1Y4UA

Conformation rearrangement of heat shock protein 90 upon adp binding
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
489
structure length
472
Chain Sequence
MKGQETRGFQSEVKQLLHLMIHSLYSNKEIFLRELISNASDAADKLRFRALSNPDLYEGDGELRVRVSFDKDKRTLTISDNGVGMTRDEVIDHLGTIAKSGTIGQFGVGFYSAFIVADKVTVRTRAAGEKPENGVFWESAGEGEYTVADITKEDRGTEITLHLREGEDEFLDDWRVRSIISKYSDHIALPVEIEKREEKDGETVISWEKINKAQALWTRNKSEITDEEYKEFYKHIAHDFNDPLTWSHNRVEGKQEYTSLLYIPSQAPWDMWNRDHKHGLKLYVQRVFIMDDAEQFMPNYLRFVRGLIDSSDLPLNVSREILQDSTVTRNLRNALTKRVLQMLEKLAKDDAEKYQTFWQQFGLVLKEGPAEDFANQEAIAKLLRFASTHTDSSAQTVSLEDYVSRMKEGQEKIYYITADSYAAAKSSPHLELLRKKGIEVLLLSDRIDEWMMNYLTEFDGKPFQSVSKVDES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of the N-terminal and middle domains of E. coli Hsp90 and conformation changes upon ADP binding.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone
molecule keywords Chaperone protein htpG
total genus 130
structure length 472
sequence length 489
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.80 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1y4uA02
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 1y4uA01
3.40.50.11260 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1y4uA03
4PRXA 1UYIA 3B26A 2XHXA 4Q20A 4YKTA 1BXDA 1Y4UA 3G7BA 2YE6A 2HKJA 1S14A 4KQVA 3HYYA 4NH7A 3Q5LA 4XE2A 3A0ZA 3C0EA 1ZXNA 2FYPA 3B27A 1USVA 4H7QA 1YC4A 5M4NA 2XX4A 4L94A 5BOCA 4E00A 3GIGA 1U0ZA 3HYZA 2PNRA 4EEHA 2YE7A 1AH8A 4LWHA 2Q8FA 1AMWA 4LPBA 2IOQA 3Q6MA 4B6CA 5J6AA 4GEEA 4L8ZA 2BRCA 2H55A 3RLPA 2VCIA 1MX0A 2O1UA 2YGFA 4FMTA 4ASAA 1Z5BA 4HYPA 3Q6NA 3OPDA 3RLRA 1UYLA 1B3QA 3R4NA 1BYQA 2YK2A 4GCZA 3K60A 3WQ9A 4XKAA 3T0HA 2YE4A 5D7RA 5FNCA 1UY8A 1MU5A 3T2SA 3ZM7A 1TH8A 4FCQA 2WI3A 4QPKA 2XDKA 2O1WA 2BYHA 2GQ0A 2GFDA 1YSRA 1YETA 2BU5A 1GKXA 1Z59A 2O1VA 2VW5A 4BIUA 2EXLA 3EHJA 4URNA 1Z5CA 1QZRA 3ZXQA 2YEDA 4LWGA 2CCUA 3EHGA 3R4MA 4URMA 1B63A 4XKOA 2VCJA 4LWEA 4HYMA 1YT1A 3OMUA 1USUA 4YKYA 2YK9A 2JJCA 3ZKDA 3O6OA 4XIQA 2BZ5A 4AWOA 2O1TA 3SL2A 3D2RA 4I5SA 1L0OA 3LPSA 4O04A 2YKEA 1GJVA 1A4HA 4BIZA 4XDMA 3OWBA 4LP0A 2GQPA 5D6QA 3GIFA 3FV5A 2QG0A 3D36A 4ASFA 5FNFA 4XIRA 3R4PA 3PRYA 1AM1A 4L91A 4CWFA 4HZ0A 2BSMA 2H8MA 4HXWA 2WERA 2ZDYA 1Z5AA 2YEGA 2BYIA 3O2FA 2YE5A 3U2KA 3BMYA 4O09A 1UY7A 5D7CA 4R1FA 1EI1A 1I5AA 1Y4SA 3U67A 1UYFA 2IWUA 3CRLA 3IEDA 4CWOA 1YSZA 4CWQA 2BU6A 1Y6ZA 2XDLA 3CGZA 4HXZA 1UYGA 2YEBA 4XCJA 4KSHA 5IDMA 5CTYA 1QY8A 5FWKA 2YEAA 4EGIA 3G75A 2WI4A 3EHFA 4JAUA 2CGEA 2YE9A 3RKZA 1I58A 5BODA 2YEJA 4R3AA 2Q8HA 4MB9A 3H80A 5CTUA 4O05A 3GIGB 1THNA 5IDJA 3KE6A 4BAEA 2WI7A 5M4MA 1GKZA 1Y8PA 1UYEA 3A0YA 4EGKA 3WHAA 4AWPA 4XITA 1AH6A 2WEPA 2XJXA 4I3HA 4H81A 5J71A 3ZKBA 3MNRP 4NH9A 3HEKA 3U2DA 3K98A 1PVGA 1TBWA 4CWRA 1UY6A 1OSFA 2XDXA 3A0TA 2YI0A 1YERA 3VADA 4PU9A 1H7UA 3BM9A 4YKZA 2YEHA 3HHUA 1TILA 5CF0A 2ZKJA 1YC3A 2XJGA 2FWYA 2XDSA 3B24A 2E0AA 4BXIA 3ZXOA 4XCLA 3QTFA 3HZ5A 3T0ZA 2YEIA 4FPPA 4EGHA 2BREA 2BTZA 2WEQA 3Q5KA 4FCPA 4XIPA 4EMVA 3PEHA 2XABA 4GT8A 2QF6A 2ZBKB 4L90A 4KP4A 1ZWHA 2YKCA 1UY9A 5C93A 4HZ5A 3K99A 2IORA 4CWTA 3CRKA 4W7TA 4BQGA 2YI5A 3DGEA 4U7OA 5M4KA 3CWVA 3FT8A 4MBCA 4XKKA 2YJWA 4XD8A 1I5CA 2Q2EB 2WI6A 1AJ6A 1S16A 2YI6A 4B7PA 3OWDA 4JASA 4CE1A 3B28A 1ID0A 2XD6A 4P8OA 1UYDA 4ASGA 3QDDA 4YKUA 2YECA 4MPEA 3A0RA 4YKRA 4NH8A 5D7DA 4E01A 1UYCA 3TZ5A 3TZ2A 4PRVA 4O07A 4LWFA 5F5RA 4URLA 1YESA 1KZNA 4DUHA 3B25A 3T10A 3O0IA 4HY1A 2K5BA 3A0XA 4EFUA 3R91A 4U7NA 4V25A 4LWIA 4K4OA 1YT0A 3JZ3A 2WI2A 3TZ4A 2CH4A 4CE3A 4XTJA 1B62A 1BGQA 3C11A 5M4HA 2XHRA 4CWNA 2CCTA 4JAVA 4BQJA 3INWA 2YE2A 3G7EA 4DZYA 4MPNA 2YE8A 4AWQA 2XK2A 2ESAA 4MOTA 5FNDA 1BKNA 3RLQA 3EHHA 2FWZA 2XX5A 2YKIA 4O0BA 2YKJA 4PL9A 3PEJA 3D0BA 4KSGA 2IWXA 1ZW9A 2YEFA 3CGYA 4MP7A 3EKOA 2IOPA 3VHCA 2IWSA 4ZKIA 3TZ0A 2BU8A 3TUHA 1KIJA 4KFGA 2UWDA 1Y8NA 4YKWA 1ZXMA 1NHHA 3R4OA 1HK7A 2XDUA 2Q8GA 1YT2A 2AKPA 2BU2A 2XHTA 4CE2A 2YGAA 5M4PA 3EKRA 3TTZA 4MP2A 1TC0A 3LNUA 4R3MA 3FT5A 4ZVIA 2WI5A 3GIEA 1I59A 4QPJA 4U93A 5L3JA 1UYHA 2XJJA 2WI1A 4GQTA 4GGLA 2YI7A 2YE3A 1TC6A 4MPCA 1QYEA 3OW6A 2YKBA 3VHAA 3Q5JA 4EM7A 2VWCA 4FCRA 3H4LA 4HY6A 2CGFA 4X9LA 3VHDA 2JKIA 3NMQA 4CWSA 5CTXA 4YKXA 4ASBA 5CPHA 2YGEA 4WUDA 1Y8OA 3INXA 1I5DA 1UYMA 2CCSA 5F3KA 4EFTA 2YJXA 1NHJA 1YS3A 2HCHA 2Q8IA 1EA6A 2FXSA 2YEEA 2BU7A 3T1KA 4UROA 2HG1A 4V26A 5M4EA 1YC1A 3K97A 3R92A 2BT0A 2CG9A 1U2OA 4GFNA 4H85A 2QG2A 4P7AA 1US7A 4JQLA 1R62A 2C2AA 3HJCA 1TIDA 3A0WA 4XC0A 4WUCA 2QFOA 3HZ1A 2XCMA 1JM6A 2ZDXA 2XX2A 1NHIA 5GGZA 4YKQA 1UYKA 5IN9A 4E02A 1H7SA 4CWPA 4WUBA 4L93A 5CTWA 4AS9A 4KTNA 5D6PA 1I5BA
chains in the Genus database with same CATH superfamily
4MHOA 1TK3A 2QVZX 2FF7A 4WAUA 1W5SA 1JG6A 1S2MA 1KWGA 2PKRA 2ZI5A 2BCEA 2AFHA 1XDUA 3F3YA 2WHPB 3EQZA 4M7PA 3T41A 2QUAA 5CW1A 3DBLB 1SBTA 3A4NA 3OIGA 3H8JA 2RJ3A 1NMXA 5GZ6A 1KSFX 1VL6A 2VSOA 3K0AB 5EIHA 5HFJA 1I2BA 1QIMA 3Q5LA 3JQEA 2A0YA 2YBDA 2DHRA 4BN5A 1IJBA 1KZ4A 4UBOA 1QJCA 2IL1A 1EGAA 1SUCA 2C5AA 1SELA 4DCMA 4EHKA 5IUJC 5GIOE 1XVTA 2VDVE 4FW4A 1M2OA 4J0HA 4JC4A 2AKEA 1JXAA 3AR5A 3OF2A 4ZXPA 4EJFA 2OZEA 2P9EA 5KJ6A 2DKFA 3V7UA 3WAKA 4F6RB 4I1UA 4R9RA 5BPHA 2FPIB 2C39A 3IPAA 4HB4A 5FR1A 4N48A 3CLVA 4LJ7A 2HK9A 3GMTA 4E70A 2ZBEA 3LH5A 4BO6A 1A77A 3CLUD 2EL7A 2RKBA 4ZAYA 4MCIA 4F12A 3A9UA 5TJHA 2P1RA 4RANA 3GUCA 4JC8A 1OFVA 1QRUA 2XGMA 5A05A 4DQLA 2FH5B 2W2LD 4ZU6X 3O83A 3RIGA 4XRGA 2I7CA 2EZUA 1GV1A 1P5JA 4P54A 3RLPA 4BX9A 4UPEA 1J0EA 1EVLA 3GFPA 4L4XA 1ELOA 3BQMB 2ZSAA 5CW2A 1XGKA 2Z2ZA 3JRXA 3TIXB 3IBYA 3M6XA 5EXXA 3YASA 1OC2A 1U9CA 4WWHA 3ZDZB 1E7QA 3PXAA 3L7OA 4D97A 3EXHC 3LYLA 3UAZA 1GRNA 4FNAA 4ARAA 5C7IO 2E9SA 3TEJA 5FORA 5FHQA 5LZ4A 3NOVA 3NPAA 2Z6VA 5LKRA 3A4LA 2J5QA 3ITDA 3A6HA 4TV8F 3BZUA 1NMEA 2LIVA 2ZBVA 3ORFA 1EUYA 1P77A 3HRIA 3UV3A 4PR0A 4BATA 1C80A 4NI5A 5D7RA 3WMEA 2O52A 4YCAA 2NU7A 4UM5A 4CMJA 3CUKA 4KREA 2W2XA 1FDVA 5HFAA 1H66A 4K0KI 2CMFA 1NJ2A 2GJ4A 3BMQA 3ME5A 2IE8A 3WDMA 9ATCA 3GJ3A 1A7JA 4UPVA 2ZI7A 4EGFA 3P3GA 2PRSA 5EFOA 4I2VA 4H16A 2CC2A 4HX5A 1OROA 4Z51A 1A82A 1WBJB 2EBWA 1I3OA 3SOZA 1OLOA 3PQDA 2DPXA 2O4CA 4OHWA 1LB1B 4OQNA 1EAYA 3B1XA 3Q7TA 4PYOA 1PSWA 4LWQA 3B85A 1MJ5A 4Q3BA 3I4LA 4Y0AA 5EL0A 1PJBA 5T4FA 4ZOAA 1QGZA 3CSSA 3NBMA 1WCWA 2VF3A 3EC1A 1YWGO 4RKEA 4QG7A 4BYGA 4DLNA 2AOVA 5EWLA 4ESEA 2GK7A 2ODEA 1PJCA 1N33I 4Q82A 1N0WA 3JX9A 4BIUA 1NLUA 3OLYA 4XGQA 5CTAA 3CM0A 5LQDA 3EHJA 1X38A 1Y9ZA 2ENWA 1JAZA 2OSBA 4MWTA 4A8JA 1L4YA 1K7CA 5L9AA 3O90A 4H1TA 3PNYA 1GSAA 2ZATA 5T5QA 4E46A 1I0IA 1B8VA 4IF4A 1R4AA 2MJLA 4JXKA 4ME6A 5CLFA 1FMJA 1N3BA 1YT1A 1W52X 2FYTA 3GRRA 4MHSA 2ZTHA 1QYVA 3HY6A 4HWPA 5ALEA 1S6YA 3EVZA 4M21A 2JFNA 2FPLA 4LFAI 2OTCA 3C4VA 4IR7A 3A9RA 4OO3A 1T8TA 3LPCA 4X00A 2CDNA 2IEDA 3S55A 4W5HA 5DNUA 4X8LA 5JNSA 1N4DA 3JR7A 5CGQB 1E4OA 2P9JA 2QEQA 1ISGA 2QN6A 4MW4A 4Z8YA 4Q12A 5G1PA 3N2GB 3RU7A 3D2RA 3N8KA 1ZJ5A 6ABPA 4MI6A 2J59A 4UUAA 5CR9A 5B2EA 3KETA 4HN2A 3O8CA 1DP4A 2YDYA 1FS6A 3D6MA 4D4GA 4INJA 2BTQA 4OQFA 3ZWOA 1AT1A 1JWAB 1KJIA 2VLBA 2JKVA 4LYAA 1G8GA 1X7XB 1Q44A 1VG8A 3AIMA 4FOTA 4QREA 1FOEB 1SC6A 2AOTA 4FKBA 3SDZA 4AJKA 4H7EA 4UHDA 4AWXA 2NYUA 4UBNA 1S7GA 3IGFA 1IN8A 2D1SA 3EUWA 3NAMA 1XK7A 1LI7A 2IYQA 4OHCA 4WINA 3Q12A 4CL8A 1G4HA 2XUIA 2RI1A 3PF9A 5LSAA 3CLRC 4IX1A 2X14A 1IZYA 1ZH6A 3FUWA 1TKAA 4OUDB 3MS2A 1MIHA 2FEXA 2G80A 2IIPA 1MX1A 4JB0A 5BMOA 3BKXA 1L5QA 1E1YA 2X77A 4P7JA 3UAYA 5AKLA 3V7WA 1T4GA 2J85A 1XZBA 5FI1B 4C87A 4FOOA 4JKYA 2A9QA 4QGSA 5A4AA 1NNLA 2OZVA 3PSHA 5SV2A 4BNGA 5DHFA 2PS1A 1CEYA 3ZLTA 1UIMA 2YEGA 1IJFA 1PFKA 2R8RA 3LX6A 4ENTA 4GG1A 3GJ8A 4BQIA 3I04A 4R1TA 4IIEA 5ESRA 3GUYA 2VPXA 1SVIA 2ZRHA 4O4LF 3VVBA 3RFFA 4AKSA 2IYFA 1UYFA 5FI3A 1K8ZB 2JATA 2VHCA 2JJMA 2R60A 4PX9A 1NW7A 2LD4A 2RH9B 1QE5A 4BLOA 2Z2KA 2AWOA 1E64A 2AKYA 4U2FA 5DH9A 1FFYA 2VK1A 1TCAA 2D1YA 4U3BA 2YHIA 3AHDA 3B8EA 3VR4A 3ZV3A 4GI1A 5IDMA 1OXXK 1EE2A 2FSSA 4N82A 1KH2A 3D4PA 4QUEA 1Z0SA 2PGAA 3BJMA 1TADA 1IG3A 2VQFE 1P2VA 2NLOA 2YHAA 3MCVA 4J8PA 3ESXA 2YE9A 5E7IA 1I1OA 2XNDA 3DV9A 4M1TA 4N8SA 3R7FA 4CM4B 1RTTA 2HB6A 3K0CA 2YOHA 1V1MA 4G4SP 2YEJA 3D0KA 3E9CA 4JR0A 4M76B 4DSUA 4H1WA 4WCFC 4NOLA 3WGLA 3A2KA 4YUXA 3SM9A 4TYNA 3H80A 5CTUA 1YD7A 2XTNA 3L7MA 4HBZA 4M1SA 5EZ6B 3A1EA 4LISA 4IIXA 2YQ4A 2AKAB 4I1RA 5I5GA 4AAYA 1YE5A 4CQLA 4GXQA 2ZSDA 2GPBA 1DQYA 1GOTA 4UVGA 4F1KA 3W6NA 4X1KB 1M8KA 1BCSA 4RZIA 1E4YA 4BBZA 3HCPA 2ZQZA 2Q99A 1M73E 1OMOA 3AU9A 4ONEA 2ZW9A 5F2EA 5CD1A 4GYWA 2HJRA 3ZKBA 3I9JA 4FFPA 4CLEA 1IJKA 1C4OA 2Y4NA 2WA1A 3HEAA 1PVGA 1NI4A 3KVRA 4Q6WA 5KKCA 4WZAB 4TTQA 3NEPX 4Y6LA 3QGMA 1DVRA 2ZSEA 3QX9A 4Z0TA 3A0TA 2C3OA 3LC0A 1XYVA 2VUHB 4EW1A 3X1JA 4HDRB 4BE4A 4TKZA 4BVJA 3LXUX 3ICQB 3B7PA 4V2UA 4ZQGA 2A0UA 2BHNA 2VWGA 3CUUA 3MZ0A 4J9UE 3CLSD 3KTFA 2WJ6A 1IB0A 4IV5A 5C4IA 4LRTB 3AM3A 5EMMA 3NIBA 1UKAA 4D6PA 4CEHA 1C0EA 1S2DA 4JITA 1G18A 3TSWA 3USCS 2GHIA 2I1LA 3W2FA 3H9UA 4IICA 3O8NA 4Y2JA 1ONPA 3PDIA 3QE9Y 3PUXA 1IBKB 1B4DA 4AZ0B 1F1BA 2PNJA 5IDVA 2ZVJA 2OV6A 5AM5A 2QQ0A 1O87A 1YS6A 2FW7A 2Q5CA 3MLEA 1FFSA 3BZWA 2IWHA 1O2DA 3ZE0B 1W19A 1YI1A 3JQGA 4C08A 4C0XA 5CB4B 4EEZA 5T57A 4DGQA 1C8BA 4MYCA 5AOCA 5JJIA 4RD2A 2FNAA 3LT0A 2BREA 5JT1A 5JCXA 1Y4DE 3TD9A 2E5FA 1W8DA 1FJGI 1AUVA 3HCWA 3L0YA 1Z4LA 3B1FA 1RHUA 3BXHA 4ER7A 4XX0B 3CH6A 2C1ZA 3L1HA 3VZSA 1QG0A 2HV8A 2OBFA 4J0FA 2D5BA 3UBMA 4DIFA 5M4KA 1ORTA 3HKCA 3LBNA 1K9SA 2CZQA 4PNPA 1K7EB 2EWVA 3J7AG 1WXHA 4H77A 4EYEA 2G25A 4G85A 3MK31 4DYHA 1I13A 2OG1A 3STWA 2PSHA 4TT3D 1P7VA 1W0KD 3Q4GA 4K7JA 5KTNA 1VFPA 1RDFA 1T9BA 2JI4A 4MUYA 4BP8A 4A92A 2DQYA 3L84A 2JARA 4IXNA 1E6WA 5E6UB 4XCXA 1EFPA 4XCVA 3KUXA 4CKCB 3PA8A 1UBHS 1VECA 3SIWA 4ASGA 1LKZA 1IUPA 1Q2UA 5K4AA 1ZHOA 2HW8A 1QHFA 3FROA 3E5NA 5D7DA 1TYZA 5AHXA 3UB4A 1EUQA 4FJ1A 4PRVA 1P6XA 4PGAA 3DKVA 1XQXA 4C3OB 5A5GA 3SLGA 4BGUA 5E6UA 5AHWA 1KKLA 4IIDA 1ZM7A 2JEYA 5FJJA 4DLWA 1L4LA 2ZUBA 4HY1A 4KO1S 1J20A 3K9CA 1WHTB 4AG5A 1ZC4A 1ZI6A 1CY1A 4PG6A 3TKAA 4C7XA 4IJ5A 2CVEA 4FEYA 1I7PA 3BZBA 3RRFA 4ABTA 1GAXA 3P9QA 1G6Q1 1ECFA 4XTJA 2VJQA 2FUG6 4EKIA 5EQDA 5J47A 5DRRA 1J7JA 4Z3DA 1WCYA 5KQLA 2Z83A 1EGVB 4M1YA 1JJFA 2VHZA 4BBPA 5HIKA 4S1TA 2DZDA 2O2EA 1VFNA 1W25A 2APJA 2VYVA 3BDIA 4OQDA 1FDSA 1NA5A 3KB2A 5CVUA 5CK4A 3S4YA 1V11A 2XQVA 1H3NA 2J9RA 2JJ8A 1SULA 3QP9A 4EFMA 4L4ZA 2O5VA 4EA7A 5C46F 3UEOA 3AFGA 5CYOA 1BWPA 1I2ZA 3JQAA 3LI2A 4IRXA 3RRYA 2QQFA 4H6XA 3K0SA 1A4UA 3D7SA 3B82A 4NFHA 2WF7A 4XFDA 4BNWA 3C7CB 3C6ZA 4HDSB 4MW1A 4P82A 1U7UA 4UVDA 4B85A 2HMYB 4FONA 1YBAA 4UTGA 2BE7A 2W6ZA 1I0LA 3NHJA 1VPVA 5COBA 3T3MB 1EX6A 2NYVA 2V8OA 3K53A 3QPCA 4JFRA 5EWMB 2CDBA 2XUHA 1KZGB 4D9CA 1OQAA 2BEVA 1KO1A 3VHCA 3CX3A 3FI0A 4Q47A 5JAPA 4DF3A 1A98A 2IYZA 3GFGA 4R9SA 1JJ7A 2BU8A 4RL4A 4EUHA 1XA3A 5YASA 1EXVA 1XNGA 1TT7A 4F6RA 2C5FA 2I4OA 1ZXMA 1I1QB 2P0YA 3GAMA 1T1SA 4QGFA 1X80A 4AJOA 1HDIA 4B87A 1L7XA 5ECDA 4PHHA 4W9NC 4N7MA 1AQLA 4QO8A 4DN6A 3FMVA 4USMA 1SUPA 4KDEA 4KIWA 2PO2A 1VHQA 4M36A 4Y2TA 4AY4A 3FAKA 4XJVA 1QZXA 2IVZA 5DLEA 1JR3D 5LUBA 3OC6A 5C4MA 4OUKX 2WW4A 3PXUA 3AOEC 3TUJC 1C1DB 1YACA 2V5AA 4ZC8A 3EOZA 4R68A 1BXGA 3ESZA 1DKOA 1E5VA 5KJFA 2IVFA 3GIEA 3F4KA 2HEIA 2I62A 5BQ3A 1E3WB 2KW5A 1DG3A 4MO9A 4OP2A 4NCKA 1KMIY 2I71A 1UYHA 4JJ6A 3TRKA 1KO5A 1QP7A 3FHCB 5HMMA 2QXYA 3A1VA 2WHPA 2ZRBA 3QPUA 1SIOA 4MEAA 2WTUA 4QPPA 2QGNA 2Y67A 4I9GA 3MGGA 4GE3A 5CFQA 5DTEA 3O4JA 5F5LA 2H5IA 4IINA 4Z9AA 3ZXSA 4L3WA 3JW8A 1ZMTA 3W3AA 1TMGE 4BRZA 4A6PA 2OORC 4FCWA 2Q1WA 1BFKA 1NC3A 5FUMA 1LPNA 1CHNA 4N6OA 1SM4A 2C5HA 3NMQA 2J7KA 1L5RA 2Q0XA 3KYIB 3T7JA 1YHCA 3OLQA 1Z6PA 2EERA 1YJ8A 3PQ5A 3K0BA 3AHEA 2Q5EA 5EINA 3IKJA 4P58A 4PNEA 4KNYA 1P61B 3ID6C 1A7AA 1AXEA 1IPEA 3DAYA 3INXA 1AQUA 5AI0A 2RI0A 2WJGA 4CIYA 3IQHX 3KL4A 1L7EA 2CJFA 3JQPA 4L76A 2LNDA 4V02A 5CNIA 3RRBA 2OCGA 5AKYA 4HACB 1SZDA 2HZBA 4EYQA 2AJCA 1T0JB 1VXRA 3B13B 4G5XA 3TLJA 4LF4B 1RQXA 3HZRA 1C4KA 2XUJA 4GC5A 2ATEA 4V0SA 3ZH9B 3LS2A 4BV3A 1I7LA 5ULLA 1SQ6A 2XIJA 4MRNA 2P9YA 4FM9A 5HP4A 4G4SO 3Q9LA 1YC1A 3M7ND 3UPTA 4Y2RA 3AR3A 3FMFA 1CY7A 1MUUA 1PJ2A 2CG9A 1V45E 3OJWA 5EHGA 3QNUA 1R9MA 1Q0ZA 5JEAE 2FE4A 2ZDHA 4J0IA 4HYEA 2Q7XA 1YOVA 1ZWKA 2QD5A 4HMPA 1RRKA 4IGFA 3HCDA 3SEQA 1SVSA 1J24A 3LDUA 4DRXB 1P73A 1H2RS 4ZO9A 3E15A 1KK0A 1VDMA 1M8FA 1E3SA 4IFDF 1Z0AA 2VP3A 4CL2A 4R3WA 2X0RA 1UZLA 5EHIA 4N65A 1ZD4A 2Z56A 2XCMA 4ZVQA 2BI8A 1EVYA 1BGWA 1GN9A 1VGQA 1XRLA 4ZU3A 2ZDXA 2Y2UA 3U1VA 1ILWA 3WGQA 2FEPA 3WP0A 3WMFA 5BSEA 1XK6A 3HHEA 1YXMA 1DJOA 4D7AA 1XR3A 2CKDA 3HZHA 2X4IA 3MWGA 4MWEA 3WLIA 4Z5XA 4E02A 3KSBC 2JE6B 3AVOA 3NS7A 5KTPA 4YEDA 1KOFA 3P7MA 5T4EA 1QK5A 5AJUA 1UOPA 4Q3CA 4O29A 3P9CA 5LQSA 4LW8A 2XMCA 2OQVA 4O2BB 4BO0A 4X71A 4IDBA 2VF7A 1ZLYA 4OHUA 1BXDA 5SZHB 2YWXA 3IAAA 4LN1A 2PIAA 4BKMA 3ASZA 2PRZA 4FEEA 4YCCA 5LQKA 1DO8A 1WDTA 2QM0A 1QKKA 1T9DA 1WMFA 5B6IA 2QVGA 4NXMB 1MA0A 4MKHA 3M85D 3EZ7A 1PG2A 4PX5A 1SZCA 1X70A 1DAFA 2CLIB 2GPNA 2IY7A 3R6GA 1AS2A 3L8GA 4NMWA 3O03A 4WACA 2XCRB 2YJ5A 3JYPA 4IDDA 4RK0A 4X1KA 4WXEA 4D9NA 3DMFA 5K8VA 4J7AA 2P91A 4G9BA 1O3YA 2AR0A 3B12A 3JCZA 3T3IA 4CM8B 5ALKA 3NFRA 1QUEA 1DQSA 2YZNA 3RIHA 4CODB 3LCJA 2JI7A 4UM8B 4WI1A 3JZAA 3M34A 1YDWA 2NVUB 3RTBA 1E2FA 1HYHA 1U0ZA 4TUYA 4Q3EA 3V8NA 5LZ2A 1XMSA 2VDRB 3QQPA 1CIVA 1EUDA 2HQOA 4EEHA 5CYPA 3BULA 3VOAA 1DTEA 3LGSA 3JARB 4ZIRA 4UD6A 4JI5B 1T6NA 3NW9A 5TF4A 2YJZA 5J1TB 4P31A 3K0FA 2UZ1A 2GNPA 2OWDA 3I76A 4GXRA 2GN4A 1WCXA 3R9IA 1CCWA 3GCZA 4HRXA 3U5ZB 2IJGX 3I3OA 2IHYA 3AVVA 1RKQA 3FJ1A 4YT8A 1I7SB 2LKCA 3AF2A 2VHUA 2ZAMA 3NBFA 1OFGA 1ONNA 5CD9A 4XB6B 3M5DA 1M67A 2WTMA 3B9BA 5DPMA 4DNPA 3H7IA 3OHMA 2DHDA 4GS5A 5FO0A 2XNDD 3NVMB 3OC0A 3ZHQA 4BGEA 4CM7A 5K99A 2UYQA 4JKOA 2LR0A 2QX6A 1N7HA 3FTDA 4LYDA 3RROA 1VE7A 1PNTA 1YZVA 1GXSB 4AP5A 2AFRA 4X62I 3R6LA 4HQNA 1KMNA 4KSYA 3EF0A 4LNUA 3SE7A 4Z2AA 4QBHA 3K72B 4ISBA 5JNWA 2AXEA 2EFEB 3OOEA 1G5QA 3Q7SA 1X3LA 2PQ0A 3DYVA 4HH1A 4WZZA 5DXFA 5CEJA 4ZCSA 1R6TA 4H60A 1HEUA 4KQFA 1NU6A 1PNOA 1ESZA 4LGCA 5K6AA 3DH0A 5JV5A 3BK2A 2HPZA 1TUBB 2DF8A 3DE0X 3N28A 3QLJA 3TCNA 2Q5FA 4WDQA 2CT8A 1G59A 1W5TA 1XFDA 2NZXA 4G89A 4D45A 1YJCA 3N8DA 3WTCA 3A6DA 3E84A 3PHGA 4CM4A 2RGNC 4MI1A 3F9IA 2ZU0C 1NMZA 2BZSA 1C50A 4CV0A 2QL6A 1JALA 2PMKA 1IOZA 2AMYA 1Y5LA 2ZTVA 5FLXQ 4TSKA 4YJHB 2I4NA 4WLFA 3NX4A 3G0HA 1L5FA 4ZPXA 4YRDA 4ZZIA 3MEQA 4XUCA 5BUSA 5KMGA 2WWHA 1RZ3A 4B8ZA 4YC7A 3ZU3A 1GEEA 1OA1A 1Q7RA 5L3QA 1KORA 3G17A 4GMGA 5B53A 4WBSA 1MJGA 2YK9A 3BFXA 3DC7A 3LM8A 2ZWPA 3COWA 2O07A 3DXFA 5L4SA 3CF4A 5ISMA 3IPCA 1SFRA 3TX2A 2YHSA 3MXOA 2EKLA 5FAXA 5CFLA 4OKNA 1KSHA 4HYTA 3IOBA 3DGEC 3NHBA 3LLMA 2W6NA 3OKFA 4RYLA 1EE9A 5IT0A 4C7OA 3SEZA 2Z6QA 1GJVA 1UZMA 4Q02A 4FFVA 3OD5A 1FXWA 5CIYA 4KN9S 2DEJA 1R6UA 4KHZA 2JFGA 5IBPA 2FU5C 4DXLA 1YQWA 2F3QA 4J07A 3TFWA 2ANBA 5ITVA 1HH4A 1E8MA 3PQ6A 3SIRA 2ZBDA 4G0VA 4ASFA 1RAEA 3D8BA 3QXHA 3SOPA 3R5FA 2M6SA 3L0ZA 2VNSA 4H35A 4U7DA 1D1PA 4MS3B 5JADA 3L7LA 2V7TA 1POWA 3FB4A 4M60A 5F9HA 5CH5A 4WGGA 1M2EA 3W05A 1PNRA 4CWFA 4UM7A 1VZ2A 1E2GA 4NNPA 2K6GA 2XF2A 5B4VA 4FS3A 4YY3I 1XZEA 3P2JA 2WD7B 4JI6E 4NHEA 3ROGA 4ZVVA 3V5NA 1VZ3A 5EKWA 2AOUB 2TMYA 2XX3A 3NYWA 1VBMA 4R2MA 5FTJA 1U5BA 3MJFA 3PYMA 3PFKA 4J3JA 1PSZA 4QUJA 4RVUA 1O6ZA 1GL3A 4UBKA 5DWQA 3ZZNA 1MGPA 3IRUA 1BS9A 4BNUA 1L9XA 3T0FA 5KOHB 1FXWF 3RSOA 4FCTA 1XD2A 4C7BA 1LC0A 3GRZA 1E9EA 4MVJG 1KY5A 1EX1A 4HDRA 4WFKA 4DSTA 1B0PA 2WFLB 3E9YA 3FTEA 1M34B 1XTSA 4RTKA 2BU6A 4PONA 5K0ZA 4DA8A 1MBZA 4NU5A 4F7WA 3UGJA 3NUQA 3UQZA 3HEBA 2C97A 3GLRA 4MUKA 4WCFA 4HNVA 1T9KA 2J4CA 3NAZA 4JIMA 4NLLA 1QV7A 4KSHA 1X1DA 1I0ZA 3PFIA 5JHHB 4GLFA 1WBDA 2DUWA 1TEHA 2ZROA 4F91B 2ST1A 1T0IA 2JEBA 3RUAA 4Y9SA 3TDKA 2GN6A 2ATCA 3MGCA 1FTQA 3G49A 4QXAA 4PGGA 4TN1A 1HI9A 1TLFA 4Q9LA 5IARA 3ZWAA 2K7FA 1QO9A 1R6MA 1I94I 4MKZA 1H8ED 4MW5A 1YDGA 3B6EA 3BAZA 4MVYA 1WUTA 4PS0A 4UUPA 5BV0A 5KWJA 3AB3A 1L4BA 3DE4X 1YUNA 3M2TA 4TLDA 5DGIA 1Q20A 2E89A 5JEAA 4O05A 3UXHA 4G81A 1EDBA 1QRAA 1NYQA 2A4MA 2ONCA 5DCUA 5TIIA 1OAKA 1KHTA 3QT5A 3AC0A 4FVTA 4DPUA 5ALHA 4DNXA 5BSVA 4HEA1 1RLUA 1SIUA 3HY4A 4UULA 4E4RA 1VG9B 3THXB 1OLXA 3O8OA 3QOYA 2WJHA 1KJJA 1U3UA 2HSWA 3AJEA 5EQJB 1R50A 5EIXA 3IAXA 4AWPA 1U98A 3RAEC 1VHTA 2AZ4A 2YOGA 1J2YA 1OPXA 4REMA 1NTOA 3PRKE 1G5TA 4FYMA 2A3NA 4BMSA 1P75A 4ESVA 2I2AA 5ENVA 1CUIA 1XLWA 2F8TA 4R1SA 1J06A 3JVVA 4EX6A 2XA9A 3F90A 5J5AA 1N7GA 3MT8A 2YI0A 2XE6A 5LN1A 4QNMA 5D85A 3KTAB 4JJ8A 1Q22A 1HDGO 1THZA 4G0MA 5DHRA 3C7TA 4DRXA 1VBKA 4KFUA 2C4UA 4LXUA 3SQMA 3ZHZA 1RIFA 3P0RA 4G1UC 4JI3I 3MILA 4KFSA 5CF0A 1IM2A 1YBHA 2WR8A 4QYIB 1R2QA 1L5GB 1CUFA 3EB9A 4HLCA 3WKAA 4BNDB 4WJKB 2NZ8A 3BXFA 4C43A 4Q4AA 7REQB 4KQ1A 1GCIA 1ZNZA 2ISSD 3EVBA 3FX2A 3KZCA 4RZXA 4JJGA 5SZIA 2IU4A 4D57A 2Q2WA 3RS5A 4KPEC 1B1AA 4TQUS 4L9AA 4D9HA 2ZITA 2Q5LA 1SBIA 4X66I 1JQJC 2VS1A 2OFWA 2ZAOA 3FFTA 5T6MA 4UHEA 5FULA 1S9DA 1DS6A 1JW9B 5EMNA 4AMZA 1Z4KA 2E4WA 4KMMA 4XPIA 3I0MA 3ECAA 4H7FA 2IS1A 2RBKA 2JRCA 4IUCS 4P0QB 4XIPA 1CUBA 4L90A 1E5TA 2CNDA 2CNOA 1IBSA 2OGUA 1OASA 4KP4A 3GGGA 3PGLA 3RVPA 5JSZA 4N5DA 3DEJA 3S2IA 3WGTA 2W90A 3HB9A 5E38A 3Q8LA 1KI6B 3SXPA 4F1WA 1Z4QA 3RS7A 5I7FA 1GNSA 4JMLA 3SAJA 3OIWA 3TW4A 1EP2B 5HS6A 3L7NA 2NMVA 1IXRC 4LIPD 4MR9A 4WZBA 2ZWIA 1NHWA 4A03A 2EZ9A 1WMAA 5GZ1A 2OZLB 4KPFC 4YJ2A 2R8YA 3N76A 1C1HA 1R0XA 1TU3A 3A28A 4IJWA 3PP8A 1NVXQ 2WWRA 1QCYA 2FMHA 2PR2A 4M6WA 1LDBA 3WA7A 4L6CA 3HKDB 3M85G 4RF3A 5C5EA 2BBTA 1OB5A 2PO1B 3QVWA 4L5AA 3RBAA 1HEIA 2WY2D 3PE3A 1R8JA 4P8OA 1C9EA 3X2SA 3IEVA 3D7MA 2O2CA 1UXGA 1XZDA 3GWGA 4RORA 5EJGA 2H0QA 4G8CA 5BWMA 4MV4A 5HIAA 1AQJA 1Z0VA 4TMYA 1WV1A 4DA7A 1UYCA 2VUIB 3QPDA 4JUDX 2BEVB 4KXNA 4O0LA 2QJTA 4R1LA 2IYWA 5HRUA 5C3UA 1U8EA 3WU4A 1KMQA 3B1JA 1Z88A 3MWEA 3R7DA 3TMYA 2CXXA 3AEQB 1LNSA 2GYUA 2I87A 3A58B 4DPYA 3PTZA 4LI3X 5K6RA 1DTWA 1MQSA 4C20A 3T10A 1JWLA 2E5LI 1PV1A 2PEYA 3DYBA 1R15A 1QTIA 3GJRA 2OCPA 1HG0A 2VO1A 4PRKA 3VHQA 1FNNA 4AIRA 1U80A 2FV8A 4XJXA 3VYSB 2GM4A 4MDEA 2Q21A 4LAFA 1ND5A 1LPPA 1SZPA 1WDKA 1P1JA 1U28C 3IXMA 2O2ZA 1GT91 1ZL2A 3BWMA 3O82A 2C7QA 2CW5A 4G1BA 4DV5I 2J9FA 4YO7A 4DMHA 2ZCVA 1DTWB 4JI3B 2QZ4A 5LMCA 4W5QA 3WWZA 2OBLA 4R01A 3GXOA 4LWOA 3MHTA 1FMTA 3CZPA 4KUEA 1KSJA 3FDJA 3HU2A 2FAXA 3B6MA 2NVUA 2WU1A 3CKLA 2A0WA 4J2HA 5F7ZA 1TNDA 4Q3DA 4Z9BA 2VWHA 3JAWA 3P0EA 1JFFB 3K0CC 2ESAA 4B4OA 1K2VN 1ULBA 5F12A 4AU1A 2B1QA 2AFIA 1FYFA 2V58A 2XE7A 3GVIA 5BR8E 1V6AA 5CNJA 4EJ0A 1JQDA 4I46A 4HACA 2G9UA 1FUEA 2ZIXB 2E5WA 2WSSD 1Q3TA 4DIEA 1JKJB 2W6CX 4LQLA 4RPKA 1EB9A 1PK8A 5CP8A 3S8MA 2WP0A 5JJBA 1T15A 4CU5A 4XKJA 3VZPA 3T3EA 2IZ1A 3KVVA 2VF5X 3QU4A 1Z15A 3TEMA 5ENZA 2X0KA 1Q7GA 1BQ4A 5L3SA 4TL9A 1XU7A 3L6RA 1NLZA 4J1SA 4ZKIA 4WXPA 4L9SA 3IE0A 4EG0A 1D1QA 1GDHA 2KLHA 3KS9A 1G8MA 4BZQA 3VH3A 1DWQA 1ENYA 3A8TA 5KBYA 1UF9A 4LFCB 3F2VA 2BYTA 1BEZA 4G25A 2G4VA 3O21A 1OWNA 4WH0A 3GZ4A 2JLQA 1WU7A 3ELBA 2CXHA 4HPXB 4NBUA 2ZI6A 4WUVA 4QVIA 1UWLA 2C2HA 2GS9A 2AKPA 5K36D 1QH1A 3EVTA 4IZIA 2OBBA 4ZVRA 1ZN8A 2DBZA 4Y1RB 3KKMA 4UTXA 3A6LA 2QBYA 5DK4A 2WSLA 4NCNA 3RS2A 4DMFA 1MC1A 2LCQA 3OZDA 3RAJA 4UHFA 1SCQA 1OLUA 4X20A 2CHGA 4G5HA 1CERA 2W6PA 1TB4A 4BFVA 3AT1A 1F4VA 4MUHA 1WQ1R 4Q7KA 5U4QA 2VDWA 1ZKMA 1G6KA 1WCIB 3U4AA 4TX1A 4CVNA 4DU8A 4B5LA 2BFFA 3N86A 2BUCA 5JSQA 2BM9A 2W2TA 4ZDJA 3EXHB 3C16C 3KL2A 3S1AA 4WNIA 1AGPA 2IBTA 3NATA 3B2NA 5JVDA 1KZ1A 1VMDA 1CJSA 2B20A 3BH7A 1V6CA 1OW3B 1DADA 5E9QA 3TLGA 3IIMA 3SZUA 2HF2A 1EJ0A 5EXDA 5PGMA 1BNCA 1E9FA 1NBMD 1XQVA 2B8TA 4MA5A 5K3BA 3T7CA 4D9IA 4IKPA 3KCQA 2W93A 5A5FA 2JIZA 4B81A 4WA7A 4RDXA 1EZ1A 1Y7IA 1V48A 3IUEA 2EX1A 4RK6A 3KUKA 3H1PA 2C42A 1A1VA 1KGSA 3PR2B 2GM3A 3H65A 3DFZA 3T1VA 4C0LA 4CF6A 3VPGA 3TIGA 4ASBA 5I9SA 5DSTA 1Q1BA 4C14A 4LE2A 1KJWA 4D42A 4ZK2A 2PBRA 4OP1A 4FZJA 1JDZA 2LWIA 5E1BA 4LOMA 2AGVA 4ZEWA 5TEVA 4Y6RA 1RQ2A 4C7MA 2EZ8A 4ND3A 1N32I 2C7GA 4D8YA 4F4DA 4F92B 2PXCA 3JARA 5EQTA 1B8NA 4MVXA 1MOZA 4E5NA 2QLMA 2IZOA 2JVJA 2P75A 3F5SA 3FMOB 3TVDA 4B3JA 4B73A 2NW6A 4EOGA 3AR9A 4C6TB 4JWTA 3RJ5A 3NPMA 4W7IA 1MAUA 4CIVA 3L5KA 2FPMA 3I12A 3Q7IA 2HG1A 1VGRA 2Z2YA 4B35A 4UE3S 1UUFA 3LGAA 4TWZA 5BYAA 4BZWA 1JHRA 3N9IA 1QDUA 1UDXA 3GNTA 5CT9A 1K5HA 4P92A 2CB9A 3WYNA 1QB7A 3JVIA 3EG9A 1GZ5A 3DT8A 2C54A 4PC6A 5ALQA 1VRVA 4H85A 4M0LA 5ERYA 2EFDB 3OZXA 1LXCA 1C8LA 4HADA 4LE0A 5E2IA 4P7AA 3H2ZA 1JA9A 2F1KA 2UXDI 3EIOA 1OH7A 1OVMA 5EL9A 1BN6A 1SU8A 3DF9A 3KJQA 3SHVA 3MJDA 6ADHA 2QAIA 1EEXB 1CRPA 3IT3A 1NG9A 2QYOA 3V4LA 3VU8A 4AZ0A 3BDVA 1C9DB 1Z6GA 4B75A 4Y7DA 1KH3A 1EG2A 2BISA 3MWEB 1SKYE 2PO2B 4YMTA 4DV1I 4AS2A 4I4NA 4XIGS 3W0LB 2ZUFA 1BMQA 3QHPA 4UUOA 3SIPA 4KR6A 4ERXA 1G5RA 3PUYA 3JQGB 2IQIA 1OREA 2ZYIA 3OZBA 4LSMA 1URPA 5KC8A 4BX2A 3ERCA 3VTAA 2B5VA 4PC7A 4ARUA 5IBCA 3WFIA 1IONA 3BH0A 1FBTA 1S3FA 3M6LA 3DD6A 1RHMA 1B0UA 2J9FB 5BMVA 3F67A 2QI9C 3HKBA 3BJZA 4I14A 3GLTA 3T35A 1GLNA 1SVWA 3ZW7A 4V1CI 2JLWA 1QHYA 2XCIA 3NHZA 4REQA 2F59A 2GD6A 2OO3A 2Y6UA 3C74A 3E9RA 3H84A 5K36A 1CUGA 3NQ41 4RHCA 1D6SA 2PUTA 4D9FA 2H1HA 1P7PA 2RIRA 4GWGA 1O54A 1S89A 3E22A 5JBQA 3QX3A 2GARA 3GH3A 3IBTA 2IHNA 2BH9A 1MABB 2HSGA 3SJ7A 3I61A 1USVA 4CETA 1KL7A 4J0EA 2I3BA 1TE2A 4P1ZA 3WL7A 2PGLA 4DIOA 4E2WA 2C95A 1A50B 1EG7A 4WN3A 2PX0A 3RU3A 4FR5A 4BX8A 1Q83A 2GCIA 5LQJA 1ZM3A 1QIGA 5LP6F 5CG2A 3QXXA 3KSDO 4RWZA 2V1UA 1TJ3A 2RGNA 4ZAZA 1UDBA 1XWIA 1NIPA 3GRVA 4HRYA 4S1PA 4UEOA 3R76A 4QSHA 3HG7A 4BFZA 2HHCA 4NPAA 1EU1A 1NRWA 1SNYA 1SXGA 3C48A 1FFEA 2Q3BA 5K2OA 3UQYS 4Q1CA 5B1EA 1VMEA 4XYEA 1VPWA 5AOBA 2XCTB 2QORA 3LECA 3EPJA 1N6LA 2QX7A 5AOAA 4CKWB 1BCRB 3SBDA 3LO8A 4CR8A 5K6TA 4EZEA 4M7WA 1NBMA 2YGFA 1H9AA 1T9GR 4QYIA 5JY6A 1WWKA 2W6IA 4G2TA 4JH0A 2Y0DA 2XMDA 3LDFA 3DKRA 4K81B 5DNEA 4RDHA 3L07A 3SSAA 2GK6A 3PQ7A 4JB2A 3RSHA 4O2BA 3RGGA 4XH9B 4DV4I 5BSUA 2OCYC 3EEYA 3UYKA 3TDMA 1A95A 1DIAA 4TVBA 1RWKA 3WQ9A 1H8EA 5LDGA 4PYQA 2QN7A 4KPUB 1RI5A 4IIHA 2K5UA 1D1TA 3C3PA 2H16A 4AUMA 4CLOA 4KQCA 4RHYA 4OXYA 2ZJ3A 5AVJA 4CEJA 1BH2A 2VJMB 2W2VA 4YRRA 2JLSA 5BV8A 4DV3E 3TR0A 3MJSA 4J90A 1X77A 3JYQA 4H27A 1Y8RA 3V4RA 4DEYA 1E7SA 2OAP1 1L4FA 2ZUWA 3FNBA 1TQ8A 3NB0A 5IAJA 3NKVA 4RKQA 2GF2A 4LZZA 3VR5D 2DPYA 1XLTC 3O3CA 3KSAC 1ADYA 4RZUA 1ZVMA 3OOJA 2DTEA 2PUWA 1ZO8A 3SZ3A 5AM1A 3DPIA 1E6KA 2BGMA 6REQA 3LMMA 4AI6A 2H11A 1M1NB 3DB1A 2WV9A 4OJQA 1H94A 2PVCA 2XA2A 2GXAA 3S5UA 5DLYA 3J80A 2ACVA 1HOXA 2Y1GA 3DT6A 3OFJA 4GXNA 5H3LA 5HQ3B 2JGMA 3IVAA 1ZH2A 2BMJA 3KFXA 4LHWA 4AC9A 3D8HA 5EP4A 1YL6A 2VYCA 2DLNA 3L7DA 4Y2XA 1W93A 3R4MA 2P8SA 2YV5A 1YC2A 5DX0A 5JO0A 1ODCA 4XPIB 1LTQA 3AFNA 2W98A 5BMVF 2J7PD 2AW5A 2RGYA 1X2BA 3PGA1 3WDKA 2P4QA 4AD8A 3E7DA 4AURA 5FPYA 4O3MA 3H6GA 4UNNA 3TAUA 1IUNA 3WHPA 5EJAA 3WB0A 1BE8A 2VCEA 2H07A 1P74A 2AVDA 5GM1A 2ZYAA 1UK6A 2NXNA 1DNPA 2OQRA 4Q6BA 1LPOA 1TC1A 1V37A 3MJRA 2GEUA 4M3NA 5AO9A 3ZE1B 2QLBA 1YIDA 2RH8A 5EI5A 4TGLA 2DPMA 4LJLA 3K6SA 4R16A 4YRSA 1NVVQ 2BZ0A 1GPMA 2X6QA 3C3XA 2ZR0A 5DMXA 1HSZA 4AP6A 4DAOA 3D36A 3ZNQA 3C5HA 3WRWA 1BW9A 3A2LA 4LX8A 1OZFA 4M22A 3ZX4A 5EP1A 2HNKA 3OAAA 4D0SA 4RLFA 4I9NA 2WU0A 2FWNA 2ZJ4A 4D4HA 1INLA 2F3RA 3A0RB 2Y1KA 3GMEA 4H2DA 4RDCA 2HJVA 4Y2YA 3O95A 1P2UA 1R18A 3HMKA 3K6SB 2IY8A 1DKMA 1ZRNA 3P5SA 4M1QA 4LSGA 4UUMA 4Q66C 2OPHA 4DM7A 6LDHA 2NN3C 5EJ6A 2JGRA 1U3WA 4QZVA 4JLVA 5J4YA 4YLGA 2PMFA 1RJWA 5KTTA 1CRLA 2P68A 1X1EA 2WG2A 4B3CA 4EUEA 4EJ2A 4TS4A 5C1DA 4X66B 2YFQA 4N4AA 3N0RA 1Z18A 4JLPA 5D7CA 2OC9A 3KZOA 2A57A 4MWBA 4DUYE 4QQFA 1BD4A 4PICA 4TWJA 3SSOA 3A1FA 3ZXUB 4QSMA 4BECA 4DXHA 3R24A 4MB2A 2FMTA 1UBTS 2ECQA 1YKGA 3ONFA 3SEAA 2Q8PA 2QVXX 1JQLB 2JBAA 2NU6A 1Y98A 2KM1A 4B2PA 4XE5A 3I2KA 1JXQA 1N32E 3R7SA 1FW6A 1Y5MA 3IP7A 3SR0A 1XLTA 4EJ6A 4NENB 3I6MA 5DTIA 4DCVA 2BC9A 4MKRA 2W6ID 4F3CA 4XCJA 3BREA 3ENWA 2QVCA 3FAZA 2QTHA 3NXKA 1FDUA 4PZAA 4Q7QA 1V1RB 2R7LA 2RGXA 2UZAA 1E9BA 1ZW1A 2C9CA 3G75A 3EHFA 2H7XA 4DLBA 1YA6A 3GIDA 2PA0A 1NPDA 5B3JC 3KPUA 1ZR2A 1ID8A 4F96A 1U7XA 3LF2A 4RSHA 4R3AA 4NBQA 4LY9A 2CEAA 4FCCA 3ZDEA 2BOVA 4YAFA 3U48A 5JXIA 3BWVA 1I51A 1RYHA 2ZJBA 2ZR8A 2O14A 3R3JA 2IW3A 2VHYA 3HJRA 2O2GA 3CJRA 3OJLA 3PHCA 1NUAA 3G2PA 5EHXA 2Z9BA 4JA2A 3R5JA 1LH0A 4MW9A 4Z7QB 3T1YB 1IN6A 5GJVC 1Z62A 1PUJA 3GZNA 3TR5A 1E6LA 2EBFX 3HVJA 1OWMA 4JLKA 4UMEA 5IDXA 5GV7A 2B0CA 3D6HA 3C14C 3AL3A 3SQDA 1XTTA 5IDWA 1FS4A 1XZCA 3NCTA 3V7YA 4JI5I 1RVDA 1HT1E 4TKUA 4YAKA 1UY6A 1GQFA 3TLGB 1CEEA 2Q0SA 2XDXA 1XUOA 2PUEA 3FY4A 1PDVA 1AS3A 4J75A 2OC4A 3TO5A 4JI2B 4CE6A 3OLCX 1LF0A 3HV2A 1EWQA 4K87A 4ZVLA 2C4NA 3EIHA 3FCOA 1F5SA 1PI3A 2EFCB 2A5DA 3KKOA 5EXPA 4FT4A 1Q7TA 2ID4A 3NNSA 3FPSA 5B12A 4RCYA 2I33A 3HHUA 2Z43A 3PK0A 4H7HA 1TILA 3I9KA 1SHUX 2WVGA 3ACDA 3UATA 2XJGA 5CB6A 1WCIA 2F17A 1ZZEA 4K6HA 4QJ5A 4DDWA 2QMQA 3H5WA 1PWZA 4RKRA 3ANYB 3KX2A 3LTNC 2ILVA 3QW4B 4DR3B 4BXIA 4N3BA 5A04A 4LJ4A 1JPNA 4MX8A 4ZVMA 3CVYA 3PX7A 2XTMA 4R3UC 3ILHA 1PHRA 2P6UA 3EUAA 2V74B 3NIDB 4Z7OB 3PPWA 1T4CB 3ZBUA 3L4JA 5LDDC 1KDZA 2NP7A 1EX9A 1TM4E 3I1FA 4ASUA 2CL0X 1ODSA 4LECA 5T8KA 4P5PA 5KHLB 3PYFA 4L9RA 3KRTA 4FYWA 1H4SA 5BR8I 4YBZA 5B7GA 4LKRA 1OLXB 1XL1A 2H31A 2NIPA 3O8OB 2AG8A 3K99A 1OAAA 4BLTA 4EI2A 4CKZA 1DT3A 2I4RA 2JI8A 2PIDA 2Z5FA 4ZRNA 3G2JA 5J4HA 3FPFA 3U4DA 1XZ8A 1JJAA 2BRUA 2LDXA 2ZPTX 1U0HC 4RVFA 1ZOOA 2C4VA 3WLSA 2EBUA 4ZARA 1YOBA 2WG1A 5AVVA 3R9XA 3F6CA 4MVJE 4XW2A 5FA5A 2QMHA 3MUFA 4XARA 4AZTA 4L5IA 3UCXA 2FFHA 2HF8A 3A3NA 3JXEA 1A8HA 5KYNA 1A9ZA 3OSUA 3EVGA 2P4EA 1BIFA 1SKQA 1WD7A 1Y9DA 2VTDA 1ETHA 3FDZA 2ZIXA 5E9AA 4KQMA 1KPIA 1B14A 2I03A 3E35A 2PSFA 3F78A 4Y6OA 1X1AA 1CY2A 1YGPA 3R3UA 4MRVA 1HNNA 1JXOA 3DHNA 3EXIA 3MJCA 2R8ZA 5IC4A 3LXRA 1YBMA 2QVLA 5FPQA 1P18A 4RTNA 4CGZA 4MPEA 5LB2A 3F5FA 1YRBA 3CZ5A 4Q37A 5IH3A 4HB3A 4KAAA 3NANA 1NNEA 3K4QA 2VKTA 3GFVA 4RULA 2XUGA 2ZIWB 2DQZA 2XBUA 3OQVA 1HTWA 4ND1A 4QRDA 5EJEA 3HJAA 5LXTF 1ISPA 4ZRDA 3EY4A 4K6OA 5ELXA 5TQ2B 3UMGA 4FU0A 4DPKA 4HUTA 5K4HA 5BN3A 5JWRA 1NDHA 4BPBA 4DLYA 3JATB 4U7NA 2GPAA 3BGOS 1YZUA 3ZJVA 4OQYA 1I80A 3V7FA 1M2GA 3IPLA 4BXOA 4IY1A 5TGDA 4CE3A 1BGQA 4KLRA 3KXKA 1JKMA 1NXPA 2AN4A 4X1IB 3RAPR 3BHMA 3AM4A 4FDTA 3VA7A 1KU0A 2BSQA 3SFZA 2X5KO 4HGNA 4UOZA 5E4YA 3JD2A 5KKAA 2NUAB 4C76A 4RXTA 2C39B 2OM2A 2WWIA 2WTBA 3UT6A 1L5SA 4DS3A 3VVLA 4ZEXA 5L3QB 2WYUA 5ESXA 5EP2A 3N59A 3TNFA 4FBMA 2OZKA 4GKAA 2CLFB 5EC8A 1NPYA 5IM5A 2ZR9A 3T4EA 3NM6B 4RPJA 1CQPA 2DUMA 2X0IA 4B4VA 1C3JA 2XDQA 1E0KA 2A9VA 4OI4A 4POOA 5K0CA 2A1TR 3H3FA 3K05A 4OLAA 2VYNA 3CGYA 1UXIA 3RCBA 3QPAA 1VLVA 5AJXA 1U8UA 1WX1A 3PC3A 2DYKA 4PPGA 4XWTA 1II8B 1CFZA 3WK9A 4E5SA 4EGCB 3IOEA 2VTKA 4GBMA 5IHPA 5A2GA 4RVDA 3FDIA 3OHPA 4LTDA 1K6IA 2OV8A 4P33A 2HLNA 2VBIA 2HMVA 3OZVA 1BMFA 2BMFA 1ND6A 2PZKA 3QNWA 3VR6H 3IHLA 3I62A 3S2ZA 1VI7A 4YIKA 3LU1A 3GEIA 1WHSB 4RSMA 3EXFA 2R4QA 4WLEA 2BU2A 3WLQA 2ON6A 3TI9A 4CE2A 2YGAA 1BMTA 1H74A 3NTRA 4WERA 3JQFC 5SYMA 1NXSA 4J7UA 5BQ5A 1TZ2A 2P2DA 3F97A 2F1OA 5BSMA 5AI4A 3DZGA 3Q5EA 5EJMA 5JPDA 2HA7A 1T5SA 3QFHA 5I7RA 2C7VA 2IHUA 2PLRA 3D9QX 2ZE8A 5ESWA 3JR3A 2F8MA 2OLEA 4IQ0A 4BB6A 1I24A 1SUIA 1T2VA 2WIAA 1K08A 4HGOA 4IGKA 1DKUA 4ZVIA 2XZOA 2V0GA 1Q92A 3AP2A 4D6XA 2ECOA 1J6UA 3IT0A 1GKYA 3N2LA 3HXMA 1DFIA 1KFBB 3O4RA 3S1LA 5G1NA 2FJ0A 1E66A 1Z26A 3C6KA 3EZNA 2IV2X 4ER3A 4IHJA 5MN6A 3K9LA 1P8AA 1UT5A 2HA5A 3WGVA 8LDHA 2BGNA 4RTMA 1JL3A 1GNQA 2I3GA 4CJXA 5MGNA 1YGYA 4YT5A 1FLNA 1U0LA 4HZIA 3LWDA 4L72A 3RHFA 3OFNA 1ZD8A 3OW6A 4AO6A 3O2JA 4KNWA 5A9SB 3O3MB 2QMYA 3CW8X 1UAGA 2XEXA 2C0CA 2C61A 4KP7A 4EY8A 1PT9A 1IIBA 3NP7A 1P1KA 2CGFA 2O2SA 5IKMA 2OHIA 3GDGA 1Y9AA 1IK6A 2C31A 1CQIA 2DPHA 3SMQA 5BN1A 3D3QA 4DR1I 5K8CA 1OH8A 3GIWA 3M5CA 3TW8A 4DANA 4YAGA 4UM9D 5FTLA 1YE8A 2A59A 1E2LA 4QYXA 1Z4PX 3N2GA 4DUYB 5CVTA 3ICPA 2V7QA 1CIJA 2PJZA 3BL8A 1FUYB 3UNXA 1LZKA 3EGXA 1BGVA 1R8SA 4RD6A 1N8TA 1JFFA 1NHJA 5FYQA 4F9TA 2RARA 1ADFA 1OHHA 1GAQA 4JGGA 3T4XA 2C4KA 4AS3A 2UDPA 1BAPA 1D6JA 4RV9A 5GONA 2BGTA 3U4MA 3PQCA 1U1GA 4BFWA 4C5BA 1WPXA 4WOJA 3ZUPA 4F8EA 1UBNA 3ZIAD 3D0OA 5C31A 1GGNA 1FSGA 5A06A 3SJUA 2GX6A 3BMCA 1T2UA 4WL0A 4LF7B 5G2OA 3A10A 4WK4B 3CVUA 3QLUA 3BB4A 5JLJA 3E22B 3KFVA 3LPLA 1G8FA 2I3AA 1IE3A 2Y1OA 4O63O 5FQNA 4HQRA 4ER5A 5I7OA 4NCAA 1AMUA 1WNFA 3UG7A 1JSCA 3CZMA 4C4RA 4D79A 3ZD6A 1ZW6A 5FBQB 3ZDQA 3QVJA 4YMHA 2BY4A 1ODKA 1OLSA 3OM9A 4EW3A 3AVUA 1Y5IA 2B7LA 3U49A 2PX8A 4C4SA 4DV4B 4H17A 3SHQA 3NNNA 1FFHA 4JLDA 4JQYA 3WHLA 1EQ2A 3FETA 4BDSA 3VSCA 1OFUA 3HZ1A 1PWHA 2C2XA 3JSXA 4L4RA 4OHBA 4UDOA 5EUMA 4JYAE 1G64A 5K3DA 1JP7A 2B99A 2YJ3A 1KAHA 2QR5A 4DPXA 3AILA 1J5EE 1NJGA 4UT4A 2A7QA 2ZIGA 3AIIA 1RAFA 2EQAA 3JYHA 3QJYA 4KQIA 1B23P 4ZOCA 3CEPB 1E0JA 1DC3A 2QRQA 2VT3A 1N2IA 5INTA 2GZ3A 4MXDA 3WKDA 3MAJA 3DWGA 1ZIDA 3NI2A 2DSTA 4NQRA 4YYEA 1Q91A 2YN0A 4DJTA 1YJXA 4IVPA 3ZGVA 3U4QB 3Q6IA 4G1MB 3K7EA 3WJAA 4WUBA 2OV2A 2ZJ7A 2G71A 3OA0A 4AS9A 3V2UA 3W8EA 1T24A 2D5AA 5K03A 1GZDA 4QEDA 4YO8A 5D8DA 1HTTA 1L5KA 5HKAA 4J1NA 5AVSA 4A6EA 3LKDA 4C0QC 3B26A 3BJRA 4Q20A 4YKTA 1N57A 2VRNA 4WNYA 3RU9A 4AF7A 4KPGA 3AJDA 3QV1A 1MOPA 4LDJA 5EUCA 5JFTA 3S70A 5CT8A 1G42A 2YN4A 1JEQB 1R5NA 1UZNA 5CURA 5SY4A 1F7UA 1DC8A 1KYZA 1JILA 3BHNA 5JW6A 2Q4TA 1A96A 1HPLA 1DKQA 4CR7A 5ARBA 4D9KA 1DUIA 1NFRA 4B3HA 3ZZ1A 1ODJA 2XMRA 2PFGA 1Y8RB 4H4CA 5J5VA 5JFGA 1UINA 1FLVA 1G3QA 3FBWA 3RU2A 4X66E 2ZI9A 3I42A 4LY3A 2Y0EA 3B38A 1UXHA 4DXAA 4NENA 3FGZA 3EW9A 1GLVA 4IZ6A 4U7PB 4S2UA 2PNLA 4G41A 4ZOLF 3R8FA 4OYRA 3GVCA 1N0IA 1X7GA 2ZULA 3EDQA 4I08A 2RAUA 3RFCA 4BX3A 1U0FA 1VKOA 2VT2A 3V8RA 3ZWMA 5JNLA 4XPZA 3R7BA 2WKQA 3DVAA 3IV6A 4I55A 2BHRA 2HRCA 2Q8FA 1WY5A 3JASB 3TX6A 3RI3A 1TYBE 2C98A 1YVRA 1DCMA 3S7TA 5JS6A 1ZIOA 3NDBB 2JK1A 4LF7I 1E2HA 4AQYE 1KK1A 2JKYA 2YV2A 3O1LA 4GEGA 1FLDA 2XRMA 3KR1A 3ZGOA 5BUCA 3WFJA 4IZJA 1ZOIA 4L0QA 2O1UA 3BRWA 3CF4G 2D8AA 3KJHA 3O6VA 3Q5GA 2YZ2A 4AJ2A 3EVNA 3O26A 4NEHB 3WQHA 1GRCA 4LOAA 1ONBA 5BSTA 3DVAB 4F3NA 4KDFA 4HDOB 2DBRA 2QAGC 2H48A 1KBZA 2H7YA 3D0QA 3UXEA 2OOSA 4L0DA 3P8ZA 5I3ZA 4ZQCB 3ADBA 1SOMA 1Y1TA 3K30A 1Z2DA 1JG4A 1YH3A 2Q3LA 3BD6A 1MIOB 3E8MA 3E9MA 1CUHA 1FE8A 1OF1A 3ESQA 3IO3A 2H85A 2QENA 4DQUA 5BORA 2RGRA 1WDMA 3F0NA 2GM5A 3BEOA 2D8MA 4U7FA 4X84A 4ZCPA 1RJDA 4URVR 1N34I 1CZLA 1PZFA 2VJYA 3CMMA 3NTVA 3GCWA 4IWYA 2NUBA 2Z3VA 5EKSA 3ZBPA 4A8TA 4YRNA 4UOEA 1PL0A 4MYUA 2FDXA 4B7ZA 5A0TA 2F9LA 1DLJA 4AKHA 2WIBA 2GEKA 2EIXA 2VSQA 5F98A 4PTLA 4EA8A 5JJLA 2QD1A 1U2GC 3TQSA 4DR4E 3OTOI 3IALA 1J8FA 1H3FA 4FYJA 4MKGA 1I10A 3BIFA 1P17A 5CIWA 5P8WA 3TZCA 3EIEA 3WYBA 4W5RA 1QG6A 4F46A 2F1HA 5HIJA 1H2AS 4II7A 1N4AA 1QC5B 2H1FA 5KQRA 1K92A 1R0LA 1CJTC 4QDKA 1DCTA 3ZH2A 2QRKA 3L0BA 4JX8A 1YB1A 1YV9A 3LQ4A 5LNK6 3RB8A 4U3DA 1W5BA 4R54A 2CCUA 4URMA 4C04A 3N7UA 3GDFA 5AIBA 4LWEA 2WUDA 4N47A 2FA9A 2PV0A 1ZIPA 3BPSA 5JZOA 2G76A 3ITKA 2FWJA 3SC3A 5JTUA 1ZINA 2D06A 3H1AA 2CV2A 1RJ9A 1FSPA 1NQXA 2OK8A 3G13A 4HDQB 5K8UA 1QCCA 2QXUA 2QVYX 3ZU4A 3ZWWA 4E4YA 1FP4A 1ZN9A 2O1TA 4NMXB 4EW6A 1IPHA 1LK0A 3SL2A 2Z09A 3QX8A 4H3KB 4S1VA 4TRMA 5IAAA 3T9DA 4QG3A 2FR1A 2PG3A 2ZS7A 5BYJA 4GPTA 2AEEA 1FFCA 2G5GX 2GXSA 3E2PA 3CUYA 5NLLA 1BFUA 1FFDA 4BIZA 1MX5A 3EXG2 2E5LB 4WOPA 3K9HA 5KOJA 2HRQA 1B6RA 4CPDA 5A02A 1IBKE 1JU4A 3WC4A 4KC0A 2HK2A 1A5AB 4QJBA 1XSEA 5JZVA 1ZJYA 4YJKA 4AIDA 3UB2A 1J7KA 1ONOA 4C03A 3A4VA 1NC1A 3FZNA 1UAAA 1JS1X 4JLAA 4YP0A 1UH5A 1E0AA 3QU2A 4N0EA 4GM0A 2FZ5A 2FSVA 2NV2B 1Z25A 5K0LA 5TB5A 4IH1A 5JR3A 1JSRA 1QG2A 2QL7A 3M7IA 3EXEA 5PNTA 3TLCA 4P36A 4C6HA 1QANA 4KLCA 5GGYA 4NG4A 4RLQA 4WLVA 5H83A 1Y8QA 3CWQA 2X0EA 5BSFA 4TRJA 3DMPA 2IW1A 3NBUA 3I3SR 1XTKA 2G40A 4C06A 4ZMRA 2V1XA 3JQ7A 2M98A 1GQRA 1JECA 3BEDA 2V7VA 1YCGA 4JZYA 4PXAA 4YCDA 5CXXA 3SZGA 4FYXA 4F9GA 2G5TA 5B6PA 3GLGB 2XHEA 2IIBA 3QVOA 4V0LA 3L4EA 2ZDGA 1CDZA 2WRZA 3OX2A 4DMMA 1GQYA 2X8AA 3LCUA 3MWDB 5ETJA 3ZWNA 2VCYA 5CJJA 2ZVPX 4PWYA 2AJ4A 2NSJA 4L50A 2XRZA 3B6IA 2FDRA 2YYZA 3AETA 3AONB 4B7CA 5BW4A 2W83A 3VNBA 3GL9A 4WQMA 4CM6A 2P5SA 1B8PA 2UVDA 4YDHB 2CF5A 1P0MA 4XZ3A 1MZVA 4G8DA 1OWOA 2AC2A 4JI7E 1DUVG 2N9UA 4OO1D 1JJVA 3QLEA 4PM4A 2FW9A 4PLVA 4BC1A 5TT0A 1OBFO 5FWKA 3LUAA 1C0LA 3WLNA 1XMOB 5E6RA 5AVXA 4A91A 1Q3KA 4OB7A 4XGRA 1XRSB 1M1NA 1XCBA 3GLFA 5DNCA 2WD8A 1K7YA 4LFAE 2OCDA 4FWIB 5BODA 3AWIA 4CM8A 3FPHA 5IYZA 2JAXA 5CMLA 1IBMI 3LVFO 4ZQBA 5AMXA 1QJ4A 2PU5A 4QDTA 4FFDA 3DBVO 1QIHA 2GNAA 1J0XO 1C3VA 1L1RA 1PD0A 1UPAA 2W2KA 3BWYA 4O0MA 2CL7X 4UXIA 3TI7A 2WI7A 3WL5A 3G2NA 3T7KA 1E69A 1Z0FA 2NSHA 3AGQA 3CCCA 1RWXA 2C2WA 1UYEA 3A0YA 4OAQA 3L82B 1P2GA 4F4CA 1TAQA 4K9RA 2XJ4A 3ORYA 4KNVA 1JH9A 4MITA 5C1BA 5L7TA 2YZMA 2JB9A 4WLNA 5J71A 2FW0A 1WSDA 3VGJA 3U2DA 2P2CA 2YIVX 5SY6A 3KAQA 5BN3B 1U9ZA 1SKBA 4J4BA 3IIJA 2AX4A 2HBQA 5DVZA 2KJQA 1I6WA 1Q6YA 3EGIA 3W5HA 1LS1A 3OJOA 4K9PA 4YAOA 4DIBA 1GPKA 2NVBA 4HFJA 4YS6A 3QEJA 5DEIA 2ZJAA 2IYUA 2VYND 1A5TA 1CLUA 1YDFA 3ZU5A 5E1MA 4IDGA 1G2IA 1EDZA 1Q50A 2X3YA 3E27A 3L4BA 4IXDA 2MSKA 4N7RA 1KKMA 3G8AA 1U7HA 4OJMX 4MUAA 5IJXA 3HVKA 3HBNA 1DXOA 3WR5A 1ZVQA 4EPXA 4HDMA 1D6NA 1ZUIA 2VT7A 3H2KA 4RY2A 5EPUA 1Y80A 4E5YA 5A03A 1FTSA 2BFNA 2I9KA 2J3DA 2GR9A 5CYGA 2IZ7A 2CNLA 3CKYA 5HX7A 1SVNA 2JLXA 5I51A 2Q6OA 3COJA 1AK1A 4B3SB 4L15A 4ZOQI 4IG9A 4R2WA 3SE0A 2FOLA 2D1RA 3HR4A 4N1AA 3FYUA 3MGAA 5G40A 1YC5A 1K2WA 4M7RA 1CB7A 4YCLA 5LVAA 6CHYA 4L8GA 1RT9A 2HUNA 2NT3A 3GJ0A 3LL4A 1KYXA 2VDQB 4ID9A 4Q4JB 2YWGA 5JHGB 4M98A 1XRRA 1D2AA 4CLRB 4DLTA 3PEHA 4GSKA 5TSDA 3FTCA 1DIGA 2B4RO 4UAJA 3TPZA 5ED4A 4JI6I 2OQ2A 1UXOA 1MOSA 3VYUB 5C0XB 4QFCA 1MG0A 3DWEX 4QJ3A 1TAHA 3CRKA 2AN5A 3EH2A 3BL6A 5LMUE 1NR5A 1XJ5A 3GT3A 5KYGA 2O5EA 1RXWA 3NC1C 3O5AA 4A9AA 2KWIA 3WV5A 5DBIA 5CTJA 5F5NA 1TD1A 2GEDA 2NZ2A 1IBLE 3MMSA 3OOYA 1UMCA 4EITA 1GQ2A 2FPWA 1L5ZA 3ET5A 2BFCA 1SB9A 1Z47A 1TGYA 4D0RA 4YDQA 4GRDA 4KPYA 1RMQA 2OO5A 1P80A 2C5BA 3OTHA 3GLKA 4F8JA 4KYUA 1R27A 1TM2A 2YYAA 2ZWOA 1HM5A 1N5DA 2DFDA 2H54A 3CRMA 1RTKA 2PWAA 2VLIA 3DV2A 4WCVA 5ANRB 5I7AA 4D2IA 5JQGA 3DCYA 2FSPA 4K9KA 4PHGA 5LXTA 2ZB2A 2MR6A 4DV6B 1T9GS 4Z7YA 2J67A 4ZICA 5BWLA 1UBFA 2OILA 3U4QA 1N9GB 2C58A 2OB2A 3AGPA 3DFUA 3N74A 3KEGA 4KXUA 2WQ7A 2AQIA 3GCMA 1TA0A 3D6AA 5EUQB 4QU8A 3TZ5A 4RIFA 1QIDA 2HLDA 5HF6A 1NR7A 4G0NA 5D01A 3TKYA 5LA6B 2W2NA 2OWEA 3B5IA 2Q07A 4B71A 1YONA 3M6UA 1Y89A 1RZRD 3K73O 1E1CB 1IXZA 4URLA 2ZM6B 1YU9A 4FZ3A 2NO0A 4IHJB 4KO3S 3B25A 1LTKA 4JLBA 2RG1A 2VG8A 4D92A 3SKVA 2K5BA 2VHQA 1J09A 3FPCA 5DI9A 3C87A 3PNQA 2FEOA 2VDJA 3JZDA 3LZ6A 4NOJA 1KR5A 5IFKA 3A37A 1YT0A 3L40A 1H0SA 1X15A 3GBPA 2ZLBA 1NE7A 4ML3A 5D5QA 2OHOA 2ZIEA 4JJ7A 5DM0A 4K3VA 3SNKA 5KEIA 3OQOA 3ET4A 1QFSA 4KYVA 1TTTA 2GAJA 5JNUA 1RMYA 4KK3A 1A1SA 1WXWA 3RLFA 3WRYC 1XDBA 4ED9A 1UODA 3AVWA 5JMPA 4XD7A 3WNZA 4BO1A 2DX7A 3EGXB 4D9JA 1HR0I 3A0UA 1SHTX 1KZHA 4J2OA 2Q5JA 2J5RA 3KE9A 4MOTA 1W6UA 4YRFA 3MD9A 1I3CA 1MFZA 4TVOA 4ARSA 5I9IA 5LIRA 1L3IA 3BILA 3IELA 3TMKA 3NWPA 1AHPA 4OQLA 5HBGA 1CZHA 2LXNA 3D0BA 2GCGA 3OURA 4PVDA 1KDOA 4CV2A 1RLMA 2B3TA 4AMYA 4DR3E 2QRPA 1XZHA 1VCHA 1ZM4A 5FUWA 1COWD 2HWXA 1VPDA 4MP7A 2X1MA 3OM8A 2QUKA 5JC1A 3ILYA 5ICGA 3EVFA 1C14A 2IUUA 4EO4A 1H2ZA 5HM8A 3DUFB 2AD5A 4EUFA 2A86A 1FTYA 3A26A 1ZLXA 4IEEA 4Q7MB 4BMPB 2PWZA 2VPIA 4AX4A 3FZEA 4MWZA 2BDUA 3LLUA 3VPHA 1ZUHA 3IUMA 2HHHE 1Z45A 1KPGA 3KDAA 4MRSA 5K0EA 2FDCA 1EWTA 2RBGA 3WK8A 4CM9A 1Q0RA 4YRTA 2CNWA 3IXLA 3UJ3X 2I34A 4GQUA 4I6JA 3M4JA 1D8TA 2DR2A 4DEXA 3IQEA 4Z86A 1HKHA 3PXEA 3T1NA 1D2RA 3JY6A 5HKOA 3TG8A 3KYDB 3SSMA 3W6UA 4AJJA 4R3MA 2DWCA 1TVMA 2NUPA 3L6UA 2NN6D 4L07A 3SFTA 4F2PA 4ZMBA 2EQ5A 1I6LA 1KYQA 1J56A 2NZWA 2P2ZA 2BGLA 3ONNA 4MPRA 3CYGA 5ALXA 4JYCA 5J1SB 5M34A 2O8BB 5CVCA 4DHWA 2OO7A 5L3JA 2JH8A 2CFRA 1H93A 2VJPA 1KZ7B 1LNQA 3F0TA 3KQQA 4X7BA 1Q11A 3UMRA 1OLSB 3PRJA 5FNZA 5B7PA 3IUBA 3WGGA 3VFDA 2PKYX 4QAQA 1EWKA 2O8CA 2H4HA 1NXQA 3W1EA 4ZYUA 5J4LA 1C81A 5FD8A 2DFTA 3TSZA 3K1ZA 4DU7A 5LZ8A 4GR9A 1DDOA 1GPBA 3D2AA 2BONA 2VHEA 4FFSA 4S1WA 5SZKB 3VC7A 1R0YA 5C8XA 3W5DA 3FVTA 5GV8A 3PXGA 1E60A 3IFSA 1Z08A 4MQ5A 3WG9A 1U3DA 2DQSA 1D6MA 3GAFA 3KJXA 4L0MA 2HIMA 3IOYA 4DB2A 2N3ZA 3A4MA 3EXG1 2YS6A 1II8A 1XT6A 3DTNA 3F6YA 4PCAA 3RKRA 2WDZA 3TAHA 4NP6A 3GLSA 3E4DA 1EHIA 2IIVA 4PFQA 1O9HA 3W3ZB 1RXCA 3AIKA 1A27A 4OMFG 3DC2A 5KREA 3GFOA 3PD7A 1W35A 1O6GA 3AERA 2HLDD 2TSYB 4WUDA 1RYMA 2G8LA 4KKXB 5GOZA 4YPVA 3NWJA 1UK7A 1X9IA 3OIVA 1YB5A 1E3JA 3BTUA 5L6LB 1MENA 4I55B 4ZAXA 4FIZA 1ZK2A 1G9TA 4XB2A 2ZEJA 1P60A 2B37A 3DEZA 3IBGA 3KR2A 1JT9A 2ERXA 1KP3A 4DR4B 1O9GA 5GAJA 4BV9A 3NBAA 4XAQA 4PPNA 4CTMA 4UROA 4PRYA 1IN4A 3BSSA 4OHRA 2AN1A 4LTNA 3CLTC 2OSVA 5D3QA 4K6CA 3ZNNA 4DT1A 3FNGA 4R8LA 3OUUA 3W8DA 4OA5A 3JTEA 4OI2A 1YCHA 2OAEA 4JP5A 1U0SY 5JAQA 2AR7A 2HFJA 3PDHA 4PGMA 3I2YX 1L7QA 4IGIA 4CR6A 2C9YA 4CQMA 3W90A 3UO8B 4KW7A 1J90A 1ONSA 4QL3A 5DX1A 2PVPA 5LL6P 1N7JA 2AEFA 4XC0A 4DZRA 2ZS9A 1NF3A 3QXGA 5JS1A 3EPPA 1X92A 2VNIA 1E98A 5THKA 3ZWCA 1X1QA 1NBAA 1XTIA 3Q3EA 3EBOA 2BSXA 3OF3A 2F8LA 2QA5A 4RMGA 1ULTA 4N3CA 3MJ4A 2IA5A 3UJAA 2UU9I 3BJEA 1KJZA 1G60A 1M2WA 3CKKA 4MVJA 4KO2S 4RK7A 4ROSA 2H4ZA 1SXPA 4KPUA 1J2JA 4TZTA 5IN9A 4NS1A 2QUJA 1V41E 2BEWB 1H7SA 3IUYA 3KAJA 1VMAA 4EKYA 1A9XB 1XEAA 2I66A 3KQMA 3VPXA 4ZK6A 3WAGA 5F78A 1PUIA 2ORED 3ANTA 1M9NA 3NTXA 1XTBA 1YZLA 1Y4UA 3EH1A 3H87A 3MBIA 1G8JA 4XLLA 1RCUA 2H2AA 5F77A 5AOVA 2G0AA 5TPWB 4XRRA 4LMAA 1SK9A 2VH2A 3J81k 3AIOA 1AG9A 1DG9A 3INTA 3PWKA 1WAMA 1JDVA 5JEAB 1WUKS 5AK0A 3QLVA 1LWOA 1DJNA 3EZXA 4DV2I 3OMWA 1OGIA 3R3HA 4DV5B 4CWAA 1W36C 3MOSA 3G5LA 3WE7A 1LJUA 2JFPA 3I9FA 1EQAA 2HDHA 4XDYA 1KERA 4K40A 4W9NA 1AMNA 1SXJA 1QLJA 4R0VA 3W7VA 3HM9A 1BVHA 1J8QA 1QMGA 3BE8A 2FCAA 4V0QA 1PLLA 2VH1A 3R5HA 2ZRLA 3I5MA 1AGYA 3BXEA 2WZDA 1HNWB 3DNPA 4NSNA 4TVSA 5J2TF 1UJCA 4FZVA 3ETHA 4M8SA 3VAYA 1QSGA 3NHKA 1NOJA 4EPRA 1N9KA 4M9UA 1MRNA 4JV5B 3L02A 1DJPA 1PWEA 5KYUB 4F6CA 3ZN2A 1AH8A 1A72A 1IQUA 3DZJA 4DR2E 2PSJA 1U3FA 3U37A 3EA4A 1WTAA 1K63A 1A9SA 4NICA 2GGSA 1XE3A 2W2QA 1Z0ZA 2WWWA 1T8YA 4FSHA 1A71A 2GCEA 3PFGA 3W3AD 5FQOA 1H2YA 4B47A 4BJ6A 5ALJA 3IVGA 2O06A 2C1IA 4J0JA 3MGKA 3HH8A 2PUVA 7REQA 3D4LA 3NJ8A 4PG7A 2JGDB 3ILXA 4O4HF 3FVRA 4O5AA 1OX6A 2XQFA 3ZHYA 4IGAA 4KITB 1S96A 3EIWA 4O4LA 5FOWA 5FPKA 4LDAA 2IYPA 3GJ6A 4HDKB 4JEUA 3KR0A 3WISA 5DNWA 4ZT5A 1BW9B 4ETWA 4TLEA 4KXVA 4XWKA 3PVZA 2QP4A 5HNKA 1P29A 3DOIA 5FPSA 4U2EA 3KQOA 2I76A 4OUDA 4RDIA 4ARZA 3ZM7A 2Z1DA 2CFTA 4OO1F 5LA6A 4FCQA 1H8HA 3KTDA 3G3EA 4IKEA 1KYYA 4WEQA 4TZKA 1XMOE 1V5WA 5EZQA 4LRSB 1LSUA 1S01A 3TQIA 2RGEA 2V4MA 4LDZA 3HCNA 4E2XA 4IHQA 4JI5E 1ORVA 2CKMA 1SC4A 1EHYA 2VXCA 1P5RA 4UDXX 2A3RA 2BYHA 1BDBA 1Z7BA 1RWOA 2Z04A 1EXWA 1MAVA 4QTUB 4B46A 4QU0A 2QTLA 5EXEA 1VIAA 2F3PA 3A06A 4KWHA 4MYRA 1E1QA 4O2AF 4F06A 4TSFD 2GLTA 2BA1G 1XG5A 3L0IB 2O8FA 1TTQB 1U3VA 4Z1MA 4D3ZA 2QD2A 4L28A 4FSXA 3L8FA 2FI1A 3RSZA 4CUJA 1SIBE 2Z5VA 3IYLW 4Q03A 4DQ0A 2Y99A 4CRWB 5AUNB 3PD0A 1B63A 3HJTA 4ISAA 4I99A 3CDJA 4MJ7A 1GL9B 4LOHA 5EA2A 3R3XA 3ESRA 3PU6A 3GRPA 3SDSA 5AXCA 5A6SA 4IS3A 1N2GA 1TPZA 2FCRA 3H2IA 1GFZA 2G36A 3DBHA 1DU4A 2R0QC 1FMLA 3CRQA 3FCUB 2QTZA 1TC2A 2WQ6A 2QL5A 2CVHA 1W46A 2YY5A 2WJWA 3PR1A 1PQPA 2QJFA 3UT0A 4BFTA 5JO9A 2PQ2A 4BWVA 3TECE 1YQTA 2FW8A 2FN9A 4IKOA 5LQUA 1PJ4A 3ZD7A 1JFTA 3Q9SA 4FN5A 4L7VA 1F8YA 4DLVA 4CF4A 4M9RA 1R64A 2FPGB 3HKMA 5IYZF 4Z0HO 4OKGA 1V39A 2H2WA 2QF7A 1P3Y1 1QE3A 4RTQA 2GZ1A 3IULA 2I2CA 4UBIA 1OT3A 1GO2A 3FTNA 2QN1A 4UHKA 4EHHA 1N92A 2GZ2A 3TNLA 1Z8DA 2P77A 1UBJS 1NJFA 2RAFA 5IG2A 4QHYA 1NY6A 2SBTA 5HKLA 1WF3A 3TSYA 4CYMA 4BLRA 1EPUA 4KWEA 2PKEA 2R48A 3FNFA 1Z2AA 4M89A 4M9XA 3SS7X 4XUDA 3MD0A 1CXZA 5IK2D 2Q9BA 2A9JA 3LWZA 4MRRA 3TNDA 1CR2A 3P0FA 2QHXA 4V0NA 4FNGA 1ETUA 1Z5AA 1TGVA 2GTHA 1KFCB 2PKQP 1HNXI 2P4SA 4JJIA 5KVAA 4HDNA 1K5DA 3AEYA 2YFKA 3RYIA 3BMYA 4JBYA 2BKVA 4DKJA 2C3PA 2YNMA 4I1VA 4WFJA 1UBCA 1UJ4A 2V9ZA 4Q3NA 4FC6A 4IQFA 5B58T 2PX4A 4YXWD 1ULAA 4PLFA 4GGOA 1EXDA 1T2DA 1JR3E 1OTYA 1UYGA 2YEBA 5BNTA 2CXPA 3PV0A 3SLRA 3RH0A 4S1OA 4BMXA 1U8FO 3OWXA 4EGIA 4RCVA 3RKZA 4QX6A 3C6QA 4HXGA 3UTCA 4OF4A 3QUCA 2EP8A 4DMGA 1NM5A 1UMDA 3EEFA 2PBLA 5LMUI 3D31A 4NCHA 4HUJA 1L8OA 3UICA 1Y6QA 4J1TC 2XOXA 4NMMA 1FXUA 2CJYA 1QHHA 1THNA 3AERB 3E2IA 2HY7A 4AMGA 5JZ9A 2Q27A 1U4SA 4ZHQB 2IXEA 3SY8A 1VIVA 4W82A 3VZDA 2WF5A 3THOA 2I6TA 3KKNA 4XB1A 1AUPA 1GZ7A 1U2RA 1PS0A 3G0DA 5KYWB 1BS2A 2X40A 3EX7C 2F3TA 2IH4A 4L3OA 2F1JA 3PYEA 1DAOA 1MAAA 1V8ZA 5HJEA 5JH7B 1RXSA 1BKSB 1N6OA 4RESA 2EKPA 5F9FA 3OPVA 1RE0A 4ZI5A 4EI8A 2PV7A 3H97A 1JPUA 2VRCA 3OE4A 4O8ZA 3EULA 1ZUD1 4H3VA 4TTSA 1SMKA 2YZGA 4B6RA 3IAFA 2VDNB 4BMDA 4CV1A 1EKXA 1TUEA 1C29B 3M6MD 3HCFA 4LFCE 3JD3A 1K8XB 1HDRA 2EGGA 3A3PA 3ZQ6A 5E4FA 1KVQA 4FE4A 2YEHA 4C4XA 1XZIA 3KPVA 3VHLB 3MBOA 4WLOA 3GOQA 3T0IA 5KZMB 1IAVA 2I7XA 3CO0S 4MU3A 3AEZA 4XVHA 1QPZA 3LL7A 2ZYHA 1SOAA 5HW0A 3VZRA 5IUNC 2PLNA 2HLPA 1ENOA 2WWFA 5DTJA 1EVIA 5B1DA 2A92A 4Q4HB 2BMDA 3H8WA 4E5KA 4Q1DA 1RADA 3OBIA 4L2IA 4HNTA 1TQ4A 5EJFA 3VSEA 3FOAA 2UUAE 4DR7I 3PJDA 3UHAA 4HV4A 4FPPA 2HJHA 3DFMA 4M1WA 1VJ0A 4KHPI 2B8NA 3COYA 1KQOA 4G56A 4YUZA 1F5NA 5M5BA 4Y2HA 4WSOA 4RQUA 4RV5A 3W2IA 2EP7A 3MWDA 4B9AA 2UYYA 5JS8A 4C01A 4DV7I 1F8XA 4G97A 5EE1A 5JSKA 3RBVA 3KB1A 2WAYA 5DN6D 1U90A 2PL3A 1RACA 1QRRA 4TS1A 3ILVA 2TMDA 4X7PA 1WXGA 1XKQA 2EJCA 4U7OA 2NZUG 5ILQA 4ACBA 3U56A 1ZH4A 2A1UA 2XI4A 2C5LA 3HNOA 1M2FA 1KI2A 1PX2A 3A14A 5FBHA 6AT1A 2DKNA 5DBOA 1J00A 3DV0A 4LZJA 5BV7A 1RCFA 5JATA 2P9CA 4H3HB 4QTYA 4DYDA 1H5UA 2EQBA 2WMYA 3GVPA 2J0QA 1P39A 1YZKA 2C38B 3I39X 3NBXX 1ID0A 4ENRA 3ZD9A 2JIRA 4BHTA 3L1IA 5JJCA 3UMBA 2NUPB 1WY7A 3EQ6A 3NGLA 1IWPB 4IJVA 4JL8A 3EK2A 3BGDA 5ALRA 1NAIA 3K4HA 3JQRA 1NMSA 4UHHA 1Q12A 4TV8A 4YKRA