4KSGA

Dna gyrase atp binding domain of enterococcus faecalis in complex with a small molecule inhibitor (4-[(1s,5r,6r)-6-amino-1-methyl-3-azabicyclo[3.2.0]hept-3-yl]-6-fluoro-n-methyl-2-[(2-methylpyrimidin-5-yl)oxy]-9h-pyrimido[4,5-b]indol-8-amine)
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
210
structure length
190
Chain Sequence
GLEAVRKRPGMYIGSTSGEGLHHLVWEIVDNSIDEALAGFAKSIQVIIEPDDSITVIDDGRGIPVGIQAKTGRPAVETVFTVLGSSVVNALSTSLDVRVYKDGKVYYQEYRRGAVVDDLKVIEETDRHGTTVHFIPDPEIFTETTVYDFDKLATRVRELAFLNRGLHISIEDRREGQEDKKEYHYEGLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase/isomerase inhibitor
molecule keywords DNA gyrase subunit B
publication title A new class of type iia topoisomerase inhibitors with broad-spectrum antibacterial activity
rcsb
source organism Enterococcus faecalis
total genus 62
structure length 190
sequence length 210
ec nomenclature ec 5.99.1.3: Transferred entry: 5.6.2.3.
pdb deposition date 2013-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 4ksgA00
2YEFA 2YKCA 2YE8A 4DUHA 4YKXA 4E02A 4CWFA 3PEJA 5IDMA 4Q20A 3CGYA 1I5CA 1ZWHA 1BXDA 2IWSA 3FT5A 1KIJA 4V25A 1BGQA 4XCJA 1B62A 3G7EA 3QTFA 4B6CA 3TZ0A 4K4OA 4GT8A 3RLRA 2WEQA 2YK2A 2YJWA 4MPNA 2FWYA 1AM1A 2XCMA 1AMWA 1UYEA 4CWTA 5M4KA 4E01A 1Z5BA 3Q5JA 3Q5LA 5M4EA 4URLA 4NH8A 2BSMA 1A4HA 3RLQA 4CWSA 2YE4A 3TZ4A 1BKNA 2YECA 1I5BA 3R4MA 3HZ1A 2JJCA 2XK2A 1TBWA 2XDUA 2YGEA 2PNRA 2WI4A 4EGIA 2IWUA 4FMTA 5BOCA 3NMQA 4XCLA 4PRVA 2YI5A 4KSGA 3R4PA 1R62A 4LPBA 3KE6A 3EHHA 3D36A 5CPHA 2ESAA 1L0OA 4ASFA 2YKIA 4DZYA 4MOTA 1Y8PA 2BU5A 3C0EA 3D2RA 3VADA 3O2FA 2QG0A 4JAVA 4HY1A 2WI7A 5D7RA 1Z5CA 3RKZA 2O1WA 5FNFA 3U2DA 2GFDA 3A0RA 2HCHA 1THNA 1I59A 2E0AA 1AJ6A 5D6QA 1YSZA 5M4PA 1GJVA 1ZW9A 2AKPA 2CG9A 2WI5A 1U0ZA 4XIRA 2YKJA 4QPJA 4X9LA 5M4MA 1YT2A 4L8ZA 3HYZA 4NH7A 4NH9A 4LWGA 1S16A 2YK9A 4B7PA 2BU2A 1GKZA 4WUCA 4EEHA 1YC4A 3IEDA 4I5SA 3VHDA 2IWXA 3VHCA 3A0XA 3CRKA 2BTZA 3R4OA 2XDSA 4R3MA 3CRLA 4O09A 4GFNA 4R1FA 4YKQA 1Y8OA 4HY6A 1I5DA 4L90A 2YE9A 3A0TA 4O05A 3BMYA 2BT0A 4EMVA 3TTZA 1NHJA 1US7A 2BYIA 5J71A 3K99A 4R3AA 2YE5A 4CWQA 4XKKA 3T2SA 2CH4A 2Q8FA 4HXZA 5D7DA 2YKBA 3O6OA 1YC1A 2YEHA 4YKYA 4FCRA 4XIPA 1QZRA 3G7BA 5FNCA 1Y8NA 4L94A 4KSHA 4I3HA 4XDMA 4CWNA 2IOPA 1NHHA 5D6PA 2YEDA 1Z5AA 2YE7A 3H80A 4MPEA 4BAEA 4FCPA 3T10A 3LNUA 4L91A 3K97A 3MNRP 1YT0A 2HKJA 3OPDA 5J6AA 4BQGA 4MB9A 3CWVA 3T1KA 2ZBKB 2XDXA 3ZKBA 4GEEA 3GIFA 4H7QA 3TZ5A 1OSFA 2WI1A 1UYIA 1EI1A 3B27A 4CWRA 1UYCA 2Q2EB 4EFTA 2ZKJA 3A0ZA 4MPCA 2FXSA 2EXLA 2BYHA 3FT8A 4GQTA 5D7CA 4KP4A 5CTUA 2ZDXA 3ZKDA 5FNDA 2QF6A 4BXIA 2JKIA 2XJGA 4LWIA 2YEAA 1ID0A 1JM6A 2HG1A 4HYMA 4CE1A 4MP7A 3EHFA 1Y4SA 4MP2A 3EHJA 1H7UA 3TZ2A 4KQVA 2CCTA 1U2OA 5IDJA 2XHXA 4V26A 4CE3A 1YS3A 1MX0A 4HZ0A 2WI2A 4FCQA 2VWCA 4UROA 2VW5A 3CGZA 4BIUA 4CE2A 4KTNA 3OMUA 1TH8A 4P8OA 4H81A 1TC0A 4FPPA 1UYGA 2Q8IA 2XJXA 3ZXOA 2WERA 4H85A 1PVGA 1I5AA 1TILA 4EGHA 4CWPA 3QDDA 4YKTA 4E00A 4GGLA 4JAUA 2XABA 2WI3A 4ASAA 3A0YA 3B26A 1YC3A 1TIDA 4O07A 4HYPA 4LWFA 1B63A 3R4NA 4U93A 3EKOA 1YERA 3OWDA 3D0BA 4HXWA 4PL9A 3B25A 4ZVIA 2Q8GA 3T0ZA 2IORA 4AWPA 2QFOA 4U7NA 4EM7A 2O1VA 4WUDA 4XKAA 2XHRA 3ZM7A 4BQJA 2C2AA 1ZXMA 3BM9A 3H4LA 4L93A 4ZKIA 2XHTA 1EA6A 3SL2A 4ASGA 3INXA 4P7AA 4EFUA 3LPSA 4BIZA 2H8MA 2Q8HA 1MU5A 2YJXA 5BODA 4YKUA 2CCUA 4LP0A 5CF0A 3B28A 5CTYA 4XIQA 4O04A 3PEHA 3O0IA 2XD6A 2YGFA 1YESA 2BRCA 5L3JA 1ZXNA 4ASBA 1UYFA 3K60A 1UY9A 3RLPA 4XD8A 1UY6A 4MBCA 1AH8A 4W7TA 2YE2A 2YEGA 2K5BA 2YI0A 4QPKA 4AWQA 2YGAA 2XJJA 2FWZA 2XDKA 4GCZA 1UY7A 4EGKA 2WEPA 3ZXQA 3HHUA 2QG2A 1UYLA 3G75A 3EKRA 3TUHA 4JQLA 4U7OA 3U2KA 2YI7A 1UYHA 3GIEA 4XITA 3HYYA 5CTWA 5FWKA 4JASA 2YE6A 3U67A 3WHAA 1S14A 2FYPA 4PU9A 1I58A 3Q5KA 1UY8A 4YKZA 3OW6A 4KFGA 2YI6A 2YEBA 2CCSA 2BU8A 4XE2A 1YSRA 2YEIA 4XTJA 3HEKA 3A0WA 3FV5A 4HZ5A 2ZDYA 5M4NA 1UYDA 2XX5A 3EHGA 3GIGB 3WQ9A 1B3QA 4O0BA 5CTXA 2XX2A 1UYKA 3K98A 4XKOA 5IN9A 3B24A 2YEEA 4URNA 3R91A 5M4HA 4PRXA 2YEJA 4LWHA 3INWA 2GQPA 1QY8A 5GGZA 2VCJA 2UWDA 3JZ3A 1Y4UA 1QYEA 1BYQA 1TC6A 3DGEA 1YT1A 2XDLA 5F5RA 3VHAA 5C93A 3T0HA 3OWBA 1H7SA 1NHIA 5F3KA 2YE3A 4AWOA 2VCIA 2O1UA 1KZNA 4CWOA 4YKRA 3HZ5A 4XC0A 1AH6A 2XX4A 4URMA 4YKWA 4WUBA 1Z59A 2BZ5A 2BU6A 1YETA 3GIGA 2IOQA 4AS9A 4LWEA 2YKEA 1UYMA 2CGFA 3C11A 2BREA 3R92A 2BU7A 2WI6A 1GKXA 2H55A
chains in the Genus database with same CATH superfamily
2YEFA 2YKCA 2YE8A 4DUHA 4YKXA 4E02A 4CWFA 3PEJA 5IDMA 4Q20A 3CGYA 1I5CA 1ZWHA 1BXDA 2IWSA 3FT5A 1KIJA 4V25A 1BGQA 4XCJA 1B62A 3G7EA 3QTFA 4B6CA 3TZ0A 2C1IA 4K4OA 4GT8A 3RLRA 2WEQA 2YK2A 2YJWA 4MPNA 2FWYA 1AM1A 2XCMA 1AMWA 1UYEA 4CWTA 5M4KA 4E01A 1Z5BA 3Q5JA 3Q5LA 5M4EA 4URLA 4NH8A 2BSMA 1A4HA 3RLQA 4CWSA 2YE4A 3TZ4A 1BKNA 2YECA 1I5BA 3R4MA 3CYGA 3HZ1A 2JJCA 2XK2A 1TBWA 2XDUA 2YGEA 2PNRA 2WI4A 4EGIA 2IWUA 4FMTA 5BOCA 3NMQA 4XCLA 4PRVA 2YI5A 4KSGA 3R4PA 1R62A 4LPBA 3KE6A 3EHHA 3D36A 5CPHA 2ESAA 1L0OA 4ASFA 2YKIA 4DZYA 4MOTA 1Y8PA 2BU5A 3C0EA 3D2RA 3VADA 3O2FA 2QG0A 4JAVA 4HY1A 2WI7A 1F51A 5D7RA 1Z5CA 3RKZA 2O1WA 5FNFA 3U2DA 2GFDA 3A0RA 2HCHA 1THNA 1I59A 2E0AA 1AJ6A 5D6QA 1YSZA 5M4PA 1GJVA 1ZW9A 2AKPA 2CG9A 2WI5A 1U0ZA 4XIRA 2YKJA 4QPJA 4X9LA 5M4MA 1YT2A 4L8ZA 3HYZA 4NH7A 4NH9A 4LWGA 1S16A 2YK9A 4B7PA 2BU2A 1GKZA 4WUCA 4EEHA 1YC4A 3IEDA 4I5SA 3VHDA 2IWXA 3VHCA 3A0XA 3CRKA 2BTZA 3R4OA 2XDSA 4R3MA 3CRLA 4O09A 4GFNA 4R1FA 4YKQA 1Y8OA 4HY6A 1I5DA 4L90A 2YE9A 3A0TA 4O05A 3BMYA 2BT0A 4EMVA 3TTZA 1NHJA 1US7A 2BYIA 5J71A 3K99A 4R3AA 2YE5A 4CWQA 4XKKA 3T2SA 2CH4A 2Q8FA 4HXZA 5D7DA 2YKBA 3O6OA 1YC1A 2YEHA 4YKYA 4FCRA 4XIPA 1QZRA 3G7BA 5FNCA 1Y8NA 4L94A 4KSHA 4I3HA 4XDMA 4CWNA 2IOPA 1NHHA 5D6PA 2YEDA 1Z5AA 2YE7A 3H80A 4MPEA 4BAEA 4FCPA 3T10A 3LNUA 4L91A 3K97A 3MNRP 1YT0A 2HKJA 3OPDA 5J6AA 4BQGA 4MB9A 3CWVA 1IXMA 3T1KA 2FTKA 2XDXA 2ZBKB 3ZKBA 4GEEA 3GIFA 4H7QA 3TZ5A 1OSFA 2WI1A 1UYIA 1EI1A 3B27A 4CWRA 1UYCA 2Q2EB 4EFTA 2ZKJA 3A0ZA 4MPCA 2FXSA 2EXLA 2BYHA 3FT8A 4GQTA 5D7CA 4KP4A 5CTUA 2ZDXA 3ZKDA 5FNDA 2QF6A 4BXIA 2JKIA 2XJGA 4LWIA 2YEAA 1ID0A 1JM6A 2HG1A 4HYMA 4CE1A 4MP7A 3EHFA 1Y4SA 4MP2A 3EHJA 1H7UA 3TZ2A 4KQVA 2CCTA 1U2OA 5IDJA 2XHXA 4V26A 4CE3A 1YS3A 1MX0A 4E72A 4HZ0A 2WI2A 4FCQA 2VWCA 4UROA 2VW5A 3CGZA 4BIUA 4CE2A 4KTNA 3OMUA 1TH8A 4P8OA 4H81A 1TC0A 4FPPA 1UYGA 2Q8IA 2XJXA 3ZXOA 2WERA 4H85A 1PVGA 1I5AA 1TILA 4EGHA 4CWPA 3QDDA 4YKTA 4E00A 4GGLA 4JAUA 2XABA 2WI3A 4ASAA 3A0YA 3B26A 1YC3A 1TIDA 4O07A 4HYPA 4LWFA 1B63A 3R4NA 4U93A 3EKOA 1YERA 3OWDA 2C1GA 3D0BA 4HXWA 4PL9A 3B25A 4ZVIA 2Q8GA 3T0ZA 2IORA 4AWPA 2QFOA 4U7NA 4EM7A 2O1VA 4WUDA 4XKAA 2XHRA 3ZM7A 4BQJA 2C2AA 1ZXMA 3BM9A 3H4LA 4L93A 4ZKIA 2XHTA 1EA6A 3SL2A 4ASGA 3INXA 4P7AA 4EFUA 3LPSA 4BIZA 2H8MA 2Q8HA 1MU5A 2YJXA 5BODA 4YKUA 2CCUA 4LP0A 5CF0A 3B28A 5CTYA 4XIQA 4O04A 3PEHA 3O0IA 2XD6A 2YGFA 1YESA 2BRCA 5L3JA 1ZXNA 4ASBA 1UYFA 3K60A 1UY9A 3RLPA 4XD8A 1UY6A 4MBCA 1AH8A 4W7TA 2YE2A 2YEGA 2K5BA 2YI0A 4QPKA 4AWQA 2YGAA 2XJJA 2FWZA 2XDKA 4GCZA 1UY7A 4EGKA 2WEPA 3ZXQA 3HHUA 2QG2A 1UYLA 3G75A 3EKRA 3TUHA 4JQLA 4U7OA 3U2KA 2YI7A 1UYHA 3GIEA 4XITA 3HYYA 5CTWA 5FWKA 4JASA 2YE6A 3U67A 3WHAA 1S14A 2FYPA 4PU9A 1I58A 3Q5KA 1UY8A 4YKZA 3OW6A 4KFGA 2YI6A 2YEBA 2CCSA 2BU8A 4XE2A 1YSRA 2YEIA 4XTJA 3HEKA 3A0WA 3FV5A 4HZ5A 2ZDYA 5M4NA 1UYDA 2XX5A 3EHGA 3GIGB 3WQ9A 1B3QA 4O0BA 5CTXA 2XX2A 1UYKA 3K98A 4XKOA 5IN9A 3B24A 2YEEA 4URNA 3R91A 5M4HA 4PRXA 2YEJA 4LWHA 3INWA 2GQPA 1QY8A 5GGZA 2VCJA 2UWDA 3JZ3A 3LMMA 1Y4UA 1QYEA 1BYQA 1TC6A 3DGEA 1YT1A 2XDLA 5F5RA 3VHAA 5C93A 3T0HA 3OWBA 1H7SA 1NHIA 5F3KA 2YE3A 4AWOA 2VCIA 2O1UA 1KZNA 4CWOA 4YKRA 3HZ5A 4XC0A 1AH6A 2XX4A 4URMA 4YKWA 4WUBA 1Z59A 2BZ5A 2BU6A 1YETA 3GIGA 2IOQA 4AS9A 4LWEA 2YKEA 3S5TA 1UYMA 2CGFA 3C11A 2BREA 3R92A 2BU7A 2WI6A 2HHIA 5JENA 1GKXA 2H55A
chains in the Genus database with same CATH topology
2YEFA 2YKCA 2YE8A 4DUHA 4YKXA 4E02A 4CWFA 3PEJA 5IDMA 4Q20A 3CGYA 1I5CA 1ZWHA 1BXDA 2IWSA 3FT5A 1KIJA 4V25A 1BGQA 4XCJA 1B62A 3G7EA 3QTFA 4B6CA 3TZ0A 4K4OA 4GT8A 3RLRA 2WEQA 2YK2A 2YJWA 4MPNA 2FWYA 1AM1A 2XCMA 1AMWA 1UYEA 4CWTA 5M4KA 4E01A 1Z5BA 3Q5JA 3Q5LA 5M4EA 4URLA 4NH8A 2BSMA 1A4HA 3RLQA 4CWSA 2YE4A 3TZ4A 1BKNA 2YECA 1I5BA 3R4MA 3HZ1A 2JJCA 2XK2A 1TBWA 2XDUA 2YGEA 2PNRA 2WI4A 4EGIA 2IWUA 4FMTA 5BOCA 3NMQA 4XCLA 4PRVA 2YI5A 4KSGA 3R4PA 1R62A 4LPBA 3KE6A 3EHHA 3D36A 5CPHA 2ESAA 1L0OA 4ASFA 2YKIA 4DZYA 4MOTA 1Y8PA 2BU5A 3C0EA 3D2RA 3VADA 3O2FA 2QG0A 4JAVA 4HY1A 2WI7A 5D7RA 1Z5CA 3RKZA 2O1WA 5FNFA 3U2DA 2GFDA 3A0RA 2HCHA 1THNA 1I59A 2E0AA 1AJ6A 5D6QA 1YSZA 5M4PA 1GJVA 1ZW9A 2AKPA 2CG9A 2WI5A 1U0ZA 4XIRA 2YKJA 4QPJA 4X9LA 5M4MA 1YT2A 4L8ZA 3HYZA 4NH7A 4NH9A 4LWGA 1S16A 2YK9A 4B7PA 2BU2A 1GKZA 4WUCA 4EEHA 1YC4A 3IEDA 4I5SA 3VHDA 2IWXA 3VHCA 3A0XA 3CRKA 2BTZA 3R4OA 2XDSA 4R3MA 3CRLA 4O09A 4GFNA 4R1FA 4YKQA 1Y8OA 4HY6A 1I5DA 4L90A 2YE9A 3A0TA 4O05A 3BMYA 2BT0A 4EMVA 3TTZA 1NHJA 1US7A 2BYIA 5J71A 3K99A 4R3AA 2YE5A 4CWQA 4XKKA 3T2SA 2CH4A 2Q8FA 4HXZA 5D7DA 2YKBA 3O6OA 1YC1A 2YEHA 4YKYA 4FCRA 4XIPA 1QZRA 3G7BA 5FNCA 1Y8NA 4L94A 4KSHA 4I3HA 4XDMA 4CWNA 2IOPA 1NHHA 5D6PA 2YEDA 1Z5AA 2YE7A 3H80A 4MPEA 4BAEA 4FCPA 3T10A 3LNUA 4L91A 3K97A 3MNRP 1YT0A 2HKJA 3OPDA 5J6AA 4BQGA 4MB9A 3CWVA 3T1KA 2ZBKB 2XDXA 3ZKBA 4GEEA 3GIFA 4H7QA 3TZ5A 1OSFA 2WI1A 1UYIA 1EI1A 3B27A 4CWRA 1UYCA 2Q2EB 4EFTA 2ZKJA 3A0ZA 4MPCA 2FXSA 2EXLA 2BYHA 3FT8A 4GQTA 5D7CA 4KP4A 5CTUA 2ZDXA 3ZKDA 5FNDA 2QF6A 4BXIA 2JKIA 2XJGA 4LWIA 2YEAA 1ID0A 1JM6A 2HG1A 4HYMA 4CE1A 4MP7A 3EHFA 1Y4SA 4MP2A 3EHJA 1H7UA 3TZ2A 4KQVA 2CCTA 1U2OA 5IDJA 2XHXA 4V26A 4CE3A 1YS3A 1MX0A 4HZ0A 2WI2A 4FCQA 2VWCA 4UROA 2VW5A 3CGZA 4BIUA 4CE2A 4KTNA 3OMUA 1TH8A 4P8OA 4H81A 1TC0A 4FPPA 1UYGA 2Q8IA 2XJXA 3ZXOA 2WERA 4H85A 1PVGA 1I5AA 1TILA 4EGHA 4CWPA 3QDDA 4YKTA 4E00A 4GGLA 4JAUA 2XABA 2WI3A 4ASAA 3A0YA 3B26A 1YC3A 1TIDA 4O07A 4HYPA 4LWFA 1B63A 3R4NA 4U93A 3EKOA 1YERA 3OWDA 3D0BA 4HXWA 4PL9A 3B25A 4ZVIA 2Q8GA 3T0ZA 2IORA 4AWPA 2QFOA 4U7NA 4EM7A 2O1VA 4WUDA 4XKAA 2XHRA 3ZM7A 4BQJA 2C2AA 1ZXMA 3BM9A 3H4LA 4L93A 4ZKIA 2XHTA 1EA6A 3SL2A 4ASGA 3INXA 4P7AA 4EFUA 3LPSA 4BIZA 2H8MA 2Q8HA 1MU5A 2YJXA 5BODA 4YKUA 2CCUA 4LP0A 5CF0A 3B28A 5CTYA 4XIQA 4O04A 3PEHA 3O0IA 2XD6A 2YGFA 1YESA 2BRCA 5L3JA 1ZXNA 4ASBA 1UYFA 3K60A 1UY9A 3RLPA 4XD8A 1UY6A 4MBCA 1AH8A 4W7TA 2YE2A 2YEGA 2K5BA 2YI0A 4QPKA 4AWQA 2YGAA 2XJJA 2FWZA 2XDKA 4GCZA 1UY7A 4EGKA 2WEPA 3ZXQA 3HHUA 2QG2A 1UYLA 3G75A 3EKRA 3TUHA 4JQLA 4U7OA 3U2KA 2YI7A 1UYHA 3GIEA 4XITA 3HYYA 5CTWA 5FWKA 4JASA 2YE6A 3U67A 3WHAA 1S14A 2FYPA 4PU9A 1I58A 3Q5KA 1UY8A 4YKZA 3OW6A 4KFGA 2YI6A 2YEBA 2CCSA 2BU8A 4XE2A 1YSRA 2YEIA 4XTJA 3HEKA 3A0WA 3FV5A 4HZ5A 2ZDYA 5M4NA 1UYDA 2XX5A 3EHGA 3GIGB 3WQ9A 1B3QA 4O0BA 5CTXA 2XX2A 1UYKA 3K98A 4XKOA 5IN9A 3B24A 2YEEA 4URNA 3R91A 5M4HA 4PRXA 2YEJA 4LWHA 3INWA 2GQPA 1QY8A 5GGZA 2VCJA 2UWDA 3JZ3A 1Y4UA 1QYEA 1BYQA 1TC6A 3DGEA 1YT1A 2XDLA 5F5RA 3VHAA 5C93A 3T0HA 3OWBA 1H7SA 1NHIA 5F3KA 2YE3A 4AWOA 2VCIA 2O1UA 1KZNA 4CWOA 4YKRA 3HZ5A 4XC0A 1AH6A 2XX4A 4URMA 4YKWA 4WUBA 1Z59A 2BZ5A 2BU6A 1YETA 3GIGA 2IOQA 4AS9A 4LWEA 2YKEA 1UYMA 2CGFA 3C11A 2BREA 3R92A 2BU7A 2WI6A 1GKXA 2H55A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YEF A;  2YKC A;  2YE8 A;  4DUH A;  4YKX A;  4E02 A;  4CWF A;  3PEJ A;  5IDM A;  4Q20 A;  3CGY A;  1I5C A;  1ZWH A;  1BXD A;  2IWS A;  3FT5 A;  1KIJ A;  4V25 A;  1BGQ A;  4XCJ A;  1B62 A;  3G7E A;  3QTF A;  4B6C A;  3TZ0 A;  4K4O A;  4GT8 A;  3RLR A;  2WEQ A;  2YK2 A;  2YJW A;  4MPN A;  2FWY A;  1AM1 A;  2XCM A;  1AMW A;  1UYE A;  4CWT A;  5M4K A;  4E01 A;  1Z5B A;  3Q5J A;  3Q5L A;  5M4E A;  4URL A;  4NH8 A;  2BSM A;  1A4H A;  3RLQ A;  4CWS A;  2YE4 A;  3TZ4 A;  1BKN A;  2YEC A;  1I5B A;  3R4M A;  3HZ1 A;  2JJC A;  2XK2 A;  1TBW A;  2XDU A;  2YGE A;  2PNR A;  2WI4 A;  4EGI A;  2IWU A;  4FMT A;  5BOC A;  3NMQ A;  4XCL A;  4PRV A;  2YI5 A;  4KSG A;  3R4P A;  1R62 A;  4LPB A;  3KE6 A;  3EHH A;  3D36 A;  5CPH A;  2ESA A;  1L0O A;  4ASF A;  2YKI A;  4DZY A;  4MOT A;  1Y8P A;  2BU5 A;  3C0E A;  3D2R A;  3VAD A;  3O2F A;  2QG0 A;  4JAV A;  4HY1 A;  2WI7 A;  5D7R A;  1Z5C A;  3RKZ A;  2O1W A;  5FNF A;  3U2D A;  2GFD A;  3A0R A;  2HCH A;  1THN A;  1I59 A;  2E0A A;  1AJ6 A;  5D6Q A;  1YSZ A;  5M4P A;  1GJV A;  1ZW9 A;  2AKP A;  2CG9 A;  2WI5 A;  1U0Z A;  4XIR A;  2YKJ A;  4QPJ A;  4X9L A;  5M4M A;  1YT2 A;  4L8Z A;  3HYZ A;  4NH7 A;  4NH9 A;  4LWG A;  1S16 A;  2YK9 A;  4B7P A;  2BU2 A;  1GKZ A;  4WUC A;  4EEH A;  1YC4 A;  3IED A;  4I5S A;  3VHD A;  2IWX A;  3VHC A;  3A0X A;  3CRK A;  2BTZ A;  3R4O A;  2XDS A;  4R3M A;  3CRL A;  4O09 A;  4GFN A;  4R1F A;  4YKQ A;  1Y8O A;  4HY6 A;  1I5D A;  4L90 A;  2YE9 A;  3A0T A;  4O05 A;  3BMY A;  2BT0 A;  4EMV A;  3TTZ A;  1NHJ A;  1US7 A;  2BYI A;  5J71 A;  3K99 A;  4R3A A;  2YE5 A;  4CWQ A;  4XKK A;  3T2S A;  2CH4 A;  2Q8F A;  4HXZ A;  5D7D A;  2YKB A;  3O6O A;  1YC1 A;  2YEH A;  4YKY A;  4FCR A;  4XIP A;  1QZR A;  3G7B A;  5FNC A;  1Y8N A;  4L94 A;  4KSH A;  4I3H A;  4XDM A;  4CWN A;  2IOP A;  1NHH A;  5D6P A;  2YED A;  1Z5A A;  2YE7 A;  3H80 A;  4MPE A;  4BAE A;  4FCP A;  3T10 A;  3LNU A;  4L91 A;  3K97 A;  3MNR P;  1YT0 A;  2HKJ A;  3OPD A;  5J6A A;  4BQG A;  4MB9 A;  3CWV A;  3T1K A;  2ZBK B;  2XDX A;  3ZKB A;  4GEE A;  3GIF A;  4H7Q A;  3TZ5 A;  1OSF A;  2WI1 A;  1UYI A;  1EI1 A;  3B27 A;  4CWR A;  1UYC A;  2Q2E B;  4EFT A;  2ZKJ A;  3A0Z A;  4MPC A;  2FXS A;  2EXL A;  2BYH A;  3FT8 A;  4GQT A;  5D7C A;  4KP4 A;  5CTU A;  2ZDX A;  3ZKD A;  5FND A;  2QF6 A;  4BXI A;  2JKI A;  2XJG A;  4LWI A;  2YEA A;  1ID0 A;  1JM6 A;  2HG1 A;  4HYM A;  4CE1 A;  4MP7 A;  3EHF A;  1Y4S A;  4MP2 A;  3EHJ A;  1H7U A;  3TZ2 A;  4KQV A;  2CCT A;  1U2O A;  5IDJ A;  2XHX A;  4V26 A;  4CE3 A;  1YS3 A;  1MX0 A;  4HZ0 A;  2WI2 A;  4FCQ A;  2VWC A;  4URO A;  2VW5 A;  3CGZ A;  4BIU A;  4CE2 A;  4KTN A;  3OMU A;  1TH8 A;  4P8O A;  4H81 A;  1TC0 A;  4FPP A;  1UYG A;  2Q8I A;  2XJX A;  3ZXO A;  2WER A;  4H85 A;  1PVG A;  1I5A A;  1TIL A;  4EGH A;  4CWP A;  3QDD A;  4YKT A;  4E00 A;  4GGL A;  4JAU A;  2XAB A;  2WI3 A;  4ASA A;  3A0Y A;  3B26 A;  1YC3 A;  1TID A;  4O07 A;  4HYP A;  4LWF A;  1B63 A;  3R4N A;  4U93 A;  3EKO A;  1YER A;  3OWD A;  3D0B A;  4HXW A;  4PL9 A;  3B25 A;  4ZVI A;  2Q8G A;  3T0Z A;  2IOR A;  4AWP A;  2QFO A;  4U7N A;  4EM7 A;  2O1V A;  4WUD A;  4XKA A;  2XHR A;  3ZM7 A;  4BQJ A;  2C2A A;  1ZXM A;  3BM9 A;  3H4L A;  4L93 A;  4ZKI A;  2XHT A;  1EA6 A;  3SL2 A;  4ASG A;  3INX A;  4P7A A;  4EFU A;  3LPS A;  4BIZ A;  2H8M A;  2Q8H A;  1MU5 A;  2YJX A;  5BOD A;  4YKU A;  2CCU A;  4LP0 A;  5CF0 A;  3B28 A;  5CTY A;  4XIQ A;  4O04 A;  3PEH A;  3O0I A;  2XD6 A;  2YGF A;  1YES A;  2BRC A;  5L3J A;  1ZXN A;  4ASB A;  1UYF A;  3K60 A;  1UY9 A;  3RLP A;  4XD8 A;  1UY6 A;  4MBC A;  1AH8 A;  4W7T A;  2YE2 A;  2YEG A;  2K5B A;  2YI0 A;  4QPK A;  4AWQ A;  2YGA A;  2XJJ A;  2FWZ A;  2XDK A;  4GCZ A;  1UY7 A;  4EGK A;  2WEP A;  3ZXQ A;  3HHU A;  2QG2 A;  1UYL A;  3G75 A;  3EKR A;  3TUH A;  4JQL A;  4U7O A;  3U2K A;  2YI7 A;  1UYH A;  3GIE A;  4XIT A;  3HYY A;  5CTW A;  5FWK A;  4JAS A;  2YE6 A;  3U67 A;  3WHA A;  1S14 A;  2FYP A;  4PU9 A;  1I58 A;  3Q5K A;  1UY8 A;  4YKZ A;  3OW6 A;  4KFG A;  2YI6 A;  2YEB A;  2CCS A;  2BU8 A;  4XE2 A;  1YSR A;  2YEI A;  4XTJ A;  3HEK A;  3A0W A;  3FV5 A;  4HZ5 A;  2ZDY A;  5M4N A;  1UYD A;  2XX5 A;  3EHG A;  3GIG B;  3WQ9 A;  1B3Q A;  4O0B A;  5CTX A;  2XX2 A;  1UYK A;  3K98 A;  4XKO A;  5IN9 A;  3B24 A;  2YEE A;  4URN A;  3R91 A;  5M4H A;  4PRX A;  2YEJ A;  4LWH A;  3INW A;  2GQP A;  1QY8 A;  5GGZ A;  2VCJ A;  2UWD A;  3JZ3 A;  1Y4U A;  1QYE A;  1BYQ A;  1TC6 A;  3DGE A;  1YT1 A;  2XDL A;  5F5R A;  3VHA A;  5C93 A;  3T0H A;  3OWB A;  1H7S A;  1NHI A;  5F3K A;  2YE3 A;  4AWO A;  2VCI A;  2O1U A;  1KZN A;  4CWO A;  4YKR A;  3HZ5 A;  4XC0 A;  1AH6 A;  2XX4 A;  4URM A;  4YKW A;  4WUB A;  1Z59 A;  2BZ5 A;  2BU6 A;  1YET A;  3GIG A;  2IOQ A;  4AS9 A;  4LWE A;  2YKE A;  1UYM A;  2CGF A;  3C11 A;  2BRE A;  3R92 A;  2BU7 A;  2WI6 A;  1GKX A;  2H55 A; 
#chains in the Genus database with same CATH topology
 2YEF A;  2YKC A;  2YE8 A;  4DUH A;  4YKX A;  4E02 A;  4CWF A;  3PEJ A;  5IDM A;  4Q20 A;  3CGY A;  1I5C A;  1ZWH A;  1BXD A;  2IWS A;  3FT5 A;  1KIJ A;  4V25 A;  1BGQ A;  4XCJ A;  1B62 A;  3G7E A;  3QTF A;  4B6C A;  3TZ0 A;  2C1I A;  4K4O A;  4GT8 A;  3RLR A;  2WEQ A;  2YK2 A;  2YJW A;  4MPN A;  2FWY A;  1AM1 A;  2XCM A;  1AMW A;  1UYE A;  4CWT A;  5M4K A;  4E01 A;  1Z5B A;  3Q5J A;  3Q5L A;  5M4E A;  4URL A;  4NH8 A;  2BSM A;  1A4H A;  3RLQ A;  4CWS A;  2YE4 A;  3TZ4 A;  1BKN A;  2YEC A;  1I5B A;  3R4M A;  3CYG A;  3HZ1 A;  2JJC A;  2XK2 A;  1TBW A;  2XDU A;  2YGE A;  2PNR A;  2WI4 A;  4EGI A;  2IWU A;  4FMT A;  5BOC A;  3NMQ A;  4XCL A;  4PRV A;  2YI5 A;  4KSG A;  3R4P A;  1R62 A;  4LPB A;  3KE6 A;  3EHH A;  3D36 A;  5CPH A;  2ESA A;  1L0O A;  4ASF A;  2YKI A;  4DZY A;  4MOT A;  1Y8P A;  2BU5 A;  3C0E A;  3D2R A;  3VAD A;  3O2F A;  2QG0 A;  4JAV A;  4HY1 A;  2WI7 A;  1F51 A;  5D7R A;  1Z5C A;  3RKZ A;  2O1W A;  5FNF A;  3U2D A;  2GFD A;  3A0R A;  2HCH A;  1THN A;  1I59 A;  2E0A A;  1AJ6 A;  5D6Q A;  1YSZ A;  5M4P A;  1GJV A;  1ZW9 A;  2AKP A;  2CG9 A;  2WI5 A;  1U0Z A;  4XIR A;  2YKJ A;  4QPJ A;  4X9L A;  5M4M A;  1YT2 A;  4L8Z A;  3HYZ A;  4NH7 A;  4NH9 A;  4LWG A;  1S16 A;  2YK9 A;  4B7P A;  2BU2 A;  1GKZ A;  4WUC A;  4EEH A;  1YC4 A;  3IED A;  4I5S A;  3VHD A;  2IWX A;  3VHC A;  3A0X A;  3CRK A;  2BTZ A;  3R4O A;  2XDS A;  4R3M A;  3CRL A;  4O09 A;  4GFN A;  4R1F A;  4YKQ A;  1Y8O A;  4HY6 A;  1I5D A;  4L90 A;  2YE9 A;  3A0T A;  4O05 A;  3BMY A;  2BT0 A;  4EMV A;  3TTZ A;  1NHJ A;  1US7 A;  2BYI A;  5J71 A;  3K99 A;  4R3A A;  2YE5 A;  4CWQ A;  4XKK A;  3T2S A;  2CH4 A;  2Q8F A;  4HXZ A;  5D7D A;  2YKB A;  3O6O A;  1YC1 A;  2YEH A;  4YKY A;  4FCR A;  4XIP A;  1QZR A;  3G7B A;  5FNC A;  1Y8N A;  4L94 A;  4KSH A;  4I3H A;  4XDM A;  4CWN A;  2IOP A;  1NHH A;  5D6P A;  2YED A;  1Z5A A;  2YE7 A;  3H80 A;  4MPE A;  4BAE A;  4FCP A;  3T10 A;  3LNU A;  4L91 A;  3K97 A;  3MNR P;  1YT0 A;  2HKJ A;  3OPD A;  5J6A A;  4BQG A;  4MB9 A;  3CWV A;  1IXM A;  3T1K A;  2FTK A;  2XDX A;  2ZBK B;  3ZKB A;  4GEE A;  3GIF A;  4H7Q A;  3TZ5 A;  1OSF A;  2WI1 A;  1UYI A;  1EI1 A;  3B27 A;  4CWR A;  1UYC A;  2Q2E B;  4EFT A;  2ZKJ A;  3A0Z A;  4MPC A;  2FXS A;  2EXL A;  2BYH A;  3FT8 A;  4GQT A;  5D7C A;  4KP4 A;  5CTU A;  2ZDX A;  3ZKD A;  5FND A;  2QF6 A;  4BXI A;  2JKI A;  2XJG A;  4LWI A;  2YEA A;  1ID0 A;  1JM6 A;  2HG1 A;  4HYM A;  4CE1 A;  4MP7 A;  3EHF A;  1Y4S A;  4MP2 A;  3EHJ A;  1H7U A;  3TZ2 A;  4KQV A;  2CCT A;  1U2O A;  5IDJ A;  2XHX A;  4V26 A;  4CE3 A;  1YS3 A;  1MX0 A;  4E72 A;  4HZ0 A;  2WI2 A;  4FCQ A;  2VWC A;  4URO A;  2VW5 A;  3CGZ A;  4BIU A;  4CE2 A;  4KTN A;  3OMU A;  1TH8 A;  4P8O A;  4H81 A;  1TC0 A;  4FPP A;  1UYG A;  2Q8I A;  2XJX A;  3ZXO A;  2WER A;  4H85 A;  1PVG A;  1I5A A;  1TIL A;  4EGH A;  4CWP A;  3QDD A;  4YKT A;  4E00 A;  4GGL A;  4JAU A;  2XAB A;  2WI3 A;  4ASA A;  3A0Y A;  3B26 A;  1YC3 A;  1TID A;  4O07 A;  4HYP A;  4LWF A;  1B63 A;  3R4N A;  4U93 A;  3EKO A;  1YER A;  3OWD A;  2C1G A;  3D0B A;  4HXW A;  4PL9 A;  3B25 A;  4ZVI A;  2Q8G A;  3T0Z A;  2IOR A;  4AWP A;  2QFO A;  4U7N A;  4EM7 A;  2O1V A;  4WUD A;  4XKA A;  2XHR A;  3ZM7 A;  4BQJ A;  2C2A A;  1ZXM A;  3BM9 A;  3H4L A;  4L93 A;  4ZKI A;  2XHT A;  1EA6 A;  3SL2 A;  4ASG A;  3INX A;  4P7A A;  4EFU A;  3LPS A;  4BIZ A;  2H8M A;  2Q8H A;  1MU5 A;  2YJX A;  5BOD A;  4YKU A;  2CCU A;  4LP0 A;  5CF0 A;  3B28 A;  5CTY A;  4XIQ A;  4O04 A;  3PEH A;  3O0I A;  2XD6 A;  2YGF A;  1YES A;  2BRC A;  5L3J A;  1ZXN A;  4ASB A;  1UYF A;  3K60 A;  1UY9 A;  3RLP A;  4XD8 A;  1UY6 A;  4MBC A;  1AH8 A;  4W7T A;  2YE2 A;  2YEG A;  2K5B A;  2YI0 A;  4QPK A;  4AWQ A;  2YGA A;  2XJJ A;  2FWZ A;  2XDK A;  4GCZ A;  1UY7 A;  4EGK A;  2WEP A;  3ZXQ A;  3HHU A;  2QG2 A;  1UYL A;  3G75 A;  3EKR A;  3TUH A;  4JQL A;  4U7O A;  3U2K A;  2YI7 A;  1UYH A;  3GIE A;  4XIT A;  3HYY A;  5CTW A;  5FWK A;  4JAS A;  2YE6 A;  3U67 A;  3WHA A;  1S14 A;  2FYP A;  4PU9 A;  1I58 A;  3Q5K A;  1UY8 A;  4YKZ A;  3OW6 A;  4KFG A;  2YI6 A;  2YEB A;  2CCS A;  2BU8 A;  4XE2 A;  1YSR A;  2YEI A;  4XTJ A;  3HEK A;  3A0W A;  3FV5 A;  4HZ5 A;  2ZDY A;  5M4N A;  1UYD A;  2XX5 A;  3EHG A;  3GIG B;  3WQ9 A;  1B3Q A;  4O0B A;  5CTX A;  2XX2 A;  1UYK A;  3K98 A;  4XKO A;  5IN9 A;  3B24 A;  2YEE A;  4URN A;  3R91 A;  5M4H A;  4PRX A;  2YEJ A;  4LWH A;  3INW A;  2GQP A;  1QY8 A;  5GGZ A;  2VCJ A;  2UWD A;  3JZ3 A;  3LMM A;  1Y4U A;  1QYE A;  1BYQ A;  1TC6 A;  3DGE A;  1YT1 A;  2XDL A;  5F5R A;  3VHA A;  5C93 A;  3T0H A;  3OWB A;  1H7S A;  1NHI A;  5F3K A;  2YE3 A;  4AWO A;  2VCI A;  2O1U A;  1KZN A;  4CWO A;  4YKR A;  3HZ5 A;  4XC0 A;  1AH6 A;  2XX4 A;  4URM A;  4YKW A;  4WUB A;  1Z59 A;  2BZ5 A;  2BU6 A;  1YET A;  3GIG A;  2IOQ A;  4AS9 A;  4LWE A;  2YKE A;  3S5T A;  1UYM A;  2CGF A;  3C11 A;  2BRE A;  3R92 A;  2BU7 A;  2WI6 A;  2HHI A;  5JEN A;  1GKX A;  2H55 A; 
#chains in the Genus database with same CATH homology
 2YEF A;  2YKC A;  2YE8 A;  4DUH A;  4YKX A;  4E02 A;  4CWF A;  3PEJ A;  5IDM A;  4Q20 A;  3CGY A;  1I5C A;  1ZWH A;  1BXD A;  2IWS A;  3FT5 A;  1KIJ A;  4V25 A;  1BGQ A;  4XCJ A;  1B62 A;  3G7E A;  3QTF A;  4B6C A;  3TZ0 A;  4K4O A;  4GT8 A;  3RLR A;  2WEQ A;  2YK2 A;  2YJW A;  4MPN A;  2FWY A;  1AM1 A;  2XCM A;  1AMW A;  1UYE A;  4CWT A;  5M4K A;  4E01 A;  1Z5B A;  3Q5J A;  3Q5L A;  5M4E A;  4URL A;  4NH8 A;  2BSM A;  1A4H A;  3RLQ A;  4CWS A;  2YE4 A;  3TZ4 A;  1BKN A;  2YEC A;  1I5B A;  3R4M A;  3HZ1 A;  2JJC A;  2XK2 A;  1TBW A;  2XDU A;  2YGE A;  2PNR A;  2WI4 A;  4EGI A;  2IWU A;  4FMT A;  5BOC A;  3NMQ A;  4XCL A;  4PRV A;  2YI5 A;  4KSG A;  3R4P A;  1R62 A;  4LPB A;  3KE6 A;  3EHH A;  3D36 A;  5CPH A;  2ESA A;  1L0O A;  4ASF A;  2YKI A;  4DZY A;  4MOT A;  1Y8P A;  2BU5 A;  3C0E A;  3D2R A;  3VAD A;  3O2F A;  2QG0 A;  4JAV A;  4HY1 A;  2WI7 A;  5D7R A;  1Z5C A;  3RKZ A;  2O1W A;  5FNF A;  3U2D A;  2GFD A;  3A0R A;  2HCH A;  1THN A;  1I59 A;  2E0A A;  1AJ6 A;  5D6Q A;  1YSZ A;  5M4P A;  1GJV A;  1ZW9 A;  2AKP A;  2CG9 A;  2WI5 A;  1U0Z A;  4XIR A;  2YKJ A;  4QPJ A;  4X9L A;  5M4M A;  1YT2 A;  4L8Z A;  3HYZ A;  4NH7 A;  4NH9 A;  4LWG A;  1S16 A;  2YK9 A;  4B7P A;  2BU2 A;  1GKZ A;  4WUC A;  4EEH A;  1YC4 A;  3IED A;  4I5S A;  3VHD A;  2IWX A;  3VHC A;  3A0X A;  3CRK A;  2BTZ A;  3R4O A;  2XDS A;  4R3M A;  3CRL A;  4O09 A;  4GFN A;  4R1F A;  4YKQ A;  1Y8O A;  4HY6 A;  1I5D A;  4L90 A;  2YE9 A;  3A0T A;  4O05 A;  3BMY A;  2BT0 A;  4EMV A;  3TTZ A;  1NHJ A;  1US7 A;  2BYI A;  5J71 A;  3K99 A;  4R3A A;  2YE5 A;  4CWQ A;  4XKK A;  3T2S A;  2CH4 A;  2Q8F A;  4HXZ A;  5D7D A;  2YKB A;  3O6O A;  1YC1 A;  2YEH A;  4YKY A;  4FCR A;  4XIP A;  1QZR A;  3G7B A;  5FNC A;  1Y8N A;  4L94 A;  4KSH A;  4I3H A;  4XDM A;  4CWN A;  2IOP A;  1NHH A;  5D6P A;  2YED A;  1Z5A A;  2YE7 A;  3H80 A;  4MPE A;  4BAE A;  4FCP A;  3T10 A;  3LNU A;  4L91 A;  3K97 A;  3MNR P;  1YT0 A;  2HKJ A;  3OPD A;  5J6A A;  4BQG A;  4MB9 A;  3CWV A;  3T1K A;  2ZBK B;  2XDX A;  3ZKB A;  4GEE A;  3GIF A;  4H7Q A;  3TZ5 A;  1OSF A;  2WI1 A;  1UYI A;  1EI1 A;  3B27 A;  4CWR A;  1UYC A;  2Q2E B;  4EFT A;  2ZKJ A;  3A0Z A;  4MPC A;  2FXS A;  2EXL A;  2BYH A;  3FT8 A;  4GQT A;  5D7C A;  4KP4 A;  5CTU A;  2ZDX A;  3ZKD A;  5FND A;  2QF6 A;  4BXI A;  2JKI A;  2XJG A;  4LWI A;  2YEA A;  1ID0 A;  1JM6 A;  2HG1 A;  4HYM A;  4CE1 A;  4MP7 A;  3EHF A;  1Y4S A;  4MP2 A;  3EHJ A;  1H7U A;  3TZ2 A;  4KQV A;  2CCT A;  1U2O A;  5IDJ A;  2XHX A;  4V26 A;  4CE3 A;  1YS3 A;  1MX0 A;  4HZ0 A;  2WI2 A;  4FCQ A;  2VWC A;  4URO A;  2VW5 A;  3CGZ A;  4BIU A;  4CE2 A;  4KTN A;  3OMU A;  1TH8 A;  4P8O A;  4H81 A;  1TC0 A;  4FPP A;  1UYG A;  2Q8I A;  2XJX A;  3ZXO A;  2WER A;  4H85 A;  1PVG A;  1I5A A;  1TIL A;  4EGH A;  4CWP A;  3QDD A;  4YKT A;  4E00 A;  4GGL A;  4JAU A;  2XAB A;  2WI3 A;  4ASA A;  3A0Y A;  3B26 A;  1YC3 A;  1TID A;  4O07 A;  4HYP A;  4LWF A;  1B63 A;  3R4N A;  4U93 A;  3EKO A;  1YER A;  3OWD A;  3D0B A;  4HXW A;  4PL9 A;  3B25 A;  4ZVI A;  2Q8G A;  3T0Z A;  2IOR A;  4AWP A;  2QFO A;  4U7N A;  4EM7 A;  2O1V A;  4WUD A;  4XKA A;  2XHR A;  3ZM7 A;  4BQJ A;  2C2A A;  1ZXM A;  3BM9 A;  3H4L A;  4L93 A;  4ZKI A;  2XHT A;  1EA6 A;  3SL2 A;  4ASG A;  3INX A;  4P7A A;  4EFU A;  3LPS A;  4BIZ A;  2H8M A;  2Q8H A;  1MU5 A;  2YJX A;  5BOD A;  4YKU A;  2CCU A;  4LP0 A;  5CF0 A;  3B28 A;  5CTY A;  4XIQ A;  4O04 A;  3PEH A;  3O0I A;  2XD6 A;  2YGF A;  1YES A;  2BRC A;  5L3J A;  1ZXN A;  4ASB A;  1UYF A;  3K60 A;  1UY9 A;  3RLP A;  4XD8 A;  1UY6 A;  4MBC A;  1AH8 A;  4W7T A;  2YE2 A;  2YEG A;  2K5B A;  2YI0 A;  4QPK A;  4AWQ A;  2YGA A;  2XJJ A;  2FWZ A;  2XDK A;  4GCZ A;  1UY7 A;  4EGK A;  2WEP A;  3ZXQ A;  3HHU A;  2QG2 A;  1UYL A;  3G75 A;  3EKR A;  3TUH A;  4JQL A;  4U7O A;  3U2K A;  2YI7 A;  1UYH A;  3GIE A;  4XIT A;  3HYY A;  5CTW A;  5FWK A;  4JAS A;  2YE6 A;  3U67 A;  3WHA A;  1S14 A;  2FYP A;  4PU9 A;  1I58 A;  3Q5K A;  1UY8 A;  4YKZ A;  3OW6 A;  4KFG A;  2YI6 A;  2YEB A;  2CCS A;  2BU8 A;  4XE2 A;  1YSR A;  2YEI A;  4XTJ A;  3HEK A;  3A0W A;  3FV5 A;  4HZ5 A;  2ZDY A;  5M4N A;  1UYD A;  2XX5 A;  3EHG A;  3GIG B;  3WQ9 A;  1B3Q A;  4O0B A;  5CTX A;  2XX2 A;  1UYK A;  3K98 A;  4XKO A;  5IN9 A;  3B24 A;  2YEE A;  4URN A;  3R91 A;  5M4H A;  4PRX A;  2YEJ A;  4LWH A;  3INW A;  2GQP A;  1QY8 A;  5GGZ A;  2VCJ A;  2UWD A;  3JZ3 A;  1Y4U A;  1QYE A;  1BYQ A;  1TC6 A;  3DGE A;  1YT1 A;  2XDL A;  5F5R A;  3VHA A;  5C93 A;  3T0H A;  3OWB A;  1H7S A;  1NHI A;  5F3K A;  2YE3 A;  4AWO A;  2VCI A;  2O1U A;  1KZN A;  4CWO A;  4YKR A;  3HZ5 A;  4XC0 A;  1AH6 A;  2XX4 A;  4URM A;  4YKW A;  4WUB A;  1Z59 A;  2BZ5 A;  2BU6 A;  1YET A;  3GIG A;  2IOQ A;  4AS9 A;  4LWE A;  2YKE A;  1UYM A;  2CGF A;  3C11 A;  2BRE A;  3R92 A;  2BU7 A;  2WI6 A;  1GKX A;  2H55 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...