;  4YKR A;  4EFU A;  5FND A;  2EXL A;  4HZ5 A;  3RKZ A;  3T1K A;  4P7A A;  2VWC A;  4MOT A;  1YC3 A;  4EGI A;  1EA6 A;  2ZDX A;  5F3K A;  1AH6 A;  3VHD A;  1Z5C A;  4JAV A;  3KE6 A;  1S14 A;  1I5A A;  4HXZ A;  4HXW A;  2YI6 A;  4CWP A;  5M4E A;  3SL2 A;  1UYI A;  2YGF A;  2YEF A;  5F5R A;  4XDM A;  1KIJ A;  3O0I A;  5CTY A;  4KQV A;  5CTW A;  2BT0 A;  4R3M A;  3TTZ A;  2YJX A;  2CCU A;  2YEI A;  5CPH A; 
#chains in the Genus database with same CATH homology
 1H7S A;  3B26 A;  3R4M A;  3T2S A;  4BAE A;  3K97 A;  4BQJ A;  3VHC A;  1PVG A;  4O05 A;  4CWN A;  2YEJ A;  2HKJ A;  3ZKB A;  3R4O A;  1NHJ A;  2ZBK B;  3BMY A;  3A0T A;  3FT5 A;  2BRC A;  4NH9 A;  1GKZ A;  3WQ9 A;  4Q20 A;  3GIE A;  2HCH A;  4GFN A;  2WI3 A;  4O0B A;  3ZM7 A;  1NHH A;  2YE7 A;  4L94 A;  3OPD A;  1US7 A;  4XIT A;  4KFG A;  1I5D A;  5D6P A;  5L3J A;  2XX5 A;  3D2R A;  2YGA A;  4LWI A;  4I5S A;  3HEK A;  4MP7 A;  2ESA A;  2BYI A;  4BIZ A;  1UYE A;  1OSF A;  2YED A;  3EHH A;  4EEH A;  1UYD A;  3JZ3 A;  4XKA A;  1YT2 A;  1YT1 A;  3K60 A;  3Q5K A;  4URO A;  1THN A;  4O04 A;  2YKB A;  2XD6 A;  3ZXQ A;  2IWX A;  1YC4 A;  4L91 A;  4XIQ A;  3ZXO A;  4DZY A;  3HYZ A;  2IWS A;  4EMV A;  1JM6 A;  4XCL A;  3CRL A;  4GGL A;  4MPC A;  1KZN A;  4V26 A;  1AMW A;  3B27 A;  3VAD A;  4EGK A;  4KP4 A;  2ZDY A;  4DUH A;  1UYF A;  3G7B A;  4XC0 A;  1B63 A;  2XAB A;  1I59 A;  2BU7 A;  5C93 A;  2XX2 A;  4CWF A;  2YKI A;  3A0Z A;  3CGY A;  3O6O A;  4LWE A;  3EHG A;  2YE2 A;  3QTF A;  2XDL A;  1R62 A;  4L8Z A;  1Y4S A;  1ZWH A;  4JAS A;  5D6Q A;  5D7C A;  4EM7 A;  4PRX A;  3U67 A;  5J6A A;  1YER A;  2BU6 A;  2YI7 A;  2H8M A;  3INW A;  4URM A;  2YI5 A;  1NHI A;  3NMQ A;  4CE1 A;  2QF6 A;  5CTU A;  3DGE A;  1UYC A;  3C11 A;  4QPK A;  3H4L A;  4W7T A;  2Q8F A;  1I5C A;  2IOR A;  2WI5 A;  4EFT A;  4GCZ A;  3PEH A;  1YET A;  4BIU A;  3HYY A;  3VHA A;  2CG9 A;  1UY6 A;  2C2A A;  3OMU A;  3R4P A;  4NH7 A;  4XKK A;  1Z5B A;  4LWG A;  4YKU A;  2QG2 A;  2WI4 A;  5M4K A;  4XCJ A;  2WI2 A;  4L90 A;  1AJ6 A;  3K98 A;  2O1V A;  4YKQ A;  3D36 A;  4KSH A;  1Y4U A;  2XDS A;  3EHF A;  4AWQ A;  3LPS A;  3RLR A;  1UYL A;  3TUH A;  5D7R A;  4O07 A;  3ZKD A;  2WEQ A;  4O09 A;  3CGZ A;  4I3H A;  4H7Q A;  4BXI A;  4XE2 A;  1ZXN A;  2XHX A;  4AS9 A;  2XDX A;  4FCP A;  4XTJ A;  1UYK A;  4B6C A;  4BQG A;  2XHR A;  1Y8P A;  2Q8H A;  1H7U A;  4HY1 A;  4WUC A;  3U2K A;  2YEC A;  2XDU A;  3HZ5 A;  4YKW A;  3R4N A;  4H81 A;  3GIG B;  2XX4 A;  4YKT A;  1QY8 A;  2Q8I A;  3RLP A;  2AKP A;  3T0H A;  3TZ2 A;  2BTZ A;  4QPJ A;  4MPE A;  4FMT A;  1L0O A;  2YEH A;  4FCR A;  2YE4 A;  2HG1 A;  4JAU A;  1Y8N A;  4GEE A;  1TBW A;  2YI0 A;  3B24 A;  4KTN A;  1YC1 A;  3TZ0 A;  2E0A A;  4AWP A;  1I58 A;  4U7N A;  1YES A;  1UY7 A;  2WI7 A;  4LP0 A;  3B28 A;  2YKE A;  2YEA A;  1UYG A;  2YEB A;  4YKX A;  4WUD A;  4PRV A;  1QYE A;  2YE5 A;  2YKC A;  2YK2 A;  1BYQ A;  4PU9 A;  4CE3 A;  4FPP A;  4HY6 A;  4CWO A;  3R91 A;  1U0Z A;  4E02 A;  3A0X A;  2CH4 A;  3FV5 A;  1TID A;  2WEP A;  4JQL A;  3Q5J A;  1I5B A;  1AM1 A;  5M4N A;  1Z5A A;  2BU5 A;  3OW6 A;  5FNF A;  1YSZ A;  2CCT A;  2YEE A;  3A0R A;  3CWV A;  5IDJ A;  4ASG A;  2BYH A;  1UY8 A;  3R92 A;  2QG0 A;  3EHJ A;  2JKI A;  2YE6 A;  4LWH A;  3QDD A;  2O1W A;  3A0Y A;  4B7P A;  1UY9 A;  4WUB A;  1S16 A;  4CWS A;  3LNU A;  1TC0 A;  1A4H A;  5IDM A;  4U93 A;  3IED A;  2ZKJ A;  4CWT A;  2GFD A;  4ZVI A;  3TZ5 A;  4PL9 A;  3T0Z A;  2YEG A;  4ASF A;  3FT8 A;  2WER A;  2O1U A;  4X9L A;  2IWU A;  2YE8 A;  1YSR A;  1TC6 A;  4NH8 A;  1YS3 A;  4EGH A;  1B3Q A;  4MBC A;  2VCI A;  4V25 A;  5BOC A;  4FCQ A;  3C0E A;  4XIR A;  3H80 A;  4HZ0 A;  4AWO A;  1B62 A;  1UYH A;  2WI6 A;  2K5B A;  4MB9 A;  5GGZ A;  3OWD A;  3G7E A;  2YE9 A;  5CF0 A;  2XJG A;  1BKN A;  1ID0 A;  3B25 A;  4CE2 A;  2FYP A;  4HYM A;  2XCM A;  2BZ5 A;  3HHU A;  3PEJ A;  4YKZ A;  4P8O A;  2UWD A;  3K99 A;  3G75 A;  1Y8O A;  4XIP A;  3GIG A;  3EKR A;  5M4P A;  4L93 A;  3EKO A;  4KSG A;  1TIL A;  1QZR A;  2YKJ A;  3INX A;  5M4M A;  2BU2 A;  2YJW A;  3OWB A;  4MPN A;  1ZW9 A;  2XHT A;  1GKX A;  2YK9 A;  3CRK A;  4R1F A;  4R3A A;  1MU5 A;  5IN9 A;  2FWZ A;  4GQT A;  2FXS A;  1BXD A;  4XD8 A;  2VCJ A;  4K4O A;  1ZXM A;  2XJX A;  3RLQ A;  2JJC A;  4CWQ A;  4GT8 A;  5J71 A;  2H55 A;  5CTX A;  3U2D A;  3GIF A;  4ASB A;  5D7D A;  2IOP A;  4HYP A;  1TH8 A;  3HZ1 A;  4LPB A;  4H85 A;  3Q5L A;  4URN A;  2BRE A;  3WHA A;  2XK2 A;  1YT0 A;  4XKO A;  4MP2 A;  2XJJ A;  2Q2E B;  1MX0 A;  1EI1 A;  1GJV A;  4LWF A;  2YE3 A;  4ASA A;  4E01 A;  2BU8 A;  2FWY A;  1BGQ A;  3T10 A;  2CCS A;  3TZ4 A;  4E00 A;  5FWK A;  2VW5 A;  2QFO A;  3MNR P;  3BM9 A;  1Z59 A;  5BOD A;  2IOQ A;  4ZKI A;  3D0B A;  2PNR A;  1U2O A;  2YGE A;  2Q8G A;  4URL A;  4CWR A;  1AH8 A;  3O2F A;  4YKY A;  2XDK A;  5M4H A;  2GQP A;  2WI1 A;  5FNC A;  2CGF A;  4U7O A;  2BSM A;  1UYM A;  3A0W A;  4YKR A;  4EFU A;  5FND A;  2EXL A;  4HZ5 A;  3RKZ A;  3T1K A;  4P7A A;  2VWC A;  4MOT A;  1YC3 A;  4EGI A;  1EA6 A;  2ZDX A;  5F3K A;  1AH6 A;  3VHD A;  1Z5C A;  4JAV A;  3KE6 A;  1S14 A;  1I5A A;  4HXZ A;  4HXW A;  2YI6 A;  4CWP A;  5M4E A;  3SL2 A;  1UYI A;  2YGF A;  2YEF A;  5F5R A;  4XDM A;  1KIJ A;  3O0I A;  5CTY A;  4KQV A;  5CTW A;  2BT0 A;  4R3M A;  3TTZ A;  2YJX A;  2CCU A;  2YEI A;  5CPH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...