1Y4UA

Conformation rearrangement of heat shock protein 90 upon adp binding
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
489
structure length
472
Chain Sequence
MKGQETRGFQSEVKQLLHLMIHSLYSNKEIFLRELISNASDAADKLRFRALSNPDLYEGDGELRVRVSFDKDKRTLTISDNGVGMTRDEVIDHLGTIAKSGTIGQFGVGFYSAFIVADKVTVRTRAAGEKPENGVFWESAGEGEYTVADITKEDRGTEITLHLREGEDEFLDDWRVRSIISKYSDHIALPVEIEKREEKDGETVISWEKINKAQALWTRNKSEITDEEYKEFYKHIAHDFNDPLTWSHNRVEGKQEYTSLLYIPSQAPWDMWNRDHKHGLKLYVQRVFIMDDAEQFMPNYLRFVRGLIDSSDLPLNVSREILQDSTVTRNLRNALTKRVLQMLEKLAKDDAEKYQTFWQQFGLVLKEGPAEDFANQEAIAKLLRFASTHTDSSAQTVSLEDYVSRMKEGQEKIYYITADSYAAAKSSPHLELLRKKGIEVLLLSDRIDEWMMNYLTEFDGKPFQSVSKVDES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chaperone protein htpG
publication title Structures of the N-terminal and middle domains of E. coli Hsp90 and conformation changes upon ADP binding.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone
total genus 130
structure length 472
sequence length 489
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.80 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1y4uA02
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 1y4uA01
3.40.50.11260 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1y4uA03
2ZDYA 3G75A 1ZXMA 1YETA 4V26A 4BIZA 1UYIA 2CCSA 3PEHA 3A0XA 3O6OA 1YS3A 2XHXA 4E02A 3INWA 4KP4A 1Y8OA 3CRKA 3VHDA 1UY6A 1ZW9A 5M4KA 2BSMA 1YC1A 3MNRP 2XHTA 1I59A 3HYZA 2AKPA 4MP7A 3TZ4A 4CWPA 2XX2A 1US7A 2BU5A 4BAEA 3Q5JA 2XDXA 4BXIA 2K5BA 3Q5KA 4EM7A 3GIFA 2YE4A 4HYMA 4BQJA 5M4HA 5F5RA 2YEEA 2Q8HA 4QPJA 5M4PA 1PVGA 2IORA 2YKJA 3TUHA 5D6PA 3CGYA 4LP0A 5CPHA 3VADA 3OPDA 4GEEA 1TIDA 3ZKBA 4U93A 3JZ3A 1YT2A 1OSFA 2YE3A 1BKNA 3DGEA 5F3KA 3ZKDA 1Y8PA 3HHUA 4WUCA 4CE2A 4HYPA 3GIEA 4QPKA 4U7NA 1AH8A 4HY6A 4XIQA 1YSRA 3HZ5A 2CGEA 1UY7A 4ASAA 1YESA 1U2OA 3WHAA 5CTXA 3ZXOA 2XD6A 1I5DA 4ZVIA 3B28A 2JKIA 2YE7A 2XDKA 2YK9A 2QF6A 2O1UA 3G7BA 3HEKA 5CTWA 3OW6A 1YT0A 4BIUA 2XHRA 4XKKA 3H80A 2IWSA 1S14A 2Q2EB 5D6QA 2EXLA 4B7PA 2YKEA 1AJ6A 1UYFA 3G7EA 4MP2A 5FNDA 2XDUA 3OWBA 2YE8A 2YKIA 4URNA 4H7QA 2HCHA 2BYHA 2WI1A 2Q8GA 1QZRA 1MX0A 4PRVA 4KTNA 1ZXNA 4R1FA 1Z5AA 1AMWA 2JJCA 3B26A 4R3MA 1QYEA 5M4EA 4L94A 2HKJA 2BU7A 2GFDA 4UROA 1USVA 3VHAA 1BXDA 3O2FA 1S16A 3K98A 3R92A 2WI4A 1YERA 3BMYA 5BODA 2ZDXA 3PEJA 2XJJA 2FWZA 3LPSA 2YE9A 2XK2A 2YEGA 4GCZA 4ASFA 1Y6ZA 1TILA 1UYMA 5IDMA 4WUBA 4GGLA 2CCUA 2YI5A 2QFOA 2ESAA 4ASGA 4ASBA 3K99A 2YE2A 3T2SA 3Q5LA 2HG1A 2YI6A 3Q6NA 4CWFA 4JASA 2WEQA 4FCPA 1HK7A 3D2RA 2WI5A 4H81A 3INXA 3T0ZA 3FT5A 2YI0A 2BU8A 3TZ5A 4XDMA 3TTZA 2XX5A 4L91A 1YC3A 3B25A 3OWDA 2YJXA 4O0BA 4JAVA 2VWCA 4FMTA 5M4NA 4YKQA 4LWGA 1YSZA 1AM1A 2YE5A 4URLA 4WUDA 1UYKA 1UYLA 1Z59A 5CTYA 2YE6A 3R4PA 3R91A 5D7RA 2E0AA 3ZM7A 2WERA 2XX4A 4GFNA 2Q8IA 3GIGB 4KQVA 3A0YA 5CTUA 1Y8NA 2CH4A 4URMA 4CWRA 4R3AA 4XITA 2VW5A 2YGAA 5FWKA 1NHJA 2WI6A 5CF0A 4FCRA 1R62A 3WQ9A 4KSHA 4MPCA 3D36A 4L8ZA 2BT0A 1L0OA 3NMQA 4EGHA 4K4OA 4GT8A 2FWYA 1YC4A 1TH8A 2C2AA 2IWXA 2YI7A 5FNCA 1GJVA 5C93A 2XJXA 2CGFA 4NH9A 2YEJA 3CGZA 4U7OA 4KSGA 3HZ1A 2CG9A 2H55A 4EEHA 1KIJA 2XCMA 4XKAA 1KZNA 4EMVA 3ZXQA 3GIGA 4HXWA 2IWUA 3OMUA 4B6CA 4PRXA 2YEAA 4YKYA 4EFTA 4NH8A 4FCQA 3T0HA 2VCJA 4I3HA 2YGFA 3KE6A 1TC0A 4HXZA 4V25A 1B3QA 4XC0A 3C0EA 1UYEA 4XIPA 1GKZA 1MU5A 4CWSA 1UYCA 3TZ2A 3HJCA 4XD8A 3A0WA 4CWTA 2YEBA 4H85A 3RKZA 2IOQA 2CCTA 2ZBKB 2GQPA 5IDJA 2H8MA 3H4LA 3EKRA 3FV5A 4E00A 5J71A 2XJGA 4DUHA 1U0ZA 3VHCA 4LWIA 1A4HA 4ZKIA 3RLQA 5BOCA 4EFUA 3T10A 3EHGA 3TZ0A 1NHHA 1UY9A 4XCLA 4XKOA 3A0TA 4MPEA 1YT1A 4JAUA 4YKXA 2BRCA 2BZ5A 1I5CA 4CWQA 2YGEA 4P7AA 5GGZA 3SL2A 4I5SA 1BGQA 3PRYA 2YEIA 4YKWA 4YKRA 3FT8A 3U67A 4AWOA 4W7TA 4MBCA 3B24A 2PNRA 1THNA 4MB9A 3K97A 2FXSA 4AS9A 1NHIA 4NH7A 5FNFA 1B63A 2XABA 3CRLA 1UYDA 2WI2A 2BTZA 1I58A 4O09A 3CWVA 2QG0A 3EKOA 3R4MA 3O0IA 2WI3A 3C11A 1Y4UA 3EHJA 1B62A 4YKTA 2BU6A 4YKZA 4LPBA 2YEFA 3D0BA 4HZ5A 3HYYA 1UYHA 4HY1A 1AH6A 1TC6A 4PU9A 2BREA 2O1TA 4CWNA 1GKXA 5L3JA 1H7SA 4O04A 2BU2A 4X9LA 5IN9A 2YEHA 1Z5CA 2QG2A 4LWEA 5J6AA 1I5BA 3LNUA 5M4MA 1ID0A 4EGIA 4GQTA 1UY8A 4FPPA 4AWPA 1QY8A 3EHFA 1USUA 2YECA 4HZ0A 4L90A 3QTFA 3U2DA 2ZKJA 4XE2A 2O1VA 4KFGA 1EA6A 2IOPA 3RLRA 4O05A 3A0ZA 4EGKA 2VCIA 4PL9A 4MPNA 4E01A 3R4OA 2XDLA 5D7CA 4XIRA 1I5AA 1ZWHA 4YKUA 2O1WA 4JQLA 4CE3A 3Q6MA 3EHHA 2XDSA 3B27A 4XTJA 4CWOA 3U2KA 2Q8FA 2YKBA 2WI7A 4MOTA 4Q20A 4AWQA 4CE1A 1Y4SA 2UWDA 4DZYA 1EI1A 4BQGA 1TBWA 3R4NA 2YKCA 2BYIA 3A0RA 3RLPA 4XCJA 3IEDA 4P8OA 1UYGA 1JM6A 4LWFA 1Z5BA 3K60A 2YJWA 2GQ0A 3QDDA 4LWHA 1BYQA 4O07A 5D7DA 1H7UA 2FYPA 3T1KA 4L93A 2YEDA 2WEPA 3BM9A 2YK2A
chains in the Genus database with same CATH superfamily
2ZANA 4BWFB 3D43A 2R8EA 4WFQA 1GLNA 1GGNA 1VJDA 1QSGA 5G1OA 4YBZA 2I34A 4YDRA 1CFZA 5C7IO 4PO3X 1XLTC 1UBUS 2ZCJA 5K36E 3WHPA 3RTCA 4CMIA 1U1CA 4LDJA 1UEKA 2RGCA 2CUTA 3IV9A 1R6UA 1QGOA 9MHTA 2QM0A 3K20A 2B21A 5BYJA 4ARCA 3WL7A 4Q48A 4JP5A 2YRXA 3V3KA 2CHEA 1ZY2A 5F2EA 4HX2A 1E5DA 1S8OA 4EFKA 3IB3A 5HA5A 4OBWA 4X20A 2WILA 4F3KA 1WNTA 1FY2A 1GU0A 1LBTA 5JYEA 4HGRA 4TV8B 3JQ9C 1GGVA 4LY3A 2DZDA 3W5DA 2KBEA 4F4DA 5FNZA 2GMWA 2O1UA 1K98A 1SKBA 2CZCA 2PGNA 3QNMA 2ZAMA 2YJNA 4H6PA 4C0HA 1P19A 3H9EO 2FZEA 2CB0A 3TR5A 2DPHA 5KOJA 2WJYA 3OQBA 3HV2A 3CRW1 1PKPA 4HGPA 2FWZA 4PZYA 4RJLA 5FI3A 1DXHA 3MC1A 1NRWA 3S2FA 4UBMA 1B2RA 1S2IA 2JD0A 1CIJA 1PWZA 2NN3C 3C7DB 4FCPA 3B5EA 4TVOA 3ZGYA 3B2EA 1U1GA 3UV3A 5JDIC 1U9ZA 3OQJA 3UNXA 1IHYA 5M4NA 3NVAA 1K6MA 4YDQA 1JXMA 1CRWG 1OC2A 3A4IA 1IM2A 4LQDA 3C3KA 5HZGA 2OLEA 4D9KA 1I4TD 2O3SA 3I4FA 2CB9A 5E9WA 2WI6A 4UT4A 4ND3A 4DR5B 3PPXA 4J9UE 1NMEA 3UMFA 5DP2A 1JAHA 3DPSA 2PFKA 3DPUA 2CVHA 4E88A 5CM8B 3MJDA 1XWIA 3OZSA 3E3MA 4IJUA 4P3PA 1PU2A 3IUBA 2UU9B 4FKMA 4RKQA 4QVIA 1XI2A 5AK4A 3K5HA 4QTUB 2FR8C 4OB7A 2J0UA 1GT6A 1ZMOA 1PZGA 1SZDA 1T5HX 5GADl 2HH9A 3VH2A 2VZEA 2WRZA 2PPLA 4L2IB 3THWB 3UJHA 3S44A 1C8VB 1P7VA 3NHAA 1LC0A 2BZ5A 2ZIVB 3I6ZA 1BDJA 2QVXX 1TCCA 1CQZA 1Z6PA 3RU7A 5ERXA 3SF8A 3C3JA 4NULA 1BJRE 5A6SB 3T1YB 3GC6A 1IXKA 2QL7A 4RD6A 4F5YA 3W5VA 4HJRA 1RWPA 5LWQA 1XPOA 4EZIA 4O5AA 1PR5A 4YKZA 4DC1A 1G21B 4CW7A 1CS4C 4FR2A 4RKFA 2ID9A 2NYVA 1E3PA 2HMVA 1CG6A 4WLOA 4BKMA 1QYDA 3DEHA 1F2VA 2C5SA 3QE3A 2P91A 3R9KA 4UMDA 4BY9E 1DQNA 4UBJA 3EHEA 2PKWA 3FUXA 1Y0BA 5ISMA 1FBNA 4RSRA 1CEQA 3U2DA 4O5OA 4FFWA 3VU1A 1KH1A 1T2FA 4FB5A 3LS2A 2B7CA 4EKYA 1NNLA 4O2BA 2XJ4A 1VG1A 3OJCA 1NG9A 1IYZA 3EHHA 2QTTA 1NFRA 4BFWA 2AGVA 3I64A 1OT3A 3CURA 1U8AA 1H4QA 1XAGA 3OX1A 4PZUA 4O4HA 2DEUA 3DLAA 1X8LA 3DF7A 1H73A 3SQLA 4O4LB 1PVOA 4WINA 4LZJA 4QQKA 3PPWA 1REQB 1Z5NA 3L93A 3JVDA 2CLHB 1YS9A 1E92A 1W4RA 3EBPA 4ZV7A 4D80A 4DSOA 4BKPA 5GJCA 4DPLA 3HEAA 4HRYA 4UAVA 2BSMA 2C4TA 3W5BA 3S81A 2GAOA 1JPUA 1HEUA 4MP7A 4ALNA 4UBIA 4EIWA 1GQRA 1G1MA 4D1YA 4F0JA 4TS9A 4UTNA 1WNFA 5ALKA 3F7NA 1ZX1A 4C0WA 1FX0B 1GG2A 2J5BA 4I50A 2IGBA 1UF9A 4KXMA 2QW8A 3KNZA 1ZW1A 5C34B 1G2OA 3EY4A 1RWOA 5EGSA 2DFVA 2ENWA 2IBMA 3L8ZA 1MH9A 3EOZA 2O8DA 2RHDA 3S1LA 3GFRA 3CZRA 3FTCA 3PFBA 5BV7A 1A8IA 3MT8A 3HVJA 5L4LA 3BWYA 3LWNA 4R2HA 3RHFA 2VT6A 4LA4A 8GPBA 3AEKB 1TYCA 2JIDA 4HTFB 3R76A 4ZZIA 3RV4A 2OSBA 3PHHA 2P90A 5LR6A 4DDHA 4BX2A 3LPDA 1T9HA 2R65A 1CNEA 1T4GA 2CNWD 4I5EA 1NF9A 4AIMA 1WBBA 1IY1A 4Q1EA 2FI1A 3PUKA 4DLBA 1AO0A 1MPTA 3PR2B 3U7GA 4CM1A 5CYFA 4OBXA 2WI4A 3W4IA 4DR4E 5HJ5A 4LJYA 3QELB 1T6YA 2HMYB 1Y6ZA 1VE5A 3OQIB 3HYSA 3CIOA 4A5SA 4MJ3A 1RYHA 2KM1A 2NSYA 2DTEA 4YP6A 5BPHA 3K99A 2B4YA 5I7OA 4L8FA 1OUMA 4L8WB 2OXCA 2XKKA 3PA8A 4GZLA 5CVJA 2DTDA 1LVHA 3U4CA 1A8UA 4OHPA 2P68A 2XI4A 1QV6A 3OJWA 2R8ZA 4HB4A 5CTYA 4UFNA 1C0KA 1ESNA 1N8NA 4Q9NA 4R3AA 3IVMA 2Q9AA 1XCPA 4X1KA 2PGIA 3D8HA 2WNHA 4LCEA 4DJEC 4CG2A 2FX5A 4BLUA 1Z15A 5FBZA 2OHFA 2CHQA 1JR2A 4XKAA 3DEKA 4M98A 1OIWA 3BD7A 4B6CA 1FRQA 5CNKA 3QHPA 2A9KA 5GJVC 2A9QA 1XZBA 3NS7A 1MR3F 5EL9A 3GBPA 2ZULA 2UAGA 1ZN8A 3A9TA 1FJHA 3TZ2A 3KZVA 2WT8A 2QVYX 4BO8A 1Z2PX 2IQ5A 3I6BA 3KDPA 3U61B 4DV1E 8ATCA 1OX5A 1XJ5A 1F20A 4ZKIA 2J09A 2O7RA 1PFKA 1R3UA 3E5NA 4WZAB 2HHLA 5F5XA 2UUCE 2P78A 4OIFA 3TLZA 3TB6A 1GPDG 3I32A 4DR2E 1PSZA 4C6TB 5EL0A 2RC5A 2BE7A 3FHOA 1DAHA 4UZFA 4ISAA 3EVEA 1M8JA 3DEYX 4LXQA 3AK4A 2HJWA 2RKWA 3TW6A 4F92B 3SQWA 3Q7PA 1BN7A 4TLDA 3PJDA 1C7QA 3N3AC 1IU9A 3AB8A 4JVSB 2GILA 2XDYA 3RSQA 4HYTA 4GMDA 1KFKB 3V1TC 3IDAA 3H2SA 4L02A 3OJFA 1HC7A 1WCIA 1ORTA 3HYRA 1DJMA 2J9XB 2FP4B 2HMTA 2NUTB 3PJEA 1LZLA 2Z2JA 1GSHA 3IP6A 3F1KA 3ZOZA 3P45A 5F5NA 4ZQHA 3JALA 3DLPX 3ESQA 2IOPA 3T9AA 4OSPA 3THXA 1A69A 2LIVA 1RBYA 1RJFA 5BV8A 4EEKA 4UBKA 4YPOA 4M2LA 2UXBE 1HDIA 1YC5A 3M49A 2OVFA 5JJBA 3PHBE 4K6MA 4GXRA 4AVYA 1M2EA 2IXDA 2Q9BA 1Z5BA 4BKOA 4CQMD 4HXEB 3KJZA 2YZ7A 4JBWA 3CCCA 2YDXA 4C08A 1EYZA 2HA0A 3X1DA 3QKIA 2XHXA 1PS0A 2C9MA 4B83A 3FUWA 4MPDA 1KC3A 2XHTA 4YRRA 4KBFA 3NHYA 1I5EA 2VPIA 3LO5A 4R1TA 1UAAA 4H3VA 4XM1A 4WY2A 3FVTA 2ONCA 5EA2A 4N82A 4RHCA 1E2HA 1MORA 4RABA 4ZCQA 1E9RA 1H0RA 2E4VA 2NX2A 2HQBA 2OORC 1GZSA 3SNHA 1M2HA 3GVCA 2W6MA 2H2AA 6PFKA 4DR1E 3RRZA 1KR5A 3DUFA 3GFFA 4PC1A 2BFPA 3C6ZA 2BI4A 5FORA 4KR6A 1A0OA 4XTCS 1BCSA 5C0XC 4UEQA 1EHYA 3SXPA 4M9CA 4K2HA 4LXYA 2W2MA 4YJ3A 1MX9A 4AC9A 4ESHA 2A57A 1A3CA 3OF5A 1XZPA 5FO0A 5AJYA 4ZAYA 2NVOA 2QP4A 1GN8A 5JD4A 1W87A 5FL7A 5JSYA 4ZYXA 2R1TA 1GPJA 1D2HA 1BXDA 2FQ1A 3HBJA 1ZICA 5F23A 2EJUA 1PNVA 5IKMA 4LMBA 4MIYA 1JNYA 3Q15C 1FE8A 1T1RA 4LG1A 3TLJA 1K9VF 1UH5A 4RZUA 2KWIA 4BV2A 3I53A 2Q4BA 1FQKA 2M6RA 3ZWOA 4PGGA 4WXPA 5ENVA 4HNAA 2Q6KA 1NU6A 2R79A 1R5NA 2WEQA 1D2CA 3PT9A 3N2NA 4N7JA 5ICFA 5HQTA 3BD6A 1D8AA 4G4SO 5K8JB 1WPRA 3H1GA 3TEMA 1Y8NA 1BRMA 1X1QA 2R1VB 1V6SA 4QUJA 3O91A 3MCWA 1N36B 3TGLA 4M1WA 2CUKA 1ZKMA 3ODPA 3OQMA 4OX9E 5ITWA 1DKRA 1YACA 1RWQA 1L7NA 4JJ8A 1S1MA 4WLFA 4X65B 1KIJA 4D82A 3FF1A 2XTJA 3KJNA 2P6OA 4GOOD 2P11A 3FZGA 3D0QA 2V98A 1OD6A 1OWPA 2ZQ5A 5E2IA 3ER8A 4KAAA 2R8YA 3C85A 1XRRA 1FQJA 2XWQA 4LYAA 2VQDA 4OD0A 2R8XA 2PNMA 5ARCA 3MINB 5EHIA 2WJPA 1RI2A 2BOVA 2ZRMA 3GAMA 3VPHA 2HO5A 3GD7A 3PR3A 4LY0A 2MCFA 4P83A 3DC2A 1GL6A 4Q93A 3BYZA 3DD6A 4MYDA 2CLKB 3ADOA 3L7MA 3Q98A 3G8CA 2P2ZA 1S4EA 4QICA 4FCCA 4JUFA 2HWWA 2WIFA 1J25A 4RFVA 3LY7A 1C80A 1L4YA 3ORSA 3S1SA 4OF4A 3U7IA 3BWMA 4LXHA 1B62A 1B8OA 2ZWPA 3EB9A 4GPD1 5TMPA 3ETHA 3DC7A 1IATA 1SCDA 5T4HA 3BORA 4MUKA 3QITA 4PNZA 7MDHA 1M2KA 4EPWA 1N7IA 1E61A 1F3LA 3KBOA 1DG3A 521PA 1Z88A 5IP5A 1LBIA 1NMYA 3TD2A 2OZLA 4AWPA 2OBNA 2PBRA 4DV3B 1I6MA 2ORYA 3UWSA 3LIIA 4YMTA 1DEAA 5F21A 2FEMA 2ZJ5A 1T2DA 3QEMB 1V9LA 2ISQA 4AJNA 2PO5A 5E4TA 4LXTA 4OOEA 5GZ3A 4GP9A 1Y60A 3SJCA 1NUTA 2B69A 1BX3A 5DHSA 1Z7YA 4CQJA 2X4LA 3TW0A 4DPTA 3EWSA 4P8OA 3EC2A 4EP1A 3HN6A 3BQNB 1KDZA 4ENPA 4Q3NA 2ZWVA 4ER0A 4KO8A 3T1NA 2YXBA 3PS2A 5CXQA 3KSAC 1HT0A 3HU5A 3I9NA 2VZ9A 1IBSA 2ZIFA 1EWRA 4DMGA 3F6BX 4B73A 2YV1A 2X1HA 3GEGA 2G71A 3L82B 3ZBTA 3PVCA 5JYCA 2PD4A 4FJ2A 1Z0UA 4REQB 2AG1A 2BRUC 2QSJA 5IG2A 1Q0LA 2P2YA 4WCFA 1PV4A 2Q0HA 2J8ZA 4BQRA 5CD1A 3HXMA 3LDGA 2PZGA 2VP2A 2AE2A 2XUQA 2XDQA 1PG2A 1XTBA 1A88A 1ISRA 1OC4A 5HIMA 2I4MA 1R4AA 3NT4A 2R8OA 1O8CA 1Y1QA 2JAOA 3G0IA 1P4RA 5F5LA 3OOYA 3AHDA 5KINB 1SKYE 2V2VA 4HD8A 4UEKA 1B6GA 1MJ5A 4IFDF 1L7RA 1TU4A 4Z7NB 4DRZA 2AEJA 4DADA 2VSOA 3CSUA 1V3TA 4IAOA 1S3FA 2J5RA 2JCGA 1U9IC 2NPOA 3VI4B 4PFJA 2AIRA 4D6YA 3E70C 2HXSA 2B83A 1G20A 1WABA 4TGLA 3ZGOA 4HKTA 1G5QA 3V33A 3DAFA 1FA9A 5JSZB 3MIZA 5CT4A 3A1VA 1KYYA 3VX4A 3DGEC 3T0ZA 3PBKA 2JGDA 3PIIA 3TZCA 3G5TA 2VF2A 3WP1B 2XA2A 1JHRA 3F46A 1YS1X 3IKJA 3M6FA 4CQMB 1U4SA 3GT4A 4WESB 4XRGA 1T3HA 2JDID 2RONA 1J97A 3CLTD 2O7VA 4AURA 2VHQA 1NBMA 1F2UA 1NUQA 4M88A 2IPOA 4RF4A 2AJCA 1PJSA 4HNQA 5ERYA 2RH8A 1COZA 4WBNB 3ANSA 3PC2A 1W4BA 4HB3A 2GEUA 1RYDA 3ONWA 4MRAA 5B64A 2V7UA 2Z9CA 4BBZA 3RCBA 3OEWA 1IOVA 4EFTA 4DLKA 1V7ZA 4EG0A 5JXGA 3ZLVA 2IEAA 4CKWB 4XC0A 3PHJA 2OBXA 1M8GA 2C92A 3A0WA 1SOVA 2WTAA 7AT1A 1K6IA 1Z39A 4LVCA 3GR6A 1E2LA 2BISA 3ZTYA 3HWWA 4S04A 4Q37A 4UW9A 3FOCA 4KPGA 4F4CA 4JI0I 4II3A 2A1TS 4ZI7A 1FTYA 1Z83A 3CPHA 3T7EA 2YEIA 3ZDFA 5D2CA 4FFOA 4JP3A 3ENVA 3TNFA 1KZYC 3B6EA 2D59A 2P5SA 4OG2A 3KKPA 1Z0TA 2IF0A 2AOTB 3ODGA 4MRPA 5K36A 2QW0X 2Q41A 1Z45A 3F47A 2R6DA 1G5FA 1JW9B 2JKYA 4YFYA 5BRJA 4R1PA 2FSVC 4S1NA 4UUQA 1JIIA 4R51A 2P4EA 4IJQA 4DR4I 3SYTA 5KYXA 4PU9A 4TMXA 2CL0X 1F7UA 4NXNB 1EXNA 3V8BA 4OKSA 3FRIA 2ZB4A 3U31A 4JITA 4K81B 4LN1A 2WA1A 2B2CA 4NYMR 2IKSA 3MLAA 1RACA 3ABIA 3OX2A 3OPMA 2WFAA 2O2SA 1NXQA 3BTVA 4G1BA 5DNDA 4B7UA 3RAJA 4TZ6A 2OXTA 1KIFA 3CLSC 3TECE 1J24A 4MROA 2NXNA 1ABFA 2J4FA 1OKKA 4MH0R 2WWHA 5GZ6A 4NATA 3DWEX 3S2IA 1IG0A 3FTQA 4PX9A 1SJ9A 2JIZD 4IY1A 4I99A 4UEWA 5KWIA 1VIAA 3LFHA 2HHCA 2R6AA 3VR6A 1GGHA 2GA9A 2EVWX 4D5EA 2Z3WA 2I8LA 2DPXA 1ZU4A 4TT3A 3LCRA 1PJQA 1NBOA 2BM9A 2UYCA 3C6KA 1I5RA 4MUHA 4ETIA 3FDZB 1EFVB 1ENOA 3BB3A 5EMMA 2XBUA 1XRLA 3R3ZA 3SWWA 3G2KA 4BS9A 2IUFA 4DV1I 2EF1A 1GUZA 4AYXA 1D9XA 5JS2A 4KGXA 2NU8A 4QULA 3G2HA 2GAJA 5CM2Z 5HMMA 2R7NA 2Q4TA 3PL1A 4RJTA 3GFBA 1MB9A 2UUCI 1MB4A 4BPBA 1JQAA 3QT8A 3VFDA 2E55A 3N07A 2WA2A 4DR2I 4Z1MA 3WTCA 5BUCA 3E9ZA 4V39A 1CY4A 1PE0A 3QVKA 1T9BA 1XLVA 4YRSA 3FYDA 1YB4A 1G6Q1 3I5MA 3DL7A 1GUDA 4K3UA 1DINA 3V7UA 3E3OA 1G0NA 2CV2A 2Q27A 5DH9A 3TQFA 1T35A 2BUAA 5F1KA 4B3RI 4JUBA 1ODTC 2BGUA 4X90A 4LDAA 5P21A 4Y2HA 1AC5A 1HE8B 3ZEAA 4PCAA 4BLOA 4X3OA 2QUKA 1PR2A 2NOAA 4CKXA 3HPQA 5L4SA 1RJGA 3TNYA 5ICMA 5EHGA 3WS7A 1ZOLA 4A26A 1KSFX 3QHAA 1Z07A 4GIBA 1OH6A 1E3LA 5T8KA 2MJLA 4IJWA 2PJZA 1BEEA 5EKTA 1CQIB 4P32A 1U7PA 3ZDDA 4A8JC 4QEKA 3KOOA 2ST1A 4OH1A 5CT8A 1DBPA 2P6MA 2UXBI 4V3BA 1L3CA 1YXMA 1Z6GA 3TZ5A 4B6SA 5AJTA 2NQ8A 3M1LA 3ZWQA 3OA2A 4GFDA 2NNWB 5IUJC 1ECPA 4EHNA 3L4KA 5TY0A 3GGDA 3W79A 3TCKA 2ZYGA 2A5GA 3LVRE 3UY4A 2D2XA 2Z1MA 2J3DA 3VR5H 2VQSA 1R62A 3KZCA 1M9NA 3U7JA 3QP9A 1JEYA 3FGOA 1YR2A 1YFJA 2IWXA 2GDJA 5DNLA 3CR8A 5AVSA 2H4YA 1KXZA 4HWPA 1QHGA 1K63A 4LKRA 4R3UC 1WW8A 3IKTA 4AQDA 3R7BA 2HZBA 3RFCA 1S2GA 3OY7A 1CIPA 5EQFA 1DJLA 1QBKC 2IP1A 2BUBA 2HSWA 2FDXA 5C8YF 1EQ2A 1WXIA 1LKZA 2Q7XA 3HQ4O 1R9NA 3KYDB 1ZJZA 1CVIA 5B3LA 1VGRA 3TZBA 5L45A 4M3NA 4CEHB 3ZW8A 5KB3A 4ZK6A 1T8SA 2XYPA 1ZD5A 1CDEA 1KVKA 5J2UB 2EX4A 2ZREA 3FNHA 4GSLA 5DN6D 2IYYA 1WE2A 5CB6A 1FZQA 4I5SA 1R5OA 3PHIA 3A0UA 3LP8A 2H1LA 2C0PA 3W7VA 1G7RA 4PYLA 2NN6C 4NV0A 1Z0KA 1TQ2A 5LB2A 2A94A 4LHVA 4C6RA 3AF6A 1P7CA 4GZ5A 4DIDA 4U9IS 1V35A 3A9UA 1GNQA 5FUVA 3CF2A 4DRYA 3MMXA 4MVJE 4IKOA 4E21A 2HX1A 1EK1A 2VUSA 1UZUA 4EHKA 1X7YB 4ZVRA 1WXDA 4C07A 4DQDA 1GKXA 4QXOA 4GOMD 2X8JB 2JFQA 3A05A 1UBLS 4O33A 4RQTA 5I4BA 2ADFA 5TQ0A 4CLRB 3K6SA 3FWHA 2NSLA 3HSSA 1C3OA 3LKVA 4JI4E 3UKJA 3OKPA 1HNZI 1T36A 5AH0A 4QYTA 4GRDA 2QTCA 2VUHB 1BS1A 3RC8A 1OLSB 3KCQA 2LNDA 3QE4A 1G5RA 1XCLA 1EB9A 3BXPA 2OGSA 4OTZA 4FOTA 2JL1A 3NZEA 7ABPA 2JFVA 3KJXA 5IAEA 2XNKA 5ITZA 2JW5A 1KY4A 2NUAA 2H0AA 4PEVA 1Y9JA 5GWXA 2ZTHA 3L8MA 4BVKA 4WVFA 4JXKA 4E02A 1UFRA 1JFSA 1QG4A 4A6PA 1H42A 3WGZA 4GXNA 5LA6A 4YB8A 4YGYA 3VDXA 1FP7A 2PKRA 4FONA 3JY6A 3FM9A 4IG9A 4BNHA 4MARA 1SRRA 3CUUA 4HGYA 2OBMA 1L1FA 4C4AA 2YEEA 2V7EA 4DCGA 4GP7A 1IJKA 2GS8A 4Q3LA 5ELMA 2PNZB 2J46A 4WFIA 2GRAA 4AMBA 2C8JA 4RVSA 4UVIA 3EOAI 1RLIA 1CUIA 4ZV9A 3LCCA 1QQ6A 3B3JA 3P2JA 3PFIA 3WQHA 3C3BA 2ETVA 2NVUA 5FLYA 2AI2A 2M32A 1ZW6A 2GK7A 1QBGA 3HMKA 4EG5A 2PCLA 4UTGA 4G81A 1DC4A 1I5DA 2P79A 3B28A 1ZBQA 3KJIA 8LDHA 1K4MA 2R6CA 2YNMC 4IZ6A 3DSRA 3DWFA 2HSZA 2WI1A 5D5QA 1T8TA 2GN6A 3B85A 2LP4Y 1JHOA 2O8EB 5KVQA 2HKJA 2X6QA 2BZ0A 2FB9A 2P9EA 4R8KA 3RSGA 4RSGA 1H5NA 1P81A 1O9HA 3VAAA 2O2HA 3R6GA 1PR4A 1FCJA 2HRBA 1JSXA 3AG6A 1Y3CE 4HG2A 2VT7A 3GQBB 1H8ED 1OAOA 3WZ2A 1L8LA 5CLIA 2R44A 3NBMA 1VYTA 4F38A 4KMOA 4KNYA 4EGCB 5FA8A 1X74A 5AW2A 4ZOEA 3WGNA 3AUSA 3QXSA 3CXUA 4LXXA 4H4DA 1PZFA 3GT7A 4J0GA 2RD2A 3A0YA 1JE0A 5EYPA 2Q2QA 2C9CA 2RBGA 1HTTA 5E1OA 1KP2A 3VNUA 3AIMA 3ROZA 1KKUA 2GJKA 1WV1A 3E8XA 5FHRA 1JECA 5F7JA 4B75A 3PKIA 3IUYA 5AW7A 3OOJA 1WV0A 2BCGY 1WMDA 5UKDA 2DG2A 2JFNA 1W88A 2AG5A 4CWSA 3OIYA 5AW9A 1R4NA 4NENA 2VKTA 5IKOA 3UAOA 4DIKA 1MOZA 1IG3A 3OCVA 2C0CA 4RYLA 4CLOA 3DW3X 2XIJA 5AYVA 1XMOE 4FW8A 4OU4A 4BAGA 5AJXA 2B1JA 3IAXA 3QFTA 4U63A 1VHTA 2O20A 4YAGA 1MLDA 2WYHA 3TRKA 4JI7B 4P3XA 4G36A 1UIRA 5CLLA 3MVEA 1NN0A 1XIVA 2EQ5A 1T2EA 3OLWA 2L69A 1UBCA 2IZOA 4R05A 5CLGA 3V5NA 1WEKA 2XMGA 5TDHA 4PLPA 2Q5EA 4LCFA 2FMHA 4KN8A 4RPLA 3DONA 3L0DA 2E85A 1TT7A 1QE0A 3DO8A 1PV2A 1LRLA 3IQIX 1RHMA 1U8TA 3ZY6A 4J0HA 3KJEA 4QATA 4LDRA 3AVVA 3P9QA 1N7GA 3ENWA 2AOUA 1KMNA 4CIXA 3S2GA 1Q7GA 1E1MA 3THYB 5EVCA 1W34A 3CRRA 1T3GA 1JWBB 4IP0A 2ATCA 3MWEB 2ALJA 3DCJA 3C0KA 3RUHA 3OFND 2IU3A 3GUUA 3KUUA 1R66A 1CDOA 1SUEA 5ADHA 3BSWA 3FLAA 3WGKA 4K6HA 2XXAA 2I7TA 3QLUA 4EGQA 2F00A 3BXZA 1XYVA 2QQEA 4QLAA 3UK7A 3CVUA 4MMZB 4I81A 4FWDA 4KHPI 1Z2OX 1ONBA 4EY5A 4UDOA 4DOMA 4L93A 4LWPA 4BNMA 1JFVA 3P9XA 3IOYA 5HCNA 3W5SA 2QP9X 3WOHA 4B1FA 4KUEA 2YWGA 2EWWA 4YH1A 2G06A 3WQSB 4AY6A 2NMVA 2FJ0A 1MOPA 1KR2A 1RAIA 2OCYC 3QVLA 4TRMA 4O2RA 1XZGA 2FPSA 4D9GA 5IVDA 5SZJA 2OXIA 3JQPA 3JQAA 3C3AA 4KKXB 3MTJA 2DC1A 1XQ1A 4E1AA 3GLTA 3ZDZB 3D1LA 2O2CA 3KETA 1ZRSA 2YVUA 4M8IA 2AFRA 5JPCA 3O74A 5FT9A 2B9EA 4MAAA 1T3ZA 4DUYB 1HL3A 1C4XA 1DP4A 2PMFA 4ZT7A 4DL9A 3JVUA 5DM4A 4Z4FA 1NP7A 1DWPA 3BEOA 4NFLA 2OQ2A 1OX4B 3LQKA 1L4FA 5F2OA 3NHZA 3LQRA 1ZCBA 1CUGA 1S14A 3WZMA 4BFVA 1ZZEA 1UBGA 5KTNA 1K6EA 4HTAA 4MB2A 3EMDA 3ORRA 2OCLA 1CV2A 4E07A 4G0ZA 1QIJA 3L04A 4DBLC 4ESOA 2NSDA 2FEXA 1WHSB 1QO9A 1JEQA 1MC1A 5I8WA 1KY5A 5HRAA 3EXEB 2C5GA 3SOZA 3AY3A 3U44B 5FADA 3WGGA 4B5LA 3T2SA 1G9XA 4ZIRA 3EEOA 4DSZA 3LVFO 4WSOA 3M8KA 5JAHA 1WPGA 2PS9A 2YS6A 2FX2A 1ZYUA 1XJ0A 3TRIA 1ZGBA 4GF5A 3MXOA 2J59A 3QOYA 2YE5A 5EIWA 4NCBA 5AUNB 4PLCA 3IIJA 4L16A 5EIHA 4M1OA 1QCCA 2FPLA 2ZIUB 4ND8A 2BFFB 3JZAA 1BYUA 1GPBA 1S5PA 1EDZA 1KOJA 3RD5A 4B85A 1KTVA 2RK4A 4BE9A 3K4HA 3OD5A 1SA0B 5HUJA 2C5BA 5IFKA 1K8RA 2N42A 3OJLA 3EZ9A 1P0MA 4K40A 3R7LA 1PJBA 4CF6A 4FLFA 3R5KA 4BQFA 1IL0A 2G77B 1JP7A 4NH8A 4GU5A 3NOQA 2ZK7A 2QWXA 5K3OA 5CFMA 1CETA 3LBHA 4IW3B 1WB5A 1UYEA 4QDZA 1V5GA 2AEEA 2Y0BA 3KYJB 1UZNA 5TS2A 4NZOA 3HC7A 3PUIA 4D4LA 5EZYB 4XJXA 5LN1A 2CBZA 2YWFA 4H35A 4O02B 4F1JA 3A0TA 5CAEB 1XHLA 3S3TA 4I6EA 1P1KA 4ZC1A 4HWKA 4MVXA 1XZNA 4BNXA 5LDDC 3M3DA 3AHHA 2C58A 1O08A 4X85A 1U11A 1U9JA 3WBJA 2DWQA 4EB6B 3TG8A 3Q5GA 3A2NA 1RYEA 1R88A 4G07A 4DQXA 3A70A 2BHTA 1Z4MA 4GGMX 3KKQA 1UBJS 2ABWA 3IL2A 1XTSA 5ESWA 2ZJ1A 3KYCA 1ORHA 1MABB 2DMRA 1FPQA 2LRHA 4HNSA 3HCBA 2HQOA 2QG2A 4L4XA 3E58A 2QGZA 3M70A 3FWYA 2OPHA 4DLXA 2P30A 1UEJA 4IOKA 4LFBE 2W9XA 1RKXA 4HFMA 2GEBA 1RVV1 3QVTA 3LK6A 4GUDA 2X6TA 2YINC 3X2FA 4F4UA 2O3TA 1GZVA 1CZOA 3G9TA 2QHXA 3DNPA 2B4RO 3ZDAA 3RC9A 5TXGA 5LJIA 3BREA 1NBEA 4M0LA 4O07A 3Q87B 2FYPA 3SM9A 2VQFB 1T9CA 4NICA 3X1MA 5H4GA 2HEGA 1C81A 4E11A 2IYRA 2JATA 2B4KA 5CHYA 3VNRA 1N2IA 3EYAA 3WB0A 2IOYA 4FC6A 3R44A 4Y6QA 3OLVA 1JDVA 4BAEA 2A9RA 5JI3E 3N8IA 821PA 3QOFA 4H4CA 1PJTA 4MB6A 1C0IA 2HSEA 2OMEA 3BWVA 3I62A 3CYFA 1UOQA 5BSRA 3VAZA 5KYWA 4C0SA 5L8VA 2JFZA 1A4RA 1SEPA 4X7MA 3OPDA 2I91A 4X7PA 3UOWA 3UWKA 1YE5A 3LO8A 1HNWB 1M66A 2ECQA 2BR2A 1MDBA 3BFXA 2AN4A 4P1ZA 4KXWA 3MQFA 1U5AA 2C3YA 1UMDA 1VRVA 3MQ4A 2OPBA 4DCMA 4MVJI 3TUIC 1C1YA 1EJBA 1XZMA 1XKTA 2WF9A 1V5IA 4RLSA 4P0QB 4NE7A 3L2OB 1UCFA 1GYQA 4JI4I 2NTVA 5C5EA 3N05A 2V7GA 2OCIA 2AZXA 1ECFA 2JLUA 2IBTA 7REQA 2G0TA 5AOVA 3HCRA 1UMBB 5JC1A 1A9YA 3G59A 4Y9RA 4R3NA 1XTVA 3DWGA 3ACDA 3I42A 4G37A 1AQ6A 1E7YA 2QTGA 3COJA 3S2EA 3SJBA 1W4AA 2ZXUA 2VR1A 4E94A 3ADCA 3DYIA 2GJSA 1PFYA 4KYUA 2TECE 2Q1YA 4MMXB 5EFZA 2HV9A 4BASA 5E6SA 3F3YA 4YT2A 1EK6A 1Y6JA 3FNEA 2OKGA 1AOXA 3F3KA 1XXHB 1M74A 3DXFA 4YPVA 4Y67A 2CJWB 4CF5A 2XOEA 4FYPA 1EHCA 3B3QA 1N77A 2I6FA 2B6NA 4PYKA 2FGKA 5EJ2A 3RUEA 4I3FA 2VYCA 1WXHA 3GARA 5IDXA 3R9IA 1JV2B 3CUEF 2RHBA 4B09A 5EINA 3A11A 1T0BA 2CFCA 1GY8A 3V8NA 2HK2A 3K2IA 4AJ2A 4G0MA 2WD9A 1I51A 4MDFA 1FUEA 4K6OA 1UBMS 4YMGA 4GE3A 2G36A 1E79D 2JGAA 3V2IA 4XDZA 2FRDA 4C6HA 2RSLA 4C0KA 5ABPA 3TLXA 1JHMA 3KB6A 4MRRA 4DTCA 3PEWA 4I6JA 2QQ5A 4GO1A 2OCAA 1GZUA 4DKJA 2AUNA 4U7DA 1ISIA 1TUIA 2IKQA 4OB6A 4D0GA 2MSCB 5BUSA 4Q4LA 3PDHA 5B3JA 5DWQA 2YZKA 5EJ5A 4PY2A 1ZMXA 3G1WA 1Z6YA 4JXZA 4HX5A 2G70A 5FOQA 3MFYA 4KIFA 1Z75A 4Y9DA 3VYSB 1NNEA 3ICVA 3PK0A 1TMGE 1PSWA 1WDMA 2ARKA 2CVEA 3BRWA 1HA3A 2WJHA 1M0EA 3I52A 2I2BA 4HAOA 4MGEA 2AK3A 4A36A 1WY7A 5D01A 4YJ2B 1QVVA 3H13A 3UH0A 5BSTA 4FYKA 1V7CA 5CCEA 4OI1A 4E01A 2Q6TA 3OZVA 2WI8A 2Y9PB 2DP4E 2PKQP 3QLVA 4Q20A 3QY0A 1I6WA 2Z30A 2NZXA 3UAYA 3UMBA 1UC5B 2YYAA 4XUEA 1XBTA 1W47A 4MPTA 2YKCA 3D6HA 2BFNA 1RWBA 4MS1A 3L18A 2ZLBA 3T61A 4LRWA 3TNJA 4XXHA 3HLYA 4R4JA 3RHZA 2VP6A 5JAIA 2I99A 1Y8AA 1ENYA 2VXCA 1Q14A 3N0WA 1T5IA 1YVRA 1PEAA 3O4IA 3P76A 1IBMI 3ZJTA 4H9GA 2QN2A 1JG6A 4KDEA 2Q21A 1V4VA 5BQPA 4DDWA 1DO0A 2XDXA 1S9DA 1QH1A 5A0VA 3L4EA 3CX4A 1LV7A 4A2PA 3FN4A 4HUTA 5LLTA 3OE5A 4OM8A 1XMOI 3HCAA 3KS9A 4RA9A 2XDWA 1A71A 4JCCA 4BMDA 2QM3A 2P3SA 2FY8A 4LOJA 5MF6A 4L3WA 4NIMA 1CY8A 3MLBA 2VDUE 3AEUB 4KJXA 4DV7E 1K6XA 2FVXA 1EFRD 2ZJ4A 3ZI0A 3DBHB 2OK8A 2QTWB 4U7NA 4B2PA 1KMHB 5CX1A 3HZ5A 3ESDA 4MWSA 1LLFA 4BMSA 1DC3A 3SXUA 4DUGA 2CW5A 1WAMA 4ZOBA 1D6MA 4Q19A 3ZDXB 3NGMA 5EMKA 2DGDA 4TQUS 1EH5A 5JQGB 1TPZA 3EZ6A 4CL3A 2BAGA 3WYAA 3X1ZA 1DI0A 2H59A 5JANA 1QH9A 1VMIA 5ILQA 1A2BA 1C4OA 3V8MA 2R48A 4UZSA 1O97D 4AECA 2D0IA 1TA0A 1ZOOA 4NYIQ 4HAYA 5IAAA 5K8VA 1ZONA 1Q91A 3MHPA 2V0CA 5DRRA 2YXEA 1X3LA 1D03A 5K0EA 1F2TB 3JQEA 3QHQA 2X86A 3HDGA 4B6JA 1J9GA 2Z09A 4MULA 1MO2A 4B3SB 4V38A 3PEVA 5KTRA 3SSOA 4MKGA 3R0IA 4BXOB 3QYPA 4MVJA 2Q5CA 4ZEWA 3DAGA 1HUQA 1FFCA 2MHCA 1K7CA 2YS7A 4IMPA 2CF6A 5HJ2A 3K9HA 3CH6A 2G0AA 2V4ZA 1LW7A 4ZMSA 3RRFA 3BXEA 4JL5A 2FE4A 3A31A 3EXAA 1G3IA 1QC5B 3SFVA 4UUPA 3JW8A 2KW5A 3ZHYA 1I80A 4GLBA 4I4TA 4E3ZA 3J7AG 4PRXA 2D5IA 1Y4DE 5IWAE 3ZU4A 1HDYA 1BMQA 4URVR 3ZVKA 4EELA 5JZSA 4KFRA 3IB6A 4C7XA 2CLEB 3I9V1 3PP8A 5A9RA 2H6EA 1VPEA 1CS0B 2QD5A 1QTIA 2OWEA 3EGIA 2IZ6A 4EG8A 4HQRA 3ADBA 4IGIA 4MW4A 3IUQA 1YULA 2WJ4A 5A0FA 1SCUA 3CSSA 3HACA 4HDSA 4QFBA 4MEBA 3AGQA 4D79A 5B3KA 2NPFA 4I1RA 2YX1A 3AKCA 1CCWA 3H9BA 1G8GA 5KX5B 2VAXA 1THNA 4J0KA 2JA1A 3TOVA 2GBCA 1T1IA 1Y5LA 4KDFA 1U98A 3DMRA 4TTTS 3U17A 4D3YA 3OVMA 2E48A 4FMPA 1OCEA 3O4RA 4MQFB 3GA0A 2D2IA 4FZRA 1DCFA 2PKYX 1NQAO 1SCNE 1LNQA 5LMUE 3JWPA 5BW5A 4U2FA 2FZGA 2A0FA 4MAFA 4J43A 3HKBB 2FR1A 3AUJB 3GJ8A 3WIEA 2HDHA 2F62A 3OTQA 3T5DA 4P93A 4ZOLB 2WZQA 4JI8B 3GRRA 3L01A 4ZZ2A 4LF7E 2ZS8A 5ELWA 2FMFA 3MF4A 1NQVA 1O6BA 3PC8A 2XHZA 2DFLA 3O3MB 2XDSA 1TO2E 2MSLA 2GXSA 2IDJA 4L51A 3ZIUA 4V3CA 4AL4A 3I9KA 1Z6QA 1P2BA 1CYEA 3O94A 4BQGA 4R9UC 3NVKI 4RPJA 2INGX 2ODNA 5REQA 4BLTA 3K9GA 2JVKA 1E4VA 4GBGA 4LWHA 2BJWA 2QMEA 3CNOA 2ZKLA 2YOGA 5FNVA 1AV6A 3C70A 4V1CI 4NF2A 3K1ZA 4AFNA 2G5TA 3D02A 4OLBA 3PXXA 1ZI9A 3S2SA 4N01A 3VHDA 4GMFA 4NESA 3U9TA 4K9SA 3X0DA 5IJ0B 1GEEA 2VDKB 3UT5A 4INPA 1ECLA 4C4YA 3EGOA 1E96A 2FMKA 3GJQA 4KVGA 5AI6A 2JG3A 1TYBE 1K97A 4JMLA 3T3DA 1E4EB 1Y3HA 2XMPA 4TV8F 1JQ5A 1VZ3A 4I8DA 1RLJA 2DQ4A 5K0NA 3ER9A 2EQBA 1F48A 4J91A 3EVDA 1W5SA 1QANA 4JLWA 5K3DA 1TEHA 4XIJA 1KMIY 2ZT8A 3TINA 4Z9BA 4P4SA 2O52A 1M7HA 1XQXA 3UMSA 1K8YB 1NU8A 4Z0PA 2IZZA 1C9JA 1UKEA 1TA9A 2ZDGA 4MQ6A 1Z4JA 3AUUA 4PLHA 1NUHA 3PLNA 1XJWA 2YTZA 1CTQA 5C80A 5FEUA 4ECEA 4EAAA 4V0QA 4OHZA 2QBYB 4EF5A 4NJOA 5KNLA 2GK4A 1QXSA 1A9TA 3MG9A 4KSBA 3TDMA 1GTL1 1JXOA 3B26A 5KSPA 2B61A 1WMFA 4UROA 1W44A 4HDNB 3EA0A 3REOA 3NDJA 3R92A 1OZHA 4MZDA 4DJFC 1P91A 3EGDB 5AMXA 4LFBI 3EIEA 3EZ7A 1YRYE 4QAQA 1R0ZA 4TLLB 1AKWA 3RO7A 1TK2A 4AM8A 2HLDD 1ZD1A 1V37A 3KOWA 5LLDA 1AGXA 1OMOA 3WJ1A 1Q44A 4CM6A 1RQGA 4LFAE 1HG1A 4WZBE 2BFMA 1XMVA 2GYWA 2NVWA 1SXGA 3FKSA 2JLSA 1EX7A 3Q9SA 1J2TA 3E15A 1KFCB 1UYKA 1T9GS 1V3QE 4LHYA 2BSXA 4KQMA 3PYEA 2D7CA 4FX2A 3JZIA 1XK7A 1OYYA 4IDOA 2B8TA 2ZI5A 2HT6A 5L3ZA 3I61A 1QHSA 3BD9A 1R37A 5ALOA 2PUEA 2ODTX 4HAXA 1ZR2A 4P5EA 1YC4A 2BDUA 1GSAA 5I9IA 1L4MA 4M7WA 3AKDA 3AXTA 3D9QX 1U1IA 2SCUA 2JVJA 3ICCA 4KITB 3OMUA 4R83A 1E7RA 3N7UA 1W25A 3V8EA 3IUSA 4H77A 1AKQA 1Y42X 1B2LA 2H1FA 3EVZA 2CV1A 1VB5A 2JF0A 3F6SA 4MU4A 2QTRA 2BF4A 4CM9A 4RH1A 2BC9A 1BOFA 3EIUA 2IERA 1YRQA 5BSVA 2WSSD 1P6QA 1XTUA 5C1OA 4X66B 2BHLA 1YBVA 3GPDG 1HT2E 3W90A 4M8NE 5B7QA 4ZOCA 4W7TA 4IMIB 2DWPA 2D7JA 1OVGA 1VJTA 4LYEA 1QIDA 5K0LA 4JLDA 3VM6A 5A9SB 5LJLA 3T5AA 1BMTA 1ODJA 4Z4IA 3SQNA 2HIGA 5JQWA 3PPIA 1T26A 1FVXA 4AO6A 1P2GA 2NSHA 2H08A 5E8JA 2ZSIA 3JQ8B 3TE6A 4N0PA 3T3NA 5D3KA 1IZ9A 4B81A 2DT5A 2ADOA 3J81k 3LUHA 2Y27A 3O5AA 3IBTA 4TQGA 1UBSB 2MYTA 3HXKA 1NWCA 1L5HA 4CNBA 4B4UA 2ZVDA 1WR8A 4OA5A 3RT9A 3DVRX 2FKAA 4PL9A 1MXFA 3HPRA 1I5AA 5DCWA 5D3MA 4HDQB 3H8VA 4JVNA 4EM6A 4NK5A 4O4LF 2BFDA 4LHZA 3T34A 3L1JA 5JO9A 1G8HA 5T4EA 1E2UA 1GFWA 3UAXA 4EL0A 4PZLA 3FBGA 1E3MA 3LQYA 2R00C 3BBPA 4XE5A 3IVAA 3SQOA 1SZJG 1QGUB 3L1VA 4RKRA 3OIFA 4QUGA 4BKRA 4IHKA 4AZ0B 4QQRA 4IZJB 4AS3A 4LOAA 4FKBA 1USIA 4E1BA 3VC2A 5L53A 4CWPA 2MINB 2QV7A 1VKJA 1XJCA 3HYCA 4BLPA 4CMEA 3C5EA 3IP9A 1KSGA 5DROA 3GIFA 4IBOA 1QVWA 3A8TA 3JRXA 5I7VA 1IJFA 3Q8WA 2W2XA 4M1ZA 4RPFA 3B89A 4HLDA 3W78A 1EX6A 1H23A 3K0FA 1JLHA 1I4EB 5DYNA 1KDYA 4BU0A 4LKOA 4Z8YA 4OXYA 2VQ3A 4JI2B 2QSZA 3B2QA 2I03A 4AZ3B 1X7XB 3BOSA 4BLRA 1FLNA 4DA7A 4V1CA 1FFDA 3ID6C 3IE0A 2XDKA 1B3BA 3RHSA 4ZZ3A 3DJYA 1NW3A 1KXJA 2HUNA 1T9KA 2VYVD 4B7PA 4GSYA 1ZN7A 3HEBA 4WJZA 3A6EA 3C4QA 3G7NA 3LKBA 4R3MA 1P4AA 3U4IA 4ZGWA 3MGAA 3NIFB 4YA6A 4LCHA 2NG1A 2HT1A 4BEVA 3NV9A 3V4ZA 4ZJZA 1M67A 1XVIA 2M9MA 3SVLA 2ZAOA 2ZRNA 2CUZA 4XM2A 1VFNA 3MTGA 1ECGA 1O0SA 1RLMA 3KELA 3WGTA 3ZDEA 1XNQE 4O1HA 3OZCA 3DLBA 5HM8A 3PF8A 4TN1A 1NYLA 2DTXA 2F59A 2Q4RA 3NR2A 2AUTA 4I0WB 4JLMA 5D7RA 3FZYA 5EWLB 1K0UA 1UM8A 2P2SA 2V2QA 3GDFA 2A8YA 2EIXA 3NMQA 2YXDA 4C1BA 5C35A 4DY6A 5KTKA 2PZEA 1QQ5A 3ZHCA 4CEIB 2H55A 2R7LA 4F21A 1VJ1A 2WKRA 2Z9DA 1X9HA 3W77A 4MI6A 2YHUA 3BXGA 1E5TA 2VRCA 1P9WA 3NO4A 2AHRA 2CL7X 5FO1A 2VDWB 1J39A 2XA9A 4QU8A 4CUJA 1NDHA 1WQ4A 3TX2A 4DV7I 3SYLA 3ZY2A 3VHCA 1M10A 3JQGB 3KL2A 1Y8RB 1L5GB 3PKZA 4QL3A 4IS2A 1O1YA 1VA5A 1BGVA 4PVCA 4BE7B 1V48A 4QGGA 4DC0A 4D96A 5KC8A 3ENNA 2X0JA 4MW2A 3UCFA 1LJUA 1JLMA 1M6NA 4DNOA 1EB8A 3ZD9A 2WHQA 5F98A 2JGKA 4JLSA 2VOJA 3VC7A 3CWVA 1VDZA 2Z83A 3NDIA 4OXXA 3NYRA 3RRMA 1Y4UA 3CEJA 4D57A 4M8KA 1P18A 5FYQA 3B6MA 2ZB2A 4R8SA 3DR5A 3P3CA 2OR3A 4OFWA 4QJ3A 1SR8A 3QKRA 3ELBA 2Q0SA 4ZT5A 5F51A 1CQWA 1XDDA 1JG7A 3LXMA 2A0WA 3ZCQA 4X6UA 3DAYA 1Z0IA 3L0BA 5IJ9A 1VJCA 1E8MA 2K5UA 3EQ9A 2B3DA 3D7KA 3PNBA 1D2EA 1KAHA 3G3EA 3WL4A 2HM7A 1WHTA 4MW9A 1SCAA 3VBEA 5COBA 1KO1A 1E20A 3BEDA 2GXUA 2BP7A 1QIGA 2IYLD 1ID1A 2AK2A 3BE8A 4N3CA 1Z6AA 1EI1A 4PAWA 4UQLA 2OO5C 5K45A 3PDUA 5BUQA 1HZZC 1ODFA 1GR0A 1QF6A 3AIOA 2GDZA 2WUFA 5LQUA 2JJMA 1SCJA 4B46A 2X40A 3W05A 3NHFA 3LNCA 3EAQA 5ESDA 5IEBA 1KDRA 1LZKA 4I55A 1VG9B 3FUUA 1ZZGA 1GWNA 1JWAB 2ACKA 4OLHA 3NZKA 2QX8A 1Q0RA 3GCDA 3UBTA 3REGA 3FOWA 2HYDA 2Y1FA 5ED0A 2O2DA 1R00A 4L85A 3ZU6A 2M2IA 1YOVA 4TTRA 3ZXSA 4ZT4A 2QRVA 1DL5A 4JB2A 4Q9IA 2LTAA 4TWRA 3DH0A 3TUHA 1E3HA 2X9NA 1UXHA 1WETA 2K87A 3EIQA 1U5BA 2RBKA 1NR5A 1Y8PA 4KIWA 1XU4A 4RE6A 3UUEA 3W3ZB 4AMYA 3HHEA 4BO4A 2NAPA 4MUIA 3IBFA 3PNLA 3W5HA 4JV5B 2JZCA 4ERNA 2IPLA 2WVGA 5GONA 2D8AA 1U7XA 4R7ZA 3WVNA 2PMEA 4GL4A 5JWRA 5MFZA 4PQEA 2B4AA 4EKDA 2IX3A 5LZ5A 3PDWA 4DR1I 5BODA 3M4JA 3OHPA 1PR3A 4BN0A 4LF7I 1EUDB 1KS9A 4XGKA 4G5GA 2AYXA 5GGYA 2C38A 3WWOA 1X0XA 4U02A 3S27A 2XNDD 5L3SA 2V4UA 1LK7A 2P5UA 3WLPA 1GPMA 1M75A 1DAEA 5KTOA 4RANA 4Q4DA 2H65A 4YAEA 1RZVA 2FFJA 2YY5A 2JGEA 4IFIA 3ZDYB 2TYSB 3FI9A 1QHXA 1QVRA 4HLUC 3F8WA 2UZAA 2TS1A 3I37X 1RI1A 3SZGA 3MMPA 5KOHA 4BE4A 4F2WA 1JU4A 3I05A 4YRQA 3KKEA 3S1AA 3T3GA 2DJIA 4GPZA 4IXTA 4XWOA 2X1VA 4G1UC 1XL0A 5KHLB 2JVIA 1TNDA 4FEEA 4KNVA 3IAUA 4NH9A 4AICA 5KJCA 4M8SA 4OAPA 4YAFA 1DPGA 4GC5A 1SXJE 4XAQA 5DRYA 1MBZA 1O94A 1AMNA 2VPTA 1NVFA 5FRDA 2YGFA 4AWAA 1ZR4A 5IH3A 4B2IA 3QWHA 3A1TA 1IPEA 1GA4A 1RBQA 1WXQA 4FSHA 1C9MA 3DE6X 1SD5A 2R47A 3FPSA 2IOQA 1ZGGA 2IW3A 2ZAIA 2BKXA 4NCJA 3K9NA 2ILTA 5T41A 1CZLA 4PGAA 5AK0A 1JBEA 3DB2A 3D5EA 4J6FA 1EFUA 5JR3A 4OX9I 2FXVA 5BMOA 1G2QA 1U80A 3H99A 4BMOB 4F6CA 1L7XA 3P2MA 2J0EA 5K3FB 3WYCA 2H7VA 4NCHA 2AI3A 2XMSA 4FUQA 3JAMQ 4YJHB 5A04A 5FULA 2FEPA 1ADJA 3WJ2A 3HUDA 3G82C 3TOCA 1WSDA 5DCYA 2QN8A 4CKCB 2WUDA 2JLBA 1VECA 5EZ6B 1GPAA 4UUOA 4ZVTA 4QT0A 2GF0A 4JUAA 3RVKA 1VGQA 3OO0A 3F2IA 1F8XA 2CWWA 3RRXA 1DBWA 3HN7A 5BV0A 5BN3B 1FFXA 3VDMA 1QK5A 2CHVA 1MRZA 3VZQA 4HP8A 5IHXA 1OJ7A 3V97A 3FZQA 1PKXA 2ODWA 3AINA 2WWRA 3CZCA 1ZJ6A 3PGJA 5ECGC 4B7ZA 1ZWHA 3X3HA 1CZUA 3UENA 3TOXA 1RKQA 2XX3A 3BT7A 3PDJA 2QDKA 4BA2B 5TLSA 4CE1A 2D7DA 5EUMA 2N9UA 4BEWA 4A03A 1XLWA 4LJ4A 1GR1A 1DEOA 4IHJB 4HUQA 1OIVA 2J0VA 3RSHA 1KJNA 3O93A 3QVXA 3VOAA 3OCYA 1BQ3A 4R2KA 1MA0A 4IS3A 4GRAA 3FYTA 4ECAA 1SN7A 1IWPB 3SR3A 5F76A 4ZHQA 1BWRA 1BFUA 2HMAA 4UTXA 3AGPA 1TW3A 3BH6A 2W48A 3GW8A 4D46A 4ER3A 3C6YA 1UANA 5BMVA 4AWXA 4X62B 1JEEA 1V25A 2FU5C 1CZNA 4O2AB 2OFOA 1P4GA 1ZCFA 2R97A 4JYBA 3PX3A 1TJYA 1EM8B 3M7IA 3R7NA 4JBYA 2CJYA 3A3YA 2IWRA 1LSUA 4MGKR 5J4LA 4MEJA 4ZJYA 4H18A 3ZZUA 3IEKA 5KTTA 3AOGA 3U5TA 3CX7A 2V7QA 3GLGE 1TZMA 1KEWA 1N32B 1ISPA 4PBTA 2QD1A 1AQYA 5G4KB 1WTAA 3B52X 5LP6C 3HSYA 4URHA 1X1AA 1LPAB 3RT1A 2NO4A 1OU0A 5GVRA 3Q2KA 1UYFA 3ETGA 1RTTA 5FNDA 5CFZA 3U7EB 1MX0A 1QAOA 4YALA 4S3MA 4QM6A 4CLHA 2CSXA 3A25A 2YWRA 1A1SA 4GDMA 2YE9A 1TZBA 5AI9A 4G24A 1VKRA 4LHWA 2PZLA 4OI2A 1EFAA 4PBRA 5HCIA 3ZV5A 3RHTA 1Z68A 4CM4B 2P0AA 4AKHA 2B34A 2Y3IA 3PC3A 2V45A 1BU8A 2GRUA 4FDAA 2GZDA 4WBNF 3SVZA 4QREA 3DE2X 4QPCA 3HCEA 4KXFB 2BMFA 2WICA 2BGJA 1JQEA 4BNLA 4UTOA 2O5RA 4O3FA 2I8CA 2ZJ3A 3IR6A 3UJ3X 1SCIA 4WEQA 4GT8A 2HJSA 3RIYA 3X1XA 4PQYA 1UAYA 3PQFA 4EEHA 1XYGA 2DCUA 2PO7A 4BGEA 1UP7A 2IHVA 1DEXA 2FN7A 2C07A 4KRFA 5K0SA 4D0NA 1FX1A 3OIDA 3OTOE 3LUGA 1ZD2P 3LHIA 1HNNA 1V2HE 2PRJA 2X5JO 5BNTA 1ZP6A 3L7ZA 3MJ4A 4H6VA 3SYMA 3AI3A 3O75A 4W63A 1T34A 5JWOA 2GPJA 1O3YA 2L42A 3T52A 1J1IA 1GZDA 1KI4A 5IFLA 3EX7C 4KXYA 2B20A 4MP8A 4G63A 4EFUA 4TL8A 2FMXA 2QRPA 4CM3A 2WB2A 3JAMA 2RAPA 1X7WB 2O59A 3B70A 3IBGA 4GICA 1ONPA 3H9QA 2RAFA 5JISA 4PO9A 2IXAA 4MJLA 3W9YA 3K30A 2FYTA 2FEKA 2G9UA 1EFHA 3O0DA 4XW2A 5B4TA 1R6MA 1FDWA 2ZBPA 4J8PA 1ONOA 421PA 2ZT7A 3FDFA 3OEEA 5C7LO 3RVPA 3T94A 1G8KA 3FCXA 1KO7A 4DR6B 1PLKA 5D7BA 1XF1A 1J56A 1Y3IA 1XQVA 4YRNA 4R69A 4YASA 2JIMA 1DLIA 4HDRB 5EWJA 3ASUA 2PHZA 2W2NA 1JU3A 3G2JA 3SBXA 4FI3F 4L4YA 1L5ZA 3MW8A 5I01A 3B7PA 1K88A 3UICA 3ETCA 2H2IA 5H02A 1NVBA 1DZIA 4JIMA 4AJHA 1L4LA 1TKAA 1E2JA 3AM5A 2A6PA 2ZKJA 1XNQI 2IEBA 1T9AA 3L92A 4QLBA 3FYUB 1XNJA 3VTFA 1N2EA 2VH1A 3NDRA 2CD9A 5F1YA 4X3CA 4UU0A 3LTNC 4L76A 1E2BA 2EHJA 4JXXA 4NZZA 4K2AA 1M1NB 3PR1A 3ROQA 3A4YA 3BGSA 1T91A 3I5XA 4J3FA 4JC0A 4GX5A 2YK2A 1X70A 3K6RA 4YXWA 3Q10A 2RGNA 3FVQA 3HMQA 1VL8A 4ALLA 2J3KA 1YK1A 3O83A 4E4RA 2YW2A 4WZBA 3MTBA 2ZYDA 5FB3A 4OEHA 1E1CB 1F9AA 4MS4A 2B1QA 1L1QA 3IP8A 1UFQA 2C5EA 3OLXA 1O57A 3GMTA 1NT4A 5M4PA 4WK6A 4XCQA 3TDNA 3TQQA 5E0OA 5HZHA 1NZJA 5FDFA 5AJZA 5E2BA 1UDXA 4UAUA 4CKBB 1DAFA 1VCMA 13PKA 4D25A 5K0BA 2O4CA 2G1PA 5JEAC 3V1MA 4ZAGA 4NJMA 3JQ6A 5CA0A 5ALLA 5JBIA 3KK0A 4ZVUA 5CBPB 1TUEA 2IUTA 3EY9A 1T0IA 2PE5A 3HFRA 5AUQA 1LK0A 3FRJA 1D2NA 3GEEA 1OGIA 4E08A 1F1BA 4L75A 5F7XA 4BNFA 4PZDA 2YY7A 1XD2B 3N2IA 4KLAA 1NBHA 1VQ1A 5BSEA 3AVWA 4ZU1X 1AMWA 4I36A 3HR7A 1OYPA 4QNRA 4PC2A 1YT5A 4AI6A 1E60A 1LQTA 3O95A 3LWDA 4E12A 2Q28A 4GCZA 4GQIA 4E13A 1WQ3A 5J4HA 4YRKA 4QG7A 2IEZA 1EK2A 2Q1XA 4C04A 1E18A 2IZ1A 3IXMA 4DYVA 5HQ3A 4KX3A 2IVFA 4G5QA 4UPDA 1JB9A 4E7OA 2VDPB 4YRTA 1QZZA 4ZCLA 5KKNB 1C1HA 4TYMA 1BE1A 1PL6A 2PSFA 5CLFA 1T8YA 4FYYA 4PG7A 5JZVA 2VP5A 5ED4A 1MO3A 1XZIA 2OB1A 3R8CA 2QJFA 2FZVA 3UJDA 4XFJA 2G83A 1A5AB 2OAEA 5IYZA 1NXWA 2OFPA 1NT2A 3CTMA 4B6FA 4AUEA 1J2UA 1DKLA 2GYUA 3NGXA 1N6KA 1M8FA 1N1GA 1E2EA 1SD2A 2ORIA 4GBMA 4JL6A 1KE1A 4MGZR 3ZCRA 3TTSA 3CVWA 5J2UF 3TVTA 2O57A 1NLZA 1ZC3A 3D0OA 1OBHA 2W6OA 1UJCA 4DR3B 3K72B 4ZANA 3WGUA 2WQ6A 4HN9A 1K7FB 1O6ZA 2J7KA 3JWEA 3EFBA 1DHTA 3TQTA 2AH5A 2Q3EA 2PGAA 3RFTA 4XYLA 4CR7A 3G02A 3RC2A 4H7HA 3K0CA 2GTHA 2OV2A 4X91A 2Z8YA 1R3DA 2ZWAA 1JLLB 3UJCA 5SYMA 3ZQ4A 1Q2XA 4PZ9A 5AM2A 4QOHA 5CURA 2MMGA 1AGYA 3ZNQA 3W8DA 4CL2A 3R4MA 3FCSB 2BWJA 3CEAA 1U1FA 1RMTA 1UXIA 1XZHA 1Z73A 3RTDA 3UMRA 2BYTA 5IBRA 2G5CA 2F8LA 5JSUA 1CUAA 1TE2A 1IY8A 2GYVA 3DMTC 3N3BC 3P4YA 2ZR0A 3VPDA 4FQ8A 1I5BA 2QEQA 3SHOA 1GG5A 4DB2A 1YF3A 3CZQA 1DUVG 3BIJA 3LUPA 3ZU2A 4MQEB 2WHEA 1H4SA 3UIEA 1JSLA 1OX6A 3L4BC 4IO1A 3WSVA 2XADA 1W2HA 1YU6A 5JD3A 3MS7A 2BZ1A 5KQLA 3I3SR 4L4RA 3RVNA 5IVKA 1R10A 3UEOA 4DQLA 3OCZA 1MC8A 2EZ4A 1KU0A 4GI2A 4JJFA 3R09A 5E38A 1MV8A 3M5WA 6NULA 2G09A 4Y6GB 3HBMA 2UYGA 4XD7A 3TG2A 3KSRA 1V1MB 2FN9A 4E2WA 1WMBA 2H2HA 3F4LA 3ZBQA 2G9VA 1JMYA 3M4NA 4J16C 3SD7A 1GQSA 4CM8B 4E5SA 4KWIA 2QRJA 5M4HA 5KYUB 1COWA 3PXEA 3THXB 3W04A 3VU9B 2YWJA 3NBQA 4WE3A 5LZ4A 2F1HA 2C5LA 3AH8A 2GAAA 2HMUA 5C51B 2H9IA 4QEZA 4RPGA 2JRCA 1YE8A 4EWLA 5ECYA 1SCKA 2NU9A 5LQAA 5AW0A 1OWLA 2OY0A 3KR1A 1TZ2A 2VQEB 3RKSA 5EE5B 4E4YA 2YL2A 2H1VA 3RPEA 3QVJA 1KWKA 1DCTA 3M89A 2I7DA 3T41A 3NTVA 4EVIA 5E1BA 1UPUA 3VYUB 5C5DA 4H27A 3ND7A 1DIOB 5HTOA 1R9GA 2A1UB 4NVRA 2RKOA 3NJ8A 3OQNA 4BWVA 3UMCA 4Z54A 3LH5A 1XROA 2TMGA 2W2QA 3V80A 5LSAA 1LPMA 1TILA 1UYMA 1J42A 1TTQB 4QQFA 4DV4E 2IGTA 3RS2A 4D43A 4RPKA 4DANA 2XYGA 2Z4TA 2OHHA 3BG5A 4O4IB 4QIHA 1BJTA 4AMZA 2BU8A 1PJ4A 4WW0A 2I1WA 1Z35A 4QXAA 1ZRNA 3ASZA 4FQ7A 3FPKA 2RGGA 4C7VA 3SIRA 4N3NA 3N2EA 1JAYA 1CZRA 1OH7A 2JGLA 1T2NA 4JB3A 3H17A 1N0VC 4F5DA 4AUKA 2ECFA 3KUDA 3DBLA 1H9BA 2BV3A 2D54A 2E1PA 1TW2A 4B43A 2PN1A 1U6JA 1MAAA 4DDKA 3FWNA 2WZBA 2QOEA 1VCIA 1X2EA 3HDTA 2BZGA 2JLYA 2HBZA 6Q21A 4S05A 4RV4A 4O1IA 5LQCA 4HNAB 4F1WA 3EGXB 2XKAA 3NP7A 1YJ8A 5H68A 1JR3D 2YCLA 3Q2OA 4CMAA 4YJKA 4G5FA 4P5PA 4JAVC 4ZEOA 4Z7QB 2XW6A 3T06B 4P4NA 2ZUUA 1A7UA 4B6QA 3E0QA 3RS8A 2OQIA 2F3TA 1JTVA 2GCPA 2HA3A 2NYUA 3GVXA 2CXQA 4B80A 2TMDA 4Y0VA 3ZE6A 4B3TE 1KRHA 1RD4A 1O6CA 5EERA 3DE5X 4NZNA 2I1QA 2OVBA 2VDMB 4PSAA 1FIUA 2MDTA 2W0MA 4MA4A 4F8YA 1V1JA 4WGFA 1AKTA 2HTEA 4JBHA 3BXFA 4CHGA 1PZEA 4US1R 2FDRA 3S40A 1UBKS 1VL6A 3C1AA 5CYGA 1BMDA 3O8CA 2PSHA 4PPGA 5K3SA 1WB9A 4R9NA 2PWBA 2HA6A 3D4PA 1J20A 6ABPA 2E5FA 1UQUA 1ORVA 2ZUWA 3PNOA 3V00A 1M6EX 1YS6A 4IZKA 1MFPA 1JDBB 5IKPA 1H0KA 1JFTA 3I8OA 4URWR 1KJWA 3BPSA 4LGCA 3MS2A 1IBKB 1PG5A 1A72A 2ZQZA 1JA0A 2CXSA 2O2EA 1GTZA 5J40A 3JTEA 3MZ0A 1W75A 4HXFB 3OI7A 4ZU3A 1RPTA 3T3MB 3SHTA 2ENUA 1N7HA 4XVRA 1WULS 2PLWA 1MAUA 2C3UA 3HM9A 5KHAA 1GRQA 2I4IA 1IUNA 3BICA 2CFRA 3OTOI 1YIAA 3UFXA 4KGVA 4LXGA 3A6GA 4IIVA 4RC9A 2RGAA 2AKPA 3V7WA 3ZBPA 2XRZA 4C88A 4JA2A 5AQEA 3U62A 5M2QA 5KYYA 2IS1A 1N1EA 4URFA 1V6AA 1JKXA 1DQPA 1S2LA 2N1MA 2FZLA 4MHSA 1JJBA 3K70B 3RDPA 2NADA 3EXFA 1O77A 2WWTA 2JE6B 2DH5A 3ZDRA 2GO1A 1M0SA 3P8ZA 3U9LA 4B31A 2HXYA 1I1OA 1RAEA 1K5GA 3EVTA 5KJ1A 5HUHA 1BFDA 5ULLA 1NPYA 2QL9A 2ZVQX 2D5LA 4KPEC 2WYWA 1D0SA 1SXJA 1DTSA 1Z5OA 1PI3A 4DHWA 1RIFA 2WYIA 1Q21A 2YK9A 3OBBA 4FHGA 5THQA 5ARDA 5PGMA 2PQ2A 4DIFA 4RS3A 5B6IA 4PRLA 1IUPA 1U0FA 2FPIA 3E2PA 4W82A 3O9MA 4BTVA 5LZ8A 5HBGA 1KYZA 5I7WA 2KLBA 5KBYA 1CF2O 3D3QA 1XZ8A 2NXEA 4NBKA 1TVMA 4IZJD 4JASB 3PEYA 1NQ5A 2XE7A 4AS2A 5TMBA 2DU8A 3FTNA 4DV5E 1CUWA 3SMQA 1Z2EA 1F5SA 3IUMA 2GS9A 1MB3A 1AGRA 5FPPA 5LDGA 2P6RA 3BFJA 4FJ1A 3IE2A 2TSYB 2ZITA 4XRRA 2EWVA 4DV2B 2QI9F 5DHQA 2G17A 1OYVA 4KLNA 4F9EA 1OZAA 2H2GA 3SK0A 3RQIA 3KCNA 4LZZA 5HKAA 1KEZA 4DDMA 3PQ8A 1RP1A 4YAJA 4X1YA 2Q5OA 5IXSA 3ZCVA 2CLMB 4OSEA 1EQUA 4GVPA 2ZBFA 2WFLA 4PQGA 2AZ4A 2C77A 3NMUF 4MV7A 4FDVA 3LW8A 3RANA 1DWUA 4DKXA 2R6JA 3VI3B 2R7AA 4MPCA 4PR3A 4ZKDA 5T67A 2F3RA 2ERXA 1UL1X 3I01A 2Z2XA 3HZ1A 1O4VA 1VA4A 4WPGA 1OXUA 4EI7A 2ZSJA 4QDOA 3JRWA 2ZJ2A 2X13A 3K1AB 4B8WA 3OOWA 1P0PA 3KUXA 1NM5C 2FSHA 1H22A 3IBYA 1Z6XA 1S0UA 4AJ1A 5EZYF 2R62A 5FOWA 1B8NA 2VT3A 2ZRHA 3CH5A 1E0JA 1IXMA 1RI4A 1YVDA 2JGDB 5DDIP 1IEXA 4EHAA 3F1LA 4OVKA 4PLYA 1KI1A 4IJMA 3ML1A 5IPFA 2D3WA 5LYJA 4FBGA 1TPYA 1JIQA 1IDOA 2KLHA 1YFLA 2P65A 2ZUFA 2Z4RA 4KC0A 1UK9A 1LLUA 2QN6A 4R71A 1Y7LA 2JH9A 2EP7A 2BJVA 2R5WA 1WW3A 3O2NA 2WIDA 5DFAA 1L9KA 2PMCA 2JLRA 2QAGC 1DTWB 2HFUA 5HPYB 1DKMA 3K17A 5AVQA 2GF9A 1ND5A 3PTAA 3ITEA 2J3LA 3V42A 1VHLA 3QY9A 2QLTA 4AULA 2QTNA 1FTGA 3VMFA 4MNTA 2DEJA 2VK4A 2V54A 3AKZA 2NWQA 4ZVSA 3OE4A 1UP4A 3CNHA 2O05A 1SC6A 5K3EA 2J5QA 2ZRGA 5AHXA 2V03A 4LZAA 2O8FB 4WXMA 1GPYA 1BH6A 3K53A 1CRLA 4DV0B 3I9LA 3EGEA 3A37A 1UDOA 1Y6FA 1DC5A 2WP8J 3GLGA 1U65A 2G8LA 4MPNA 1TIBA 1M8KA 4L0DA 1W0KA 1YBHA 1BVYF 3Q8MA 5FA6A 4C3ZA 3BL8A 4PBSA 4DUZE 4DIMA 5EE3A 1RLUA 2HC9A 5EZQA 3NKLA 1L5LA 1W5BA 2OBLA 1A9ZA 3FD8A 4BP8A 4LWFA 3DM5A 1H7UA 5TQVA 1Q95A 2AZMA 2IHBA 1LBQA 1RS0A 3QMPA 4A27A 1G3MA 1Q5PA 1DV2A 3I34X 2OAQ1 1W0CA 4JI5E 1S9HA 3JYOA 1ZEMA 1JDPA 1DAKA 4BVHA 3HFSA 5TPZD 1H2WA 1GQ2A 3TTYA 4G86A 5DV9A 3FGPA 4NHEA 4NEQA 5AI0A 5DHUA 1L4NA 3QEJA 1KH2A 2YUIA 3W3AA 3EAFA 5CYOA 2YVKA 2FGJA 4WWHA 1PD0A 3VC3A 3M0EA 3WKAA 3JYHA 3GLIE 3VPSA 2RCYA 3NRCA 1QRAA 3ZKWB 5BR8B 3O1IC 3DXZA 3Q4GA 4RAQA 4ITUA 1PBTA 3B1KA 5F4BA 1ZOPA 2ZB8A 1U28A 2Q07A 4HCJA 3UAVA 1ZH4A 2DUUA 2E2WA 1HYEA 3L46A 3VZDA 3O31A 2YE3A 4BJHB 3T9CA 4TYYA 3AY7A 4FZ5A 3KXKA 1Z0BA 1GVNB 5A62A 1N57A 5JCZA 3OE7A 1XPRA 5CP8A 3E22A 1M2VB 3WBFA 2C78A 3MQ2A 3RNLA 3OH8A 3UKDA 3BAZA 3T7IA 3OW6A 4NLLA 1CE8A 1O6FA 1JQ3A 3VZPA 4LDPA 4HEA6 3PLRA 2B25A 2VIIA 2XEXA 2Q99A 3BB1A 1BMFA 2BR5A 3IUNA 4QKQA 3B9PA 4D5GA 1NQXA 3EXHA 2DM6A 3SI7A 4AY2A 3U39A 2XAAA 4EHHA 3LL4A 1E3IA 2B35A 1XELA 4HPWA 3GVHA 3OKFA 1XVVA 1D1PA 4YNBA 3S8MA 4QU0A 2WV7A 2C9YA 1ADBA 3GHYA 2J7PA 3KV3O 4U8GA 4DDVA 2F48A 4EJ2A 3NAGA 3VH1A 3L1KA 1SBIA 4EYQA 1I94E 3EF0A 4OP3A 4I3GA 1O0BA 1WXEA 4IGEA 3VR3D 4HDKA 3MCTA 2Q1UA 1OYRA 1DVRA 3WZLA 2J9FA 3JCZA 3AHFA 2FPMA 1BTOA 1HE2A 3RU9A 2GO4A 3ZU3A 3T3HA 4TV9A 2XNSA 5A2QC 3CX8A 1LCIA 3RM3A 5IAKA 3R5TA 3M5CA 4R6XA 2A35A 1ZCJA 1Q0ZA 3GQVA 4QDXA 1N6NA 3KSDO 3T0HA 2AVDA 4RCYA 3PWTA 5J58A 4B33A 4EO9A 1M34E 3H2ZA 1P5HA 3TJZA 4HOYA 3GAFA 4H2DA 1JKFA 3AVPA 4LOKA 4XEUA 5L9AA 1LI5A 4CCYB 4DA8A 2VF7A 2ZBKB 1AD2A 4A8HA 2YHIB 3IAM1 1IPFA 1XQWA 4OPMA 1BDBA 2DRIA 3RFUA 1JKJB 4PYIA 5KCMA 3VPXA 3GT3A 2HGSA 5HS6A 1JHXA 2V7PA 2BM1A 3C16C 4OIMA 4MWBA 1PTJA 4LTNA 3MRTA 1EBFA 4CMBA 4WDRA 1ZCZA 4IVRA 3PQCA 3D5QA 3ZWDA 2A4MA 2Q6LA 2B6HA 2H3HA 1NI4A 3ISVA 1P1BA 4OHOA 4XIIA 4OGGA 4KLRA 2OV1A 5FBRB 4DT1A 3COSA 4M89A 3CZ5A 4COKA 4IJVA 3ABOB 1NMZA 1YONA 3R6LA 4U7JA 2P1DA 5A71A 2E7ZA 5BOVA 2UUPA 4KR7A 4DV4I 4XWTA 4YJ2F 3I04M 3VHXA 1YAJA 3GZJA 4Y1EA 2GBLA 5EEGA 2VO1A 3WIDA 4RE5A 4G5YA 4KN9S 2GCGA 4PXYA 4P3OA 3A0RB 3FMPB 4DLAA 4I4LA 1MJFA 4FCTA 1UEXC 1NVGA 5JW6A 1TUBB 2XAUA 4G9BA 2GERA 3TTVA 1BEZA 2CVZA 4ALJA 2AX4A 4ZYYA 3QVVA 3AWDA 4D0LB 1PZMA 3LRXA 2JHFA 1XDGA 3V9PA 2WLSA 3S70A 2JGIA 3C1TA 1NV9A 5HM6A 4DLPA 2HHHE 1CVRA 4AJ9A 4MWGA 2E4ZA 2J67A 1E2GA 2Y0EA 2ERYA 1LDYA 1U8ZA 5FWYB 2P9GA 3ZDQA 4LZWA 1Y8OA 1DO2A 3ENKA 3SP1A 5IABA 4LUCA 3U3XA 3ZUGA 1DMSA 3G2IA 1SBYA 3W0LB 1TUGA 3KQPA 4WCDA 4R7TA 1PNOA 1TX4B 2Q29A 1R0XA 5EJEA 1C3JA 4EJSA 4O3MA 5ALYA 3E81A 4BNGA 2ZSBA 2AN9A 5CH3A 3B3AA 4JI0B 5HCUA 1W19A 2BY4A 4F96A 1EVIA 1AV7A 4GPEA 1ECJA 4U9HS 4J76A 3NC1C 3IFSA 5IM4A 1S96A 4B3TI 1G7TA 2YWXA 3LPNA 1SXPA 5K8UA 3ZVRA 3K94A 1IK4A 4HYPA 3M6MD 5JQGF 1P2SA 3INRA 2BGTA 1J5EE 3AB3A 4GECA 4UUMA 5ITZB 1DKOA 3A14A 4LV5B 2Z5BA 4EH1A 1XA0A 4UOQA 5AW1A 4DR4B 4ND2A 4PPNA 2QF6A 3UAWA 1BCRA 3RVJA 2WVAA 4YT5A 2RBEA 2NZWA 2EATA 5DX8A 2JC3A 5IASA 1OGYA 1RPZA 4P8RA 2C39B 1MO5A 4PHHA 3NFRA 5BYKA 2Q8GA 4C4ZA 3W2IA 1Z2CA 2NO1A 1TIPA 1NAIA 4UTVA 4Q7KA 1R4MB 3KRNA 1HQKA 4MWDA 2OV8A 3FBTA 3LK7A 3SAJA 4AIIA 2HQSA 2F43A 3P06A 3PVSA 4B82A 1EVLA 4DIUA 3FR8A 4F6RB 4ZDWA 5HKLA 5AKKA 1M6VA 1T1GA 3CG0A 3ECCA 4OXQA 4ARUA 4EQ6B 1WRBA 5C8XA 5IX8A 2UZ1B 1UOOA 2FFAA 1B6SA 3NUQA 4LXUA 2AJDA 2NVUB 4LWGA 3UJ6A 1PX0A 3HEMA 4D2IA 3FSGA 4PNHA 4M9SA 5IT4A 3VDRA 4ZALA 2O6HA 1JRLA 2B4QA 4X94A 2E87A 1KI7A 4X97A 1OF1A 4UNQA 1T9ZA 3HVRA 2HFKA 2FPOA 4A16A 5A3RA 4RV9A 5DHTA 4KLCA 5ER9A 1M1YE 1LLQA 3OMLA 4GC9A 1PF7E 1RWKA 5I4KA 1JJ7A 3LQ1A 1QNLA 1IMJA 1WD5A 2CL5A 4HXZA 2FN4A 1NFQA 1QNFA 1Q0HA 2IEGA 4RH0A 1DUSA 4N6OA 4PU0A 3PWZA 2FKNA 3PTZA 4J0QA 3OOSA 3HDYA 4KK3A 3WYDA 4TMYA 5BQ5A 5KX5F 4NE2A 1E89A 1AA9A 3BK2A 5KYKA 4UCXA 4NOKA 1P29A 4R9RA 2HFJA 3LTEA 4MUFA 4BEBA 2O7SA 4B3XA 4BO6A 3UVEA 4B3RB 1BGQA 4YKRA 2EW2A 1F8FA 1BU5A 2VJLA 2AW3A 4LBWA 3RVSA 4IIGA 5IWAI 4QASA 4K28A 3PHGA 2EEPA 3CW8X 2WTBA 1UC9A 1UJ6A 3EDMA 3IEVA 2I6UA 3E8SA 2F55A 3FOAA 1RPNA 2ETXA 4EITA 1M5RA 4DV5I 4JJ4A 1JHPA 5TARA 4CQNA 1CVLA 4ZOLF 2E49A 1XVLA 3RUCA 4KW7A 4USKA 4NENB 2F17A 3NHUA 4GQTA 3U1KA 2O0MA 3IUPA 4EUHA 5BNWA 2CJPA 5KYNA 2FHSA 5BSMA 5TC4A 1E6WA 2OHIA 4X54A 3BRQA 1U1EA 3MLEA 4FFLA 3TWOA 3UUWA 4EG7A 1N8SA 1P9NA 1J8QA 1NC3A 3KJQA 3UHOA 3CX3A 3DMYA 2CNKA 3PUYA 4CDGA 3HVKA 4LJRA 1ULTA 5DSTA 4B32A 4Q47A 1R8QA 4LFCB 4BRZA 4QYIB 2BDTA 3ZIAD 3Q7QA 1O95C 1PWEA 3IIEA 1DRWA 4OO1E 5TSDA 2OV4A 2Z2YA 5LMUI 2HJVA 1D6JA 1ESMA 3HS3A 2ZDHA 2EGHA 4ES6A 4R41A 1UK6A 4YBRA 2WDZA 4PSDA 1CB7A 4GBJA 4DPMA 1TVEA 2YVAA 4LCJA 3R3XA 2QD3A 2IH5A 1M6HA 1HDGO 4OJTA 4IUYA 1YWGO 5EIBD 4R6WA 4P98A 2F90A 2PYIA 2OGUA 1H1TA 1IY2A 1A6FA 1OYSA 2PEZA 3RFXA 3OM0A 4HWGA 3L4SO 4Y1GA 2BSQA 5B4UA 3N2KA 3EULA 3NYWA 2IPNA 4XPIA 3W1WA 3ROTA 4RSMA 3LA8A 3K85A 5LKRA 1CRZA 4PYOA 4ZI5A 4MVJG 1Z7GA 4BVAA 3I1FA 2IBSA 5D85A 1GCIA 4AMUA 1GU7A 4J4TA 4Y7CA 4PIMA 4UC0A 4A1OA 5DIZA 4NDNE 4ASAA 4IOJA 2GBPA 1X13A 2IX9A 3WLHA 2AJ4A 1QIFA 2Y1GA 1BJKA 1YI1A 4BKQA 2E3JA