4URNA

Crystal structure of staph pare 24kda in complex with novobiocin
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
207
structure length
188
Chain Sequence
LEGLEAVRKRPGMYIGSTDKRGLHHLVYEIVDNSVDEVLNGYGNEIDVTINKDGSISIEDNGRGMPTGIHKSGKPTVEVIFTVLVGASVVNALSEWLEVEIHRDGNIYHQSFKNGGSPSSGLVKKGKTKKTGTKVTFKPDDTIFKASTSFNFDVLSERLQESAFLLKNLKITLNDLRSGKERQEHYHY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA TOPOISOMERASE IV, B SUBUNIT
publication title Structures of Kibdelomycin Bound to Staphylococcus Aureus Gyrb and Pare Showed a Novel U-Shaped Binding Mode.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Isomerase
total genus 54
structure length 188
sequence length 207
chains with identical sequence B, C
ec nomenclature ec 5.99.1.-:
pdb deposition date 2014-07-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 4urnA00
1ID0A 2Q8FA 3OWDA 2XJGA 5CTUA 4H7QA 4GCZA 4EGIA 4LP0A 2BU7A 1NHHA 2Q8GA 3H4LA 4MP7A 2XDXA 3H80A 3K60A 3T0ZA 4URLA 3T10A 2BZ5A 5FNDA 3A0RA 1KIJA 3GIGB 1U0ZA 2BT0A 2VCIA 2WI1A 4O09A 1MU5A 2BRCA 3IEDA 1ZWHA 2O1VA 5M4NA 2YGEA 1UY6A 4MP2A 4LWGA 1UYEA 1YSRA 2JJCA 2Q8HA 1B62A 1Y4SA 5GGZA 3G75A 3HYYA 2YI7A 2YE2A 3TZ4A 4URNA 4FMTA 2XHRA 2XK2A 1Z5BA 3ZXOA 5M4KA 3C0EA 3TZ0A 5FNFA 1I58A 1EI1A 4ZKIA 3U2KA 4CWFA 3GIFA 1AJ6A 2BU5A 3GIGA 2YEAA 4U93A 1BXDA 4BIUA 3BMYA 5D7CA 1I59A 4B6CA 2CG9A 4GT8A 1Y8NA 2YKIA 3HZ5A 3FT8A 1UYFA 1Y8OA 4XIPA 4CE2A 1UY7A 1OSFA 4NH8A 2O1WA 2XJXA 4CWRA 4XKOA 4YKUA 1S14A 3R4MA 1I5CA 4W7TA 2CGFA 1AMWA 3MNRP 4L8ZA 1GJVA 4LWFA 2ZKJA 3PEJA 3FT5A 1YESA 4E02A 3T1KA 3LPSA 1JM6A 1EA6A 2YEBA 3NMQA 1ZXMA 4BIZA 3HHUA 3R91A 4DUHA 3DGEA 4MB9A 3A0WA 4E01A 4O07A 2XJJA 5M4PA 2H8MA 4CWNA 2IOQA 4V25A 1YT2A 2XDKA 2FXSA 5M4MA 4DZYA 4EFUA 4CWOA 5J71A 2WI4A 4GQTA 5M4EA 3SL2A 2YI5A 1H7UA 1UYCA 1B63A 2XX5A 2XD6A 4EMVA 5IN9A 1AH6A 2XX4A 3BM9A 2WEPA 3INXA 2VCJA 2IWXA 2Q2EB 2YKBA 4HZ5A 2YKJA 1Y4UA 2XX2A 3HEKA 3RLQA 4L93A 2WI6A 3A0ZA 3RLRA 1UYIA 2YE3A 3CRLA 1ZW9A 2O1UA 1BYQA 2YI6A 2K5BA 3U2DA 1GKZA 2PNRA 3Q5JA 1TH8A 2EXLA 2YEHA 4L94A 1QYEA 3O2FA 3INWA 3JZ3A 4PL9A 1THNA 1TBWA 3B28A 4HYPA 2BU2A 4FCRA 5D7DA 2XCMA 2BSMA 4EM7A 4MOTA 3B27A 2IWUA 5M4HA 3VHCA 2UWDA 4KTNA 1QZRA 3RLPA 4NH9A 4LWIA 2ZBKB 4XIQA 1R62A 3WQ9A 3ZKDA 4XE2A 4KFGA 1UYDA 4R1FA 4EFTA 2CCTA 1Z5AA 2YE8A 1I5BA 3LNUA 4MPNA 4CE3A 4XC0A 2YE5A 4EEHA 1MX0A 4URMA 3ZKBA 2WI5A 1UYLA 4ZVIA 1NHJA 4KSGA 2JKIA 3QTFA 3D36A 4ASBA 2H55A 2YEFA 4BAEA 4XIRA 1Z59A 4X9LA 2CCUA 4BXIA 1KZNA 4I3HA 2WEQA 1YETA 4GFNA 4HYMA 3R92A 3VADA 2QF6A 3EHFA 4FCPA 2YJXA 2GFDA 2WI7A 1YC1A 3O0IA 3OMUA 2YKCA 1A4HA 2YK2A 2ZDYA 2AKPA 2BU8A 2YE9A 4AS9A 2VWCA 2XDUA 2BU6A 3G7BA 5CF0A 1TIDA 1NHIA 4B7PA 3K98A 1YC3A 4FPPA 4L91A 2XDSA 2YEGA 4EGKA 3K99A 4YKWA 3OWBA 2QG0A 4JAVA 3Q5LA 5CTXA 3A0XA 3B25A 1YSZA 4NH7A 2BREA 3CWVA 4ASGA 1I5AA 2BTZA 3TZ5A 5FWKA 4WUBA 2QFOA 3PEHA 2YKEA 5CTYA 3TUHA 2YE6A 5IDJA 4LWEA 2IOPA 2XHXA 5CTWA 3EKRA 1U2OA 3RKZA 4HZ0A 3G7EA 1BKNA 3Q5KA 4WUCA 4XCLA 3A0TA 3TZ2A 4CWQA 1TC0A 2VW5A 5BODA 2XABA 4XITA 2YK9A 2YGAA 4AWPA 4CWTA 2YE7A 4U7NA 2CCSA 3CGZA 4XCJA 2YECA 4KSHA 4E00A 2YI0A 3HZ1A 4HY6A 4XKKA 3R4OA 4HXZA 2YEIA 1US7A 3OPDA 4O05A 5C93A 1PVGA 4XDMA 3CGYA 4CWSA 1I5DA 5L3JA 1UY8A 1YT0A 3C11A 3D2RA 4H81A 4MPEA 4XTJA 1B3QA 1BGQA 3ZXQA 4L90A 4MPCA 3A0YA 4EGHA 1QY8A 4BQGA 4PU9A 4Q20A 4PRXA 4P8OA 2QG2A 1ZXNA 2XDLA 4ASFA 4YKRA 2GQPA 3B24A 4JQLA 3R4PA 2YGFA 4O0BA 5CPHA 4K4OA 3FV5A 1L0OA 1YC4A 4BQJA 3GIEA 5J6AA 5D6QA 3T2SA 1UY9A 1UYGA 2WI2A 2YEJA 2FWYA 1UYHA 2HG1A 4I5SA 1H7SA 3T0HA 2FWZA 4O04A 4JAUA 3B26A 3EHGA 1YERA 2YJWA 1TC6A 3VHAA 2CH4A 3CRKA 1YT1A 2E0AA 4KQVA 2Q8IA 2HKJA 3R4NA 4HXWA 1YS3A 4YKZA 2YE4A 4QPKA 2HCHA 1Z5CA 3ZM7A 4R3MA 3KE6A 2XHTA 4LPBA 3U67A 1GKXA 4U7OA 4PRVA 3O6OA 4JASA 5D6PA 5FNCA 2YEEA 3TTZA 5IDMA 1TILA 4ASAA 3HYZA 4LWHA 4P7AA 2IWSA 1UYMA 2WERA 2ZDXA 4QPJA 4H85A 3OW6A 4WUDA 1AH8A 1Y8PA 3D0BA 4YKQA 4KP4A 2YEDA 4FCQA 4YKYA 4GEEA 4MBCA 5F3KA 1S16A 2IORA 4YKTA 2ESAA 4CE1A 4YKXA 3EHHA 5F5RA 4R3AA 4AWOA 4UROA 2FYPA 4XD8A 2WI3A 4CWPA 3QDDA 4GGLA 5BOCA 3WHAA 1UYKA 2BYHA 3VHDA 3EKOA 2BYIA 4HY1A 4V26A 4XKAA 5D7RA 3K97A 1AM1A 3EHJA 2C2AA 4AWQA
chains in the Genus database with same CATH superfamily
1ID0A 2Q8FA 3OWDA 2XJGA 5CTUA 4H7QA 4GCZA 4EGIA 4LP0A 2BU7A 1NHHA 2Q8GA 3H4LA 4MP7A 2XDXA 3H80A 3K60A 3T0ZA 4URLA 3T10A 2BZ5A 5FNDA 3A0RA 1KIJA 3GIGB 1U0ZA 2BT0A 2VCIA 2WI1A 4O09A 1MU5A 2BRCA 3IEDA 1ZWHA 3LMMA 2O1VA 5M4NA 2YGEA 1UY6A 4MP2A 4LWGA 1UYEA 1YSRA 2JJCA 2Q8HA 1B62A 1Y4SA 5GGZA 3G75A 3HYYA 2YI7A 2YE2A 3TZ4A 4URNA 4FMTA 2XHRA 2XK2A 1Z5BA 3ZXOA 5M4KA 3C0EA 3TZ0A 5FNFA 1I58A 1EI1A 4ZKIA 3U2KA 4CWFA 3GIFA 1AJ6A 2BU5A 3GIGA 2YEAA 4U93A 1BXDA 4BIUA 3BMYA 5D7CA 1I59A 4B6CA 2CG9A 4GT8A 1Y8NA 2YKIA 3HZ5A 3FT8A 1UYFA 1Y8OA 4XIPA 4CE2A 1UY7A 1OSFA 4NH8A 2O1WA 2XJXA 2HHIA 4CWRA 4XKOA 4YKUA 1S14A 3R4MA 1I5CA 4W7TA 2CGFA 1AMWA 3MNRP 4L8ZA 1GJVA 4LWFA 2ZKJA 3PEJA 3S5TA 3FT5A 1YESA 4E02A 3T1KA 3LPSA 1JM6A 1EA6A 2YEBA 3NMQA 1ZXMA 4BIZA 3HHUA 3R91A 4DUHA 3DGEA 4MB9A 3A0WA 4E01A 2C1GA 4O07A 2XJJA 5M4PA 2H8MA 4CWNA 2IOQA 4V25A 1YT2A 2XDKA 2FXSA 5M4MA 4DZYA 4EFUA 4CWOA 5J71A 2WI4A 4GQTA 5M4EA 3SL2A 2YI5A 1H7UA 1UYCA 1B63A 2XX5A 2XD6A 4EMVA 5IN9A 1AH6A 2XX4A 3BM9A 2WEPA 3INXA 2VCJA 2IWXA 2Q2EB 2YKBA 4HZ5A 2YKJA 1Y4UA 2XX2A 3HEKA 3RLQA 4L93A 2WI6A 3A0ZA 3RLRA 1UYIA 2YE3A 3CRLA 1ZW9A 2O1UA 1BYQA 2YI6A 2K5BA 3U2DA 4E72A 1GKZA 2PNRA 3Q5JA 1TH8A 2EXLA 2YEHA 4L94A 1QYEA 3O2FA 3INWA 3JZ3A 4PL9A 1THNA 1TBWA 3B28A 4HYPA 2BU2A 4FCRA 5D7DA 2XCMA 2BSMA 4EM7A 4MOTA 3B27A 2IWUA 5M4HA 3VHCA 2UWDA 4KTNA 1QZRA 3RLPA 4NH9A 4LWIA 2ZBKB 4XIQA 1R62A 3WQ9A 3ZKDA 4XE2A 4KFGA 1UYDA 4R1FA 4EFTA 2CCTA 1Z5AA 2YE8A 1I5BA 3LNUA 4MPNA 4CE3A 4XC0A 2YE5A 4EEHA 1MX0A 4URMA 3ZKBA 2WI5A 1UYLA 4ZVIA 1NHJA 4KSGA 2JKIA 3QTFA 3D36A 4ASBA 2H55A 2YEFA 4BAEA 4XIRA 3CYGA 1Z59A 4X9LA 2CCUA 4BXIA 1KZNA 4I3HA 2WEQA 1YETA 4GFNA 4HYMA 3R92A 3VADA 2QF6A 3EHFA 4FCPA 2YJXA 2GFDA 2WI7A 1YC1A 3O0IA 3OMUA 2YKCA 1A4HA 2YK2A 2ZDYA 2AKPA 2BU8A 2YE9A 4AS9A 2VWCA 2XDUA 2BU6A 3G7BA 5CF0A 1TIDA 1NHIA 4B7PA 3K98A 1YC3A 4FPPA 4L91A 2XDSA 2YEGA 4EGKA 3K99A 4YKWA 2FTKA 3OWBA 2QG0A 4JAVA 3Q5LA 5CTXA 3A0XA 3B25A 1YSZA 4NH7A 2BREA 3CWVA 4ASGA 1I5AA 2BTZA 3TZ5A 5FWKA 4WUBA 2QFOA 3PEHA 2YKEA 5CTYA 3TUHA 2YE6A 5IDJA 4LWEA 2IOPA 2XHXA 5CTWA 3EKRA 1U2OA 3RKZA 4HZ0A 3G7EA 1BKNA 3Q5KA 4WUCA 4XCLA 3A0TA 3TZ2A 4CWQA 1TC0A 2VW5A 5BODA 2XABA 4XITA 2YK9A 2YGAA 4AWPA 4CWTA 2YE7A 4U7NA 2CCSA 3CGZA 4XCJA 2YECA 4KSHA 4E00A 2YI0A 3HZ1A 4HY6A 4XKKA 3R4OA 4HXZA 2YEIA 1US7A 3OPDA 4O05A 5C93A 1PVGA 4XDMA 3CGYA 4CWSA 1I5DA 5L3JA 1UY8A 1YT0A 3C11A 3D2RA 4H81A 4MPEA 4XTJA 1B3QA 1BGQA 3ZXQA 4L90A 4MPCA 3A0YA 4EGHA 1QY8A 4BQGA 4PU9A 4Q20A 4PRXA 4P8OA 2QG2A 1ZXNA 2XDLA 4ASFA 4YKRA 2GQPA 3B24A 4JQLA 3R4PA 2YGFA 4O0BA 5CPHA 4K4OA 3FV5A 1L0OA 1YC4A 4BQJA 3GIEA 5J6AA 5D6QA 3T2SA 1UY9A 1UYGA 2WI2A 2YEJA 2FWYA 1UYHA 2HG1A 4I5SA 1H7SA 3T0HA 2FWZA 4O04A 4JAUA 3B26A 3EHGA 1YERA 2YJWA 1TC6A 3VHAA 2CH4A 3CRKA 1YT1A 2E0AA 4KQVA 2Q8IA 2HKJA 3R4NA 4HXWA 1YS3A 5JENA 4YKZA 2YE4A 4QPKA 2HCHA 1Z5CA 3ZM7A 4R3MA 3KE6A 2XHTA 4LPBA 3U67A 1GKXA 4U7OA 4PRVA 3O6OA 4JASA 5D6PA 5FNCA 2YEEA 1IXMA 3TTZA 5IDMA 1TILA 4ASAA 3HYZA 4LWHA 4P7AA 2IWSA 1UYMA 2WERA 2ZDXA 4QPJA 1F51A 4H85A 3OW6A 2C1IA 4WUDA 1AH8A 1Y8PA 3D0BA 4YKQA 4KP4A 2YEDA 4FCQA 4YKYA 4GEEA 4MBCA 5F3KA 1S16A 2IORA 4YKTA 2ESAA 4CE1A 4YKXA 3EHHA 5F5RA 4R3AA 4AWOA 4UROA 2FYPA 4XD8A 2WI3A 4CWPA 3QDDA 4GGLA 5BOCA 3WHAA 1UYKA 2BYHA 3VHDA 3EKOA 2BYIA 4HY1A 4V26A 4XKAA 5D7RA 3K97A 1AM1A 3EHJA 2C2AA 4AWQA
chains in the Genus database with same CATH topology
1ID0A 2Q8FA 3OWDA 2XJGA 5CTUA 4H7QA 4GCZA 4EGIA 4LP0A 2BU7A 1NHHA 2Q8GA 3H4LA 4MP7A 2XDXA 3H80A 3K60A 3T0ZA 4URLA 3T10A 2BZ5A 5FNDA 3A0RA 1KIJA 3GIGB 1U0ZA 2BT0A 2VCIA 2WI1A 4O09A 1MU5A 2BRCA 3IEDA 1ZWHA 2O1VA 5M4NA 2YGEA 1UY6A 4MP2A 4LWGA 1UYEA 1YSRA 2JJCA 2Q8HA 1B62A 1Y4SA 5GGZA 3G75A 3HYYA 2YI7A 2YE2A 3TZ4A 4URNA 4FMTA 2XHRA 2XK2A 1Z5BA 3ZXOA 5M4KA 3C0EA 3TZ0A 5FNFA 1I58A 1EI1A 4ZKIA 3U2KA 4CWFA 3GIFA 1AJ6A 2BU5A 3GIGA 2YEAA 4U93A 1BXDA 4BIUA 3BMYA 5D7CA 1I59A 4B6CA 2CG9A 4GT8A 1Y8NA 2YKIA 3HZ5A 3FT8A 1UYFA 1Y8OA 4XIPA 4CE2A 1UY7A 1OSFA 4NH8A 2O1WA 2XJXA 4CWRA 4XKOA 4YKUA 1S14A 3R4MA 1I5CA 4W7TA 2CGFA 1AMWA 3MNRP 4L8ZA 1GJVA 4LWFA 2ZKJA 3PEJA 3FT5A 1YESA 4E02A 3T1KA 3LPSA 1JM6A 1EA6A 2YEBA 3NMQA 1ZXMA 4BIZA 3HHUA 3R91A 4DUHA 3DGEA 4MB9A 3A0WA 4E01A 4O07A 2XJJA 5M4PA 2H8MA 4CWNA 2IOQA 4V25A 1YT2A 2XDKA 2FXSA 5M4MA 4DZYA 4EFUA 4CWOA 5J71A 2WI4A 4GQTA 5M4EA 3SL2A 2YI5A 1H7UA 1UYCA 1B63A 2XX5A 2XD6A 4EMVA 5IN9A 1AH6A 2XX4A 3BM9A 2WEPA 3INXA 2VCJA 2IWXA 2Q2EB 2YKBA 4HZ5A 2YKJA 1Y4UA 2XX2A 3HEKA 3RLQA 4L93A 2WI6A 3A0ZA 3RLRA 1UYIA 2YE3A 3CRLA 1ZW9A 2O1UA 1BYQA 2YI6A 2K5BA 3U2DA 1GKZA 2PNRA 3Q5JA 1TH8A 2EXLA 2YEHA 4L94A 1QYEA 3O2FA 3INWA 3JZ3A 4PL9A 1THNA 1TBWA 3B28A 4HYPA 2BU2A 4FCRA 5D7DA 2XCMA 2BSMA 4EM7A 4MOTA 3B27A 2IWUA 5M4HA 3VHCA 2UWDA 4KTNA 1QZRA 3RLPA 4NH9A 4LWIA 2ZBKB 4XIQA 1R62A 3WQ9A 3ZKDA 4XE2A 4KFGA 1UYDA 4R1FA 4EFTA 2CCTA 1Z5AA 2YE8A 1I5BA 3LNUA 4MPNA 4CE3A 4XC0A 2YE5A 4EEHA 1MX0A 4URMA 3ZKBA 2WI5A 1UYLA 4ZVIA 1NHJA 4KSGA 2JKIA 3QTFA 3D36A 4ASBA 2H55A 2YEFA 4BAEA 4XIRA 1Z59A 4X9LA 2CCUA 4BXIA 1KZNA 4I3HA 2WEQA 1YETA 4GFNA 4HYMA 3R92A 3VADA 2QF6A 3EHFA 4FCPA 2YJXA 2GFDA 2WI7A 1YC1A 3O0IA 3OMUA 2YKCA 1A4HA 2YK2A 2ZDYA 2AKPA 2BU8A 2YE9A 4AS9A 2VWCA 2XDUA 2BU6A 3G7BA 5CF0A 1TIDA 1NHIA 4B7PA 3K98A 1YC3A 4FPPA 4L91A 2XDSA 2YEGA 4EGKA 3K99A 4YKWA 3OWBA 2QG0A 4JAVA 3Q5LA 5CTXA 3A0XA 3B25A 1YSZA 4NH7A 2BREA 3CWVA 4ASGA 1I5AA 2BTZA 3TZ5A 5FWKA 4WUBA 2QFOA 3PEHA 2YKEA 5CTYA 3TUHA 2YE6A 5IDJA 4LWEA 2IOPA 2XHXA 5CTWA 3EKRA 1U2OA 3RKZA 4HZ0A 3G7EA 1BKNA 3Q5KA 4WUCA 4XCLA 3A0TA 3TZ2A 4CWQA 1TC0A 2VW5A 5BODA 2XABA 4XITA 2YK9A 2YGAA 4AWPA 4CWTA 2YE7A 4U7NA 2CCSA 3CGZA 4XCJA 2YECA 4KSHA 4E00A 2YI0A 3HZ1A 4HY6A 4XKKA 3R4OA 4HXZA 2YEIA 1US7A 3OPDA 4O05A 5C93A 1PVGA 4XDMA 3CGYA 4CWSA 1I5DA 5L3JA 1UY8A 1YT0A 3C11A 3D2RA 4H81A 4MPEA 4XTJA 1B3QA 1BGQA 3ZXQA 4L90A 4MPCA 3A0YA 4EGHA 1QY8A 4BQGA 4PU9A 4Q20A 4PRXA 4P8OA 2QG2A 1ZXNA 2XDLA 4ASFA 4YKRA 2GQPA 3B24A 4JQLA 3R4PA 2YGFA 4O0BA 5CPHA 4K4OA 3FV5A 1L0OA 1YC4A 4BQJA 3GIEA 5J6AA 5D6QA 3T2SA 1UY9A 1UYGA 2WI2A 2YEJA 2FWYA 1UYHA 2HG1A 4I5SA 1H7SA 3T0HA 2FWZA 4O04A 4JAUA 3B26A 3EHGA 1YERA 2YJWA 1TC6A 3VHAA 2CH4A 3CRKA 1YT1A 2E0AA 4KQVA 2Q8IA 2HKJA 3R4NA 4HXWA 1YS3A 4YKZA 2YE4A 4QPKA 2HCHA 1Z5CA 3ZM7A 4R3MA 3KE6A 2XHTA 4LPBA 3U67A 1GKXA 4U7OA 4PRVA 3O6OA 4JASA 5D6PA 5FNCA 2YEEA 3TTZA 5IDMA 1TILA 4ASAA 3HYZA 4LWHA 4P7AA 2IWSA 1UYMA 2WERA 2ZDXA 4QPJA 4H85A 3OW6A 4WUDA 1AH8A 1Y8PA 3D0BA 4YKQA 4KP4A 2YEDA 4FCQA 4YKYA 4GEEA 4MBCA 5F3KA 1S16A 2IORA 4YKTA 2ESAA 4CE1A 4YKXA 3EHHA 5F5RA 4R3AA 4AWOA 4UROA 2FYPA 4XD8A 2WI3A 4CWPA 3QDDA 4GGLA 5BOCA 3WHAA 1UYKA 2BYHA 3VHDA 3EKOA 2BYIA 4HY1A 4V26A 4XKAA 5D7RA 3K97A 1AM1A 3EHJA 2C2AA 4AWQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ID0 A;  2Q8F A;  3OWD A;  2XJG A;  5CTU A;  4H7Q A;  4GCZ A;  4EGI A;  4LP0 A;  2BU7 A;  1NHH A;  2Q8G A;  3H4L A;  4MP7 A;  2XDX A;  3H80 A;  3K60 A;  3T0Z A;  4URL A;  3T10 A;  2BZ5 A;  5FND A;  3A0R A;  1KIJ A;  3GIG B;  1U0Z A;  2BT0 A;  2VCI A;  2WI1 A;  4O09 A;  1MU5 A;  2BRC A;  3IED A;  1ZWH A;  2O1V A;  5M4N A;  2YGE A;  1UY6 A;  4MP2 A;  4LWG A;  1UYE A;  1YSR A;  2JJC A;  2Q8H A;  1B62 A;  1Y4S A;  5GGZ A;  3G75 A;  3HYY A;  2YI7 A;  2YE2 A;  3TZ4 A;  4URN A;  4FMT A;  2XHR A;  2XK2 A;  1Z5B A;  3ZXO A;  5M4K A;  3C0E A;  3TZ0 A;  5FNF A;  1I58 A;  1EI1 A;  4ZKI A;  3U2K A;  4CWF A;  3GIF A;  1AJ6 A;  2BU5 A;  3GIG A;  2YEA A;  4U93 A;  1BXD A;  4BIU A;  3BMY A;  5D7C A;  1I59 A;  4B6C A;  2CG9 A;  4GT8 A;  1Y8N A;  2YKI A;  3HZ5 A;  3FT8 A;  1UYF A;  1Y8O A;  4XIP A;  4CE2 A;  1UY7 A;  1OSF A;  4NH8 A;  2O1W A;  2XJX A;  4CWR A;  4XKO A;  4YKU A;  1S14 A;  3R4M A;  1I5C A;  4W7T A;  2CGF A;  1AMW A;  3MNR P;  4L8Z A;  1GJV A;  4LWF A;  2ZKJ A;  3PEJ A;  3FT5 A;  1YES A;  4E02 A;  3T1K A;  3LPS A;  1JM6 A;  1EA6 A;  2YEB A;  3NMQ A;  1ZXM A;  4BIZ A;  3HHU A;  3R91 A;  4DUH A;  3DGE A;  4MB9 A;  3A0W A;  4E01 A;  4O07 A;  2XJJ A;  5M4P A;  2H8M A;  4CWN A;  2IOQ A;  4V25 A;  1YT2 A;  2XDK A;  2FXS A;  5M4M A;  4DZY A;  4EFU A;  4CWO A;  5J71 A;  2WI4 A;  4GQT A;  5M4E A;  3SL2 A;  2YI5 A;  1H7U A;  1UYC A;  1B63 A;  2XX5 A;  2XD6 A;  4EMV A;  5IN9 A;  1AH6 A;  2XX4 A;  3BM9 A;  2WEP A;  3INX A;  2VCJ A;  2IWX A;  2Q2E B;  2YKB A;  4HZ5 A;  2YKJ A;  1Y4U A;  2XX2 A;  3HEK A;  3RLQ A;  4L93 A;  2WI6 A;  3A0Z A;  3RLR A;  1UYI A;  2YE3 A;  3CRL A;  1ZW9 A;  2O1U A;  1BYQ A;  2YI6 A;  2K5B A;  3U2D A;  1GKZ A;  2PNR A;  3Q5J A;  1TH8 A;  2EXL A;  2YEH A;  4L94 A;  1QYE A;  3O2F A;  3INW A;  3JZ3 A;  4PL9 A;  1THN A;  1TBW A;  3B28 A;  4HYP A;  2BU2 A;  4FCR A;  5D7D A;  2XCM A;  2BSM A;  4EM7 A;  4MOT A;  3B27 A;  2IWU A;  5M4H A;  3VHC A;  2UWD A;  4KTN A;  1QZR A;  3RLP A;  4NH9 A;  4LWI A;  2ZBK B;  4XIQ A;  1R62 A;  3WQ9 A;  3ZKD A;  4XE2 A;  4KFG A;  1UYD A;  4R1F A;  4EFT A;  2CCT A;  1Z5A A;  2YE8 A;  1I5B A;  3LNU A;  4MPN A;  4CE3 A;  4XC0 A;  2YE5 A;  4EEH A;  1MX0 A;  4URM A;  3ZKB A;  2WI5 A;  1UYL A;  4ZVI A;  1NHJ A;  4KSG A;  2JKI A;  3QTF A;  3D36 A;  4ASB A;  2H55 A;  2YEF A;  4BAE A;  4XIR A;  1Z59 A;  4X9L A;  2CCU A;  4BXI A;  1KZN A;  4I3H A;  2WEQ A;  1YET A;  4GFN A;  4HYM A;  3R92 A;  3VAD A;  2QF6 A;  3EHF A;  4FCP A;  2YJX A;  2GFD A;  2WI7 A;  1YC1 A;  3O0I A;  3OMU A;  2YKC A;  1A4H A;  2YK2 A;  2ZDY A;  2AKP A;  2BU8 A;  2YE9 A;  4AS9 A;  2VWC A;  2XDU A;  2BU6 A;  3G7B A;  5CF0 A;  1TID A;  1NHI A;  4B7P A;  3K98 A;  1YC3 A;  4FPP A;  4L91 A;  2XDS A;  2YEG A;  4EGK A;  3K99 A;  4YKW A;  3OWB A;  2QG0 A;  4JAV A;  3Q5L A;  5CTX A;  3A0X A;  3B25 A;  1YSZ A;  4NH7 A;  2BRE A;  3CWV A;  4ASG A;  1I5A A;  2BTZ A;  3TZ5 A;  5FWK A;  4WUB A;  2QFO A;  3PEH A;  2YKE A;  5CTY A;  3TUH A;  2YE6 A;  5IDJ A;  4LWE A;  2IOP A;  2XHX A;  5CTW A;  3EKR A;  1U2O A;  3RKZ A;  4HZ0 A;  3G7E A;  1BKN A;  3Q5K A;  4WUC A;  4XCL A;  3A0T A;  3TZ2 A;  4CWQ A;  1TC0 A;  2VW5 A;  5BOD A;  2XAB A;  4XIT A;  2YK9 A;  2YGA A;  4AWP A;  4CWT A;  2YE7 A;  4U7N A;  2CCS A;  3CGZ A;  4XCJ A;  2YEC A;  4KSH A;  4E00 A;  2YI0 A;  3HZ1 A;  4HY6 A;  4XKK A;  3R4O A;  4HXZ A;  2YEI A;  1US7 A;  3OPD A;  4O05 A;  5C93 A;  1PVG A;  4XDM A;  3CGY A;  4CWS A;  1I5D A;  5L3J A;  1UY8 A;  1YT0 A;  3C11 A;  3D2R A;  4H81 A;  4MPE A;  4XTJ A;  1B3Q A;  1BGQ A;  3ZXQ A;  4L90 A;  4MPC A;  3A0Y A;  4EGH A;  1QY8 A;  4BQG A;  4PU9 A;  4Q20 A;  4PRX A;  4P8O A;  2QG2 A;  1ZXN A;  2XDL A;  4ASF A;  4YKR A;  2GQP A;  3B24 A;  4JQL A;  3R4P A;  2YGF A;  4O0B A;  5CPH A;  4K4O A;  3FV5 A;  1L0O A;  1YC4 A;  4BQJ A;  3GIE A;  5J6A A;  5D6Q A;  3T2S A;  1UY9 A;  1UYG A;  2WI2 A;  2YEJ A;  2FWY A;  1UYH A;  2HG1 A;  4I5S A;  1H7S A;  3T0H A;  2FWZ A;  4O04 A;  4JAU A;  3B26 A;  3EHG A;  1YER A;  2YJW A;  1TC6 A;  3VHA A;  2CH4 A;  3CRK A;  1YT1 A;  2E0A A;  4KQV A;  2Q8I A;  2HKJ A;  3R4N A;  4HXW A;  1YS3 A;  4YKZ A;  2YE4 A;  4QPK A;  2HCH A;  1Z5C A;  3ZM7 A;  4R3M A;  3KE6 A;  2XHT A;  4LPB A;  3U67 A;  1GKX A;  4U7O A;  4PRV A;  3O6O A;  4JAS A;  5D6P A;  5FNC A;  2YEE A;  3TTZ A;  5IDM A;  1TIL A;  4ASA A;  3HYZ A;  4LWH A;  4P7A A;  2IWS A;  1UYM A;  2WER A;  2ZDX A;  4QPJ A;  4H85 A;  3OW6 A;  4WUD A;  1AH8 A;  1Y8P A;  3D0B A;  4YKQ A;  4KP4 A;  2YED A;  4FCQ A;  4YKY A;  4GEE A;  4MBC A;  5F3K A;  1S16 A;  2IOR A;  4YKT A;  2ESA A;  4CE1 A;  4YKX A;  3EHH A;  5F5R A;  4R3A A;  4AWO A;  4URO A;  2FYP A;  4XD8 A;  2WI3 A;  4CWP A;  3QDD A;  4GGL A;  5BOC A;  3WHA A;  1UYK A;  2BYH A;  3VHD A;  3EKO A;  2BYI A;  4HY1 A;  4V26 A;  4XKA A;  5D7R A;  3K97 A;  1AM1 A;  3EHJ A;  2C2A A;  4AWQ A; 
#chains in the Genus database with same CATH topology
 1ID0 A;  2Q8F A;  3OWD A;  2XJG A;  5CTU A;  4H7Q A;  4GCZ A;  4EGI A;  4LP0 A;  2BU7 A;  1NHH A;  2Q8G A;  3H4L A;  4MP7 A;  2XDX A;  3H80 A;  3K60 A;  3T0Z A;  4URL A;  3T10 A;  2BZ5 A;  5FND A;  3A0R A;  1KIJ A;  3GIG B;  1U0Z A;  2BT0 A;  2VCI A;  2WI1 A;  4O09 A;  1MU5 A;  2BRC A;  3IED A;  1ZWH A;  3LMM A;  2O1V A;  5M4N A;  2YGE A;  1UY6 A;  4MP2 A;  4LWG A;  1UYE A;  1YSR A;  2JJC A;  2Q8H A;  1B62 A;  1Y4S A;  5GGZ A;  3G75 A;  3HYY A;  2YI7 A;  2YE2 A;  3TZ4 A;  4URN A;  4FMT A;  2XHR A;  2XK2 A;  1Z5B A;  3ZXO A;  5M4K A;  3C0E A;  3TZ0 A;  5FNF A;  1I58 A;  1EI1 A;  4ZKI A;  3U2K A;  4CWF A;  3GIF A;  1AJ6 A;  2BU5 A;  3GIG A;  2YEA A;  4U93 A;  1BXD A;  4BIU A;  3BMY A;  5D7C A;  1I59 A;  4B6C A;  2CG9 A;  4GT8 A;  1Y8N A;  2YKI A;  3HZ5 A;  3FT8 A;  1UYF A;  1Y8O A;  4XIP A;  4CE2 A;  1UY7 A;  1OSF A;  4NH8 A;  2O1W A;  2XJX A;  2HHI A;  4CWR A;  4XKO A;  4YKU A;  1S14 A;  3R4M A;  1I5C A;  4W7T A;  2CGF A;  1AMW A;  3MNR P;  4L8Z A;  1GJV A;  4LWF A;  2ZKJ A;  3PEJ A;  3S5T A;  3FT5 A;  1YES A;  4E02 A;  3T1K A;  3LPS A;  1JM6 A;  1EA6 A;  2YEB A;  3NMQ A;  1ZXM A;  4BIZ A;  3HHU A;  3R91 A;  4DUH A;  3DGE A;  4MB9 A;  3A0W A;  4E01 A;  2C1G A;  4O07 A;  2XJJ A;  5M4P A;  2H8M A;  4CWN A;  2IOQ A;  4V25 A;  1YT2 A;  2XDK A;  2FXS A;  5M4M A;  4DZY A;  4EFU A;  4CWO A;  5J71 A;  2WI4 A;  4GQT A;  5M4E A;  3SL2 A;  2YI5 A;  1H7U A;  1UYC A;  1B63 A;  2XX5 A;  2XD6 A;  4EMV A;  5IN9 A;  1AH6 A;  2XX4 A;  3BM9 A;  2WEP A;  3INX A;  2VCJ A;  2IWX A;  2Q2E B;  2YKB A;  4HZ5 A;  2YKJ A;  1Y4U A;  2XX2 A;  3HEK A;  3RLQ A;  4L93 A;  2WI6 A;  3A0Z A;  3RLR A;  1UYI A;  2YE3 A;  3CRL A;  1ZW9 A;  2O1U A;  1BYQ A;  2YI6 A;  2K5B A;  3U2D A;  4E72 A;  1GKZ A;  2PNR A;  3Q5J A;  1TH8 A;  2EXL A;  2YEH A;  4L94 A;  1QYE A;  3O2F A;  3INW A;  3JZ3 A;  4PL9 A;  1THN A;  1TBW A;  3B28 A;  4HYP A;  2BU2 A;  4FCR A;  5D7D A;  2XCM A;  2BSM A;  4EM7 A;  4MOT A;  3B27 A;  2IWU A;  5M4H A;  3VHC A;  2UWD A;  4KTN A;  1QZR A;  3RLP A;  4NH9 A;  4LWI A;  2ZBK B;  4XIQ A;  1R62 A;  3WQ9 A;  3ZKD A;  4XE2 A;  4KFG A;  1UYD A;  4R1F A;  4EFT A;  2CCT A;  1Z5A A;  2YE8 A;  1I5B A;  3LNU A;  4MPN A;  4CE3 A;  4XC0 A;  2YE5 A;  4EEH A;  1MX0 A;  4URM A;  3ZKB A;  2WI5 A;  1UYL A;  4ZVI A;  1NHJ A;  4KSG A;  2JKI A;  3QTF A;  3D36 A;  4ASB A;  2H55 A;  2YEF A;  4BAE A;  4XIR A;  3CYG A;  1Z59 A;  4X9L A;  2CCU A;  4BXI A;  1KZN A;  4I3H A;  2WEQ A;  1YET A;  4GFN A;  4HYM A;  3R92 A;  3VAD A;  2QF6 A;  3EHF A;  4FCP A;  2YJX A;  2GFD A;  2WI7 A;  1YC1 A;  3O0I A;  3OMU A;  2YKC A;  1A4H A;  2YK2 A;  2ZDY A;  2AKP A;  2BU8 A;  2YE9 A;  4AS9 A;  2VWC A;  2XDU A;  2BU6 A;  3G7B A;  5CF0 A;  1TID A;  1NHI A;  4B7P A;  3K98 A;  1YC3 A;  4FPP A;  4L91 A;  2XDS A;  2YEG A;  4EGK A;  3K99 A;  4YKW A;  2FTK A;  3OWB A;  2QG0 A;  4JAV A;  3Q5L A;  5CTX A;  3A0X A;  3B25 A;  1YSZ A;  4NH7 A;  2BRE A;  3CWV A;  4ASG A;  1I5A A;  2BTZ A;  3TZ5 A;  5FWK A;  4WUB A;  2QFO A;  3PEH A;  2YKE A;  5CTY A;  3TUH A;  2YE6 A;  5IDJ A;  4LWE A;  2IOP A;  2XHX A;  5CTW A;  3EKR A;  1U2O A;  3RKZ A;  4HZ0 A;  3G7E A;  1BKN A;  3Q5K A;  4WUC A;  4XCL A;  3A0T A;  3TZ2 A;  4CWQ A;  1TC0 A;  2VW5 A;  5BOD A;  2XAB A;  4XIT A;  2YK9 A;  2YGA A;  4AWP A;  4CWT A;  2YE7 A;  4U7N A;  2CCS A;  3CGZ A;  4XCJ A;  2YEC A;  4KSH A;  4E00 A;  2YI0 A;  3HZ1 A;  4HY6 A;  4XKK A;  3R4O A;  4HXZ A;  2YEI A;  1US7 A;  3OPD A;  4O05 A;  5C93 A;  1PVG A;  4XDM A;  3CGY A;  4CWS A;  1I5D A;  5L3J A;  1UY8 A;  1YT0 A;  3C11 A;  3D2R A;  4H81 A;  4MPE A;  4XTJ A;  1B3Q A;  1BGQ A;  3ZXQ A;  4L90 A;  4MPC A;  3A0Y A;  4EGH A;  1QY8 A;  4BQG A;  4PU9 A;  4Q20 A;  4PRX A;  4P8O A;  2QG2 A;  1ZXN A;  2XDL A;  4ASF A;  4YKR A;  2GQP A;  3B24 A;  4JQL A;  3R4P A;  2YGF A;  4O0B A;  5CPH A;  4K4O A;  3FV5 A;  1L0O A;  1YC4 A;  4BQJ A;  3GIE A;  5J6A A;  5D6Q A;  3T2S A;  1UY9 A;  1UYG A;  2WI2 A;  2YEJ A;  2FWY A;  1UYH A;  2HG1 A;  4I5S A;  1H7S A;  3T0H A;  2FWZ A;  4O04 A;  4JAU A;  3B26 A;  3EHG A;  1YER A;  2YJW A;  1TC6 A;  3VHA A;  2CH4 A;  3CRK A;  1YT1 A;  2E0A A;  4KQV A;  2Q8I A;  2HKJ A;  3R4N A;  4HXW A;  1YS3 A;  5JEN A;  4YKZ A;  2YE4 A;  4QPK A;  2HCH A;  1Z5C A;  3ZM7 A;  4R3M A;  3KE6 A;  2XHT A;  4LPB A;  3U67 A;  1GKX A;  4U7O A;  4PRV A;  3O6O A;  4JAS A;  5D6P A;  5FNC A;  2YEE A;  1IXM A;  3TTZ A;  5IDM A;  1TIL A;  4ASA A;  3HYZ A;  4LWH A;  4P7A A;  2IWS A;  1UYM A;  2WER A;  2ZDX A;  4QPJ A;  1F51 A;  4H85 A;  3OW6 A;  2C1I A;  4WUD A;  1AH8 A;  1Y8P A;  3D0B A;  4YKQ A;  4KP4 A;  2YED A;  4FCQ A;  4YKY A;  4GEE A;  4MBC A;  5F3K A;  1S16 A;  2IOR A;  4YKT A;  2ESA A;  4CE1 A;  4YKX A;  3EHH A;  5F5R A;  4R3A A;  4AWO A;  4URO A;  2FYP A;  4XD8 A;  2WI3 A;  4CWP A;  3QDD A;  4GGL A;  5BOC A;  3WHA A;  1UYK A;  2BYH A;  3VHD A;  3EKO A;  2BYI A;  4HY1 A;  4V26 A;  4XKA A;  5D7R A;  3K97 A;  1AM1 A;  3EHJ A;  2C2A A;  4AWQ A; 
#chains in the Genus database with same CATH homology
 1ID0 A;  2Q8F A;  3OWD A;  2XJG A;  5CTU A;  4H7Q A;  4GCZ A;  4EGI A;  4LP0 A;  2BU7 A;  1NHH A;  2Q8G A;  3H4L A;  4MP7 A;  2XDX A;  3H80 A;  3K60 A;  3T0Z A;  4URL A;  3T10 A;  2BZ5 A;  5FND A;  3A0R A;  1KIJ A;  3GIG B;  1U0Z A;  2BT0 A;  2VCI A;  2WI1 A;  4O09 A;  1MU5 A;  2BRC A;  3IED A;  1ZWH A;  2O1V A;  5M4N A;  2YGE A;  1UY6 A;  4MP2 A;  4LWG A;  1UYE A;  1YSR A;  2JJC A;  2Q8H A;  1B62 A;  1Y4S A;  5GGZ A;  3G75 A;  3HYY A;  2YI7 A;  2YE2 A;  3TZ4 A;  4URN A;  4FMT A;  2XHR A;  2XK2 A;  1Z5B A;  3ZXO A;  5M4K A;  3C0E A;  3TZ0 A;  5FNF A;  1I58 A;  1EI1 A;  4ZKI A;  3U2K A;  4CWF A;  3GIF A;  1AJ6 A;  2BU5 A;  3GIG A;  2YEA A;  4U93 A;  1BXD A;  4BIU A;  3BMY A;  5D7C A;  1I59 A;  4B6C A;  2CG9 A;  4GT8 A;  1Y8N A;  2YKI A;  3HZ5 A;  3FT8 A;  1UYF A;  1Y8O A;  4XIP A;  4CE2 A;  1UY7 A;  1OSF A;  4NH8 A;  2O1W A;  2XJX A;  4CWR A;  4XKO A;  4YKU A;  1S14 A;  3R4M A;  1I5C A;  4W7T A;  2CGF A;  1AMW A;  3MNR P;  4L8Z A;  1GJV A;  4LWF A;  2ZKJ A;  3PEJ A;  3FT5 A;  1YES A;  4E02 A;  3T1K A;  3LPS A;  1JM6 A;  1EA6 A;  2YEB A;  3NMQ A;  1ZXM A;  4BIZ A;  3HHU A;  3R91 A;  4DUH A;  3DGE A;  4MB9 A;  3A0W A;  4E01 A;  4O07 A;  2XJJ A;  5M4P A;  2H8M A;  4CWN A;  2IOQ A;  4V25 A;  1YT2 A;  2XDK A;  2FXS A;  5M4M A;  4DZY A;  4EFU A;  4CWO A;  5J71 A;  2WI4 A;  4GQT A;  5M4E A;  3SL2 A;  2YI5 A;  1H7U A;  1UYC A;  1B63 A;  2XX5 A;  2XD6 A;  4EMV A;  5IN9 A;  1AH6 A;  2XX4 A;  3BM9 A;  2WEP A;  3INX A;  2VCJ A;  2IWX A;  2Q2E B;  2YKB A;  4HZ5 A;  2YKJ A;  1Y4U A;  2XX2 A;  3HEK A;  3RLQ A;  4L93 A;  2WI6 A;  3A0Z A;  3RLR A;  1UYI A;  2YE3 A;  3CRL A;  1ZW9 A;  2O1U A;  1BYQ A;  2YI6 A;  2K5B A;  3U2D A;  1GKZ A;  2PNR A;  3Q5J A;  1TH8 A;  2EXL A;  2YEH A;  4L94 A;  1QYE A;  3O2F A;  3INW A;  3JZ3 A;  4PL9 A;  1THN A;  1TBW A;  3B28 A;  4HYP A;  2BU2 A;  4FCR A;  5D7D A;  2XCM A;  2BSM A;  4EM7 A;  4MOT A;  3B27 A;  2IWU A;  5M4H A;  3VHC A;  2UWD A;  4KTN A;  1QZR A;  3RLP A;  4NH9 A;  4LWI A;  2ZBK B;  4XIQ A;  1R62 A;  3WQ9 A;  3ZKD A;  4XE2 A;  4KFG A;  1UYD A;  4R1F A;  4EFT A;  2CCT A;  1Z5A A;  2YE8 A;  1I5B A;  3LNU A;  4MPN A;  4CE3 A;  4XC0 A;  2YE5 A;  4EEH A;  1MX0 A;  4URM A;  3ZKB A;  2WI5 A;  1UYL A;  4ZVI A;  1NHJ A;  4KSG A;  2JKI A;  3QTF A;  3D36 A;  4ASB A;  2H55 A;  2YEF A;  4BAE A;  4XIR A;  1Z59 A;  4X9L A;  2CCU A;  4BXI A;  1KZN A;  4I3H A;  2WEQ A;  1YET A;  4GFN A;  4HYM A;  3R92 A;  3VAD A;  2QF6 A;  3EHF A;  4FCP A;  2YJX A;  2GFD A;  2WI7 A;  1YC1 A;  3O0I A;  3OMU A;  2YKC A;  1A4H A;  2YK2 A;  2ZDY A;  2AKP A;  2BU8 A;  2YE9 A;  4AS9 A;  2VWC A;  2XDU A;  2BU6 A;  3G7B A;  5CF0 A;  1TID A;  1NHI A;  4B7P A;  3K98 A;  1YC3 A;  4FPP A;  4L91 A;  2XDS A;  2YEG A;  4EGK A;  3K99 A;  4YKW A;  3OWB A;  2QG0 A;  4JAV A;  3Q5L A;  5CTX A;  3A0X A;  3B25 A;  1YSZ A;  4NH7 A;  2BRE A;  3CWV A;  4ASG A;  1I5A A;  2BTZ A;  3TZ5 A;  5FWK A;  4WUB A;  2QFO A;  3PEH A;  2YKE A;  5CTY A;  3TUH A;  2YE6 A;  5IDJ A;  4LWE A;  2IOP A;  2XHX A;  5CTW A;  3EKR A;  1U2O A;  3RKZ A;  4HZ0 A;  3G7E A;  1BKN A;  3Q5K A;  4WUC A;  4XCL A;  3A0T A;  3TZ2 A;  4CWQ A;  1TC0 A;  2VW5 A;  5BOD A;  2XAB A;  4XIT A;  2YK9 A;  2YGA A;  4AWP A;  4CWT A;  2YE7 A;  4U7N A;  2CCS A;  3CGZ A;  4XCJ A;  2YEC A;  4KSH A;  4E00 A;  2YI0 A;  3HZ1 A;  4HY6 A;  4XKK A;  3R4O A;  4HXZ A;  2YEI A;  1US7 A;  3OPD A;  4O05 A;  5C93 A;  1PVG A;  4XDM A;  3CGY A;  4CWS A;  1I5D A;  5L3J A;  1UY8 A;  1YT0 A;  3C11 A;  3D2R A;  4H81 A;  4MPE A;  4XTJ A;  1B3Q A;  1BGQ A;  3ZXQ A;  4L90 A;  4MPC A;  3A0Y A;  4EGH A;  1QY8 A;  4BQG A;  4PU9 A;  4Q20 A;  4PRX A;  4P8O A;  2QG2 A;  1ZXN A;  2XDL A;  4ASF A;  4YKR A;  2GQP A;  3B24 A;  4JQL A;  3R4P A;  2YGF A;  4O0B A;  5CPH A;  4K4O A;  3FV5 A;  1L0O A;  1YC4 A;  4BQJ A;  3GIE A;  5J6A A;  5D6Q A;  3T2S A;  1UY9 A;  1UYG A;  2WI2 A;  2YEJ A;  2FWY A;  1UYH A;  2HG1 A;  4I5S A;  1H7S A;  3T0H A;  2FWZ A;  4O04 A;  4JAU A;  3B26 A;  3EHG A;  1YER A;  2YJW A;  1TC6 A;  3VHA A;  2CH4 A;  3CRK A;  1YT1 A;  2E0A A;  4KQV A;  2Q8I A;  2HKJ A;  3R4N A;  4HXW A;  1YS3 A;  4YKZ A;  2YE4 A;  4QPK A;  2HCH A;  1Z5C A;  3ZM7 A;  4R3M A;  3KE6 A;  2XHT A;  4LPB A;  3U67 A;  1GKX A;  4U7O A;  4PRV A;  3O6O A;  4JAS A;  5D6P A;  5FNC A;  2YEE A;  3TTZ A;  5IDM A;  1TIL A;  4ASA A;  3HYZ A;  4LWH A;  4P7A A;  2IWS A;  1UYM A;  2WER A;  2ZDX A;  4QPJ A;  4H85 A;  3OW6 A;  4WUD A;  1AH8 A;  1Y8P A;  3D0B A;  4YKQ A;  4KP4 A;  2YED A;  4FCQ A;  4YKY A;  4GEE A;  4MBC A;  5F3K A;  1S16 A;  2IOR A;  4YKT A;  2ESA A;  4CE1 A;  4YKX A;  3EHH A;  5F5R A;  4R3A A;  4AWO A;  4URO A;  2FYP A;  4XD8 A;  2WI3 A;  4CWP A;  3QDD A;  4GGL A;  5BOC A;  3WHA A;  1UYK A;  2BYH A;  3VHD A;  3EKO A;  2BYI A;  4HY1 A;  4V26 A;  4XKA A;  5D7R A;  3K97 A;  1AM1 A;  3EHJ A;  2C2A A;  4AWQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...