1Y4UA

Conformation rearrangement of heat shock protein 90 upon adp binding
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
489
structure length
472
Chain Sequence
MKGQETRGFQSEVKQLLHLMIHSLYSNKEIFLRELISNASDAADKLRFRALSNPDLYEGDGELRVRVSFDKDKRTLTISDNGVGMTRDEVIDHLGTIAKSGTIGQFGVGFYSAFIVADKVTVRTRAAGEKPENGVFWESAGEGEYTVADITKEDRGTEITLHLREGEDEFLDDWRVRSIISKYSDHIALPVEIEKREEKDGETVISWEKINKAQALWTRNKSEITDEEYKEFYKHIAHDFNDPLTWSHNRVEGKQEYTSLLYIPSQAPWDMWNRDHKHGLKLYVQRVFIMDDAEQFMPNYLRFVRGLIDSSDLPLNVSREILQDSTVTRNLRNALTKRVLQMLEKLAKDDAEKYQTFWQQFGLVLKEGPAEDFANQEAIAKLLRFASTHTDSSAQTVSLEDYVSRMKEGQEKIYYITADSYAAAKSSPHLELLRKKGIEVLLLSDRIDEWMMNYLTEFDGKPFQSVSKVDES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords Chaperone protein htpG
publication title Structures of the N-terminal and middle domains of E. coli Hsp90 and conformation changes upon ADP binding.
pubmed doi rcsb
source organism Escherichia coli
total genus 130
structure length 472
sequence length 489
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.80 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1y4uA02
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 1y4uA01
3.40.50.11260 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1y4uA03
3CRLA 4EM7A 4WUCA 4YKWA 2YEBA 2WI2A 5CF0A 4FPPA 3QDDA 2WI3A 4XC0A 1MU5A 5M4KA 3T2SA 2YGEA 1Y4UA 3A0ZA 2XDUA 1ZXNA 3DGEA 3QTFA 4Q20A 3ZKBA 4LWFA 1UY9A 4P8OA 1Z5BA 1NHIA 2ZBKB 2O1TA 2IWXA 3BMYA 2K5BA 2XX5A 4EFUA 2CGFA 3EHJA 2YI6A 5CTWA 2WI4A 1B63A 4E02A 2QG0A 3A0XA 1UY7A 1I5CA 4QPJA 4CWQA 4DUHA 2XHRA 1QYEA 4XCLA 2XDXA 4URLA 4URNA 3R4MA 4KTNA 4ASAA 3MNRP 4GCZA 2HG1A 4JAVA 2QFOA 3U67A 4I5SA 1UYHA 4GT8A 4H81A 2BT0A 2EXLA 1YC4A 1AH6A 4LP0A 4U7OA 3T0HA 4P7AA 1AH8A 2BU8A 3RLRA 5FNFA 3INXA 3IEDA 4L91A 3FT8A 4FCRA 3JZ3A 3CRKA 2CGEA 4YKUA 4MP7A 2BRCA 2BZ5A 5FNDA 2IWUA 5J6AA 3TZ0A 3TZ2A 2YK9A 2YE8A 5F5RA 4V26A 3VADA 2XD6A 3D36A 2XX4A 3FT5A 1Y8PA 2YGFA 1I58A 1TBWA 1ZW9A 3ZXQA 2O1WA 1S14A 2XDKA 2CCUA 2YKBA 1YSRA 1UY6A 4MPNA 4FMTA 4L8ZA 4XIQA 2ZKJA 1QY8A 3CGYA 5D6PA 4KP4A 3A0YA 2GFDA 4XITA 1Z59A 4X9LA 3O2FA 1YC1A 3D0BA 3PEHA 3R92A 1AMWA 3EHFA 3HEKA 4HXZA 5GGZA 4JQLA 1US7A 2JJCA 4AWQA 4BIUA 1YS3A 2BU7A 2BU6A 1UYMA 2XHXA 2YEIA 4WUDA 1QZRA 4QPKA 3OWDA 1YC3A 1S16A 1BGQA 2BU2A 2CH4A 3TTZA 1JM6A 1YT1A 4ASGA 4XCJA 4XIPA 3T0ZA 1Y8NA 4XKAA 2YJWA 4ASBA 1Z5CA 4EEHA 4NH8A 4B6CA 4YKXA 2XCMA 3HYYA 5M4HA 3K97A 1R62A 3K99A 4MPCA 2YJXA 2JKIA 4PRVA 1Y4SA 3GIGB 2XDSA 2VCIA 2XK2A 4CE2A 1YSZA 3K98A 4HYPA 3A0RA 3OWBA 4MPEA 4FCPA 1TH8A 1I5DA 4BIZA 4E00A 5F3KA 3HJCA 5CTXA 5BOCA 5CTUA 4LWEA 3OMUA 4EMVA 4XIRA 5D7DA 4AWPA 4W7TA 1PVGA 1USVA 4E01A 3HYZA 4L90A 4EGHA 5D7CA 1THNA 4V25A 4ZKIA 4CWTA 4PU9A 1U2OA 3Q5LA 2WI1A 2XHTA 4EGIA 2CCSA 2WI5A 4DZYA 1AJ6A 1UYIA 1ZWHA 2HCHA 2XABA 4PL9A 4CE1A 4MP2A 3CGZA 2O1UA 3EHGA 4XTJA 5M4NA 1H7SA 1B3QA 4HXWA 3R91A 1ID0A 1KZNA 4YKTA 1YT2A 1YESA 4H7QA 2FXSA 2Q8FA 1I5AA 3RLQA 3GIGA 3K60A 1KIJA 5M4PA 2HKJA 3G7EA 3T1KA 3PRYA 1HK7A 4KSHA 3U2KA 4YKQA 1Z5AA 1NHHA 3Q6NA 2VCJA 4ASFA 3TUHA 2YE3A 4CWOA 2YKCA 3B28A 4KFGA 2ZDYA 4U93A 2YI7A 5IN9A 3HZ5A 3ZXOA 3D2RA 4URMA 1USUA 1UY8A 5L3JA 4MBCA 2YEDA 2YEAA 3WHAA 3Q5KA 3U2DA 1U0ZA 3OW6A 4R3AA 2XJJA 2BSMA 4CWPA 4YKYA 3SL2A 4O05A 1BKNA 4YKRA 2YEGA 1I5BA 3R4PA 2XJXA 4FCQA 1Y6ZA 2CG9A 5BODA 2IORA 5D7RA 2XDLA 3B24A 4EFTA 2YEFA 1YETA 2QF6A 4O0BA 3LPSA 2C2AA 5C93A 2YECA 2FWZA 1GKZA 4AS9A 5J71A 1UYEA 3FV5A 3VHAA 4R1FA 4CWSA 4CWRA 3GIEA 2YE2A 2H8MA 2FYPA 2FWYA 3GIFA 1BXDA 2AKPA 1ZXMA 4LWHA 3LNUA 3NMQA 1YERA 4LWGA 4BQJA 2XX2A 2YK2A 4UROA 4CWFA 3BM9A 4U7NA 4NH9A 2YKEA 1UYCA 3R4NA 4MOTA 1TC0A 3B27A 2YEHA 1AM1A 2Q8HA 4BAEA 4L93A 1NHJA 2YEEA 3INWA 2YI5A 4LWIA 2Q8GA 4EGKA 3A0TA 1GKXA 2YEJA 4HZ5A 2BU5A 3EHHA 3C0EA 2YI0A 4ZVIA 2YE9A 4CWNA 4L94A 2H55A 4NH7A 3WQ9A 3Q5JA 3Q6MA 3H4LA 3OPDA 3EKRA 4XE2A 4GQTA 4O09A 4HZ0A 3T10A 2CCTA 4KQVA 1UYLA 5IDMA 2YGAA 4AWOA 1GJVA 5CTYA 4O07A 3ZM7A 1UYKA 1Y8OA 2XJGA 3O6OA 2WI6A 4XKOA 2WEQA 3RLPA 2GQ0A 1L0OA 2WERA 3G75A 2BTZA 2ESAA 4GEEA 1OSFA 5M4EA 2ZDXA 1I59A 3G7BA 5FWKA 2VWCA 1TILA 1A4HA 2BYHA 4LPBA 4PRXA 2UWDA 2IOPA 4MB9A 4KSGA 3RKZA 3EKOA 3HZ1A 1TC6A 3CWVA 5D6QA 1UYGA 2Q8IA 2YE5A 3ZKDA 4YKZA 4K4OA 4GFNA 4WUBA 4XKKA 1UYDA 3A0WA 5M4MA 3VHCA 4BXIA 2IWSA 2BREA 2Q2EB 2IOQA 2O1VA 2YKIA 2YKJA 1TIDA 4XDMA 4I3HA 1UYFA 2E0AA 3R4OA 3H80A 5IDJA 4O04A 2YE6A 3PEJA 3TZ4A 2YE4A 3HHUA 3KE6A 4JASA 4B7PA 2WI7A 5CPHA 3B25A 2YE7A 1B62A 3VHDA 4HY6A 3O0IA 4R3MA 4CE3A 1MX0A 2PNRA 1EA6A 2QG2A 3B26A 4XD8A 4JAUA 1EI1A 1BYQA 2GQPA 4HYMA 4GGLA 5FNCA 1YT0A 2WEPA 3C11A 4HY1A 4BQGA 2BYIA 2VW5A 3TZ5A 1H7UA 4H85A
chains in the Genus database with same CATH superfamily
3KQVA 3ICCA 4RVHA 4JLOA 4QJBA 3QUCA 5C7LO 2V9PA 4X20B 5IYZB 2YJ5A 1TK9A 4ZOAA 3OCZA 1US8A 1EWTA 3TZBA 2XXBA 1QANA 4X24A 2P2NA 2FQWA 1RXYA 4IIVA 4J4HA 1FSSA 4C6SA 2PFSA 4B6JA 3ABSB 3I01A 3LPDA 4XLLA 4K6CA 2P1DA 1KR5A 3GZTB 4FDVA 1TYAE 2EJTA 4PPGA 1P75A 4O4IB 3TTYA 4DEXA 2H1OA 1TO2E 2DR0A 3D0OA 3MAJA 3BGSA 3UT6A 1L7PA 2K2WA 1DUIA 3O4IA 3TLKA 3A10A 3GJ3A 2WFAA 2BGGA 2O0HA 2IYZA 4ZIRA 1DSSG 3CNOA 3HVJA 3B52X 1RXSA 3TPCA 3AIOA 5KSOA 1GTG1 1CR2A 2ERCA 3ZGYA 3GPCA 2NUAA 3DSRA 3CSDA 3MERA 3DV9A 2Q6VA 4NFHA 3MXOA 4K0KE 4MUKA 5J1TB 3ICEA 2QX4A 5HVNA 2C2HA 3X1KA 2PE5A 1G63A 4XPIA 5KCMA 1ZDMA 5FJJA 4LVUA 3S5JA 3BWEA 1JFFA 3WYAA 5FFNA 3RF7A 3DZBA 2FMKA 2RGAA 4JLKA 4TMZA 3BRSA 1Z0DA 4G8DA 3ZD7A 4ZFNA 3RHSA 4MQ5A 4OX9E 3OX4A 3K9WA 2F1OA 4GRAA 5MFPA 2I2XB 3DBHB 1Z8DA 3BSSA 3P19A 3R3VA 3VX4A 2GYUA 4L90A 5AK4A 2V0NA 3OTHA 2IYNA 4AX8A 1QFXA 1Z7YA 1OFUX 1JQEA 3SSNA 3SMVA 2CXOA 2W7TA 3KU4A 3QSGA 4LRSB 1KWGA 1M0EA 2FPIB 3QIAA 4J0JA 4JG4A 4HYYA 1I7QB 2IOHA 3HVHA 2O8FB 1OXMA 4ZO9A 2GLXA 2YWXA 1UJ6A 4WK0B 5DWQA 3TSZA 4QECA 4MJLA 3UMBA 4J0HA 2AMFA 4HGYA 4ARBA 4K8OA 1CBUA 3QXCA 4S1TA 4DR3I 1GRNA 3BC1A 2AB0A 1WU7A 1UXHA 4IGFA 4RK0A 3CG0A 3PDWA 2BUCA 3OLYA 1FSPA 1MG0A 2W2KA 5JTUA 4E21A 1Z83A 1IJFA 1CB0A 1LXCA 4EABA 2ZIAA 4IV8A 4LX0A 5TGTA 4RK6A 1CZNA 3MGAA 1ILEA 1PSDA 4ID3A 4QT0A 4JI8B 1HT0A 1IL0A 2TYSB 1K88A 2PTGA 3G17A 4FNGA 4GC9A 5DHFA 4TYMA 3Q6MA 3EC1A 3N3AC 2Q1XA 4NZMA 1J7KA 4Q9LA 5AM0A 2HHHE 4H6VA 2H18A 1LLQA 3JVUA 2CXQA 5HDQA 3TBHA 2GQ0A 2DUUA 3MJ4A 5KDDA 1A8HA 1ONOA 3IIKA 2OCGA 4DUYI 4LDJA 3VR0A 4OG2A 1S1CA 1PNRA 1H2XA 2RI1A 1NW7A 1KTIA 3C3BA 5F9FA 2COKA 1VL8A 5GP1A 1HNNA 4OHFA 4Z8YA 1UYDA 3DYBA 1ZUHA 1DWQA 1Y6QA 4BA1A 4GO1A 3NM5A 2CVHA 4F6LA 3BDVA 4A9AA 2W6JA 2R6HA 1MO5A 4BZWA 4XDZA 2R47A 1Z06A 3AFHA 1JGTA 2PNRA 3BULA 4WZAA 2WYHA 2B0CA 2OHGA 3HBJA 2XSZD 4WOCA 4CJXA 2WDPA 4ZHQA 4RA9A 2C5LA 5CF0A 1AT1A 3QDDA 1D4ZA 3WA6A 3W2EA 3BKXA 4QG3A 3PWKA 5K6AC 1JEDA 5DT9A 1N6NA 3GLQA 2H59A 4ITRC 4NU0A 5B7GA 3L46A 4ZVPA 3ZI4A 1QYDA 1ZJ6A 3EQ7A 1YQQA 3IS3A 1RAEA 5J4VA 1L9XA 4G2TA 4UTOA 3PDHA 4U2FA 1KPIA 2EJCA 2V45A 4QAQA 4P4UA 4I1RA 5CDYA 3LHFA 2HYIC 2WJGA 1E1CB 3GCWA 1G2PA 1QCYA 3GMIA 5CG1A 5DXAA 1Q0ZA 4L72A 5FWXB 5AXCA 5C8YF 2JZOA 5ALTA 1Z6QA 2PN1A 5F73A 2Z2XA 3TZ0A 3ZOZA 3TFOA 3EXEA 4DEYA 2QVZX 2VRCD 4BMXA 4M83A 2V4ZA 4DR5I 4IH9A 4QOSA 3HC7A 1XMVA 2YHIA 1WG8A 1H4TA 3B3FA 4Z7CA 3G2NA 1ZK1A 5E4YA 4B6PA 2PO0A 3RQSA 3H5NA 4EMUA 2E5LE 5AM2A 3ZY2A 5FBKA 4A03A 1Y1SA 3L8CA 4B83A 3JVEA 3QKRA 4UARA 1Z45A 5A2QA 3AVVA 1A6FA 1GCUA 4FX5A 3IPYA 3KZXA 3Q7TA 3VX3A 2RGUA 2ZP1A 2DB3A 2UVDA 3QLUC 2ZRKA 3LC7O 4O2AA 1T8WA 2Q50A 2P7IA 4WN9A 3SEZA 1UPAA 2RH8A 3GWGA 5JSQA 1RREA 1Q22A 1KHHA 3QEJA 4QXPA 4OQZA 2GBPA 1U9ZA 4KQ9A 1TVEA 5L6LB 4TTQA 3FNQA 4QWMA 4MNTA 1WKVA 2V3VA 1XNRI 4J3JA 2XODA 4JLVA 4CF4A 3WICA 3C8HA 3MUEA 3Q5LA 4JOCA 4N8DA 2X36A 3QJYA 4A2QA 2V59A 3NYRA 3ABRB 4FDUA 2OQVA 3LKVA 4P3OA 2NTYC 3QXSA 5EERA 3W1WA 4MPJA 3MK31 3WJ1A 5JRJA 4DXHA 3LQ2A 4I5EA 1KO1A 3EGEA 5CGQB 3KQWA 4ZANA 2CHVA 3H84A 2QZSA 1YS1X 3G7NA 1GAWA 3IERA 4X44A 3JQ9C 3DW1X 3CRRA 3WKBA 1L5KA 3ADOA 2XHZA 4MS3A 4BMPB 2GRJA 3OMWA 1FB5A 1YRQA 1E0DA 2R1TA 4EI7A 5EE1A 2NUTA 1RP1A 3U3DA 3K9HA 3MQ2A 1FYXA 4UAUA 1GM5A 2I91A 1FJXA 2F1DA 4DU7A 4MKFA 1XB2A 5EP4A 3NXKA 1YR1A 1L6IA 3D31A 5H81A 4MOTA 3QE0A 1YDHA 3JXEA 1PR3A 3RGWS 2WM3A 4DPLA 3E9QA 2H5JA 1YE5A 3QYJA 1IWOA 5DX0A 3CUSA 3V8PA 4YAIA 3E1GA 2BZGA 1R8QA 4HLQB 5DHRA 1MABA 1MFPA 1MW8X 4EYKA 5ALLA 3NONA 2XJ9A 2BGWA 2E4YA 4AECA 2C5BA 2FWJA 4XKOA 2NUBA 1SQSA 3AR6A 4QTUB 3U4DA 3NHJA 2MU1A 4LF4I 4G1VA 2Q3FA 2FQ1A 1OHHD 3F74A 3K7EA 4RHFA 1T1IA 2XUHA 2FN9A 3FTPA 3JSXA 3AESA 4RPLA 5CHYA 3UMVA 3D8UA 3K17A 1XZJA 4X66B 4OXRA 1BE0A 1MO6A 2FCAA 3KTAB 3KS9A 4OM7A 5M4MA 3LK6A 4K6FA 3PD7A 3QVVA 4I5FA 5AXDA 5DP1A 1NKSA 1R6XA 2CNWD 2VK8A 2HRZA 3BEDA 1PFUA 2XBMA 4YQYA 3KXLA 1CJKC 3HEAA 2C2YA 1RQ7A 1NJ5A 3DEYX 3MEQA 4O4HF 1EPUA 3STUA 3M5PA 4II2A 5B55A 4A0SA 1KEEA 2RHOA 4OMCA 4D3DA 4IRMA 1SIWA 1PEDA 2SNIE 3U3ZA 4G84A 1DWOA 2QW8A 5TS2A 1T0HB 4BO8A 3TD2A 2ZIGA 3Q10A 4C0KA 3CRMA 3ZDDA 4JELA 4CXMA 2W5UA 1VYTA 4F38A 1GVNB 2JIZA 4FFLA 3E3OA 3FJOA 2H06A 2YI6A 4KLRA 1RQ2A 1INLA 2XMSA 3KKZA 3FE2A 4LHVA 5AFSA 3G8DA 5H3HA 1HURA 1SBIA 3CX3A 1N4DA 4URNA 4YP6A 2XUGA 3VKHA 3MWEB 1Z5VA 5C9ZA 3NP9A 3WSWA 3WJ2A 1ECGA 1W4AA 2W2LA 3ETEA 4I1VA 4JI2E 4TV8B 3R3UA 1DJQA 3G0OA 2IHNA 3M7NG 4MAMA 5J6AA 3ZC3A 2QNRA 2WDZA 1E1LA 3HXPA 4FW9A 4CL0A 3CNEA 4D4LA 1SM4A 4ZOLA 1KAEA 1RFLA 3DGFC 1M2EA 4G56A 4XWWA 3K09A 3G88A 2YVAA 1ESNA 3OZUA 4HDMA 2VSNA 4CDNA 4DREA 3OZTA 1US7A 3RRFA 3KM0A 5SV2A 2X41A 5IARA 4D9CA 5I45A 2G25A 1W9HA 2JFPA 2Z4TA 5DNXA 1DWUA 2WHYA 3EIXA 3RYTC 1Y8NA 4BLRA 2IW3A 3O3CA 3BEOA 3UANA 2ZJYA 1Z33A 4RKYA 3WGZA 1SELA 3OU7A 5CYGA 1X7DA 2O50A 1UDWA 4XX1A 1KH2A 2VF7A 2ZWMA 5LKRA 1CW2B 5F2OA 4L4ZA 1C0EA 3T0GA 1SZCA 1DZIA 4P2BA 1YIDA 2YJ4A 1U1DA 1MRZA 4JI0I 3Q3GE 3H1CA 2NYUA 1ISSA 3OFSA 5KNDH 4DSOA 4KI7A 1N33I 1QP7A 3NBQA 1QVZA 3D8TA 2J31A 5GM1A 3CVXA 1WMSA 1PJ2A 4WXPA 3EZYA 5LZ4A 3A9TA 4HN9A 2P5TB 5FOXA 1HX7A 4IIBA 3CA8A 1BFKA 3EXHC 2OEPA 5EKTA 1A71A 3UK7A 4MYHA 4B3SB 2HMSA 4F4HA 3KDPA 5EZQA 4BEVA 3QLVA 1IOZA 2CC2A 2J65A 2J7KA 1BHQ1 3ICOA 4OUKX 5JQGB 4K0KB 4QNNA 1WNFA 1Z5ZA 4G07A 5TMEA 3WYBA 1KI9A 3Q0IA 1S4EA 4FCVA 6REQB 3LFTA 1V7QA 1XN4A 1GLGA 2CCJA 5JWRA 2XWSA 4HX5A 3JQAA 4FKZA 2AEEA 3IDZA 2R4QA 4OFXA 5TJ9A 5IP5A 1M10A 2O6HA 5I9TA 1WS6A 2I03A 4B3ME 2I4RA 1F0KA 4XLTA 3R0JA 2Q41A 5JZMA 3BMNA 2WICA 1NJGA 3AHHA 2ONYA 4MV3A 1DLJA 5GOZA 2H1HA 1VSQA 3FN4A 1Z25A 5D1NA 2ZIWB 5EN4A 5DTRA 5CPBA 1FIUA 5LWHA 1OZGA 1QYRA 5CB6A 1PW5A 2OXFA 1PK7A 4R9SA 3IPXA 4MTLA 5BN5A 4MMYB 5ALOA 3N70A 3OLCX 4CQLA 7ABPA 3C7AA 2CKDA 4TT8A 4RHXA 1SQFA 1GJRA 1NR1A 2IEIA 3WLRA 3S2YA 1EM8B 1PDOA 3OIUA 3R5FA 5JD4A 1MAAA 2EJUA 2WUVA 2XE8A 3HB0A 3FAKA 1R0KA 5BUZA 1Z6XA 4W9NA 1RADA 5BMVB 3AKYA 4M86A 4EDFA 3BQNB 2YKJA 3EVGA 4NZYA 5BWMA 1PTKA 4O04A 4IXMA 2P4EA 1KEPA 4D3ZA 1CVIA 1U3TA 4OA5A 4B44A 1RMYA 2IE8A 3I8OA 1UJ2A 1IFXA 3E9RA 3EY4A 3G8CA 1SNYA 4YJFA 1SZJG 3O92A 3JWPA 1GADO 1JQ3A 4O5AA 1LLCA 4XIJA 2VN8A 4BFZA 1ZW6A 4TTAA 4YCBA 4URZR 4CEIA 5HIMA 2Q3BA 3AWIA 4RPHA 3PE4A 3TQOA 1CNFA 1KGSA 1E6KA 4B0OA 2IL1A 1X6VA 5C1PA 4Z7QB 3LQKA 5A5VA 3FCSB 5HOEA 2JFHA 4XQGA 3P0IA 2JK1A 4Z54A 2YICA 3CVWA 2ZE8A 4ZVLA 4DUHA 4YHHI 3E9YA 2HHHB 2P8SA 1WCIA 2MINB 4Y1GA 4H3KB 1ODSA 4RWEA 3FA2A 4ONEA 2C04A 3P97A 3X1WA 4LCBA 4C7MA 3DEHA 3F4KA 2NYVA 2PSDA 1SCAA 2J7PD 1N75A 2I71A 2YV2A 5ALGA 3RIHA 2X5JO 3SHOA 5EUMA 1ZR2A 4BLQA 2YINC 5CVJA 2I2FA 1W73A 2QEQA 1ZUNB 2CMHA 4P3PA 3ADCA 3WB0A 4N1AA 4ZT2A 3R8FA 3DULA 2XYPA 1H73A 3BM5A 1XDDA 5H82A 5CMLA 3SJUA 2AJ8A 3VPDA 5IFLA 4JDPA 5DX1A 1E2IA 3OA0A 1Z59A 1QTNA 2GXAA 3QUAA 4D2IA 3O74A 3UKDA 4DTIA 3B13B 3QXHA 4A1FA 2A2DA 4RQTA 4ZDJA 1X0XA 4YAJA 3FM9A 2JCVA 4W5RA 3T6KA 3F3MA 2FUG6 3LLSA 3U16A 4EMTA 3WE7A 2V6BA 4EGFA 3AILA 4HLUC 3ZBUA 5C3MA 4ZCQA 3PC3A 1HWYA 4QVKA 3K98A 3DD5A 3O8QB 2GSWA 4HGZA 3V1NA 1MAHA 4NYMQ 5MHTA 4UHFA 4AJEA 5C0XE 4EB8A 1QGED 3HYZA 4H1TA 3WGMA 4DM3A 1JHQA 3HP4A 2UKDA 4X62E 2JFZA 2ETVA 5B12A 4JUFA 2PYIA 4WZBE 3ZK8A 4RHTA 3FMFA 5AVVA 4O2BF 3GBPA 2ZDYA 5K8IA 2H4JA 3M4NA 1FYVA 3IQDB 1IULA 3MJVA 3SIXA 4MBCA 1QUEA 2QU8A 4DQLA 3B6EA 1N4AA 1LU9A 3FDZA 2O8VA 2VYQA 5HBRA 3HULA 4KOAA 1ZIXA 2GK3A 3UKOA 2E5LB 3E22A 4LOIA 4AJKA 3KE9A 1U9IC 2ZR7A 1JIVA 4C76A 1DP4A 4TVBA 4TLEA 1EUDA 2FEPA 4QELA 4B73A 3K0SA 2PLAA 2ZI5A 1U0JA 4KXXA 4A8JC 4W63A 2V7QD 3CWCA 4EATA 4OKSA 3TTWA 4FDAA 4DPXA 5JEAA 1ZD1A 3WNCA 2W93A 4X1YB 5A3QA 1CWUA 4JXKA 4UKDA 4BMSA 3TNFA 3IEXA 2VAWA 1O96A 3W5SA 2B1RA 3G6WA 2PSFA 3L9WA 3UCEA 4US2R 1ENPA 4Y9DA 2BU5A 5KYYA 3KJZA 4FGKA 3UJNA 4N5NA 4YMUA 3H1EA 3QU4A 3D1VA 3PKZA 4KJXA 1Z18A 2HZBA 2NU7B 1H3EA 2BISA 2WWHA 2F8MA 2PS0A 3LRXA 1I1HA 1XZHA 5IULC 4PBRA 2IY8A 5I5EA 3S29A 4CCYA 4A6DA 2GN2A 2MYNA 3A9CA 3U3MA 3LA6A 2D7JA 2RH9B 3BMOA 1FX1A 1KIAA 1OLUB 4R8SA 2B98A 4DA0A 1V7ZA 4RLFA 2FMXA 3KYBA 2DXIA 5FR2A 3L8GA 3SOPA 5CBKA 3DTYA 3V8NA 1G291 2RGYA 3QKTA 3CS3A 1P7VA 2WNIA 3IAS1 2GBIA 4FFBB 2Y1EA 1JAHA 4A15A 3AVPA 4A2PA 2C8LA 1G21A 5K0CA 1T4MA 2G5TA 1KXZA 3A04A 2WF9A 1JEQB 3EX7C 1IVSA 3FX2A 2JE6B 2IZ5A 4M99A 3I2YX 1YBHA 1TC2A 4XC0A 5M4KA 3STTA 2VA9A 3KLOA 1R64A 4P82A 1A69A 2Z5FA 4WLFA 3RH0A 1X1RA 7MDHA 3WGQA 2QM0A 3TXYA 2QT9A 4ZT7A 1LQUA 2DQYA 2XDXA 2VDUE 1JYSA 4BQIA 1PZFA 3NI2A 2KMLA 3M85G 1JH8A 3BICA 4P36A 2BR3A 1GV1A 1H74A 3OPVA 4RXMA 2RCYA 3SC2A 1JA0A 2R2GA 2WZDA 5KS2A 3IAFA 4HNHA 3VJMA 1RKVA 3DTTA 1M7BA 4PBSA 4FI3F 1EWKA 2CLSA 4N6OA 1JLLA 4GT1A 2Q29A 4EGSA 2AFIA 1FW8A 4DCJA 4IMPA 2OFPA 4J2TA 4K6KA 5HDBB 4OGGA 2XZLA 4XCVA 1ETHA 1UY6A 3QVTA 1YHNA 4V3CA 3UAXA 1YGYA 1HDRA 4JHXA 3U7GA 4PRLA 1VLJA 1EIZA 4G8JA 4G0YA 4GOLD 4BWGA 5LQCA 3E9EA 4ZK6A 4PHFA 1ZBDA 2JKYA 2ID8A 4A0HA 4B4UA 2DH6A 3Q8MA 4CM8A 4PVDA 1WXXA 2VNSA 5DHUA 3EG9A 4GI3A 1ZVJA 1XTQA 2PH1A 4Q9KA 5KEIA 3OWHA 5D7NA 3HWX1 4OXNA 4GOKA 5IJ0B 2BFDA 2LDXA 5HKLA 1YJCA 4JI1E 2Z83A 3AL2A 4XGIA 2JIBA 2ZUDA 3C6XA 5H7XA 2VDKB 5CTXA 1ZGZA 3TR0A 4M1TA 3HV0A 2E82A 1NT2A 4HOYA 1XCGB 1CZKA 4JVSB 5D7DA 2V9ZA 3D8NA 3QV2A 3OZIA 3AGPA 3O21A 4GLBA 5EWLA 3H7IA 1R0BA 5EESA 4FIDA 1H7SA 4JI2B 1KJ8A 2AW3A 4G5QA 1E3DA 4ZI3A 1UJNA 3JVVA 4Q82A 3B1ZA 4TRMA 2MT9A 4LZZA 4UOEA 1QX4A 2G36A 1EDEA 1SBQA 1CJSA 3A25A 2CLLB 3PUWA 3VAAA 2XA2A 3W8DA 4D42A 2F59A 4OXKA 3R9XB 4MUXA 4PC2A 3RDPA 4FW6A 3FZQA 4EHJA 4HUQB 4LF9I 1W8DA 1R5NA 1SUDA 4KYUA 3TZEA 1JQDA 4LWZA 1JPJA 1IWPB 3H3JA 1Q16A 2IUSA 3OI7A 1RWPA 4FCQA 3TX2A 2CZ9A 5LLTA 5DHTA 3LPSA 3O6VA 2VK2A 3E3LA 3UXMA 3V48A 4JC4A 1EM6A 3DE3X 4IOLA 3MJDA 1YERA 3HB4X 3RJTA 3QELA 1V4VA 3QT5A 2ZJ1A 2IZZA 5JBNA 4PF1A 5BWNA 2C2WA 1E8NA 1ZNXA 2D54A 5BN3B 1L5RA 3B53X 3L0YA 3OJLA 2F1RA 4CWNA 1YR9A 2PLNA 3C15C 3TZCA 4C89A 2UUBB 2C2XA 4U3JA 4O2RA 3SYKA 3BD6A 2B6HA 3IEIA 1GGFA 1EESA 3PXAA 5ANRB 2WFZA 4R4JA 1NGSA 4AW9A 3JQFA 3OLZA 2UU9I 3N58A 5FNVA 1VCHA 1XYVA 3CG4A 1SEPA 3AUXA 3CB2A 1KDPA 3DBRA 5KJFA 3H0KA 2FRXA 3VC3A 1SVOA 5KPDA 3ZGZA 4U7TB 2C59A 4CCWA 3ES9A 2Q9UA 2NTJA 4ZICA 3VPFA 5IG2A 5GONF 2JHPA 1RJFA 5DDIP 2YCLA 4LF5B 1F6BA 1YCFA 1ZUWA 1DHRA 4DG8A 2CE7A 3EQ6A 3ETNA 1BJTA 3GRRA 4RVOA 3QWAA 4DUGD 2PJZA 2VJCA 2C3MA 2O8NA 1VL5A 4UUQA 2ZYTX 1TVKB 4D3SA 3B26A 2GO7A 1TTHA 4IHJF 1CVLA 1O77A 2AKYA 1X7YA 1SBZA 3NC4A 4R16A 4RQAA 1Z6GA 4LOMA 3EGXB 1T9HA 4B3MB 1PZGA 4H15A 4U7WA 3HSSA 1KI6B 5B7PA 3TW8A 3AJAA 2IPNA 4YX9A 4ZQIA 3O2NA 1R5OA 2JLYA 5HQ3B 4YFYA 5EGSA 1RWBA 1UK9A 5G0VA 1D9ZA 4M0EA 2DHCA 2BEJA 3ICVA 4QHSA 1LKZA 4LYEA 4ZV7A 1PL6A 2WQZA 3WL5A 1GL7A 2Q3EA 2QY9A 2AN5A 5DM70 1E2QA 3RUAA 1NYLA 3R5XA 1KQFA 3MCTA 1XVAA 4F5YA 1FC0A 3PQFA 3VR2A 2XD6A 1M72A 4DR7B 1H22A 3WGYA 1GNLA 2VFAA 3U9TA 4EY5A 4UHCA 2ZROA 2XJ4A 4BX0A 4TYYA 1FFEA 2X7HA 2R4TA 1OFGA 3A05A 2PS9A 1E3MA 3JQRA 5ALVA 3ULKA 5DV9A 5LL6R 1CU1A 3LG2A 2I1WA 1DLIA 3OY7A 3C5HA 4D8XA 3I0NA 3H6KA 4NMWA 3LYAA 1YFKA 1QE0A 1JDBC 3HA7A 2P2YA 1CUUA 1BGQA 1EHCA 3Q2OA 3QU9A 3FWPA 1ZONA 3G85A 2IYXA 1EDOA 2ZRFA 2D4AA 1XFDA 1U2DA 3E61A 2H1LA 4XIYA 5D2CA 1QF9A 3QA3E 1IY2A 3GIGB 1DEHA 4CT0A 4MI6A 2I22A 5AVQA 1P5RA 1YD7A 3TVYA 2CV1A 3M33A 4HV4A 4YBRA 4LWEA 2UUAB 3VR3A 3CCFA 1IEVA 4FYJA 3A6JA 4PLTA 3MINB 3DVAA 4RMHA 4QEKA 4K8RB 1G0NA 1GKYA 4PONA 1ETUA 1I13A 4ENWA 4Z7JA 2R7MA 1H6CA 4N40A 2VHUA 4MEJA 3PFGA 4YRAA 1QNLA 3AKDA 3SBXA 3VPAA 3K16A 4KE6A 3QU7A 1YUMA 4MUJA 2GDJA 3ICPA 5GV8A 1KK1A 4O6VA 4IFDD 5DMXA 4AZWA 3CM0A 3FMGA 1U1IA 1A5SB 3EXIA 2DP4E 3RARA 1I4WA 5T6MA 5LBUA 4FC6A 3LP6A 1YKSA 4GAEA 4R83A 1UBSB 4RETA 2ZM6I 3IUPA 1HE3A 3VV3A 4FTWA 4GOJA 4JFAA 2TMGA 3DOJA 1XLUA 3UJ8A 1IY1A 4DB2A 1L5HA 1GSHA 3PX2A 1NN5A 3SF8A 3E9ZA 2XDQA 4PQGA 4AJ9A 4WXYB 4YMIA 1Z74A 3X1ZA 4ZZIA 4DV6I 3WLJA 2H8MA 3AUUA 3OG9A 2VTBB 4RNCA 4HDRA 3LNUA 1O9GA 4BZPA 1GQOA 4JKIA 5HEKA 4WD3A 1VB3A 4G0MA 4PHHA 3O8LA 3TSCA 4YJ3F 4S0ZA 3U7QB 4FOOA 4IFDF 4MGHA 1HOXA 3RASA 2MSDB 4D9MA 2I4NA 3PDIB 3Q9LA 5E2BA 2GPWA 3B89A 3C0EA 5AW8A 4QUDA 4BMZA 3K15A 2LKCA 4LFBB 4BGVA 2C3YA 4EVRA 4CF5A 4LXUA 5CPFA 1VJ1A 2JFVA 5C5CA 2NVUA 1QRSA 2A33A 4CR8A 4G41A 3RE1A 1M6VB 2O8BA 4WZBB 2ESAA 1VSBA 2C8KA 3RFVA 1OA0A 2DMRA 4AKIA 3GMDA 2DR2A 3F5QA 1K6EA 4IDNA 2YXPX 4IHQA 3PEEA 3CLRC 4OUDA 3P76A 3FCEA 4HEHA 3Q41A 4F71A 1YR8A 4DC9A 6ABPA 3K9LA 3CLKA 5E6SA 2HV8A 2R6GA 3VI4B 3A0WA 3T1YI 4EHNA 3JQ7B 3UBTA 2JI8A 1P44A 4DR2I 2AKEA 1EK5A 1R9GA 4GPEA 3L7DA 3I1JA 2QP3A 1SCJA 5IN4A 1NWHA 3L4JA 2XGJA 1TZMA 2ZJOA 3AEXA 4Q00A 2CYBA 5JHGB 1Q14A 1OH6A 2AI2A 4Z4CA 1Z0ZA 1XNQE 2ZCVA 1RLMA 1Z37A 4MWGA 3WB2A 5U4QA 4YUZA 4P7FA 1TK3A 2Z2IA 1MUUA 5EXEA 2DBQA 3PSAA 4XD2A 2OL4A 1VBKA 3O75A 3DBLA 2UVPA 1J8VA 3FPLA 1B63A 4JBNA 1KRXA 3U40A 4HPWA 4OV6B 2PRIA 4RIIA 1R8JA 5A4DA 3HWWA 3H9JA 4RHCA 1WCV1 5CNJA 3SX0A 1SQ0A 5AJZA 2WSLA 3E70C 4OU5A 1JG6A 4FHGA 2ZJ8A 1TGVA 1ULZA 4AMVA 3V1UA 3RRNA 5A03A 1OI3A 3BE5A 2IDKA 1JMKC 3FH0A 3H9EO 3H8SA 2JS7A 3L6RA 3G23A 3TRFA 4YP0A 2WTNA 1H8HA 2RAFA 3WL8A 5A5GA 1BVUA 3LV8A 4UXIA 5DK6A 4IGAA 3DHVA 1U5BA 5HMMA 4X9LA 1V6SA 1K9VF 2R60A 5FADA 4YP1A 4M9RA 4LYGA 3I2JA 5JCJA 4YC7A 2QYTA 1DOZA 4Q1AA 3LZCA 4JSTA 3KZVA 3OPQA 4X1IA 4B3RI 1N7JA 2YJWA 1YQGA 4JIGA 2J6IA 3BQMB 2NACA 3CX6A 2XUFA 5TEWA 4PAMA 2JEAB 1TQ8A 2Z4RA 4N3NA 2J3KA 5BYBA 2XDSA 2I67A 1LH0A 3W6UA 2CXXA 3WGKA 3ZUGA 3GA0A 5BQ3A 1FXWA 5F2KA 1HT1E 3OIWA 4TQ9A 1G5FA 2XTJA 2QMYA 2RONA 1USVA 3VU8A 3MT9A 4HZUA 4MPPA 3M49A 1I3LA 1NVBA 5JDIA 3FUXA 4IDHA 4G5YA 1NVMB 1JB1A 4ZXFA 2OORA 3C45A 1TTQB 1NDQA 1UPTA 1M73E 5EXDA 2JEYA 5IZCA 1C0PA 2XZOA 1Y81A 2RB5A 2I54A 1JXAA 3LCMA 1J09A 4A16A 1JG7A 3UHPA 1JQKA 2JIMA 5LQSA 2OKGA 4PSVA 4KQXA 3OD5A 5DCUA 3PGA1 4GP9A 5DH9A 2JFNA 3MWLA 1PE0A 3CHYA 3V4RA 2OAEA 2HLHA 1Q3TA 4ADSG 3N2KB 1XA0A 2YRFA 1D2MA 1VPEA 2Q7XA 3EAFA 4Q4AA 2IH2A 2ZWVA 2VZ9A 3O26A 1IEQA 1SA0B 4RW0A 2PVSA 4BFWA 2PSHA 2BMJA 1MEEA 1NSYA 4L5YA 3BKWA 4FFPA 3HL0A 1NHJA 2JA1A 1BCRB 2HBYA 5KX5B 2RK4A 2C5HA 4EENA 5AXBA 4MU4A 5IJ9A 4WH0A 2OMKA 3EFBA 2CMDA 3ZD8A 1LF0A 3H2ZA 3QQ5A 3F0TA 2ZRAA 3JWJA 1SXJB 4KN6A 3IR7A 4P5DA 3SIRA 4LOJA 5E7JA 2P6RA 2YGAA 2F1KA 5CTYA 2QHXA 4TRJA 3O6OA 4CPDA 3PQ6A 3BRCA 4M1MA 2WI6A 3KQNA 1LTKA 4QLOA 2JGLA 3HB7A 2H8KA 2AMYA 2EFEB 3JARB 1IIBA 1TJYA 2V0GA 4EYOA 1OAKA 2MJLA 3QTLA 4D46A 5KQSA 1ZZEA 4AM3A 1P6XA 4C6TB 4DCNA 1LGYA 1SHJA 4KIFA 1R6MA 1XALA 1E9EA 2J0QA 4TKUA 3WJAA 4HVCA 3JQEA 3O95A 1XZNA 5JFOA 1E20A 3U7FB 1IZZA 4FZRA 4R9VA 2QRVB 4GQIA 1YGPA 3IUBA 4KJZA 4I50F 1UXOA 4HY6A 4E6EA 3Q9UA 2DSTA 1PP4A 4BVFA 1SOWA 1R0RE 3WWEA 2XNHA 4RORA 1R18A 4IF4A 5BSUA 4C4XA 3T7EA 1L7XA 4BGDA 1HO3A 3CE9A 3TRHA 2J1LA 2WU4A 5ITWA 2XDUA 1W1UA 1P0PA 3UG6A 3WDSA 3B78A 3GUCA 2PXHA 4JYCA 1JDBB 4EFUA 3REQB 2P2LA 1NVUQ 4PC3A 4F7WA 1QYEA 3LBHA 3AHIA 3OT1A 4OBWA 3RYHA 2YHUA 3BCUA 5EZYF 4DPTA 2RG1A 3S2FA 2A1UB 4Y0AA 4GWKA 4I5SA 1X7ZA 2EFYA 3R5HA 3G8AA 4OM8A 2F2TA 2PVCA 3R7WA 4Z9YA 2KLHA 4ER0A 1NVEA 1YNOA 2ZT8A 1FP4B 3H1PA 3LT1A 4TMXA 4MVJA 1YO6A 4KTVE 4BMVA 1VBFA 4FYIA 4ED9A 3JPYA 5FDFA 2FEWB 1JJAA 2GZSA 3UAWA 3AY7A 2WZBA 1XWWA 4AWQA 3DVRX 4I4TF 2I6TA 1YONA 1J99A 5DHPA 2Q5HA 1N0IA 4PZ0A 4YV0A 3C70A 3HN6A 5A4KA 4BO0A 1JM6A 2OV8A 1Y8RB 1ULBA 2RK6A 3JASA 5KYUB 3S2EA 2NQ2C 3FUTA 4YKXA 5DIZA 2VAMA 2VSQA 2NAPA 2C98A 3DO5A 2PRJA 1Y4SA 2WJIA 2VCIA 2J48A 2L0XA 3OQ1A 2HXSA 1WXGA 2IPMA 1CEXA 4GIBA 4OJMX 4DLXA 4EUNA 1PX2A 4LAFA 1OLXB 4GZ6A 3S55A 4L1KA 3S2UA 3RU9A 5K0SA 3J80C 1ZK4A 2COUA 2Z5CB 4NESA 4JV5I 2TMKA 4YT8A 2XABA 1T2VA 1UC5B 9GPBA 4OKNA 1ISGA 1YCHA 3OP4A 2H8GA 3TTVA 2A92A 4ZVQA 1M2VB 1HLPA 5ELLA 3EPRA 2HMUA 3ECCA 2VQEB 2YKCA 4WX2B 1JS1X 2NUPB 3I23A 3FKSD 4DR1I 1BMDA 3UJDA 2QMUA 2QR2A 5CA0B 4NHEA 2JARA 1A4IA 2EP7A 3E8SA 2X58A 1Q44A 2XDWA 4BFXA 3Q2KA 4WBNA 3EVAA 4G81A 4BJHB 3LWBA 1WZ2A 1WD7A 2H85A 5E1DA 4LYDA 2VUTA 3W2IA 4YV2A 1E9DA 1M1YE 4UCFA 1JEYA 3IP7A 3RS4A 1H05A 3G1UA 3R0ZA 1L5LA 2NTNA 3U1YA 3KCNA 3VKVA 4EKDA 5J2TA 3QITA 3LX5A 4N5LA 1SCKA 3TNYA 1BWQA 4WXRA 1RW4A 4YHBA 1N7GA 4IWYA 1P7CA 5LMUE 4LWIA 1YDEA 3JAMA 4ARAA 2UDPA 2H11A 1GQYA 4E51A 3DHEA 2C78A 4GI5A 2IX9A 4M0PA 5BSTA 2C37A 1T6XA 1RHYA 5THXA 1EQ2A 2HNBA 5A4AA 3KQTA 4KWIA 1OBVA 3IULA 1DMSA 1FLVA 4MGKR 4BPBA 3RTCA 4L8LA 4C5AA 4LCEA 5HBGA 3QEAZ 1JLRA 3AF1A 2G04A 3PYFA 2EGHA 4CMAA 4FMDF 1DKOA 2O2ZA 3ZHOA 1PL7A 1FTNA 2VHJA 4RELA 3B5JA 3WDMA 1DKRA 2QTNA 2AKAB 4X64I 3ZCUA 3HL4A 5F5NA 1TZJA 1XHFA 3FDJA 2Q4TA 3DTVD 4TS3A 2JGDA 3IAHA 3G0BA 1HOTA 2PUTA 2J6HA 1BDBA 5BMOA 2W4IA 1LZLA 4C03A 3AHDA 3EPKA 1PZEA 3SU8A 1Y6JA 1ZJJA 4GEKA 3DFFA 2GPJA 4BMCA 5L3SA 1PFKA 2JD1A 2X6TA 2BVNA 1W1WA 3TSWA 4PTYA 3UEOA 2FVYA 2BJVA 2O7VA 1IOWA 3A0ZA 4TSFD 5LP6B 5CD9A 2GJ8A 4PINA 2FZGA 1SVIA 4WCVA 3E9DA 1PNQA 1TAGA 3LY8A 1AOXA 1R4NB 5EMMA 2HK3A 2MSLA 3W0LB 1VMDA 3G7SA 3UMSA 1Z0JA 1VZ2A 3O4RA 2X5KO 4H1WA 1NVAA 4PO9A 2PBZA 1RI5A 2LWIA 4NH4A 2DOKA 5FNFA 4RSGA 2J87A 2LKDA 2QN8A 1QOPB 3ZDXB 2HHLA 3RRMA 5ADHA 4DCTA 2JHCA 1XV5A 4V26A 2ZCJA 5I8WA 1XJWA 3IBTA 3HXQA 1F0PA 1RM0A 4WKPA 4HH0A 4CBVA 1LPSA 4GWLA 4FMTA 2UZAA 4IAOA 1JU9A 1TM3E 4TXMA 2RCNA 2JVJA 3HFGA 4DANA 2REOA 3ANXA 1PT8A 1MPXA 1OPRA 1RBYA 2BGRA 4GF5A 1YBMA 3GJRA 1XHLA 1W30A 3AZOA 4U00A 2Z9CA 2D2EA 1Q19A 4MR8B 4NCIA 4MWTA 1M5RA 2WUDA 2QJRA 5JJLA 1Y1PA 3NNNA 3AKZA 3WRYA 4FZ5A 2JKIA 4W5TA 1NE7A 4Z7YA 4X1KB 3QMPA 2Z2YA 4F56A 3W5JA 2Q9CA 1M1NA 3ROXA 2GEKA 3JYPA 2J0SA 1T1JA 1GFIA 2Z1NA 3NAQA 5FLXC 3IPLA 3CUVA 3P2EA 4G5FA 2WWVD 1Z0SA 5BVHA 2B4YA 3KQYA 1THNA 4JMPA 4DV1I 2JDID 1Y3DE 3LT0A 1QP0A 2CCSA 1QRAA 1FP7A 2LD4A 1MPTA 2YJ6A 5JRZA 4U2BA 3QA9A 2WLSA 1DXOA 5EKXA 4N0DA 1OJ4A 1W6RA 2DHDA 1WXDA 4IIHA 3FGZA 3P2OA 3FFAA 5AW4A 3RVDA 1Y82A 5EHNA 5AI5A 1WXWA 1R5JA 3VSAA 1UT6A 3GLKA 1DINA 3FYHA 4S1WA 4MXDA 2VJAA 4LBZA 4C3ZA 4CIYA 3RIYA 2L18A 1FOEB 5IT0A 3JX9A 1P1FA 3E1KA 4KLZA 4LDNA 3HNOA 4QG7A 4XIGS 1UDSA 2B7CA 2P9GA 4KX5A 5IKEA 1C1XB 1CR4A 5L7YA 1TIBA 1KVQA 1XMOI 4HWOA 1H8ED 4X5OA 4GECA 3OKPA 1R2QA 1IPEA 3A4VA 5F78A 4IOKA 2NN6A 4KFSA 1WMFA 1JQ5A 4CMBA 3FZYA 4GYKA 2X5NA 3WKCA 3AVXA 1Y8OA 2O3UA 5B1EA 4B4KA 1NI4A 2WK1A 4NXMI 2Q4DA 2C3OA 1MRNA 2PFGA 1GN9A 5M4EA 1RRGA 3P7MA 1X1CA 2PXCA 1ZRMA 2BGMA 4JXJA 4RTPA 1E1KA 1GXSB 3ZHVA 2R48A 4UU0A 5FUBA 4EO7A 2BFCB 4U0KA 2BSAA 1M33A 2HJRA 3LZDA 3ZGOA 3AB7A 3OEWA 3P4XA 4NHOA 1NKVA 3SKYA 3CF4A 2I55A 2E0AA 4IJ6A 2FW6A 2EATA 2QRLA 4JI7E 4YUYA 4BKUA 3HCWA 3L7ZA 3HJNA 5DPMA 4E15A 4FS8A 3PIIA 4AIDA 4EFDA 1U9CA 4IOMA 4RE5A 1SBNE 3BUSA 1BWPA 4M36A 721PA 3DMYA 4RIEA 3T4PA 2DWUA 1EGQA 2E6UX 2X5OA 1QG4A 1BOFA 2YIJA 4L4SA 3L06A 2GEJA 4MOWA 1F9EA 3JAWA 3C5WP 2ASVA 2FQYA 1V3TA 1ISIA 2UUCI 3N7AA 1UCFA 5JCXA 2R3VA 1LF5A 1VKJA 3JCZA 3K0BA 4UNRA 4DCSA 4QDOA 1VKOA 1Q3HA 3CIFA 1IM8A 2B9EA 3N8DA 1NAHA 3D3WA 2WAMA 4TVKA 2PNLA 4WV3A 3VKUA 1JEAA 2WFLB 3T5TA 3T1HE 1MO2A 4CU5A 1C9MA 3HUUA 2XA1A 4JDUA 3D6FA 2PX8A 4CG0A 2EXLA 1YC4A 3DPSA 1XCPA 1H65A 4DR4I 4EHAA 5H1YA 2GVNA 1WDKA 2YOFA 4DJJA 1ZHOA 4DCVA 3ADKA 2J9FB 2PGIA 2KE5A 4MUYA 4YCCA 5KU1A 2VLBA 4HB4A 5E1MA 3GONA 3VJLA 4JJ6A 3KTDA 2KPOA 3IVRA 4L5JA 4M0LA 1XQ9A 5A1TA 4OOEA 4PG6A 1G8JA 1QO7A 5D6PA 1TKCA 4I2VA 1FLNA 4MQUA 3UXYA 1FSGA 4EW2A 1FJGI 5JJIA 4IFDE 3LQ4A 3COWA 3DMRA 3WWOA 4Y30A 5T3YA 1HE2A 1V5WA 1PD1A 3D7LA 3AUAA 2IEZA 3WGJA 3CEMA 3IVAA 2XMBA 1KOLA 5FHRA 4R05A 1DKMA 1A8PA 2O3TA 4MDFA 2QG4A 1S2LA 1K86A 3ZHXA 1XEWX 5JNTA 3AQIA 4J7XA 2IUEA 3II6X 2GCOA 1DRJA 1R37A 5I7SA 4OX9B 4P3XA 1HZZA 2VSYA 3C3JA 1M75A 5FQNA 2ZJ5A 2O0KA 2CYAA 3U44B 1W49A 5K8LA 4R1TA 3LWDA 1YQUA 4PQFA 2C2KA 4RZSA 2I7CA 2GRAA 3IEUA 3ZHRA 2VH1A 3N0XA 2E55A 4OFWA 1Z5NA 2GAFA 4E31A 4BVBA 3O82A 2HIMA 4ERNA 4RIHA 1IUKA 1IBLE 1C3EA 1ZW1A 1BDJA 4J49A 1SHLA 1Z7GA 4NBVA 5AM3A 1H23A 3IPAA 5CX1A 5KQGA 4PNEA 3CTPA 4AO6A 4HMQA 4DSTA 2P6UA 4BKRA 1UWCA 2V3CC 2XMQA 1K6XA 2C00A 1P7WA 5EMJA 2JLBA 2D62A 3OJFA 3BS4A 1QC5A 1MG7A 2B61A 2XB9A 3ETGA 5KTNA 1N6PA 4NZ9A 4REQB 5JSYA 4Z4FA 2HLDA 2HWXA 3JR3A 5CK5A 1POXA 2QZPA 2EWWA 2VJDA 3K94A 3HXKA 1WUTA 3P5SA 2AG5A 4E5VA 2R6FA 5H9WA 4KN9S 1V9SA 2UV8A 3ROQA 1WUKS 4NMMA 4Q19A 1NBIA 3PD0A 2PKXA 4DV5E 1YL7A 1DS6A 1ZI6A 3E0XA 4CN9A 4IKOA 4AQYI 1HFJA 2BIFA 4P38A 4P9NA 2VVTA 3KKQA 3V2HA 3SHVA 3PYGA 5H4HA 1QV9A 2OCKA 1DC3A 2PAFA 4L0MA 5DX8A 1XC7A 1LWNA 3IHTA 3K71B 3D4PA 1C7QA 4TYNA 2PNMA 2I1LA 4PR0A 2EFDB 4TUYF 5ECWA 3TMKA 4L3VA 3TOZA 4HAOA 3GQBB 1TJNA 3BJMA 1W46A 3HCFA 1U8TA 3ANSA 3RVMA 1ID1A 4FR0A 1BXKA 4KX3A 2R1UA 2B4QA 1I1QB 3EK2A 4W8GA 5D6QA 2ZRIA 4UQLA 3ZW8A 3NTRA 4BU1A 4IUYA 3FR7A 4CLOB 3LDHA 3BWBA 4Z0TA 2Q2EB 1JDZA 5LJIA 3CKMA 3EEFA 2ZRGA 2UYYA 3RYIB 1MIHA 4MO2A 3TLZA 5K9ZA 4CUKA 4AZ0B 4CTMA 3KE6A 4IGKA 1M1YB 1RVDA 2QUJA 2JA2A 4G37A 2GT1A 2VOEA 3HXTA 5JSKA 1GQ2A 4R3NA 1REQB 3TZ5A 4YA6A 1PV1A 3I8XA 3A1UA 1DXQA 2OFXA 4GYJA 2WWFA 4R2HA 4PGHA 5DN6D 1PDWA 4BCDA 3C3CA 2Z9DA 1ZGCA 2E89A 5LXTB 3P71T 1P4HA 2BHNA 4MJ3A 1NFQA 4WASA 4RXUA 1HDXA 1YU9A 4GVXA 3L5KA 4F3KA 3ZHZA 4S05A 2GARA 1Q83A 3BGDA 1SOMA 3NJ8A 3PGKA 2PLFA 1TQ2A 2FPPA 4WKNA 1Z4KA 4ML3A 2PZEA 4BTEA 3ZGLA 4TKVB 4ALLA 1IDOA 3EMBA 5ALSA 5IHXA 5F35A 3HCAA 4FCRA 4BP9A 4PHTA 2F90A 1A2BA 4XVQA 3AOEC 2ECKA 1FVXA 1ZSNA 1DPGA 4AIMA 2W2TA 3FXAA 4KR3A 3ZLUA 2KYRA 3KKPA 2D5AA 2PU7A 1EVIA 1JN0A 2ZR8A 4CG3A 2JZNA 4TXNA 2OAGA 2LNDA 2C9OA 3LPCA 4QDKA 3HTXA 2XUOA 2NZVG 1WP4A 3KG2A 1EE2A 1LSJA 4URUR 5BO5A 1NW3A 5KAPA 1JQLB 1N92A 1YS3A 2BU7A 2WW8A 1GUFA 3THYA 1E3WB 2X5XA 1JHZA 2XNKA 3A26A 2XF8A 4MV8A 3T3IA 4C0WA 3IESA 5EUQB 3CBQA 2GKSA 1B8UA 3MMSA 1BWRA 1RZUA 4AJ1A 1Y1TA 2BSQA 4N49A 1QG6A 1JMVA 4KNWA 4NZPA 4G5OA 3MRXA 5BSMA 1YB2A 2PUHA 2L42A 3P32A 5BUQA 5KYTA 4GE0A 1AGXA 4MWCA 4XUCA 1N2JA 4OL0A 3QE2A 3ASUA 1H3NA 5THQA 3WMRA 1E89A 3KHUA 3B7GA 3CIOA 5K3OA 4KK3A 1H93A 1KZ7B 3P3EA 6ADHA 1ZBQA 4H4EA 3BHMA 4B8WA 2Z08A 2XE7A 3ANMA 3KXPA 1VIYA 4H6PA 5HW0A 2Q6TA 3A8TA 5F76A 1EVEA 3D4LA 3M1IA 4BIMA 1DIRA 3HFJA 5F5XA 1S02A 3RM3A 5LC1A 1A8IA 3GC6A 3PC8A 4Z3KA 3D0KA 3IP1A 4YKRA 2YEGA 1TYDE 3RJ9A 2FE4A 3IVMA 2N0SA 5FL7D 2GZMA 4DLRA 4XQEA 2I2DA 3GGPA 3IQEA 5J40A 3X0DA 2VCEA 2VR1A 3ZYCA 4LWHA 1GT91 3DR5A 2RHLA 2GN0A 1IY8A 4BUCA 1XCOA 5AOCA 2OP0A 5FTKA 5TVGA 3S1AA 3HVIA 4DV7I 4HJXA 3GUHA 3S2GA 1IOLA 4E22A 3FCXA 2EC5A 2H55A 4ZEOA 2G0AA 3PI6A 3I61A 2AG0A 1E9SA 4LDPA 4IIUA 3GDHA 3HRKA 5IVDA 5IDMA 1GZDA 4LRQA 2LIVA 3B6JA 2ZT5A 2VEDA 4NZNA 3TZKA 3EZ9A 4BQPA 2CD7A 5LOVF 1LTQA 1GG2A 3G0DA 2IOPA 2ZFUA 1TUBA 2Q2QA 2ZAMA 3ZTYA 1YZUA 2C5EA 2YE5A 2WD8A 4I55A 3ETLA 3K6KA 2JGJA 2C4NA 2F43B 1OBOA 4S04A 3NATA 4BQNA 4DUPA 1ZYUA 1QQAA 1EFPB 4XDYA 4ZTZB 1YQDA 4AP5A 1FX0A 5DT2A 1IZYA 1T1EA 4AULA 3CLSD 1CJVC 4LF6I 3IHWA 4H85A 2JJ2D 2OUKA 2DE0X 1NRWA 3MLAA 1L5ZA 1K8ZB 4D26A 3T2SA 1N7IA 1ZD5A 3ISTA 4Q1DA 2AC7A 3IAEA 3W79A 2YXBA 2IUTA 2RJ3A 3ZZNA 2F67A 3OKCA 1WAMA 4XWGA 2YXNA 2PR2A 3GGDA 2IS1A 3H97A 4DARA 3FNEA 3MIZA 4ED4A 3PEFA 2H5LA 1WMDA 4KHPI 4PGAA 1XCMA 4PZZA 5HGJA 2OFOA 3WLMA 2WP8B 1GUAA 2OAP1 4Q3LA 3MHTA 4PE5B 4J3NA 4C0BA 1KKLA 3UAZA 2DCUA 3UK1A 1H69A 2CNBA 2DHEA 3IEDA 1M0SA 5DBGA 3IQZA 4ISAA 2IXFA 1N2GA 3U5ZB 2Q1WA 4NYJR 2X19A 5CIQA 3D36A 1LNSA 3KWJA 4PIMA 3VR6H 1CYEA 2PH7A 2EFCB 4JT8A 2BA0G 3I37X 3HKDB 2JLVA 2GTHA 3EXFA 4F8YA 4XEHA 3AEUB 4JI7B 1F9AA 1UOPA 4GGOA 1S2OA 3QWBA 3EHDA 3WLPA 1OXXK 4DMUB 4BNKA 5LA6A 3ZD9A 4O4LA 3SFVA 1VPWA 1CS0A 1JUDA 1XLTA 3Q72A 5ALQA 3L05A 4F3TA 3C87A 1IXMA 2HIHA 3LW8A 4W9RA 3C7TA 3LWZA 3MWFA 2X8JB 1MQAA 1Q57A 3VYWA 5IT9C 2I8LA 3OTWA 3CJRA 4X54A 4CEHA 4YCSA 2YJXA 2P2GA 1QCZA 3L1JA 3OWBA 1N5OX 4BIZA 3BMCB 2Q3DA 3OMXA 2OSBA 5TMPA 1A4XA 1J9EA 4E3ZA 1Z39A 1P9RA 2AN4A 2PZ8A 2A0XA 1FQJA 1J8MF 1W29A 3S8EA 1Z38A 5AVSA 5SY6A 4DF3A 2PH3A 1JHVA 2VK1A 1GU7A 3DH0A 2YKGA 1P2UA 3HUFA 1I8TA 4WLEA 3E0QA 1E2UA 3Q7SA 3O91A 4EYGA 1GCIA 1T5HX 3KQMA 4GXNA 2DQSA 3FPHA 1V37A 2EDCA 1IUNA 1GLNA 4XQ9A 3GOQA 2G80A 5J58A 2BFEB 1UMCB 5IN9A 2SECE 1JA9A 4UUOA 2O20A 2A9FA 1YTLA 3UO8B 4JMLA 2MCFA 1VYVA 3T61A 2WA2A 1RFGE 3K85A 3GCMA 2XX3A 4D25A 3JATA 4Z7OB 1HMYA 2QT1A 1T2NA 1C3LA 3K1YA 1ZISA 4S3MA 3JZFA 2XDLA 1HSZA 1NNUA 2D0PB 3EB9A 3JQ8A 1L6RA 4Y9TA 4UFNA 5TMBA 3ZY6A 1VPVA 4OHCA 1J33A 3U9LA 3R24A 1W5AA 1NW9B 1RLUA 3ZWNA 1SUBA 2XE4A 2OECA 3QU2A 4W6ZA 1CEYA 1J1ZA 1SXJC 5C2JB 1GARA 1Z34A 1F48A 1ZS9A 2EXXA 4EI2A 2FI1A 3GJ8A 4RD6A 4YP9A 3GMEA 1E59A 4FN4A 3M3PA 1WUJS 2E18A 3THXA 5L3ZA 4B80A 2DG2A 4B34A 3CNHA 1XEFA 3GJXC 3IBYA 1SKYE 4ZVUA 4IDPA 4MRAA 4BP1A 1D9XA 4CFYA 1IBLB 2KBEA 3IAM1 2PZAA 1ZI8A 3WU4A 4OJNA 1JSRA 5M7EA 3PFFA 3NUQA 2LCIA 3H18A 4MB9A 1A04A 4C9BA 2Z0MA 1G41A 3P8ZA 1DXHA 2EARA 3TLMA 2YNMC 4AUMA 1Q92A 3GT0A 4BXIA 2VQFE 1YQWA 3M6VA 1DBQA 4FFRA 2Q3LA 4I81A 2XGGA 1EFVB 3GDOA 1Y80A 2HUNA 2M6SA 1ACLA 4DMMA 3KP1A 5KAMA 3KKLA 5KYVA 4Y2YA 3KXKA 1WY5A 4J0CA 2J8ZA 2XB4A 4GGLA 1U2SA 1RJDA 2BBSA 2DUWA 2XTAA 4LSMA 4KNYA 5TQ2B 4DV0I 4DV5B 2GN8A 2IELA 2OCYC 4DIOA 2H1VA 4UREA 3BCRA 1UP4A 2MR5A 2W6JD 4FOLA 1U3CA 3WMWA 4TRRA 3E9CA 3U9SA 1S8AA 1J9GA 2ZS7A 2JJ8A 1QFMA 1XL0A 2A1TR 1TXGA 5HUHA 5H5JA 2QRJA 1W5BA 1FDRA 2GCPA 1W6UA 4RGQA 1AU9A 5IN5A 1OBFO 2N3ZA 3VDXA 1Z12A 4BATA 5DASA 4DNPA 2GHQA 2ABWA 4GM4A 3JYLA 4OP2A 3HV2A 2C7RA 3PHGA 4OU4A 1HY3A 3PEVA 3DDHA 3NMUF 2IOYA 1B8NA 1U2TA 3L2OB 1U4NA 3P0EA 1E9CA 5DWVA 4UEKA 3TTSA 1X1QA 1LB1B 1NVXQ 4DWOA 4C4TA 2V2ZA 2WINI 3PXUA 2GSDA 4UD2A 1QGUB 1AKUA 2AFHE 4P3KA 1RRCA 1T0PA 4C2TA 5A04A 2CVQA 5BN4B 1HQDA 9ATCA 5G2OA 3OP1A 4WUDA 4KUGA 4ZHQF 2FFJA 3DOEA 3F5FA 2PUDA 3GMTA 4A8HA 1T3TA 4ASBA 3L49A 1QPBA 3S1SA 3VBCA 1S4QA 3LFUA 4GNKA 1WJGA 4M0UA 1E2MA 3F2VA 4IDGA 3SXJA 3HDQA 2D5IA 1SWVA 4H0FA 4BV8A 4QXAA 3Q12A 1G3IA 4WRRA 1HEYA 5C0XB 1H1LB 4RTOA 2BZ1A 2WHXA 2WD7A 4V0KA 1EFLA 2ZYDA 1YDFA 5IS2A 4X62B 2M98A 1W88B 4AAYA 4XM1A 5INTA 2BWJA 2FP4A 3WL3A 4P7BA 4BBZA 3UG7A 3C98A 1TRHA 2NZJA 2NV6A 3I58A 2BI8A 1Y5NA 4FHDA 4TRNA 3WVNA 4HUJA 1QS0B 1ZM3A 3SAJA 4MGYR 1AURA 4Y7CA 4UHDA 1SC9A 4R71A 2A1IA 3D2LA 5TSDA 1X80B 3Q8WA 3I4CA 3UIEA 4ENTA 1CY1A 1I6MA 1CTQA 4CWRA 4PWZA 1IEWA 1RHKA 1Y1KE 2FYPA 2RJOA 3OF2A 1JX6A 3DEAA 4UPVA 1TE2A 3IBFA 3F8SA 4O2AF 2AS0A 2ORIA 2JGIA 5C5IA 2YKEA 2I66A 4JBLA 2DUJA 3SCZA 2X2OA 1PGJA 5K99A 2YEJA 4E11A 1TOAA 4U5QA 1OAOA 1QZXA 4TROA 3ZDRA 1XN1A 3V8EA 1VZ3A 3SDSA 2HA7A 2ISQA 3MGGA 4MLCA 1M9NA 4IX1A 4AMZA 4OIMA 5D00A 3UFBA 5JV5A 2Q9BA 5LMNE 1UK7A 3DKIA 5AJHA 2H1IA 2AOTA 3G75A 1DAIA 4GHWA 3VNBA 4PFQA 3GLFA 1NJ1A 1AM4D 3PHCA 1ZC4A 4KMMA 1NNSA 1L4LA 3M6IA 5FFFA 4EX6A 5CAEA 4LSZA 1EXDA 4UTRA 4RH0A 3G2QA 2R65A 1Y6FA 1H4VB 1MB2A 1S8NA 1WHSB 2H6EA 2OILA 3HADA 1TYZA 4I3HA 2FPXA 2IS4A 4MAFA 3MT8A 1ZOIA 4EMSA 4CEJA 3EIHA 2J6BA 3ZQJA 3WFJA 1IBRA 5FCDA 5EJ4A 4RDXA 2X0DA 2XMZA 1J2YA 5JJBA 2JIOA 1F17A 2P9ZA 1UZMA 5KSWB 3GJSA 4JBIA 5EI5A 5LP6C 1T9KA 1UKCA 3PQ5A 3CRNA 5FOTA 3IBCA 1SXPA 3F8TA 4H6WA 421PA 5FTWA 2GNPA 3HYSA 1Y4AE 4B9EA 2E87A 1DOHA 1Y5RA 1XTKA 3HR7A 4UEOA 5EG5A 1YDMA 1JIQA 5CTWA 4DT1A 2ZETA 4W8OA 2I7TA 5DGXA 4BFSA 3EVCA 5ENDA 4J0DA 2HTEA 3VJKA 2CJWA 1PYGA 4DHEA 3EDMA 4KP7A 1P1RA 4D02A 1N34E 1ZA1A 2BR5A 5FR1A 4BVKA 2G7MC 1IQPA 3DCYA 3W2TA 1E69A 1L4UA 1ZFNA 1L8LA 2O3QA 2JIZD 3WMXA 4FX2A 2CBGA 2QENA 4UDOA 3AG6A 3C7CB 5GV7A 3ODGA 1QZ3A 3S81A 1V39A 1U0TA 3V3KA 1RS0A 4W5OA 1A7AA 1OKKA 2GXQA 5H83A 4M0DA 4QBHA 1J0XO 2JFGA 3I1IA 1QRUA 4FZJA 3Q8XB 3G68A 2W2LD 2F6RA 3NGLA 3QFTA 1B0PA 4ALJA 1GPAA 1GPYA 4RPKA 3T06B 3GFBA 3JW8A 3KV3O 3HJUA 4FQ7A 3GFSA 4HAIA 5EMLA 4DDUA 4JVNA 1J06A 5TY0A 2JLSA 1DX4A 5HRUA 2HTFA 1YAJA 4B6GA 2F1IA 4B3CA 1DKPA 1OILA 3H99A 1GGEA 3KZ1E 4EZIA 5BW5A 2R5NA 2C4WA 4F93B 1DJPA 2ZBDA 4JI1B 4I3GA 4E00A 1PKPA 1JKMA 1HYQA 2XLBA 2GK4A 4XGRA 1R0WA 3WI7A 4YPFA 4H1HA 4WCFA 2IYPA 3KSMA 3JWHA 1U7ZA 2VF3A 4WJKB 2DUMA 1GUDA 1U0SY 5H3LA 2VP5A 3RLQA 2ZBFA 5IASA 2NO1A 4ASFA 1RQPA 2HSJA 1Z4JA 5CK4A 4GSLA 3WLQA 4ZOLF 4M8KA 1P0CA 3HWSA 3N59A 3BWXA 1C7ZA 4DXLA 2IX3A 1CIPA 5ETJA 1RACA 4QNMA 3ORSA 1KMNA 5EXTA 2B6NA 2HCFA 1XD9A 3B24A 4H4DA 3OM1A 4YMHA 4U63A 3ENWA 1TEZA 2QQ5A 2KLBA 1W2WB 1XKLA 4OO1D 3PWZA 4H59A 4UVEA 3JR7A 4W5HA 3TOXA 3UGTA 2FFRA 4J2HA 2HCTA 4J75A 1MQSA 3BX1A 5GJBA 1Z5PA 1N5RA 1HL7A 2G5GX 4IVRA 2ACWA 1OWPA 4YACA 3STXA 3A7EA 4CLHA 4EFMA 4A4DA 3SJBA 5EZ5A 3ZV7A 3O84A 2IITA 2P4SA 3BE6A 1IN6A 5C8YB 1CHNA 3JQAD 4R9UC 1ADYA 1JR3D 1GZ3A 3VJRA 4USKA 1EB9A 2DSNA 5FBLB 4BNLA 4AUKA 3PVCA 4IZJD 4FKMA 3H2HA 2GD1O 2P79A 2VJLA 2NNWB 1K6MA 3AK4A 4BKOA 1CDZA 4OO1F 5B1DA 5L3QB 1U2QA 2UVQA 1EUQA 3U2QA 1N9GB 5JMPA 4LJSA 2J3LA 2QUKA 4O3FA 3UVEA 4E12A 2LVBA 5KHAA 4J76A 3DUFB 3ZCRA 1V5EA 2YE7A 3KR2A 1O2DA 5EP2A 4ETMA 2W9XA 3E48A 1DOAA 4GPZA 4PSKA 2ANBA 3R3WA 3VVCA 1AX9A 3WLEA 3DB2A 4URYR 2I1VB 3I2FA 1T5TA 1TZKA 2V5UA 4F4DA 1BCSB 2GNOA 3VDNB 2XRFA 1HUQA 3KYJB 3S4YA 4A92A 3K0FA 5LQKA 3ETJA 4Y6LA 2C4VA 2JAXA 2ZJ7A 2C95A 3K8YA 4P7KA 5AIAA 1V8PA 3WLAA 3BE8A 4EECA 2BFPA 1SKYB 1PHPA 3RYFB 3OJCA 3G79A 3ZJTA 5C4IA 3V2UC 1YZHA 3W7VA 3TG2A 3DDCA 2BEWB 3A1VA 2QGNA 4P7AA 1KFKB 3KU1A 5L7TA 4C5CA 3A6DA 2A2ZA 3WV5A 3KOXA 2D1QA 3Q8LA 1E7MA 3TZ2A 2VQFB 2WU3A 3LDAA 2VSXA 4RJ2A 4ZCRA 3J81k 2I0FA 2O8DA 4PAGA 1M0WA 3JRWA 3ROZA 5KVQA 2XEXA 2R96A 1S8OA 2WRZA 3PU6A 3MTIA 3DZ8A 3KWFA 2VOJA 5K2OA 2OGWA 3IAAA 4G63A 1J5EE 4M8NE 2R8XA 1ORIA 3LFHA 2Q3JA 1T2FA 3ESAA 2H07A 4I6EA 4GI1A 5D84A 1V1RB 3PNQA 3PK0A 1UC4B 1SUFA 4NIMA 1QQBA 3ZN2A 2IU4A 3I05A 3NVDA 4FHZA 1RHRA 3MM4A 1WXFA 5IK2A 4JUDX 2ZZKA 1D03A 4GRDA 4P58A 4RGBA 1K7EB 3CZ9A 4URFA 3FYTA 3UHMA 2CVEA 1ZD4A 2A9KA 1EJBA 3T3EA 5EP1A 3PVSA 1S0UA 3MBOA 4AVYA 4KC0A 2XNCA 5LPNA 3SS8A 2QTAA 1TQDA 4JJ7A 1BRTA 3PHHA 1ZWHA 5GOTA 1SUPA 2EEPA 3ZGVA 1QOQB 3UOAB 4BLVA 2EG5A 1ZH6A 5KTOA 4MUNA 1NI3A 3OQIB 4O4HB 4LY3A 2BI4A 3GVHA 5ITVA 3P2JA 1OF1A 5IC6A 2PT6A 4OJQA 2Q1TA 3R7FA 3FKQA 3CCBA 4JUIA 3UH0A 1RQLA 2DLNA 4FCWA 1V4NA 1U04A 2QJOA 1KS2A 1KJZA 1XP5A 3RPEA 1IXRC 1FFXA 3FCCA 1UDCA 4IZKB 4J1QA 1UF9A 4IICA 1Z88A 5E6RA 1Z0KA 3P9CA 3LRTA 3TR5A 3GROA 4FGZA 1FTWA 3UKJA 5CFPA 3QTBA 3CW8X 2VZ8A 2EBWA 2DRIA 4H27A 5HIJA 4MWEA 4LYFA 2CT8A 5J23A 2ZIZA 5I7FA 4HK4A 4MWOA 4M88A 1D3AA 3T3MB 4LZNA 1DAPA 4OCZA 3FCYA 1XF1A 4KE8A 4WOBA 4MUAA 1MW9X 1VLQA 4LXTA 1P2FA 3GL9A 4KGZA 2IXEA 3CW2A 4KBGA 5EHZA 2G07A 5FPYA 3NIGB 5JEAD 1ZK2A 4YGYA 4Q48A 1FP1D 1K5HA 1N2CE 1U0EA 3NBZC 4BU0A 2VP0A 1YB7A 2N1BA 1LI5A 2ZPAA 3TXXA 3HMQA 1QHXA 3O8DA 2VP9A 1W96A 1UQRA 1MDBA 5FPSA 4ZVRA 4DV3E 2ILVA 4BLTA 3SVTA 4C4ZA 1QQ6A 1IXYA 3STHA 2BF4A 4QDTA 1LBQA 2D1SA 2G82A 4LV8B 3AT1A 5TF0A 4BO1A 1FDWA 3U0BA 2I3GA 2PGXA 3NBUA 5EJ7A 1P73A 3CX8A 5JH7B 3X1MA 4EQ6B 1DIHA 1V1MA 1UAGA 4TLBA 2WJWA 1PFVA 4C88A 2GF0A 2YIMA 2GQPA 2E4ZA 4XD7D 5C7OO 4BQGA 2ZBUA 5ARCA 5JEAF 4EMBA 2ONKA 2I6XA 2G63A 1XNQB 4OQDA 1P0IA 2IK8A 1X8LA 4KQ1A 3N9IA 4KYTA 5BR7A 3NIFB 1CUIA 3LQYA 4IW3B 1ORDA 4LMRA 3L84A 5MN6A 2ZBKB 2WIBA 2E2WA 4ECEA 1UDAA 2CXRA 2BHRA 5LMCA 2WT4A 2LIPA 5EHXA 3WISA 1C2TA 4Y2TA 1A9OA 2R5WA 3V6MA 3G0CA 2POQX 1QORA 2HJGA 1HYGA 2C9YA 2WV9A 1SWWA 3P9QA 2QZZA 1N36E 3K8OE 1UAYA 4OEHA 2P2SA 3VM6A 2GCGA 1F4LA 2I78A 3I9NA 1YK0A 3QPVA 4ZJPA 2QQ0A 4ND8A 1O6GA 1GU1A 4GVPA 4RZQA 3NDRA 2UZ1A 2ZJFA 3TUZC 4IJUA 4HDNA 4L57A 1U7DA 4TKMA 1AKEA 3R7SA 4XE5A 2CVPA 3QE9Y 2Y4NA 2O48X 5L40A 1R15A 5FI0B 4WOJA 4RJLA 2DBRA 4KO3S 5IWCA 3GZNA 4DJDC 4KB5A 3L1KA 3MJEA 2PEYA 2I62A 1HR0E 4LQDA 1WDTA 1O8BA 2XCLA 3HGMA 1UKBA 1J1UA 4WNIA 1PGPA 2ROQA 3C8DA 4K03A 3RUCA 1QFYA 4OQPA 3BJEA 3QWFA 3R6DA 2BFAA 2VH2A 3UJ3X 3S2IA 4CUJA 1RHQA 3RRZA 3D6NB 4O5OA 4W1SA 2XZTA 1SN7A 4GPBA 3M3HA 3JY6A 2DFVA 2V6MA 1N34B 4MP2A 1V3VA 1ZY2A 4TMFA 1R8SA 3MAAC 2OPHA 5I9NA 4UFOA 2D3WA 5U4XA 3DOFA 1Q2UA 3DFIA 1ADBA 1IXSB 4JI6I 5HK8A 3SLRA 1XXEA 1ZGAA 3NM4A 3HBMA 3KAQA 4IP0A 3IALA 3WHAA 1K5GA 2VTVA 1MAVA 5DGIA 1L5FA 5DK4A 3AG5A 4BRUA 2V54A 1NDUA 1ULHA 1W85B 2ZVPX 1AJEA 2CDRA 1SXQA 1Y6ZA 1NY6A 2Q45A 2QF6A 2Z1MA 4CF7A 2OZKA 2AXEA 1Y8QA 3B9RA 3QEBZ 1HDIA 2DWCA 1GPKA 2XB2A 1KJYA 4IYJA 4Q3NA 3RUDA 4QYWA 4FEGA 1T29A 3WRWA 3ER9A 1E7RA 1A3CA 3HJBA 4QO8A 2VPTA 4BNNA 4UD6A 2YWDA 1KZYC 2C83A 2YEEA 4PR3A 1R10A 4L4YA 1PQPA 4AY4A 4XGKA 2X7XA 4AJHA 2WUWE 3I9KA 3UUFA 1WQ4A 2XPCA 3GB9A 4KQGA 2GAAA 3B9PA 2CXUA 2ES4A 4JBYA 1MEOA 1Z2OX 3R4CA 1KJIA 1EK0A 3BF8A 4G0WA 3OA2A 5D7BA 4RKWA 4YQZA 3KQHA 1CS4C 3W5HA 4I1IA 3T7DA 3HHPA 3ZE9A 3LDUA 5B58T 2NX2A 4N39A 1LV7A 2PUAA 1XXHA 2JBAA 1R4AA 1WV0A 2CB0A 2HMYB 2QSJA 2KW5A 2WPNA 3I6QA 1S1MA 4W82A 3B6IA 4YI5A 3WK9A 1JB9A 3IILA 3R41A 4WJLA 1CKEA 4AKSA 3FPEA 4YXWD 3DAPA 4R69A 2DTDA 2CNKA 5CT6A 3QNWA 4BNDB 4MRRA 1A5ZA 5AKLA 1P9WA 4QM6A 3DL0A 3HKBB 4X9XA 1BH6A 2DQZA 3CB4A 4FPXA 2EOAA 2COEA 3AF4A 3M0EA 5IUKC 3SYLA 2OLJA 4F9TA 4JR2A 3V7YA 1MFZA 3RCBA 2HMTA 3OM9A 3L0DA 4FLEA 3I01M 5GINE 1WULS 4X85A 4KBYA 2X9VA 5ALZA 2G1AA 4UNPA 5LQMA 5DM4A 1JKFA 3GV0A 3MWDB 2PR7A 5CDHA 4P4SA 5MFZA 4O2BB 1YFJA 1Q7TA 3O8OA 5FNVF 1Z2DA 1CEQA 1NFRA 3SG0A 4IM7A 3ZE2B 3LYHA 1CQIB 3CSSA 3BERA 5TDHA 4ZYWA 2DLDA 4YCDA 1YH3A 1JKXA 4OHZA 2J46A 4FSHA 1HSOA 3IXQA 3L8DA 4QDZA 1CDDA 1I3CA 3UWPA 4ZZ1A 1OXVA 4CCSA 3DZHA 4MZDA 2FAXA 2HU8A 2XYGA 3KOZA 4CLRA 1E2JA 2IY9A 3CH4B 5DM60 1G5QA 2K7FA 1WSBA 1TMGE 4KODA 2NSDA 2C42A 1GZSA 3E7PA 4QRIA 4HPJB 5PNTA 3VC1A 1JTFA 1UDRA 3UWOA 5JSHA 3TZHA 4M9UA 3AUYA 4IUBS 1X9IA 3VR2D 4WEOA 1GTL1 2Y1WA 3OWDA 2G7ZA 3PJFA 2B5WA 3RR2A 2OBBA 4CKCA 1TU0A 3WNDA 1TI7A 4QGAA 2B21A 3HYYA 4CMIB 1ABBA 1P4RA 1DCFA 1GNQA 3V4VB 3AZQA 2CL0X 2JLZA 4DYVA 2XDYA 4GZMA 2WSMA 3L7YA 3TVDA 2C31A 2GH1A 5DB4A 1IXZA 4DVJA 3EWAA 4V0ME 4J4TA 1NNI1 4CMGA 3PLNA 2ZRBA 2WUGA 5CBPB 4TTPA 4MVJM 3O0TA 1D1SA 1DIBA 1YR3A 3TB6A 4JBXA 2VJMB 4IFDC 3UYKA 2FPOA 3V34A 3PHIA 2PS3A 3E7XA 1Q0SA 2VI5A 4U7FA 2VHTA 3ANTA 1ODKA 4Z2AA 4BB5A 2E85A 4EFLA 3IAS6 3ILXA 2BSMA 4RPFA 1PTJA 1P0MA 1E18A 5I3CA 1R88A 1ZESA 4B6RA 4FEEA 5EKDA 1J5EB 2BFMA 5JZ9A 5IKPA 3AVWA 5C8VA 3EWSA 4CIVA 3L1IA 2ATCA 6NULA 1TO1E 2WU0A 1GGVA 2CJYA 4CKWA 1X1DA 3C7DB 1C30B 4HEA1 3QP9A 3ACBA 4OP3A 3R4NA 1YZVA 3GT3A 2QL6A 3VZQA 5SZHB 5LMUB 1DEAA 1GZUA 2QU7A 3VR4A 5T64A 5M5BA 4HNTA 4JWTA 5JEEA 5K3DA 4EI9A 2CMFA 1XSEA 4UMEA 2AXPA 2EKQA 1ZA2A 4AD8A 4K9OA 4W7IA 1NP3A 1SCUA 1AKWA 3EUAA 1I3OA 1U4OA 3VHXA 2FCRA 4B7AA 4MLDA 2VDRB 2WHPA 2YWRA 1O95A 1E58A 5AKIA 1G8GA 3FFBA 4S12A 3ZKDA 3UFXB 1NUSA 4C05A 4ASUD 4ZWNA 1HM5A 1T25A 5CH8A 1KFJB 2V55B 3R4OA 1XMPA 1BEZA 3V5RA 3R3YA 4Q4CA 1F51E 4R3MA 4NE9A 1TW3A 1SBCA 4RGYA 2YS6A 3B3AA 3VTFA 1IATA 1UPXA 3ZE8A 3GJYA 3ZXIA 4WUCA 2OXEA 1DT5A 3ESDA 2NU6B 1C8BA 2VATA 1U0HC 1TJ4A 3VSBA 1QLJA 2VAPA 3AFOA 4WESB 2AJDA 2GYWA 1J2EA 3A58B 4KSCA 4RV4A 4WK2B 4JOQA 3LUJA 3A9RA 4N41A 4LDAA 3EPJA 4G1EB 3P3CA 3AR7A 4KXYA 4B76A 1F2TB 4JXZA 4XYBA 1U9YA 2NU9A 3KQLA 5TQ0B 1T9ZA 3I42A 2BR2B 2APJA 3CT4A 1VLMA 1W36D 3BFPA 4DL9A 1UKEA 4CODB 1U0GA 4HWGA 1QTQA 5FOUA 1RHMA 3HS3A 4DV3B 3WC4A 3W3AA 4A5SA 4HDAA 1UEKA 2BKAA 1TFRA 5AKHA 4EPWA 1YRLA 5AJVB 1U94A 1MQ8B 4ZDWA 4JLSA 4G0QA 5ICMA 3QVUA 1HTTA 1SC4A 4LUCA 3HDGA 1D2EA 4UVGA 1WKBA 1K8QA 1YSCA 4N65A 3H1AA 1E62A 5C46F 1CVRA 4HLCA 1VXRA 4F45A 4GLFA 3UOGA 2ESRA 5LZ5A 3NT5A 1CJMA 4YUWA 1YAHA 4WHMA 4MVWA 2JB9A 4G9EA 3LO8A 1QHGA 3DXFA 1FE8A 1H5UA 1VI5A 4ZYVA 3GUZA 4MK4A 1I7NA 3FUUA 5AVTA 5DTJA 2Q7OE 3D81A 1RQXA 4M8IA 5C0XC 3AFIA 4ES6A 3I32A 5IBRA 1AHNA 1G6HA 4EZEA 2WG2A 3IP3A 3OUUA 2HHCA 2RG7A 4RPIA 3OMUA 4C0QC 2CLDX 5JCJD 3HZHA 2FWPA 1AA6A 1N8KA 4OO1E 1RIFA 4FDLA 1WETA 3BZUA 4ZKIA 4NJMB 1RRFA 2WNRB 3CGZA 2HFUA 1SBYA 3EY9A 3GY0A 4JK3A 2MYPA 3EW7A 2A14A 5CITA 3U48A 3BXXA 1XR3A 1A2OA 1QZTA 3WTCA 4YCMA 3CMMA 4BCCA 4ZAFA 4AP9A 4FFWA 1KEVA 2CMGA 4HDKB 1E6MA 1JR3E 2NT4A 1DKUA 3WGNA 3Q5KA 4JNKA 4LK3A 4GICA 3W8EA 2C2MA 4YKYA 4NMXB 1SVSA 1G20A 3S7ZA 1FBTA 2QLBA 3IL2A 4ISBA 4DCCA 5CYFA 4BQFA 3H9QA 4DCOA 1AQNA 3ELYA 1UMDA 4GP6A 4QXRA 2Q0QA 3LQFA 4CF6A 3DL4A 1T8PA 4QU8A 2FPWA 3DAFA 1HDEA 2O1EA 1PL0A 5KTKA 2Y1FA 1H4SA 4WADA 1FXWF 3WGHA 4KMOA 4KZKA 4Z1OA 4QEDA 3M6WA 4AQDA 4AZSA 1EBUA 5EJ9A 3K1ZA 4DPKA 4C78A 3R7BA 1VG1A 2IKQA 3LTNC 3HVKA 3MJCA 3QPWA 3D4BA 2CFCA 2D1YA 4EB6B 4X7BA 2NXNA 1B1CA 5K3FA 2GO3A 2FOIA 3HN7A 4RH1A 1A76A 1UBRS 2FEXA 1B7GO 1JLKA 1P42A 1DZ3A 4NU5A 1UXGA 3DL7A 3GGOA 2IPAB 2NM0A 3R5KA 1K97A 5JNWA 1SPBS 3H7AA 2X4GA 4MDEA 4J9UE 5IKOA 2QLFA 4BV9A 2R66A 4KR2A 4ZD6A 3U3KA 2P6PA 3ZH2A 1C9KA 1HKHA 1N6RA 4J0IA 4IV5A 1D6TA 2EX1A 4NU8X 2ON6A 1TYCA 4WI1A 2PX5A 2EYQA 1DC5A 3DZGA 3NR2A 1D4FA 3ILVA 1P1JA 3EMDA 2QAJA 3JQBA 4M8SA 4F6RB 1UJCA 3F6BX 3G0GA 2RMKA 2X8WA 3Q15C 2IU3A 4O08A 4IQ0A 1P2BA 1WMAA 3E3MA 2BGKA 3U13A 4XWAA 2V7VA 1V16B 5TPZA 4KPUA 2D00A 3EFOA 2C38B 1C3OB 3CTMA 3JYOA 4GKKI 4NNJA 2I3AA 3T1HB 4QUEA 2PZLA 5E7QA 3DFMA 3HCOA 1CQJB 1XEXA 5EWJA 1DC7A 4URXR 3I76A 3WYDA 3V3TA 4QU9A 5FHQA 5G0WA 4UE3S 1D6SA 3CRKA 1RI4A 2C97A 4N3GA 2WUEA 2Z30A 2REBA 4Y7DA 5TNXA 3W6NA 4FWDA 4G0UA 5DLDA 3LUHA 1U3UA 4D98A 1UM9A 3E27A 3VOBA 4YJ3B 3PFWO 2JLUA 4P8RA 4IFDB 3F6RA 2GEVA 3FFTA 5BQXA 1PQWA 3JYNA 1X15A 2I80A 4D82A 1YCDA 2UZ0A 4XZ3A 3SP1A 4MVJD 4DIEA 1KI3A 1K4MA 1G8PA 5E9JA 1QH1B 3Q2IA 3ZWBA 1EG2A 3GRUA 1Y1QA 5B2EA 1E0JA 5JNRA 2Y77A 3F7OA 2PV0A 5KYKA 1RQRA 1NLUA 4N76A 2EGUA 1JLMA 2ID7A 2QN7A 1S2GA 3SOZA 1DKNA 1FDUA 2QNBA