4URNA

Crystal structure of staph pare 24kda in complex with novobiocin
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
207
structure length
188
Chain Sequence
LEGLEAVRKRPGMYIGSTDKRGLHHLVYEIVDNSVDEVLNGYGNEIDVTINKDGSISIEDNGRGMPTGIHKSGKPTVEVIFTVLVGASVVNALSEWLEVEIHRDGNIYHQSFKNGGSPSSGLVKKGKTKKTGTKVTFKPDDTIFKASTSFNFDVLSERLQESAFLLKNLKITLNDLRSGKERQEHYHY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords DNA TOPOISOMERASE IV, B SUBUNIT
publication title Structures of Kibdelomycin Bound to Staphylococcus Aureus Gyrb and Pare Showed a Novel U-Shaped Binding Mode.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 54
structure length 188
sequence length 207
chains with identical sequence B, C
ec nomenclature ec 5.99.1.-:
pdb deposition date 2014-07-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 4urnA00
1UY9A 4FCQA 3O2FA 4MP7A 4L93A 4XIRA 4JASA 4YKXA 4WUDA 4FCRA 2YKEA 4PRVA 2VWCA 3G7EA 3T0ZA 1UYHA 2BU7A 2JJCA 5C93A 2YKIA 4ASFA 1UY6A 5IN9A 4CWTA 1AH6A 1R62A 3Q5LA 3Q5KA 4BXIA 4GQTA 5M4KA 2GQPA 2FWYA 4W7TA 3RLRA 4CE3A 2YGFA 2VCIA 5IDMA 1Z5AA 3A0TA 3K98A 4L8ZA 4U93A 2IORA 4LP0A 1QY8A 2IOPA 3A0WA 2XJGA 3QTFA 4XITA 4V25A 4U7NA 1YC3A 2WI6A 4LPBA 4XCLA 5FNFA 2YI7A 1I5AA 1UYKA 2BU2A 2YE9A 2O1UA 1UYGA 1YSRA 3O6OA 3A0YA 2BREA 4XD8A 1UYEA 1AM1A 5D6PA 2YEHA 1NHHA 2YI6A 3EHJA 5FWKA 3OWDA 4EGKA 5IDJA 3ZKBA 4ASGA 2CCSA 2XDSA 3B25A 5CF0A 1Z5CA 3U67A 3EKRA 4L90A 1S14A 2CG9A 5BODA 4EGIA 2YEFA 4L94A 2YGAA 4H85A 3C0EA 1GKZA 1GKXA 3A0RA 4CE1A 3G7BA 2FYPA 3OW6A 4BQJA 2XDUA 4EFUA 3ZXQA 4MPCA 3RLQA 4O0BA 1ZWHA 2YJXA 1TC0A 2YEGA 4L91A 1I5BA 3WHAA 1BYQA 4EM7A 4MP2A 3FT5A 1Y8PA 2EXLA 3KE6A 2H55A 1ZXNA 2QG2A 3INXA 3OMUA 4B7PA 4R3MA 1UYFA 2WEPA 2YECA 4NH7A 2YEAA 3EHGA 3TTZA 3GIEA 2GFDA 2Q8FA 5F3KA 1OSFA 2YE3A 3K60A 4GGLA 3U2DA 4AWOA 4YKTA 3QDDA 3R4PA 2YJWA 3B28A 1NHJA 3D0BA 2BU6A 1UYCA 2WI5A 4GFNA 4BQGA 4YKYA 2XDXA 2YE6A 1Y4UA 3DGEA 4AWQA 4I3HA 3CGYA 4LWIA 1YESA 1QZRA 1TIDA 4MPEA 3T10A 3BMYA 1Y8NA 3B26A 3R92A 1YSZA 2XX4A 2WI4A 5J6AA 2UWDA 4KSGA 4V26A 3CGZA 4CWQA 3TZ5A 3A0XA 4PL9A 1L0OA 4Q20A 4GT8A 2FWZA 4AS9A 3HHUA 4URLA 2WI7A 4JAUA 2IWSA 1BGQA 1MU5A 2XJJA 3GIGB 4JAVA 4E00A 2HKJA 3FV5A 4DUHA 3LPSA 2YE5A 1UYMA 4LWHA 4YKZA 4BIUA 4KFGA 2YI5A 1B62A 4KTNA 2YEDA 4YKQA 1NHIA 2VCJA 1QYEA 4XTJA 5GGZA 2XHRA 4FMTA 1YT2A 2CH4A 1AH8A 1PVGA 1TBWA 3JZ3A 4QPJA 1AJ6A 3ZKDA 3OWBA 2FXSA 3NMQA 1Y8OA 2BZ5A 3RKZA 3EKOA 2YE4A 4CWSA 4PU9A 4URMA 5M4NA 3GIFA 4DZYA 2WI3A 4I5SA 2YK2A 2ZDYA 2XHXA 4O05A 4KQVA 4MBCA 2WI1A 2XJXA 1UYLA 4HXZA 2K5BA 3T1KA 2HG1A 4MOTA 3INWA 4YKWA 1ZXMA 2Q8IA 4EFTA 4MPNA 2XCMA 3GIGA 5CTYA 1Y4SA 3IEDA 4O09A 1B3QA 2H8MA 3B24A 1EA6A 1YC1A 2BU5A 5CTWA 4CWRA 1BXDA 1BKNA 4XKAA 4BIZA 1JM6A 3PEJA 3PEHA 2VW5A 4NH9A 5CPHA 3VHDA 4HYMA 1YC4A 3CRLA 4K4OA 3HEKA 4B6CA 4XIPA 4LWGA 2Q2EB 5J71A 3VHCA 2XDLA 3Q5JA 5D7RA 1S16A 4PRXA 4KP4A 1U0ZA 2E0AA 5FNDA 5L3JA 3R4MA 2Q8HA 2XX2A 1B63A 3MNRP 4HZ5A 3WQ9A 3TZ2A 2ESAA 1KIJA 2YEEA 3G75A 2YE7A 2QG0A 4FPPA 3ZM7A 4R1FA 4GCZA 3SL2A 2YKBA 2YE2A 4JQLA 4R3AA 2ZKJA 5CTUA 4XIQA 5FNCA 1YETA 3C11A 5BOCA 4O04A 3HZ5A 1TH8A 1TILA 4ASBA 2BTZA 5D6QA 2WEQA 5M4HA 5M4EA 2YGEA 2IOQA 4XCJA 4BAEA 4P8OA 1EI1A 1US7A 3B27A 2YE8A 3LNUA 3D2RA 2BT0A 5F5RA 1H7UA 2XK2A 4E02A 5M4PA 3O0IA 2BYHA 5D7DA 5CTXA 2ZBKB 2YEIA 2YI0A 4YKUA 4QPKA 2YK9A 1I59A 4HY6A 2YKCA 2O1VA 3HYZA 3OPDA 1A4HA 1I5DA 4MB9A 2ZDXA 4YKRA 3A0ZA 2BYIA 4E01A 4CWPA 2WERA 4X9LA 2BSMA 2IWXA 4EGHA 4EMVA 1ID0A 2CCUA 3VHAA 3EHHA 1I5CA 4HZ0A 4CE2A 2HCHA 3HZ1A 2CGFA 1Z5BA 3ZXOA 4NH8A 3T2SA 2IWUA 1U2OA 3TZ4A 1MX0A 4LWFA 2YKJA 4AWPA 4URNA 3D36A 3TUHA 1UY8A 3R4NA 2Q8GA 4HY1A 3K99A 2WI2A 1GJVA 4WUBA 4O07A 4WUCA 4XE2A 4XC0A 3VADA 1YERA 1I58A 1YS3A 3HYYA 5M4MA 2QFOA 4EEHA 2XD6A 2XDKA 4XKOA 2C2AA 3RLPA 2BU8A 1THNA 4HYPA 4CWOA 3T0HA 3EHFA 3U2KA 4P7AA 4ZVIA 2YEBA 4XDMA 2XABA 1KZNA 2AKPA 2CCTA 2JKIA 2QF6A 1TC6A 3CRKA 4GEEA 4LWEA 2XX5A 4HXWA 3FT8A 4UROA 1UYDA 2PNRA 2YEJA 4ASAA 1H7SA 3R91A 2BRCA 3H80A 4FCPA 4U7OA 4XKKA 3R4OA 4H7QA 1UY7A 4ZKIA 4CWFA 1YT0A 3K97A 1UYIA 3H4LA 4H81A 3CWVA 3TZ0A 2O1WA 1Z59A 2XHTA 4CWNA 1YT1A 1ZW9A 5D7CA 4KSHA 3BM9A 1AMWA
chains in the Genus database with same CATH superfamily
1UY9A 4FCQA 3O2FA 4MP7A 4L93A 4XIRA 4JASA 4YKXA 4WUDA 4FCRA 2YKEA 4PRVA 2VWCA 3G7EA 3T0ZA 1UYHA 2BU7A 2JJCA 5C93A 2YKIA 4ASFA 1UY6A 5IN9A 4CWTA 1AH6A 1R62A 3Q5LA 3Q5KA 4BXIA 4GQTA 5M4KA 2GQPA 2FWYA 4W7TA 3RLRA 4CE3A 2YGFA 2VCIA 5IDMA 1Z5AA 3A0TA 3K98A 4L8ZA 4U93A 2IORA 4LP0A 1QY8A 2C1IA 2IOPA 3A0WA 2XJGA 3QTFA 4XITA 4V25A 5JENA 4U7NA 1YC3A 2WI6A 4LPBA 4XCLA 5FNFA 2YI7A 1I5AA 1UYKA 2BU2A 2YE9A 2FTKA 2O1UA 1UYGA 1YSRA 3O6OA 3A0YA 2BREA 4XD8A 1UYEA 1AM1A 5D6PA 2YEHA 1NHHA 2YI6A 3EHJA 5FWKA 3OWDA 4EGKA 5IDJA 3ZKBA 4ASGA 2CCSA 2XDSA 3B25A 5CF0A 1Z5CA 3U67A 3EKRA 4L90A 1S14A 2CG9A 5BODA 4EGIA 2YEFA 4L94A 2YGAA 4H85A 3C0EA 1GKZA 1GKXA 3A0RA 4CE1A 3G7BA 2FYPA 3OW6A 4BQJA 2XDUA 4EFUA 3ZXQA 1F51A 4MPCA 3RLQA 4O0BA 1ZWHA 2YJXA 1TC0A 2YEGA 4L91A 1I5BA 3WHAA 1BYQA 4EM7A 4MP2A 3FT5A 1Y8PA 2EXLA 3KE6A 2H55A 1ZXNA 2QG2A 3INXA 3OMUA 4B7PA 4R3MA 1UYFA 2WEPA 2YECA 4NH7A 2YEAA 3EHGA 3TTZA 3GIEA 2GFDA 2Q8FA 5F3KA 1OSFA 2YE3A 3K60A 4GGLA 3U2DA 4AWOA 4YKTA 3QDDA 3R4PA 2YJWA 3B28A 1NHJA 3D0BA 2BU6A 1UYCA 2WI5A 4GFNA 4BQGA 4YKYA 2XDXA 2YE6A 1Y4UA 3DGEA 4AWQA 4E72A 4I3HA 3CGYA 4LWIA 1YESA 1QZRA 1TIDA 4MPEA 3T10A 3BMYA 1Y8NA 3B26A 3R92A 1YSZA 2XX4A 2WI4A 5J6AA 2UWDA 4KSGA 4V26A 3CGZA 4CWQA 3TZ5A 3A0XA 4PL9A 1L0OA 4Q20A 4GT8A 2FWZA 4AS9A 3HHUA 4URLA 2WI7A 4JAUA 2IWSA 1BGQA 1MU5A 2XJJA 3GIGB 4JAVA 4E00A 2HKJA 3FV5A 4DUHA 3LPSA 2YE5A 1UYMA 4LWHA 4YKZA 4BIUA 4KFGA 2YI5A 1B62A 4KTNA 2YEDA 4YKQA 1NHIA 2VCJA 1QYEA 4XTJA 5GGZA 2XHRA 4FMTA 1YT2A 2CH4A 1AH8A 1PVGA 1TBWA 3JZ3A 4QPJA 1AJ6A 3ZKDA 3OWBA 2FXSA 3NMQA 1Y8OA 2BZ5A 3RKZA 3EKOA 2YE4A 4CWSA 3CYGA 4PU9A 4URMA 5M4NA 3GIFA 4DZYA 2WI3A 4I5SA 2YK2A 2ZDYA 2XHXA 4O05A 4KQVA 4MBCA 2WI1A 2XJXA 1UYLA 4HXZA 2K5BA 3T1KA 2HG1A 4MOTA 3INWA 4YKWA 1ZXMA 2Q8IA 4EFTA 4MPNA 2XCMA 3GIGA 5CTYA 1Y4SA 1IXMA 3IEDA 4O09A 1B3QA 2H8MA 3B24A 1EA6A 1YC1A 2BU5A 5CTWA 4CWRA 1BXDA 1BKNA 4XKAA 4BIZA 1JM6A 3PEJA 3PEHA 2VW5A 4NH9A 5CPHA 3VHDA 4HYMA 1YC4A 3CRLA 4K4OA 3HEKA 4B6CA 4XIPA 4LWGA 2Q2EB 5J71A 3VHCA 2XDLA 3Q5JA 5D7RA 1S16A 4PRXA 4KP4A 1U0ZA 2E0AA 5FNDA 5L3JA 3R4MA 2Q8HA 2XX2A 1B63A 3MNRP 4HZ5A 3WQ9A 3TZ2A 2ESAA 1KIJA 2YEEA 3G75A 2YE7A 2QG0A 4FPPA 3ZM7A 4R1FA 4GCZA 3SL2A 2YKBA 2YE2A 4JQLA 4R3AA 2ZKJA 5CTUA 4XIQA 5FNCA 1YETA 3C11A 5BOCA 4O04A 3HZ5A 1TH8A 1TILA 4ASBA 2BTZA 5D6QA 2WEQA 5M4HA 5M4EA 2YGEA 2IOQA 4XCJA 4BAEA 4P8OA 1EI1A 1US7A 3B27A 2YE8A 3LNUA 3D2RA 2BT0A 5F5RA 1H7UA 2XK2A 4E02A 5M4PA 3O0IA 2BYHA 5D7DA 5CTXA 2ZBKB 2YEIA 2YI0A 4YKUA 4QPKA 2YK9A 1I59A 4HY6A 2YKCA 3S5TA 2O1VA 3HYZA 3OPDA 1A4HA 1I5DA 4MB9A 2ZDXA 4YKRA 3A0ZA 2BYIA 4E01A 4CWPA 2WERA 4X9LA 2BSMA 2IWXA 4EGHA 4EMVA 1ID0A 2CCUA 3VHAA 3EHHA 1I5CA 4HZ0A 4CE2A 2HCHA 3HZ1A 2CGFA 1Z5BA 3ZXOA 4NH8A 3T2SA 2IWUA 1U2OA 3TZ4A 1MX0A 4LWFA 2YKJA 4AWPA 4URNA 3D36A 3TUHA 1UY8A 3R4NA 2Q8GA 4HY1A 3K99A 2WI2A 1GJVA 4WUBA 4O07A 4WUCA 4XE2A 4XC0A 3VADA 1YERA 1I58A 1YS3A 3HYYA 5M4MA 2QFOA 4EEHA 2XD6A 2XDKA 4XKOA 2C2AA 3RLPA 2BU8A 1THNA 4HYPA 4CWOA 3T0HA 3EHFA 3U2KA 4P7AA 2HHIA 4ZVIA 2YEBA 4XDMA 2XABA 1KZNA 2AKPA 2CCTA 2JKIA 2QF6A 1TC6A 3CRKA 4GEEA 4LWEA 2XX5A 4HXWA 3FT8A 4UROA 1UYDA 2PNRA 2YEJA 4ASAA 1H7SA 3R91A 2BRCA 3H80A 2C1GA 4FCPA 4U7OA 4XKKA 3R4OA 4H7QA 1UY7A 4ZKIA 4CWFA 1YT0A 3K97A 1UYIA 3LMMA 3H4LA 4H81A 3CWVA 3TZ0A 2O1WA 1Z59A 2XHTA 4CWNA 1YT1A 1ZW9A 5D7CA 4KSHA 3BM9A 1AMWA
chains in the Genus database with same CATH topology
1UY9A 4FCQA 3O2FA 4MP7A 4L93A 4XIRA 4JASA 4YKXA 4WUDA 4FCRA 2YKEA 4PRVA 2VWCA 3G7EA 3T0ZA 1UYHA 2BU7A 2JJCA 5C93A 2YKIA 4ASFA 1UY6A 5IN9A 4CWTA 1AH6A 1R62A 3Q5LA 3Q5KA 4BXIA 4GQTA 5M4KA 2GQPA 2FWYA 4W7TA 3RLRA 4CE3A 2YGFA 2VCIA 5IDMA 1Z5AA 3A0TA 3K98A 4L8ZA 4U93A 2IORA 4LP0A 1QY8A 2IOPA 3A0WA 2XJGA 3QTFA 4XITA 4V25A 4U7NA 1YC3A 2WI6A 4LPBA 4XCLA 5FNFA 2YI7A 1I5AA 1UYKA 2BU2A 2YE9A 2O1UA 1UYGA 1YSRA 3O6OA 3A0YA 2BREA 4XD8A 1UYEA 1AM1A 5D6PA 2YEHA 1NHHA 2YI6A 3EHJA 5FWKA 3OWDA 4EGKA 5IDJA 3ZKBA 4ASGA 2CCSA 2XDSA 3B25A 5CF0A 1Z5CA 3U67A 3EKRA 4L90A 1S14A 2CG9A 5BODA 4EGIA 2YEFA 4L94A 2YGAA 4H85A 3C0EA 1GKZA 1GKXA 3A0RA 4CE1A 3G7BA 2FYPA 3OW6A 4BQJA 2XDUA 4EFUA 3ZXQA 4MPCA 3RLQA 4O0BA 1ZWHA 2YJXA 1TC0A 2YEGA 4L91A 1I5BA 3WHAA 1BYQA 4EM7A 4MP2A 3FT5A 1Y8PA 2EXLA 3KE6A 2H55A 1ZXNA 2QG2A 3INXA 3OMUA 4B7PA 4R3MA 1UYFA 2WEPA 2YECA 4NH7A 2YEAA 3EHGA 3TTZA 3GIEA 2GFDA 2Q8FA 5F3KA 1OSFA 2YE3A 3K60A 4GGLA 3U2DA 4AWOA 4YKTA 3QDDA 3R4PA 2YJWA 3B28A 1NHJA 3D0BA 2BU6A 1UYCA 2WI5A 4GFNA 4BQGA 4YKYA 2XDXA 2YE6A 1Y4UA 3DGEA 4AWQA 4I3HA 3CGYA 4LWIA 1YESA 1QZRA 1TIDA 4MPEA 3T10A 3BMYA 1Y8NA 3B26A 3R92A 1YSZA 2XX4A 2WI4A 5J6AA 2UWDA 4KSGA 4V26A 3CGZA 4CWQA 3TZ5A 3A0XA 4PL9A 1L0OA 4Q20A 4GT8A 2FWZA 4AS9A 3HHUA 4URLA 2WI7A 4JAUA 2IWSA 1BGQA 1MU5A 2XJJA 3GIGB 4JAVA 4E00A 2HKJA 3FV5A 4DUHA 3LPSA 2YE5A 1UYMA 4LWHA 4YKZA 4BIUA 4KFGA 2YI5A 1B62A 4KTNA 2YEDA 4YKQA 1NHIA 2VCJA 1QYEA 4XTJA 5GGZA 2XHRA 4FMTA 1YT2A 2CH4A 1AH8A 1PVGA 1TBWA 3JZ3A 4QPJA 1AJ6A 3ZKDA 3OWBA 2FXSA 3NMQA 1Y8OA 2BZ5A 3RKZA 3EKOA 2YE4A 4CWSA 4PU9A 4URMA 5M4NA 3GIFA 4DZYA 2WI3A 4I5SA 2YK2A 2ZDYA 2XHXA 4O05A 4KQVA 4MBCA 2WI1A 2XJXA 1UYLA 4HXZA 2K5BA 3T1KA 2HG1A 4MOTA 3INWA 4YKWA 1ZXMA 2Q8IA 4EFTA 4MPNA 2XCMA 3GIGA 5CTYA 1Y4SA 3IEDA 4O09A 1B3QA 2H8MA 3B24A 1EA6A 1YC1A 2BU5A 5CTWA 4CWRA 1BXDA 1BKNA 4XKAA 4BIZA 1JM6A 3PEJA 3PEHA 2VW5A 4NH9A 5CPHA 3VHDA 4HYMA 1YC4A 3CRLA 4K4OA 3HEKA 4B6CA 4XIPA 4LWGA 2Q2EB 5J71A 3VHCA 2XDLA 3Q5JA 5D7RA 1S16A 4PRXA 4KP4A 1U0ZA 2E0AA 5FNDA 5L3JA 3R4MA 2Q8HA 2XX2A 1B63A 3MNRP 4HZ5A 3WQ9A 3TZ2A 2ESAA 1KIJA 2YEEA 3G75A 2YE7A 2QG0A 4FPPA 3ZM7A 4R1FA 4GCZA 3SL2A 2YKBA 2YE2A 4JQLA 4R3AA 2ZKJA 5CTUA 4XIQA 5FNCA 1YETA 3C11A 5BOCA 4O04A 3HZ5A 1TH8A 1TILA 4ASBA 2BTZA 5D6QA 2WEQA 5M4HA 5M4EA 2YGEA 2IOQA 4XCJA 4BAEA 4P8OA 1EI1A 1US7A 3B27A 2YE8A 3LNUA 3D2RA 2BT0A 5F5RA 1H7UA 2XK2A 4E02A 5M4PA 3O0IA 2BYHA 5D7DA 5CTXA 2ZBKB 2YEIA 2YI0A 4YKUA 4QPKA 2YK9A 1I59A 4HY6A 2YKCA 2O1VA 3HYZA 3OPDA 1A4HA 1I5DA 4MB9A 2ZDXA 4YKRA 3A0ZA 2BYIA 4E01A 4CWPA 2WERA 4X9LA 2BSMA 2IWXA 4EGHA 4EMVA 1ID0A 2CCUA 3VHAA 3EHHA 1I5CA 4HZ0A 4CE2A 2HCHA 3HZ1A 2CGFA 1Z5BA 3ZXOA 4NH8A 3T2SA 2IWUA 1U2OA 3TZ4A 1MX0A 4LWFA 2YKJA 4AWPA 4URNA 3D36A 3TUHA 1UY8A 3R4NA 2Q8GA 4HY1A 3K99A 2WI2A 1GJVA 4WUBA 4O07A 4WUCA 4XE2A 4XC0A 3VADA 1YERA 1I58A 1YS3A 3HYYA 5M4MA 2QFOA 4EEHA 2XD6A 2XDKA 4XKOA 2C2AA 3RLPA 2BU8A 1THNA 4HYPA 4CWOA 3T0HA 3EHFA 3U2KA 4P7AA 4ZVIA 2YEBA 4XDMA 2XABA 1KZNA 2AKPA 2CCTA 2JKIA 2QF6A 1TC6A 3CRKA 4GEEA 4LWEA 2XX5A 4HXWA 3FT8A 4UROA 1UYDA 2PNRA 2YEJA 4ASAA 1H7SA 3R91A 2BRCA 3H80A 4FCPA 4U7OA 4XKKA 3R4OA 4H7QA 1UY7A 4ZKIA 4CWFA 1YT0A 3K97A 1UYIA 3H4LA 4H81A 3CWVA 3TZ0A 2O1WA 1Z59A 2XHTA 4CWNA 1YT1A 1ZW9A 5D7CA 4KSHA 3BM9A 1AMWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UY9 A;  4FCQ A;  3O2F A;  4MP7 A;  4L93 A;  4XIR A;  4JAS A;  4YKX A;  4WUD A;  4FCR A;  2YKE A;  4PRV A;  2VWC A;  3G7E A;  3T0Z A;  1UYH A;  2BU7 A;  2JJC A;  5C93 A;  2YKI A;  4ASF A;  1UY6 A;  5IN9 A;  4CWT A;  1AH6 A;  1R62 A;  3Q5L A;  3Q5K A;  4BXI A;  4GQT A;  5M4K A;  2GQP A;  2FWY A;  4W7T A;  3RLR A;  4CE3 A;  2YGF A;  2VCI A;  5IDM A;  1Z5A A;  3A0T A;  3K98 A;  4L8Z A;  4U93 A;  2IOR A;  4LP0 A;  1QY8 A;  2IOP A;  3A0W A;  2XJG A;  3QTF A;  4XIT A;  4V25 A;  4U7N A;  1YC3 A;  2WI6 A;  4LPB A;  4XCL A;  5FNF A;  2YI7 A;  1I5A A;  1UYK A;  2BU2 A;  2YE9 A;  2O1U A;  1UYG A;  1YSR A;  3O6O A;  3A0Y A;  2BRE A;  4XD8 A;  1UYE A;  1AM1 A;  5D6P A;  2YEH A;  1NHH A;  2YI6 A;  3EHJ A;  5FWK A;  3OWD A;  4EGK A;  5IDJ A;  3ZKB A;  4ASG A;  2CCS A;  2XDS A;  3B25 A;  5CF0 A;  1Z5C A;  3U67 A;  3EKR A;  4L90 A;  1S14 A;  2CG9 A;  5BOD A;  4EGI A;  2YEF A;  4L94 A;  2YGA A;  4H85 A;  3C0E A;  1GKZ A;  1GKX A;  3A0R A;  4CE1 A;  3G7B A;  2FYP A;  3OW6 A;  4BQJ A;  2XDU A;  4EFU A;  3ZXQ A;  4MPC A;  3RLQ A;  4O0B A;  1ZWH A;  2YJX A;  1TC0 A;  2YEG A;  4L91 A;  1I5B A;  3WHA A;  1BYQ A;  4EM7 A;  4MP2 A;  3FT5 A;  1Y8P A;  2EXL A;  3KE6 A;  2H55 A;  1ZXN A;  2QG2 A;  3INX A;  3OMU A;  4B7P A;  4R3M A;  1UYF A;  2WEP A;  2YEC A;  4NH7 A;  2YEA A;  3EHG A;  3TTZ A;  3GIE A;  2GFD A;  2Q8F A;  5F3K A;  1OSF A;  2YE3 A;  3K60 A;  4GGL A;  3U2D A;  4AWO A;  4YKT A;  3QDD A;  3R4P A;  2YJW A;  3B28 A;  1NHJ A;  3D0B A;  2BU6 A;  1UYC A;  2WI5 A;  4GFN A;  4BQG A;  4YKY A;  2XDX A;  2YE6 A;  1Y4U A;  3DGE A;  4AWQ A;  4I3H A;  3CGY A;  4LWI A;  1YES A;  1QZR A;  1TID A;  4MPE A;  3T10 A;  3BMY A;  1Y8N A;  3B26 A;  3R92 A;  1YSZ A;  2XX4 A;  2WI4 A;  5J6A A;  2UWD A;  4KSG A;  4V26 A;  3CGZ A;  4CWQ A;  3TZ5 A;  3A0X A;  4PL9 A;  1L0O A;  4Q20 A;  4GT8 A;  2FWZ A;  4AS9 A;  3HHU A;  4URL A;  2WI7 A;  4JAU A;  2IWS A;  1BGQ A;  1MU5 A;  2XJJ A;  3GIG B;  4JAV A;  4E00 A;  2HKJ A;  3FV5 A;  4DUH A;  3LPS A;  2YE5 A;  1UYM A;  4LWH A;  4YKZ A;  4BIU A;  4KFG A;  2YI5 A;  1B62 A;  4KTN A;  2YED A;  4YKQ A;  1NHI A;  2VCJ A;  1QYE A;  4XTJ A;  5GGZ A;  2XHR A;  4FMT A;  1YT2 A;  2CH4 A;  1AH8 A;  1PVG A;  1TBW A;  3JZ3 A;  4QPJ A;  1AJ6 A;  3ZKD A;  3OWB A;  2FXS A;  3NMQ A;  1Y8O A;  2BZ5 A;  3RKZ A;  3EKO A;  2YE4 A;  4CWS A;  4PU9 A;  4URM A;  5M4N A;  3GIF A;  4DZY A;  2WI3 A;  4I5S A;  2YK2 A;  2ZDY A;  2XHX A;  4O05 A;  4KQV A;  4MBC A;  2WI1 A;  2XJX A;  1UYL A;  4HXZ A;  2K5B A;  3T1K A;  2HG1 A;  4MOT A;  3INW A;  4YKW A;  1ZXM A;  2Q8I A;  4EFT A;  4MPN A;  2XCM A;  3GIG A;  5CTY A;  1Y4S A;  3IED A;  4O09 A;  1B3Q A;  2H8M A;  3B24 A;  1EA6 A;  1YC1 A;  2BU5 A;  5CTW A;  4CWR A;  1BXD A;  1BKN A;  4XKA A;  4BIZ A;  1JM6 A;  3PEJ A;  3PEH A;  2VW5 A;  4NH9 A;  5CPH A;  3VHD A;  4HYM A;  1YC4 A;  3CRL A;  4K4O A;  3HEK A;  4B6C A;  4XIP A;  4LWG A;  2Q2E B;  5J71 A;  3VHC A;  2XDL A;  3Q5J A;  5D7R A;  1S16 A;  4PRX A;  4KP4 A;  1U0Z A;  2E0A A;  5FND A;  5L3J A;  3R4M A;  2Q8H A;  2XX2 A;  1B63 A;  3MNR P;  4HZ5 A;  3WQ9 A;  3TZ2 A;  2ESA A;  1KIJ A;  2YEE A;  3G75 A;  2YE7 A;  2QG0 A;  4FPP A;  3ZM7 A;  4R1F A;  4GCZ A;  3SL2 A;  2YKB A;  2YE2 A;  4JQL A;  4R3A A;  2ZKJ A;  5CTU A;  4XIQ A;  5FNC A;  1YET A;  3C11 A;  5BOC A;  4O04 A;  3HZ5 A;  1TH8 A;  1TIL A;  4ASB A;  2BTZ A;  5D6Q A;  2WEQ A;  5M4H A;  5M4E A;  2YGE A;  2IOQ A;  4XCJ A;  4BAE A;  4P8O A;  1EI1 A;  1US7 A;  3B27 A;  2YE8 A;  3LNU A;  3D2R A;  2BT0 A;  5F5R A;  1H7U A;  2XK2 A;  4E02 A;  5M4P A;  3O0I A;  2BYH A;  5D7D A;  5CTX A;  2ZBK B;  2YEI A;  2YI0 A;  4YKU A;  4QPK A;  2YK9 A;  1I59 A;  4HY6 A;  2YKC A;  2O1V A;  3HYZ A;  3OPD A;  1A4H A;  1I5D A;  4MB9 A;  2ZDX A;  4YKR A;  3A0Z A;  2BYI A;  4E01 A;  4CWP A;  2WER A;  4X9L A;  2BSM A;  2IWX A;  4EGH A;  4EMV A;  1ID0 A;  2CCU A;  3VHA A;  3EHH A;  1I5C A;  4HZ0 A;  4CE2 A;  2HCH A;  3HZ1 A;  2CGF A;  1Z5B A;  3ZXO A;  4NH8 A;  3T2S A;  2IWU A;  1U2O A;  3TZ4 A;  1MX0 A;  4LWF A;  2YKJ A;  4AWP A;  4URN A;  3D36 A;  3TUH A;  1UY8 A;  3R4N A;  2Q8G A;  4HY1 A;  3K99 A;  2WI2 A;  1GJV A;  4WUB A;  4O07 A;  4WUC A;  4XE2 A;  4XC0 A;  3VAD A;  1YER A;  1I58 A;  1YS3 A;  3HYY A;  5M4M A;  2QFO A;  4EEH A;  2XD6 A;  2XDK A;  4XKO A;  2C2A A;  3RLP A;  2BU8 A;  1THN A;  4HYP A;  4CWO A;  3T0H A;  3EHF A;  3U2K A;  4P7A A;  4ZVI A;  2YEB A;  4XDM A;  2XAB A;  1KZN A;  2AKP A;  2CCT A;  2JKI A;  2QF6 A;  1TC6 A;  3CRK A;  4GEE A;  4LWE A;  2XX5 A;  4HXW A;  3FT8 A;  4URO A;  1UYD A;  2PNR A;  2YEJ A;  4ASA A;  1H7S A;  3R91 A;  2BRC A;  3H80 A;  4FCP A;  4U7O A;  4XKK A;  3R4O A;  4H7Q A;  1UY7 A;  4ZKI A;  4CWF A;  1YT0 A;  3K97 A;  1UYI A;  3H4L A;  4H81 A;  3CWV A;  3TZ0 A;  2O1W A;  1Z59 A;  2XHT A;  4CWN A;  1YT1 A;  1ZW9 A;  5D7C A;  4KSH A;  3BM9 A;  1AMW A; 
#chains in the Genus database with same CATH topology
 1UY9 A;  4FCQ A;  3O2F A;  4MP7 A;  4L93 A;  4XIR A;  4JAS A;  4YKX A;  4WUD A;  4FCR A;  2YKE A;  4PRV A;  2VWC A;  3G7E A;  3T0Z A;  1UYH A;  2BU7 A;  2JJC A;  5C93 A;  2YKI A;  4ASF A;  1UY6 A;  5IN9 A;  4CWT A;  1AH6 A;  1R62 A;  3Q5L A;  3Q5K A;  4BXI A;  4GQT A;  5M4K A;  2GQP A;  2FWY A;  4W7T A;  3RLR A;  4CE3 A;  2YGF A;  2VCI A;  5IDM A;  1Z5A A;  3A0T A;  3K98 A;  4L8Z A;  4U93 A;  2IOR A;  4LP0 A;  1QY8 A;  2C1I A;  2IOP A;  3A0W A;  2XJG A;  3QTF A;  4XIT A;  4V25 A;  5JEN A;  4U7N A;  1YC3 A;  2WI6 A;  4LPB A;  4XCL A;  5FNF A;  2YI7 A;  1I5A A;  1UYK A;  2BU2 A;  2YE9 A;  2FTK A;  2O1U A;  1UYG A;  1YSR A;  3O6O A;  3A0Y A;  2BRE A;  4XD8 A;  1UYE A;  1AM1 A;  5D6P A;  2YEH A;  1NHH A;  2YI6 A;  3EHJ A;  5FWK A;  3OWD A;  4EGK A;  5IDJ A;  3ZKB A;  4ASG A;  2CCS A;  2XDS A;  3B25 A;  5CF0 A;  1Z5C A;  3U67 A;  3EKR A;  4L90 A;  1S14 A;  2CG9 A;  5BOD A;  4EGI A;  2YEF A;  4L94 A;  2YGA A;  4H85 A;  3C0E A;  1GKZ A;  1GKX A;  3A0R A;  4CE1 A;  3G7B A;  2FYP A;  3OW6 A;  4BQJ A;  2XDU A;  4EFU A;  3ZXQ A;  1F51 A;  4MPC A;  3RLQ A;  4O0B A;  1ZWH A;  2YJX A;  1TC0 A;  2YEG A;  4L91 A;  1I5B A;  3WHA A;  1BYQ A;  4EM7 A;  4MP2 A;  3FT5 A;  1Y8P A;  2EXL A;  3KE6 A;  2H55 A;  1ZXN A;  2QG2 A;  3INX A;  3OMU A;  4B7P A;  4R3M A;  1UYF A;  2WEP A;  2YEC A;  4NH7 A;  2YEA A;  3EHG A;  3TTZ A;  3GIE A;  2GFD A;  2Q8F A;  5F3K A;  1OSF A;  2YE3 A;  3K60 A;  4GGL A;  3U2D A;  4AWO A;  4YKT A;  3QDD A;  3R4P A;  2YJW A;  3B28 A;  1NHJ A;  3D0B A;  2BU6 A;  1UYC A;  2WI5 A;  4GFN A;  4BQG A;  4YKY A;  2XDX A;  2YE6 A;  1Y4U A;  3DGE A;  4AWQ A;  4E72 A;  4I3H A;  3CGY A;  4LWI A;  1YES A;  1QZR A;  1TID A;  4MPE A;  3T10 A;  3BMY A;  1Y8N A;  3B26 A;  3R92 A;  1YSZ A;  2XX4 A;  2WI4 A;  5J6A A;  2UWD A;  4KSG A;  4V26 A;  3CGZ A;  4CWQ A;  3TZ5 A;  3A0X A;  4PL9 A;  1L0O A;  4Q20 A;  4GT8 A;  2FWZ A;  4AS9 A;  3HHU A;  4URL A;  2WI7 A;  4JAU A;  2IWS A;  1BGQ A;  1MU5 A;  2XJJ A;  3GIG B;  4JAV A;  4E00 A;  2HKJ A;  3FV5 A;  4DUH A;  3LPS A;  2YE5 A;  1UYM A;  4LWH A;  4YKZ A;  4BIU A;  4KFG A;  2YI5 A;  1B62 A;  4KTN A;  2YED A;  4YKQ A;  1NHI A;  2VCJ A;  1QYE A;  4XTJ A;  5GGZ A;  2XHR A;  4FMT A;  1YT2 A;  2CH4 A;  1AH8 A;  1PVG A;  1TBW A;  3JZ3 A;  4QPJ A;  1AJ6 A;  3ZKD A;  3OWB A;  2FXS A;  3NMQ A;  1Y8O A;  2BZ5 A;  3RKZ A;  3EKO A;  2YE4 A;  4CWS A;  3CYG A;  4PU9 A;  4URM A;  5M4N A;  3GIF A;  4DZY A;  2WI3 A;  4I5S A;  2YK2 A;  2ZDY A;  2XHX A;  4O05 A;  4KQV A;  4MBC A;  2WI1 A;  2XJX A;  1UYL A;  4HXZ A;  2K5B A;  3T1K A;  2HG1 A;  4MOT A;  3INW A;  4YKW A;  1ZXM A;  2Q8I A;  4EFT A;  4MPN A;  2XCM A;  3GIG A;  5CTY A;  1Y4S A;  1IXM A;  3IED A;  4O09 A;  1B3Q A;  2H8M A;  3B24 A;  1EA6 A;  1YC1 A;  2BU5 A;  5CTW A;  4CWR A;  1BXD A;  1BKN A;  4XKA A;  4BIZ A;  1JM6 A;  3PEJ A;  3PEH A;  2VW5 A;  4NH9 A;  5CPH A;  3VHD A;  4HYM A;  1YC4 A;  3CRL A;  4K4O A;  3HEK A;  4B6C A;  4XIP A;  4LWG A;  2Q2E B;  5J71 A;  3VHC A;  2XDL A;  3Q5J A;  5D7R A;  1S16 A;  4PRX A;  4KP4 A;  1U0Z A;  2E0A A;  5FND A;  5L3J A;  3R4M A;  2Q8H A;  2XX2 A;  1B63 A;  3MNR P;  4HZ5 A;  3WQ9 A;  3TZ2 A;  2ESA A;  1KIJ A;  2YEE A;  3G75 A;  2YE7 A;  2QG0 A;  4FPP A;  3ZM7 A;  4R1F A;  4GCZ A;  3SL2 A;  2YKB A;  2YE2 A;  4JQL A;  4R3A A;  2ZKJ A;  5CTU A;  4XIQ A;  5FNC A;  1YET A;  3C11 A;  5BOC A;  4O04 A;  3HZ5 A;  1TH8 A;  1TIL A;  4ASB A;  2BTZ A;  5D6Q A;  2WEQ A;  5M4H A;  5M4E A;  2YGE A;  2IOQ A;  4XCJ A;  4BAE A;  4P8O A;  1EI1 A;  1US7 A;  3B27 A;  2YE8 A;  3LNU A;  3D2R A;  2BT0 A;  5F5R A;  1H7U A;  2XK2 A;  4E02 A;  5M4P A;  3O0I A;  2BYH A;  5D7D A;  5CTX A;  2ZBK B;  2YEI A;  2YI0 A;  4YKU A;  4QPK A;  2YK9 A;  1I59 A;  4HY6 A;  2YKC A;  3S5T A;  2O1V A;  3HYZ A;  3OPD A;  1A4H A;  1I5D A;  4MB9 A;  2ZDX A;  4YKR A;  3A0Z A;  2BYI A;  4E01 A;  4CWP A;  2WER A;  4X9L A;  2BSM A;  2IWX A;  4EGH A;  4EMV A;  1ID0 A;  2CCU A;  3VHA A;  3EHH A;  1I5C A;  4HZ0 A;  4CE2 A;  2HCH A;  3HZ1 A;  2CGF A;  1Z5B A;  3ZXO A;  4NH8 A;  3T2S A;  2IWU A;  1U2O A;  3TZ4 A;  1MX0 A;  4LWF A;  2YKJ A;  4AWP A;  4URN A;  3D36 A;  3TUH A;  1UY8 A;  3R4N A;  2Q8G A;  4HY1 A;  3K99 A;  2WI2 A;  1GJV A;  4WUB A;  4O07 A;  4WUC A;  4XE2 A;  4XC0 A;  3VAD A;  1YER A;  1I58 A;  1YS3 A;  3HYY A;  5M4M A;  2QFO A;  4EEH A;  2XD6 A;  2XDK A;  4XKO A;  2C2A A;  3RLP A;  2BU8 A;  1THN A;  4HYP A;  4CWO A;  3T0H A;  3EHF A;  3U2K A;  4P7A A;  2HHI A;  4ZVI A;  2YEB A;  4XDM A;  2XAB A;  1KZN A;  2AKP A;  2CCT A;  2JKI A;  2QF6 A;  1TC6 A;  3CRK A;  4GEE A;  4LWE A;  2XX5 A;  4HXW A;  3FT8 A;  4URO A;  1UYD A;  2PNR A;  2YEJ A;  4ASA A;  1H7S A;  3R91 A;  2BRC A;  3H80 A;  2C1G A;  4FCP A;  4U7O A;  4XKK A;  3R4O A;  4H7Q A;  1UY7 A;  4ZKI A;  4CWF A;  1YT0 A;  3K97 A;  1UYI A;  3LMM A;  3H4L A;  4H81 A;  3CWV A;  3TZ0 A;  2O1W A;  1Z59 A;  2XHT A;  4CWN A;  1YT1 A;  1ZW9 A;  5D7C A;  4KSH A;  3BM9 A;  1AMW A; 
#chains in the Genus database with same CATH homology
 1UY9 A;  4FCQ A;  3O2F A;  4MP7 A;  4L93 A;  4XIR A;  4JAS A;  4YKX A;  4WUD A;  4FCR A;  2YKE A;  4PRV A;  2VWC A;  3G7E A;  3T0Z A;  1UYH A;  2BU7 A;  2JJC A;  5C93 A;  2YKI A;  4ASF A;  1UY6 A;  5IN9 A;  4CWT A;  1AH6 A;  1R62 A;  3Q5L A;  3Q5K A;  4BXI A;  4GQT A;  5M4K A;  2GQP A;  2FWY A;  4W7T A;  3RLR A;  4CE3 A;  2YGF A;  2VCI A;  5IDM A;  1Z5A A;  3A0T A;  3K98 A;  4L8Z A;  4U93 A;  2IOR A;  4LP0 A;  1QY8 A;  2IOP A;  3A0W A;  2XJG A;  3QTF A;  4XIT A;  4V25 A;  4U7N A;  1YC3 A;  2WI6 A;  4LPB A;  4XCL A;  5FNF A;  2YI7 A;  1I5A A;  1UYK A;  2BU2 A;  2YE9 A;  2O1U A;  1UYG A;  1YSR A;  3O6O A;  3A0Y A;  2BRE A;  4XD8 A;  1UYE A;  1AM1 A;  5D6P A;  2YEH A;  1NHH A;  2YI6 A;  3EHJ A;  5FWK A;  3OWD A;  4EGK A;  5IDJ A;  3ZKB A;  4ASG A;  2CCS A;  2XDS A;  3B25 A;  5CF0 A;  1Z5C A;  3U67 A;  3EKR A;  4L90 A;  1S14 A;  2CG9 A;  5BOD A;  4EGI A;  2YEF A;  4L94 A;  2YGA A;  4H85 A;  3C0E A;  1GKZ A;  1GKX A;  3A0R A;  4CE1 A;  3G7B A;  2FYP A;  3OW6 A;  4BQJ A;  2XDU A;  4EFU A;  3ZXQ A;  4MPC A;  3RLQ A;  4O0B A;  1ZWH A;  2YJX A;  1TC0 A;  2YEG A;  4L91 A;  1I5B A;  3WHA A;  1BYQ A;  4EM7 A;  4MP2 A;  3FT5 A;  1Y8P A;  2EXL A;  3KE6 A;  2H55 A;  1ZXN A;  2QG2 A;  3INX A;  3OMU A;  4B7P A;  4R3M A;  1UYF A;  2WEP A;  2YEC A;  4NH7 A;  2YEA A;  3EHG A;  3TTZ A;  3GIE A;  2GFD A;  2Q8F A;  5F3K A;  1OSF A;  2YE3 A;  3K60 A;  4GGL A;  3U2D A;  4AWO A;  4YKT A;  3QDD A;  3R4P A;  2YJW A;  3B28 A;  1NHJ A;  3D0B A;  2BU6 A;  1UYC A;  2WI5 A;  4GFN A;  4BQG A;  4YKY A;  2XDX A;  2YE6 A;  1Y4U A;  3DGE A;  4AWQ A;  4I3H A;  3CGY A;  4LWI A;  1YES A;  1QZR A;  1TID A;  4MPE A;  3T10 A;  3BMY A;  1Y8N A;  3B26 A;  3R92 A;  1YSZ A;  2XX4 A;  2WI4 A;  5J6A A;  2UWD A;  4KSG A;  4V26 A;  3CGZ A;  4CWQ A;  3TZ5 A;  3A0X A;  4PL9 A;  1L0O A;  4Q20 A;  4GT8 A;  2FWZ A;  4AS9 A;  3HHU A;  4URL A;  2WI7 A;  4JAU A;  2IWS A;  1BGQ A;  1MU5 A;  2XJJ A;  3GIG B;  4JAV A;  4E00 A;  2HKJ A;  3FV5 A;  4DUH A;  3LPS A;  2YE5 A;  1UYM A;  4LWH A;  4YKZ A;  4BIU A;  4KFG A;  2YI5 A;  1B62 A;  4KTN A;  2YED A;  4YKQ A;  1NHI A;  2VCJ A;  1QYE A;  4XTJ A;  5GGZ A;  2XHR A;  4FMT A;  1YT2 A;  2CH4 A;  1AH8 A;  1PVG A;  1TBW A;  3JZ3 A;  4QPJ A;  1AJ6 A;  3ZKD A;  3OWB A;  2FXS A;  3NMQ A;  1Y8O A;  2BZ5 A;  3RKZ A;  3EKO A;  2YE4 A;  4CWS A;  4PU9 A;  4URM A;  5M4N A;  3GIF A;  4DZY A;  2WI3 A;  4I5S A;  2YK2 A;  2ZDY A;  2XHX A;  4O05 A;  4KQV A;  4MBC A;  2WI1 A;  2XJX A;  1UYL A;  4HXZ A;  2K5B A;  3T1K A;  2HG1 A;  4MOT A;  3INW A;  4YKW A;  1ZXM A;  2Q8I A;  4EFT A;  4MPN A;  2XCM A;  3GIG A;  5CTY A;  1Y4S A;  3IED A;  4O09 A;  1B3Q A;  2H8M A;  3B24 A;  1EA6 A;  1YC1 A;  2BU5 A;  5CTW A;  4CWR A;  1BXD A;  1BKN A;  4XKA A;  4BIZ A;  1JM6 A;  3PEJ A;  3PEH A;  2VW5 A;  4NH9 A;  5CPH A;  3VHD A;  4HYM A;  1YC4 A;  3CRL A;  4K4O A;  3HEK A;  4B6C A;  4XIP A;  4LWG A;  2Q2E B;  5J71 A;  3VHC A;  2XDL A;  3Q5J A;  5D7R A;  1S16 A;  4PRX A;  4KP4 A;  1U0Z A;  2E0A A;  5FND A;  5L3J A;  3R4M A;  2Q8H A;  2XX2 A;  1B63 A;  3MNR P;  4HZ5 A;  3WQ9 A;  3TZ2 A;  2ESA A;  1KIJ A;  2YEE A;  3G75 A;  2YE7 A;  2QG0 A;  4FPP A;  3ZM7 A;  4R1F A;  4GCZ A;  3SL2 A;  2YKB A;  2YE2 A;  4JQL A;  4R3A A;  2ZKJ A;  5CTU A;  4XIQ A;  5FNC A;  1YET A;  3C11 A;  5BOC A;  4O04 A;  3HZ5 A;  1TH8 A;  1TIL A;  4ASB A;  2BTZ A;  5D6Q A;  2WEQ A;  5M4H A;  5M4E A;  2YGE A;  2IOQ A;  4XCJ A;  4BAE A;  4P8O A;  1EI1 A;  1US7 A;  3B27 A;  2YE8 A;  3LNU A;  3D2R A;  2BT0 A;  5F5R A;  1H7U A;  2XK2 A;  4E02 A;  5M4P A;  3O0I A;  2BYH A;  5D7D A;  5CTX A;  2ZBK B;  2YEI A;  2YI0 A;  4YKU A;  4QPK A;  2YK9 A;  1I59 A;  4HY6 A;  2YKC A;  2O1V A;  3HYZ A;  3OPD A;  1A4H A;  1I5D A;  4MB9 A;  2ZDX A;  4YKR A;  3A0Z A;  2BYI A;  4E01 A;  4CWP A;  2WER A;  4X9L A;  2BSM A;  2IWX A;  4EGH A;  4EMV A;  1ID0 A;  2CCU A;  3VHA A;  3EHH A;  1I5C A;  4HZ0 A;  4CE2 A;  2HCH A;  3HZ1 A;  2CGF A;  1Z5B A;  3ZXO A;  4NH8 A;  3T2S A;  2IWU A;  1U2O A;  3TZ4 A;  1MX0 A;  4LWF A;  2YKJ A;  4AWP A;  4URN A;  3D36 A;  3TUH A;  1UY8 A;  3R4N A;  2Q8G A;  4HY1 A;  3K99 A;  2WI2 A;  1GJV A;  4WUB A;  4O07 A;  4WUC A;  4XE2 A;  4XC0 A;  3VAD A;  1YER A;  1I58 A;  1YS3 A;  3HYY A;  5M4M A;  2QFO A;  4EEH A;  2XD6 A;  2XDK A;  4XKO A;  2C2A A;  3RLP A;  2BU8 A;  1THN A;  4HYP A;  4CWO A;  3T0H A;  3EHF A;  3U2K A;  4P7A A;  4ZVI A;  2YEB A;  4XDM A;  2XAB A;  1KZN A;  2AKP A;  2CCT A;  2JKI A;  2QF6 A;  1TC6 A;  3CRK A;  4GEE A;  4LWE A;  2XX5 A;  4HXW A;  3FT8 A;  4URO A;  1UYD A;  2PNR A;  2YEJ A;  4ASA A;  1H7S A;  3R91 A;  2BRC A;  3H80 A;  4FCP A;  4U7O A;  4XKK A;  3R4O A;  4H7Q A;  1UY7 A;  4ZKI A;  4CWF A;  1YT0 A;  3K97 A;  1UYI A;  3H4L A;  4H81 A;  3CWV A;  3TZ0 A;  2O1W A;  1Z59 A;  2XHT A;  4CWN A;  1YT1 A;  1ZW9 A;  5D7C A;  4KSH A;  3BM9 A;  1AMW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...