1Y4UA

Conformation rearrangement of heat shock protein 90 upon adp binding
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
489
structure length
472
Chain Sequence
MKGQETRGFQSEVKQLLHLMIHSLYSNKEIFLRELISNASDAADKLRFRALSNPDLYEGDGELRVRVSFDKDKRTLTISDNGVGMTRDEVIDHLGTIAKSGTIGQFGVGFYSAFIVADKVTVRTRAAGEKPENGVFWESAGEGEYTVADITKEDRGTEITLHLREGEDEFLDDWRVRSIISKYSDHIALPVEIEKREEKDGETVISWEKINKAQALWTRNKSEITDEEYKEFYKHIAHDFNDPLTWSHNRVEGKQEYTSLLYIPSQAPWDMWNRDHKHGLKLYVQRVFIMDDAEQFMPNYLRFVRGLIDSSDLPLNVSREILQDSTVTRNLRNALTKRVLQMLEKLAKDDAEKYQTFWQQFGLVLKEGPAEDFANQEAIAKLLRFASTHTDSSAQTVSLEDYVSRMKEGQEKIYYITADSYAAAKSSPHLELLRKKGIEVLLLSDRIDEWMMNYLTEFDGKPFQSVSKVDES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of the N-terminal and middle domains of E. coli Hsp90 and conformation changes upon ADP binding.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone
molecule keywords Chaperone protein htpG
total genus 130
structure length 472
sequence length 489
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.80 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1y4uA02
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 1y4uA01
3.40.50.11260 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1y4uA03
3LNUA 1I5BA 2WI1A 5IN9A 5D6PA 4JAVA 2QG2A 1QZRA 4XD8A 3EHJA 3HEKA 4KP4A 2XD6A 2YGAA 4GT8A 2WI3A 3GIGA 4XDMA 5CTYA 1KIJA 4KSHA 4AWPA 4V25A 4KFGA 1UYCA 4U93A 4PU9A 1UY8A 5J71A 4AWOA 1B62A 4GEEA 1UYEA 4XITA 1R62A 2XABA 4FCQA 4PRXA 1Z5BA 1S14A 3INWA 4BIUA 3K60A 4XKAA 2BU6A 1PVGA 4EFTA 4XTJA 4CE3A 3B24A 4R3AA 2YJXA 4E00A 1Y4SA 2Q8IA 4LWGA 4AWQA 3OPDA 4PRVA 2YI7A 2ZBKB 3WHAA 1A4HA 4GQTA 3B25A 1AH6A 4O05A 4HYMA 1KZNA 4WUCA 3OWDA 4LWFA 4WUBA 4YKYA 2XX4A 4JASA 5M4MA 3A0YA 5M4KA 2HCHA 2XDXA 3INXA 4GGLA 4HXZA 2CCSA 3QTFA 1YT1A 2O1UA 4BAEA 2WI2A 2XDKA 5BODA 4KSGA 4O04A 4EGIA 3U2DA 4MP2A 2YEIA 1Y8OA 2XHTA 2XHRA 2XDUA 4DUHA 2YJWA 1ID0A 1TC6A 4CWPA 4EGKA 1UYFA 2XX2A 3BM9A 1ZW9A 1Y4UA 2FWZA 2VW5A 3H4LA 4W7TA 4LWIA 2H55A 2O1WA 4P7AA 1US7A 4MPCA 2BTZA 2YGEA 1B3QA 3A0ZA 2Q8FA 2H8MA 4NH9A 3K97A 2CGFA 3O6OA 3C11A 4O0BA 1YERA 4R3MA 2BSMA 4XCJA 4LWHA 1BKNA 1AH8A 2WI7A 2YKEA 2BREA 3LPSA 2YEDA 2YKJA 1U0ZA 4L91A 3GIFA 4YKUA 1AM1A 4EEHA 3Q5KA 2YKCA 3R4NA 4EFUA 3OWBA 5D7CA 5D6QA 1TH8A 3A0RA 1TC0A 3D36A 3FT8A 2YECA 3TTZA 2E0AA 3EKOA 5CTXA 5CF0A 3A0TA 2CCTA 3WQ9A 2XJJA 2O1TA 3ZKBA 2BU5A 1YETA 2BU7A 3K98A 3O2FA 3VHCA 2YEJA 3T0ZA 4BQGA 3GIEA 1Z5AA 3QDDA 2AKPA 3SL2A 3MNRP 5M4NA 4HY6A 2PNRA 1YS3A 3B27A 2YEAA 1JM6A 5CPHA 1BYQA 3TZ2A 5M4HA 3HYYA 2XX5A 3U2KA 2YE5A 3B28A 1YT0A 1I58A 2GFDA 1USVA 4GFNA 1HK7A 2VWCA 4LWEA 3RLPA 5F3KA 1H7UA 2JKIA 1USUA 2XHXA 1YC4A 4EGHA 3CRKA 1TILA 3TZ5A 5GGZA 4LPBA 2GQ0A 3CGYA 4HY1A 4H81A 5CTWA 4URLA 1YC1A 4DZYA 1Y8PA 3Q6NA 1UYKA 1NHIA 2WEPA 1YC3A 2C2AA 3OMUA 4YKRA 1EA6A 3ZM7A 3HJCA 2XJGA 3R4OA 1ZXMA 5F5RA 5M4EA 2CH4A 2K5BA 2IOPA 2UWDA 5D7DA 4U7OA 1I5AA 4URMA 4I5SA 4BIZA 2EXLA 2YI5A 2YE7A 2ZDXA 3RLQA 1Y6ZA 4P8OA 4XKOA 5J6AA 4KTNA 1I5CA 4L94A 2Q2EB 4U7NA 4XC0A 4E01A 3R4MA 2BYIA 3G7EA 4ASAA 4CWRA 4K4OA 2WI4A 4E02A 5M4PA 2BYHA 3KE6A 3EHFA 4ZKIA 1YSZA 3TZ0A 2YI6A 4ASBA 2CCUA 3HYZA 3T10A 3A0XA 2FXSA 3CWVA 3HZ1A 4EMVA 1NHJA 2FWYA 5L3JA 4L90A 2WERA 4Q20A 2WEQA 2YEHA 5D7RA 2HKJA 1I5DA 1QYEA 4YKXA 2IWUA 1UYMA 1UYDA 3A0WA 4XIPA 3TUHA 3FT5A 2IWXA 5C93A 4CWOA 3C0EA 2BRCA 4URNA 3JZ3A 2HG1A 1EI1A 4CWTA 1Z59A 2QF6A 2YKIA 2YE8A 4FPPA 2YE9A 1TIDA 3D2RA 4FCPA 4EM7A 3ZXQA 4KQVA 2Q8HA 1UY7A 1MU5A 3EKRA 3EHHA 2XDSA 1AMWA 4FCRA 3O0IA 4GCZA 4YKWA 1ZWHA 4XKKA 3T1KA 4CE1A 2WI6A 1H7SA 2ZKJA 3PRYA 3VADA 1NHHA 4YKZA 2YEGA 1YT2A 2CG9A 3PEHA 2XDLA 4MPEA 4FMTA 4H85A 4XIRA 5CTUA 4HZ0A 1ZXNA 3Q5JA 1BGQA 1UY9A 4MBCA 4B6CA 2YK2A 5FWKA 3T2SA 2XCMA 2YE3A 2YEEA 4LP0A 2QG0A 2BZ5A 2YEBA 1UYGA 4XIQA 3G75A 2WI5A 3K99A 4ASGA 3HHUA 4XE2A 3EHGA 3FV5A 4X9LA 3ZXOA 2IORA 2IWSA 3NMQA 2YE4A 4CWFA 4V26A 2BT0A 4QPKA 3DGEA 3B26A 2Q8GA 2YGFA 4QPJA 3RKZA 1UYIA 2BU8A 1UY6A 3R91A 4O09A 5IDJA 3OW6A 3HZ5A 2YEFA 3T0HA 4WUDA 2FYPA 4L93A 3VHAA 3H80A 4YKQA 1TBWA 4CWQA 1Z5CA 5IDMA 4HYPA 4I3HA 4L8ZA 1AJ6A 4XCLA 1UYLA 4HZ5A 3Q5LA 1THNA 1Y8NA 2VCIA 5FNFA 4HXWA 3D0BA 2BU2A 4CWNA 1I59A 1MX0A 2YKBA 5FNCA 5BOCA 4NH8A 2XJXA 1OSFA 2JJCA 1UYHA 2YE2A 1B63A 4PL9A 1QY8A 4H7QA 2YI0A 1GJVA 4JAUA 4YKTA 4CWSA 1YSRA 4ASFA 3RLRA 3R4PA 4CE2A 1L0OA 3ZKDA 2XK2A 4MOTA 3IEDA 2YE6A 4MB9A 1BXDA 2CGEA 4ZVIA 3TZ4A 2ESAA 1U2OA 4BXIA 2ZDYA 4AS9A 3R92A 3G7BA 1GKZA 2O1VA 2YK9A 1S16A 2GQPA 2IOQA 4NH7A 2VCJA 3Q6MA 3BMYA 3CGZA 4R1FA 3GIGB 4O07A 5FNDA 4BQJA 4B7PA 2QFOA 3CRLA 1GKXA 3VHDA 3U67A 4UROA 1YESA 4MPNA 4JQLA 4MP7A 3PEJA
chains in the Genus database with same CATH superfamily
1CQXA 1UMBA 3B6JA 2GKOA 4FQ5A 4M9SA 1MIOA 3PTZA 5LP1A 4LRUA 3AC0A 3ANXA 3IMEA 2Q07A 4BUZA 1BVYF 4XYMA 1IBLI 3QVGA 3IEMA 1E62A 2ZBFA 1G8FA 3GB9A 4FW3A 5HIAA 4XDMA 1KO7A 4KAFA 1MVLA 4L8VA 3PQ7A 1MRSA 2HO5A 2UU9B 5JEDA 1QCZA 3ZU6A 4B8YA 3VR3D 4DRXA 1NFFA 1O95A 1KMIY 5C7YA 4JY7A 1T6XA 1SIOA 1LC3A 5L3SA 4FEEA 1PNRA 4DUZE 1SPBS 1E6UA 1CF9A 2E6KA 4UUAA 5I7VA 1ZG3A 1RHKA 2I3BA 1FLNA 1ELOA 4FWBA 1J21A 1DEHA 3V8EA 4UVHA 1LPAB 1PEAA 2R7NA 1PJBA 4QTXA 3EVBA 5JEEA 4P54A 2EG5A 2FMFA 3SVLA 1RQ2A 2PZAA 4RH1A 3SQMA 2JT2A 4V03A 2FUNB 1RRMA 2IP1A 3R9KA 3B8HA 3GLLA 1MJHA 2GAOA 3HLTA 4G01B 4MV7A 3L0BA 4RZXA 1KS2A 5CAEA 1OH7A 1E99A 3OPXA 3O83A 5HUQA 5ERXA 3RADC 2DQSA 3U7RA 2BR4A 2WLTA 3M4YA 4NULA 1ZRMA 4ZQFA 1LNZA 2R68A 1CPYA 5KYWB 3RD5A 2WG2A 3TQOA 2X5NA 1IUPA 3ODPA 1ESDA 2HNKA 3UC9A 4C0SA 1GLGA 1ZMRA 3QUTA 4PE5B 5JSHA 3C16C 3RYCB 1ENPA 5AR1A 5P8WA 2G4CA 3QFSA 1NUHA 1YAJA 4BEVA 1P31A 4DBZA 1BMQA 2ATVA 3CEHA 3SJAA 4QM6A 1OBHA 3P19A 3IP3A 3R0VA 2PN1A 1RQNA 4OGLA 3VNQA 1G2PA 5ICSA 1DKPA 2GD6A 3C1TA 3IQEA 3SPXA 2ZRFA 4EPRA 3OO0A 1B0ZA 2VK8A 3QYJA 4R3WA 1GXSB 1H6DA 5I9MA 2QE7A 5EHNA 3CPEA 3M2TA 1QO9A 3ZGYA 5BSVA 2GN9A 3R40A 3P9NA 3INXA 1EFCA 3ICOA 1SQFA 4QARA 1C81A 3P3EA 1T5DX 3HYNA 1H8HA 1V5FA 3PUHA 4F9FA 4EGIA 2GJ4A 5C0XF 4IWNA 4KODA 2ZTHA 4UEQA 3UAGA 3WHLA 2PWAA 3OZXA 2YEIA 2NN6D 1GCIA 3ORQA 3M3DA 5LLDA 2RFLA 3K70D 3DFZA 1VP3A 1SD5A 1W0JA 3H5OA 4A6DA 4LPSA 4MYUA 2ZCVA 1PJLA 2HA4A 3FPLA 5DDIP 1XAJA 4LC9A 5EPEA 1LVHA 4JQCA 4OBBA 3IEUA 1K3UB 3M4XA 3CJQA 4Q9HA 1C0IA 3DKIA 2VZ8A 2OZKA 1R27A 1AN9A 1C30B 2P11A 3EZYA 4GR9A 1Y63A 2YMMA 3RUEA 3VPHA 3INRA 3LUFA 3ZJ5A 4EYGA 5DHAA 1NQTA 2CF6A 1US7A 2PX5A 2ZB2A 3ZY4A 4ZEVA 1M34A 5K8IA 1FFCA 3LLMA 1D7AA 4HH1A 1E7MA 3LKVA 3W6NA 1HNZI 4B7XA 4MIOA 4ZVLA 1KWKA 3IUMA 1HNZB 1I4EB 4A2PA 2V7BA 3SSMA 1KO1A 2XNCA 3BXPA 3BGIA 3DC7A 1IXZA 1J22A 3PT5A 4BQFA 1IPHA 4DBLC 1CUWA 1R6UA 2FPXA 4S12A 1Z7BA 4KU4A 3RIMA 2W2VA 5CBPA 1YUMA 1A4UA 1U8ZA 3GUYA 3BCHA 3RYFB 5DTJA 4GKJI 1XMXA 3KZCA 1H0HA 2A92A 4LJSA 2QP4A 3T7DA 5JRDS 4FSDA 1JKXA 3TOVA 5AK0A 3AX6A 2QRNA 2O2EA 4L16A 4M49A 2KW5A 2YKGA 1W8IA 2PRJA 1PT7A 1WTAA 3B9PA 4NS4A 4DM7A 1U0ZA 3AKZA 5HP4A 3KQWA 1X9HA 2Y1KA 3CF6R 1XDZA 3C98A 4RGVA 1IBME 3CRVA 1RP1A 1X0XA 3JASB 4CKEB 1UBLS 3ZIUA 5C5EA 4TV8F 1HQKA 1NYQA 1H1TA 3F3KA 7AT1A 2QAJA 2XTAA 1NKVA 3DMRA 4K81B 4RACA 3TCNA 5K0TA 1ORIA 1GQYA 3GLVA 3KR2A 5CB4A 3SKYA 3L1UA 4O4LB 2ZVDA 2UUCE 4DUZI 1OWOA 3RRFA 3VTAA 3DSRA 4IV8A 2CJWB 3TAXA 4D9MA 2TRSB 5DK6A 3CRZA 1GWNA 1N5RA 3COWA 3BAFA 4V0QA 4JQOA 1GQQA 4X85A 3KJGA 5CLIA 4ACAA 4BB9A 1IVSA 2PUBA 2FX5A 1FYDA 1M73E 3W0LB 1SUPA 3J7TA 3AL0C 1TQ4A 3WQ9A 3H2HA 5C0XC 5FD8A 2IOHA 4EB3A 3IA7A 4QELA 5IS2A 1G3UA 3SXUA 3M1LA 3A1TA 1YGYA 4RA9A 2V3VA 2A9RA 1K9SA 1P7VA 2VYFA 2XWQA 5I9TA 5YASA 2UXDE 1OYOA 3EAGA 4QDOA 3GZJA 2R79A 1T43A 4P4GA 5A7GA 3MHPA 3G5MA 3ZXXA 5BR8I 3LUDA 5H70A 2IPMA 3TTYA 3HBLA 3O3CA 3GBPA 5K20A 3QDDA 3LLVA 2VFAA 3FUTA 2Y9PB 2EFEB 4UXJA 3UJ7A 2ZYIA 3TB4A 3NBAA 3B27A 2C88A 2ZE6A 3FD8A 5THKA 4U3BA 1XZDA 3G13A 2EFGA 5LNK6 1BYQA 2QJRA 5LMUI 3V97A 3ZX5A 1I6WA 1OZAA 2WZCA 1FLDA 3TSCA 3A6KA 5ITSA 4E5KA 2IFTA 3HWRA 2QRMA 4IYJA 2HZBA 4DV6I 1S3FA 2JGKA 3LI2A 5LZ5A 4FW4A 3V32A 1ONSA 1QKJA 3FFXA 4OO1D 1O89A 1Y3CE 1OAAA 2GA9A 3K0FA 3PQ3A 2AW5A 1CLUA 3VNAA 4A8JB 1PNTA 1VJCA 1TILA 1PL6A 5D01A 4B31A 4YV7A 2I33A 3TXAA 1R6DA 5JC1A 5AW9A 1JGTA 4CGZA 1AKQA 2WUVA 3K5PA 4S04A 3PDUA 3M6IA 3PQ4A 3U4AA 3KOWA 4TWZA 1Z6AA 2Z58A 3MCWA 2WFMA 3G9QA 4HBZA 4I3FA 3S4YA 1EDDA 1ICIA 2F48A 1B7GO 3RAEC 3NKVA 4G4SO 1JAXA 3I8XA 2WQ6A 1DX6A 4CCAA 1JX6A 4FFMA 1NULA 3RPEA 4LV5B 4N3GA 3UBMA 2C77A 3EA0A 2QPAA 9ABPA 4OJTA 1ZXMA 3IERA 1PIWA 1D9ZA 2REBA 3SE7A 2OWDA 3OTQA 1RZVA 4IJVA 3N2NA 1KKHA 2FW8A 2ZAGA 3CZQA 3EXIA 4QOEA 3T7CA 3VPCA 2C4HA 1XRRA 2FP4B 2H31A 4LECA 4AN0A 2ZETA 2PWPA 1ZUWA 3DTTA 2EXLA 3EPKA 1DP4A 2ZDXA 4YT4A 1FFXB 4LN1A 1QBGA 2RAFA 3QENA 4KLCA 4MWBA 4BP3A 5F4ZA 2AJ4A 2A0YA 4ZJPA 2DT8A 1YTUA 1E77A 3BILA 5SY4A 4O8CA 1J2RA 4P4NA 1ENOA 2FTKA 4LF4I 2ZW9A 3AILA 3G7EA 1Q6YA 2ZUSA 1Z2OX 1CWUA 3QVWA 4NESA 2RAVA 4P38A 4YACA 1FA9A 4F1KA 3R24A 3E61A 2C8VA 4H27A 1Z62A 1EP9A 2HPZA 1TF7A 3CY6A 4J49A 2G04A 4LJLA 3KRNA 2JK0A 4B6RA 1SAYA 1ZGGA 2PL5A 3NGMA 2J08A 3DJYA 4RY0A 3QW2A 2FJUA 2ZRMA 2PIAA 2VH5R 4WKGA 4IHAA 1DXOA 1ZK0A 2Q5IA 1EPUA 1NVUQ 1T91A 1ZSVA 5FADA 2CWDA 2ZM6B 1S2LA 3G9XA 1BW9A 4LJAA 1FLVA 4L07A 3V4FA 2ZTUA 4Q3BA 3OT4A 4DPUA 1T5LA 2Z4SA 4ZI7B 4BLOA 4MA5A 4D0RA 4QKQA 1MN6A 1Y5LA 2RI0A 3D43A 4MQEB 3H5AA 2GK4A 3QVKA 4GWLA 4IW3B 5AHWA 4BN0A 3WHPA 4JASB 1JJBA 1VB5A 2X5OA 4TN1A 5A4MS 2YZNA 1Z3IX 4YKXA 4WFKA 1B76A 3KTAA 4GKVA 5ECGC 1W29A 1UYMA 3K8YA 1E3WA 2OHJA 4WXPA 4M1KA 1Z0AA 5EINA 3EE6A 1FUEA 1ACLA 1YDWA 3PBKA 3CH6A 2O3SA 1GCOA 2PANA 4URNA 2V0NA 4GBGA 4O63O 3UGKA 1JNYA 3JZ3A 4K9LA 4NBUA 3CUYA 4OYLA 5F76A 3RUFA 4BNIA 1EI1A 1XBTA 2ID4A 1AE1A 2PXCA 3B6EA 3L7CA 5DNCA 3NHFA 1ZBDA 4QG3A 4LYEA 1E64A 1YR8A 3VYVA 1A5BB 2RIPA 3D5TA 5HRCA 5IU6A 3D6UA 4NXME 1S3IA 2Y3IA 4PNPA 3RROA 3DBHB 2FMTA 1ID1A 5JNSA 1DU4A 1E3JA 4XVRA 5AVRA 1VKOA 3VU0A 1B42A 4EM7A 1JEAA 3I12A 4EMSA 2AW3A 4EYQA 1B43A 1UEIA 4L27A 1VPWA 3BORA 1E60A 4A27A 1CDEA 4M53A 1CJTC 3C3CA 2Q8HA 2DUWA 1NR1A 3B1VA 5KAMA 5T41A 3WK6A 1LV7A 3RNOA 1NT4A 3IVMA 3EGCA 1QP7A 4ZKEA 3HB1A 3C0KA 2I2XB 4IOLA 2BA0D 4JOSA 2C7GA 1KPGA 3T1KA 5A71A 4F5DA 3UT0A 3LVQE 2WI6A 1PF7E 2IZ6A 3P0RA 4PYJA 3ZGOA 3WY9A 3H11B 4ITRC 4ETWA 2GLTA 5JHHB 3PDIA 2JDID 3FWKA 4RSMA 1N1MA 1U3UA 1WCXA 1F9AA 2IV2X 1XRLA 4YJ3B 2BMVA 1E4VA 2Y4NA 4CV1A 4F6RA 5KOJA 1QMPA 4JIGA 1W49A 2QUAA 1K68A 3IRUA 5EQJB 1Y1KE 4LYFA 4BMNA 4UFOA 4B3TI 2BGNA 2PAAA 3FPCA 3G2NA 3B2EA 5AW6A 2M9MA 3Q5JA 3QY9A 3OIFA 1NHGA 1T3TA 3OETA 2QPTA 4UOQA 4EARA 4B4UA 4J8PA 2SCUA 4KLNA 2O8CB 2C2KA 2HF7A 1W44A 1WXXA 2WUFA 3D3QA 3EIQA 1M67A 3T2SA 3R4CA 4WBNF 4E13A 3NBZC 1C8VB 4PYOA 2BZGA 3Q1LA 4OK3A 4YLEA 3DZCA 5JALA 4FWHA 3NM5A 2W22A 4K0KB 1E2LA 5ADVA 4FEAA 1DIOB 2R1TA 4L28A 4GKBA 3EMDA 1DJNA 1JG6A 4WLFA 1PZNA 4XOUA 3V4SA 2J33A 1DAKA 2GH1A 4NXMI 2C1ZA 3FV5A 1LI5A 2DCUA 1XMQI 1U1CA 1Y9EA 2Q1SA 1V3QE 4BNVA 5JXHA 2X5KO 4O3FA 2IWSA 1PZXA 2MTBA 1K8QA 2QSYA 4NENA 4OQ4A 5IKOA 5ABPA 1VBMA 3PDJA 3BK7A 5KNLA 3N9IA 5AI8A 4EUEA 1NI3A 3EC1A 1FRFS 1FS6A 1EYZA 3LM8A 4L6AA 2HV9A 1VCOA 2GZAA 4KQ6A 4CM4A 3RKZA 2Q5LA 2G5PA 4DPWA 3FSEA 2BU8A 4JN6B 5E7IA 3W5HA 5BR1A 4TYPA 4WLUA 2ORED 4F4CA 3GJZA 2VJYA 1KU6A 2JFOA 4HMOA 3VVCA 3T0HA 2DLCX 1MR3F 4TYWA 1OHHD 3NHKA 3TLEA 3D2AA 1CW2B 2AC4A 3IDSA 1L4HA 1WU8A 4JT4A 4NFHA 5DM60 5AOAA 4GZ3A 2ZSEA 2O05A 1HBJA 3R20A 1EXWA 4MO2A 1DWOA 3PUVA 3D1LA 1WVMA 2Z6AA 5FA5A 5E8JA 3VC7A 3CZ4A 3V46A 2D13A 4M0LA 1NPYA 1Y3DE 3IFSA 3LPDA 1D2CA 3M34A 2VJDA 4GOMD 3WGIA 4XVCA 1G17A 1JT9A 2BA1D 1ISFA 2AUTA 2VRCD 3LL4A 2V2VA 2KWIA 2BEWB 4DV5I 4H1HA 4IGEA 4MGKR 1MT0A 1UINA 1VBNA 1ZL2A 4N5MA 3L8GA 3LA6A 3LLUA 1VJGA 4FINA 3RI3A 4QJIA 4CBVA 1QUFA 3MJEA 1DQRA 2JG3A 2QORA 3TB6A 3RREA 5B7NA 4NE7A 3VJLA 4EUSA 2GZ3A 3FOZA 3DAGA 2YMLA 1QY8A 1WZNA 3NWOA 4M0CA 3U4QB 2C84A 1UBFA 3PXXA 4S1VA 2P1RA 4B4VA 2WKSA 4RCVA 5C0XD 4LZZA 5KTNA 1JVNA 5JWHA 4CLDA 3MWLA 3DMHA 4ZHQF 3OAAD 1F8XA 1Z56C 1EESA 5KTRA 1EUCB 2YE6A 3QLJA 1NAHA 1ZU4A 2ZXEA 4BTEA 2IYWA 1CTQA 3D6VA 3WGMA 3GPIA 4GX2A 5EHXA 3FPJA 4F4UA 1PNVA 1GLVA 2BW0A 2VN8A 1W8DA 4F46A 4MEBA 4BXIA 5TLSA 2BGUA 1D07A 1G8MA 1LTKA 3AHCA 4M2LA 1BYUA 2I6GA 1KP3A 3AP2A 3S27A 3LHDA 4YQEA 1CUAA 4F56A 1T13A 4I8DA 5K01A 1SKQA 1BJTA 4DR1I 2IOQA 4MWOA 3SC2A 4P84A 4Y0VA 1XD9A 2JNWA 2D5BA 4U2GA 1BE8A 2VF3A 2WJ3A 4GKAA 4IQ8A 3GPLA 2V9ZA 1I4DD 3WYAA 4C06A 5IC4A 4B6PA 2D0PB 1GUAA 2G7MC 4H6VA 5EIOA 1Z6GA 3HKCA 4IAOA 4MB6A 1TVCA 2IU3A 2X41A 1OE0A 4DMRA 1JB9A 1Y33E 3VHDA 4CGYA 5KTMA 1CJMA 2ATCA 2KQUA 4WKBA 5HTKA 1CDZA 4FHDA 2W6IA 5REQB 3VV2A 1CRLA 1GSAA 3BZUA 1X94A 3LFHA 3P0JA 3BICA 4MP7A 1SBTA 2BGMA 3PDCA 4FLFA 4LJ4A 2BZSA 2C54A 1HR0E 3LOQA 3N0XA 4AG3A 4JI8B 1BKSB 1OC2A 2PK3A 3I01A 3GJXC 1P2DA 4J03A 1KDYA 5DU2A 4EGSA 3GLIB 4Y1RA 3JZIA 3DUWA 1XPOA 2DH5A 1C9EA 4FS8A 2E48A 4HLUC 3U44B 2JE6A 1CQIA 3VPXA 3RC2A 1D6SA 1JIKA 5KYYB 2YGAA 4GT8A 4OX9B 2OD7A 1JAZA 3WKEA 4C0HA 2WP8J 2G67A 3JQ8B 2ZBEA 3M6UA 1U8AA 4B81A 3PD7A 4N4AA 3Q87B 3RYIA 1ST2A 1TZ2A 2VXCA 2YIVX 1OXVA 4RCZA 5EN4A 5I7AA 3VZSA 2FEXA 3T1HB 4UBJA 1OUMA 3A9TA 1NY5A 3DV0B 4XUGB 1YONA 5KSYA 4RBNA 3ILHA 2H00A 2XYPA 4PS0A 4Y7CA 5A2QA 1KYZA 4RK7A 2IUSA 1IOLA 2WTXA 1XN4A 3AONB 3P5BA 3LC2O 1RAIA 2GRJA 3PHHA 1ETHA 4D0NA 3MJDA 5DHRA 3BJEA 1A82A 1VJ0A 1Z5BA 2JFZA 4G67A 3RUHA 1S14A 2NN6C 3ADCA 5AJTA 1ZC3A 2PZJA 4CIDA 4URYR 1PUJA 4EZBA 5BSWA 1UJ2A 1KTIA 1JLLA 3OWXA 4EO9A 5DX0A 1WD5A 5K2OA 4EFDA 2X1HA 4HWKA 3THRA 4QYTA 1I3LA 2CVFA 3CZMA 3ZU4A 4J1TC 3QE9Y 5JFGA 4C05A 3E03A 1EK6A 4ZO8A 3SX0A 1NVDA 2V59A 3WIBA 2C7OA 3IAS6 1Z4NA 3GCXA 3KWJA 4TOIA 4MB2A 4YQZA 4HNUA 2W2XA 1LZLA 2PKWA 1XD2B 3BMXA 3IPXA 1M0EA 1OKKA 2NXEA 1ZITA 5CX1A 4H9GA 4GQTA 2CUZA 1LLFA 3QVTA 5IUKC 4QU5A 5FI1B 5B36A 5D3ZA 2XCTB 2GM9A 2RHOA 2CHGA 1NW4A 3BH7A 4XYGA 4CM6A 2FGJA 5EWMA 1P44A 2QSUA 4D57A 3VA7A 2D4HA 1R9GA 3QT5A 2WB2A 3VH3A 4PLYA 2I22A 1PS8A 2I9KA 4JB2A 1J42A 1OJ4A 2X8JA 5LYJF 4ZYTA 4YX9A 2NOAA 4BAEA 1SG9A 1WE2A 5BODA 2EEPA 3CB2A 4J4TA 4S1OA 4AO8A 5KO2A 5K6AC 2QG6A 1XTKA 2PH5A 4Q1CA 2H29A 2BBTA 2REQB 3LPMA 3ZKWB 2ZRHA 1AQNA 1JR3D 1ZGBA 4IOJA 3FTCA 5B2FA 4AFNA 2HADA 3CF0A 1CE8A 3I2YX 1I80A 1TB4A 4LSWA 3S8MA 1O7JA 3NV9A 2C2MA 3GELA 2IKQA 3CEMA 3ZHOA 4WNYA 3H7AA 3AUTA 4FOPA 4OAQA 2AWNA 2GPTA 4Q00A 3IBCA 4AIMA 4HXEB 5ES4B 2PVCA 2PYDA 6ABPA 3NNSA 5CD9A 3ZLBA 3GG9A 2YWRA 2ISQA 2ZJYA 1GTG1 1Z34A 5CU7A 4C6TA 4DV0B 4XM1A 2PFGA 5HKKA 1VI2A 2ZRAA 4GGMX 4O4IF 5IAEA 2BH2A 4JBXA 2VF2A 2JCGA 2WWHA 4HB0A 3MPOA 2WQZA 1MTOA 4PQGA 4LSZA 1HDRA 4YJ2B 3UH1A 5DNUA 4R0MA 3LF2A 2YMPA 1XTJA 4YAIA 3B5EA 4DIMA 1V3UA 3MUOA 5DISB 2VK1A 4FFOA 3RQIA 4MR7B 5A9SB 3MT0A 1Q2XA 1L7EA 3ESZA 1JHUA 3AWDA 4G9GA 4MPJA 4N01A 5BRNA 5EHGA 1AH8A 5IKEA 2YKEA 2JVIA 2XOEA 1E6MA 3HUEA 3QFTA 1MQSA 3L4SO 1HV8A 1X1RA 3PIIA 2BREA 1MGOA 2NU6A 2PUTA 3HDHA 4BV3A 3KEGA 4BX9A 1AOXA 1KMHB 3GIFA 2F1JA 3BWEA 1YQWA 3HCCA 1TKRA 1JAHA 2B1IA 2XUHA 4OUKX 4RZQA 3UV3A 5JJLA 2QIPA 2Z9BA 4CMKA 1PSZA 3N0RA 1TQHA 4K9MA 5HK8A 4EEHA 2RGRA 1DTWB 3TLGB 3A0UA 3R4NA 4QNKA 3DDSA 5D00A 4DV4E 1N2GA 4HYTA 3SZ3A 1VIYA 4LF7E 1PFVA 2O23A 4URZR 4XPIA 4MDHA 2QTMA 4OX9Y 1NUAA 1ZYUA 1VYTA 1S02A 3NTVA 4V0RA 5K3SA 1ZQ1A 4G0QA 3RAJA 2JRCA 3RHTA 3WRXC 4C14A 4P31A 3P45A 2ZIUB 2I6FA 1QANA 3HXPA 4Q9NA 3BXOA 1XRJA 5EPUA 3HDTA 1TCUA 4IEEA 3HB5X 3TLYA 2VTBB 4LJ6A 4JG4A 3B1YA 3DMTC 2AN3A 1I7PA 2VWPA 4B87A 2AG1A 3LJKA 1KY4A 1ZOOA 5DCYA 1QU2A 3KOXA 2CCTA 4J9VA 2AOTB 4EVIA 4KAJA 3GLIE 1YDGA 2OBLA 5IJ9B 1J07A 2XQFA 2HU5A 3PKJA 4K9QA 4EMBA 2XJJA 1G1AA 5DBIA 3LY5A 2FOIA 6CHYA 3VNSA 5AI9A 4AX4A 3EVZA 4PEVA 4ZDJA 2BBOA 2J8ZA 3NANA 4AIIA 2KLBA 5LIPA 5HUJA 2QS9A 5A7HA 4CM5A 4DBVO 4XDZA 2ZJ7A 5AUNB 1GJRA 2XYVA 3WZLA 2IELA 1H2RS 2GBCA 4F96A 3V2UC 4YYZA 3P2IA 3BEDA 2VNSA 2ZU0C 3BFPA 3FFTA 4YRLA 3ZUPA 4F4JA 4DDKA 3ZBUA 3F0NA 1BQEA 1T2AA 2Q3MA 2E18A 4MS1A 3L0YA 5EKXA 5JR3A 1KQ3A 3G5TA 4IRUB 4WRRA 4DDMA 1MO5A 3TE6A 5D5PA 1PS0A 5GVSA 1RXSA 1ZVMA 1IMOA 2EJVA 2PQ2A 4UFNA 1DINA 3RJ9A 5KINB 2J3MA 4BNWA 1PV4A 3EDQA 1KDOA 4BMVA 2GBFA 4EF5A 3QWIA 5CBKA 2QN7A 2BR2B 1R0CA 5ENVA 5J1SB 5TT1A 4JITA 4MYDA 5C35A 1IXMA 3GFGA 3CRKA 4N54A 3WX0A 2C8KA 2P9HA 2P9CA 1OAOA 3VR0A 1YZUA 4D3ZA 1LDMA 1G8GA 2EERA 4BAUA 3PE3A 3IQWA 1KNXA 5CLFA 2Y0CA 3IH5A 3K7EA 2ZRPA 1JDJA 2I6XA 5ER6A 5H81A 4KN5A 1HE2A 1A1SA 1T4GA 3IQIX 2LPMA 3JALB 2WU8A 3CYFA 4TLDA 3RLFA 1O94A 3TVYA 121PA 3KEFA 5G0SA 4JR0A 2GN1A 1TYAE 1K6JA 4ZIRA 3ZHTA 2QL7A 3ZM7A 1LH0A 2VK4A 1I5RA 2VYND 2YDXA 4EI9A 1AV6A 1SBCA 1Z28A 3FZYA 4N3NA 1W5TA 1L6RA 1H05A 1GRVA 4P34A 1GOTA 2CHUA 2QAGB 3V8QA 4EB6A 1HDYA 3HHPA 1T6ZA 3TH5A 2DQYA 3DAFA 1WS6A 5T4BA 3HVHA 4HUTA 3EASA 2BFWA 3ZCTA 4U6SA 4I5SA 1HT2E 3DCNA 2P4QA 1NQUA 4MS4A 4TMYA 2IU0A 3QXSA 1UPTA 3KZNA 4BE4A 2JIRA 4EP1A 2B7LA 5DTRA 1MVOA 1G98A 1TCBA 4JI6I 5IBQA 4Q01A 3G9ZA 5CVVA 1ZR4A 1JG2A 2AE2A 3I2IA 3A8TA 3RTAA 2YHBA 4DG5A 4LZNA 5HDQA 3NONA 4BVFA 2X42A 4R9SA 4GF5A 1GM5A 4NCXA 3AR6A 2DFDA 1GUFA 1YKGA 3QSGA 3WOHA 2A4KA 2YBEA 3MGGA 5LSAA 5LYJB 2IS4A 3NHUA 1XJ0A 2C4VA 1JI0A 4BLVA 3WAJA 1QE5A 2Z5GA 3EHFA 1CY7A 3F9CA 1L5GB 1QZXA 1B2LA 3C5VA 5DYGA 5IH7A 1EGMB 2B2XA 1ECFA 2BTQB 3AI7A 5JLJA 1P33A 2DETA 2YXNA 3O9VA 5JOQA 3T10A 1ZMTA 4LPKA 3F7TA 4BATA 3P3GA 1CY6A 2CVZA 3WB2A 2H2AA 1U8EA 1Z0UA 1I32A 4R9RA 1U63A 1GITA 2OB2A 3NX4A 3RVNA 1QTQA 5HE9A 1XLTA 1ODSA 2JIPA 1YQGA 1JLKA 3PENA 4Y2SA 4MS1B 5F7ZA 3VSBA 3VV3A 4BCDA 1U7HA 3KK0A 4M21A 5DNXA 1S0UA 4E21A 5IHPA 3KB6A 2IBSA 1OFIA 3JARA 3F3MA 2YY5A 3NRCA 4I4TB 4Q20A 4Q4LA 5EIXA 1SQGA 1ACMA 1PJRA 5F3WB 3EXEA 4D7AA 5IT9Q 1F38A 2BJVA 4CT0A 1OGYA 3QJGA 4HQRA 4IGFA 1ZNXA 1PCXA 2NPFA 1YDFA 3AVQA 3KKNA 3LT2A 3VOAA 1NBHA 4XEUA 1X7YB 4Y67A 4CF3A 5EZYA 1I01A 2IWXA 4NMLA 3FFWA 3WLOA 1VISA 3QLUC 3AG5A 4DCSA 2BTEA 4UD2A 2VT2A 1Z4IA 2EF1A 1ACJA 4GLOA 4K6FA 4QWWA 3FVTA 4XWAA 2HB6A 1DNPA 2Z2IA 1VCMA 4UQLA 2Z4RA 5HM6A 1E2QA 4LHEA 1YR2A 2YE9A 3BK2A 2DLDA 3HRIA 4F04A 4TROA 3OLYA 4XLTA 3ZNNA 1G59A 2HFUA 1M0WA 2BBSA 4D9NA 1W94A 1FMJA 1G1MA 1E2IA 1NMQA 3VYUB 2QYSA 4GI3A 1G6HA 1CSEE 3WISA 4NPAA 2GAJA 2IU6A 1VHWA 3LK6A 5AM5A 1YQQA 1MU5A 3GUHA 4BUCA 4BMSA 2OBXA 2UZ1B 4GCZA 4YKWA 2XKJE 3JQQA 1VFPA 4TL7A 4TWRA 1E3IA 2HSWA 1A9OA 1V1JA 2QBYA 3DDNA 5H59A 3BKXA 5ECYA 4BCCA 1EFAA 1ZIDA 1RREA 3W34A 1GKYA 3A25A 1L5MA 3MQFA 2CNOA 2X9VA 1QG0A 1WXEA 2DBVO 3DXXA 3ESCA 5JZBA 4FMTA 5BV8A 2AD1A 4JT2A 5FBWB 3EF1A 1YZYA 2Z8YA 1QO7A 4ARUA 4DVJA 3BIXA 3D9QX 1L3CA 4MLZA 5HBRA 4MQMA 4J3FA 4X65E 3Q3HA 4K1LA 4F0JA 4B6CA 2F3TA 5EP4A 4EG5A 1GYQA 1ZP6A 3ZOZA 4L72A 3RUPA 3ANLA 13PKA 5FPTA 1RM3A 2C7VA 4G1CA 1F1BA 4C88A 5KS2A 1OXUA 1A7UA 2GYUA 5CTJA 4NDZA 1LSJA 1OX5A 3GJ6A 1K7CA 3PEYA 4X7RA 2C57A 3VAYA 4ONEA 5EC8A 4JGGA 5I9BA 4X9LA 1H8EA 5F51A 3GJ3A 3NP9A 3TSYA 4R81A 3FTEA 1F2VA 2MYNA 1ZONA 2RK3A 3AL2A 2QP3A 3JWHA 4BPRA 3WMFA 4ZVTA 4JI0B 1EDEA 1XMIA 3WLQA 3R9XA 1LPNA 1NYLA 4F84A 2QVYX 1SWVA 1K5DA 5EJGA 4FT4A 2JLCA 3W2FA 3E8XA 4BQSA 3FOEC 1C9YA 1QSGA 2FRDC 4Y6RA 3RKUA 1W48A 2H48A 5IASA 5ITVA 3BZBA 4RC9A 2R7LA 4PICA 5U4QA 4OQPA 1Q21A 5AUPB 4RZHA 4RJJA 1E1KA 3WSVA 1QVWA 4MGIR 2WMYA 4NR0A 1YNOA 2UXCE 4EHNA 4X61A 5B6JA 1OGIA 1SCQA 1HY3A 2ZRBA 3OCVA 2RB5A 3ELYA 3FBTA 3JQPA 3N0VA 5DCLA 5BR4A 1HEUA 3E4DA 3SI7A 3ZD9A 1UDWA 1D2AA 1FX1A 2F67A 2NZ8A 1YWGO 2O7RA 3KUKA 2I80A 4TV9F 3ZWNA 1Z0BA 2FKNA 5FNFA 4HQNA 4ILEA 1PG2A 5AVWA 2QV7A 4DKJA 2GXQA 3FGOA 1FMTA 3FGZA 4FTWA 1OH8A 1M8GA 5HJEA 1GTJ1 4CODB 2HLHA 5IHXA 3C6MA 4BEWA 5B57C 3LBYA 3C3XA 4BMPB 5I7EA 3R3XA 1SKYB 1R0XA 2CKMA 1QV9A 1U0OC 4CHTA 4OHFA 3GDOA 2O8FA 1RACA 3A4TA 1GGKA 2ZJ8A 5C4GB 1RDFA 4LGVA 1NUQA 2CF5A 4NS1A 3Q0EA 3RFUA 1WBDA 3B1XA 4R54A 1NIPA 2ORYA 2EJBA 4Q34A 4JI3B 3HB7A 1GRQA 3QUAA 3E8MA 2JFPA 3OEHA 5AW5A 4B33A 4HNVA 3FRHA 5AQ1A 1UKAA 2YIDA 1TM3E 2Q2WA 4Y9DA 5KVQA 4E08A 2QRGA 1D5CA 2LBPA 2PTGA 2ESAA 2I91A 3GGGA 3LXRA 2GBIA 3HJGA 3CHYA 4L78A 3DO6A 2ZDYA 2F4NA 2JEYA 1BQ3A 2DHEA 1XNRI 4X1IA 4AIRA 4NYMR 5L40A 4IFDD 4U7DA 3SHFA 1SUWA 3HRHA 1PFQA 4V1CA 4KXNA 4R8MA 3QA3E 2G4LA 2F1HA 3QVSA 4YLGA 3IDZA 4RDCA 2Z08A 1D2GA 1UZAA 2Q6LA 621PA 2JH8A 3N39C 2C5EA 3JQAD 4R1FA 5F1YA 4UBIA 3VFDA 3HUFA 4K88A 3KV1A 3MJCA 4ZAXA 2BRUC 3FLAA 1R4NA 4NBLA 4RZIA 5K03A 2BFDA 4WFIA 2DF8A 4TRNA 3M0EA 5T8KA 1SU6A 4AWXA 1UZLA 4WEOA 2C7QA 3HJBA 4CI9A 1CUDA 1MORA 1QHGA 4LVNA 4HI0E 4N8DA 3VDMA 2YHIB 3BRQA 1JKJA 3P27A 4E31A 3GJRA 3MBOA 5E1DA 3BPSA 3HVIA 1BWQA 4IIYA 1KK2A 1E6EA 4JAVA 4TV9B 2IW1A 4LRSB 4UBMA 1YB7A 1MJGM 2LR0A 3WFZA 1E1QD 3JRXA 3M7IA 4FHGA 2CMKA 1JHRA 1YBFA 3Q3JB 4H2DA 4H0FA 5KJFA 1N78A 2QVLA 3QTLA 3I92A 4BBZA 4JAVC 2Q6VA 2ZBPA 2VQSA 4YRFA 3UA3A 3FWYA 1QYDA 2WIKA 3F8SA 1RHYA 1E4OA 1AS0A 1KKLA 2LNDA 1R64A 2AEEA 2G4VA 3DV9A 2JBHA 3NBMA 4ZVNA 4FWDA 4AWPA 3UJ8A 1YQDA 2Q3FA 2B8WA 2WU1A 2A1TR 4KFGA 1FNDA 3R5KA 1S8FA 3EFBA 2W6ID 3AERB 4XCVA 4H7KA 3WKCA 4LW8A 1ZRHA 3UCFA 2NN6E 2WFZA 4JXJA 2C82A 3DO5A 6LDHA 2PLWA 3DMGA 2CV0A 3FAZA 4D81A 4MV9A 1G5HA 3WLLA 2L42A 5U9CA 1RLMA 3D7RA 1QB7A 1PS9A 1N7HA 1REQA 8ABPA 5JEAC 4JC5A 3MWDA 1X7XB 1XYGA 1VL5A 2PX0A 3A4NA 5BNFA 5CFPA 4LOJA 4Q12A 3HB0A 1TEHA 4CE3A 3KD3A 4NATA 3E22A 4LF5E 4R3AA 1SUDA 2YXEA 3B1FA 4FNAA 5FHRA 3UNXA 3CE6A 2R5NA 1W0CA 3P97A 2FCRA 4M6WB 1BHQ1 5B37A 5JSFA 3PX3A 2IVZA 4A03A 3WGGA 4CCSA 3E15A 5BSRA 4HYEA 5LL6R 3RVLA 5KQLA 3KKOA 1A4HA 4KBFA 2ZZNA 4P4SB 1PQ4A 3GJ8A 1DKOA 1OLSA 2YV5A 3BSSA 4TYQA 4FBMA 4V38A 1AD2A 1C0KA 1RLIA 4RK1A 4HYMA 4GYWA 1NTOA 4OUDA 1AJEA 3T3EA 4YKYA 2YS6A 1KJ8A 3ETJA 3HFSA 4HYQA 3W7VA 3WGVA 1PFYA 1ICEA 1VPDA 1B4DA 2PKRA 3JQFA 2BSQA 2P2SA 2BDUA 4B75A 1MAVA 2C1GA 2ZIWB 3AYZB 2WP8A 2EBFX 2I6UA 1E3QA 5HF5A 4GZLA 3TZHA 1OW3B 3KC2A 4DNXA 1UPBA 3TUZC 4A15A 2DMRA 1QDUA 3HB9A 1PUXA 1KZHA 1ZI6A 3KV3O 4R8VA 2W6QA 3QFCA 2NT4A 5AOCA 3M6AA 1SN7A 3E1GA 1XAIA 4FQ7A 3FPKA 2PTHA 4CM4B 3TXXA 4NHOA 1QIFA 1W1WA 2HO4A 2PRKA 1C3LA 1WEKA 2D1YA 1YI0A 2GCOB 3DWFA 4AYTA 4DV4B 3FYUB 1V9LA 3C45A 3FCUB 5ICEA 4UTRA 4IICA 4PX2A 3JQBA 3ECCA 2HJSA 3ANMA 4IQ4A 2JLYA 2PWYA 1HQYE 5E9AA 5AHOA 1KAEA 3ZTWA 4INAA 3H4LA 2G9QA 4KFCA 1KXZA 4ZZ1A 4HGRA 2DPXA 2OCIA 4KE7A 1N2JA 3STXA 5D6OA 6Q21A 3M4ZA 3MRSA 4F8EA 1V0JA 4Y6QA 4F6RB 1JSZA 2Y1WA 3QI7A 2HQOA 1RAFA 2QJWA 3DHEA 5EXDA 1JQDA 1OIWA 4QUJA 4UM8B 5DHPA 3PPYA 1FSPA 4YVFA 4BGEA 1TYBE 4NZPA 1E2DA 1STOA 2H1HA 3PC8C 5KWJA 2VRBA 4TRRA 3O6OA 1V5EA 3AIMA 2W2KB 1YERA 3KZXA 4TWIA 2IWHA 3EUWA 2MSKA 3NYWA 3PPXA 4NCAA 4L02A 2OO3A 1H6CA 2HRRA 3FI0A 3F0TA 1CS4C 4BQRA 1Z6PA 3GPCA 4IG4A 1EG2A 4WA7A 4B7CA 2JHGA 4QT0A 1B1AA 4Y98A 2CVOA 2PPLA 4Z3DA 3KL4A 5A6SA 2XZDA 1VMIA 4DXLA 1GPWB 2P79A 2Y67A 4YASA 1EZ4A 4DR7B 1QRRA 2M6RA 3NATA 4FCVA 2JK1A 2IV7A 4ZAVA 2ZCJA 1VHJA 3Q5KA 4XOIA 3T3HA 4C04A 3RYIB 3PLNA 4LEIA 1HDZA 3G1UA 3LGXA 5D7CA 2A9OA 4RF3A 4P4UA 4RY2A 4OO1E 2WP0A 5DYTA 4C2AA 4YRMA 5KHOC 2KYRA 1OLXA 1IWPB 4Z7YA 3H05A 3VH2A 3GARA 4DS3A 4YRRA 2WWYA 1VP9A 2YECA 1YACA 3PKZA 4UUPA 2PDAA 5B2ZA 4B3SB 3OZWA 3L6CA 5T5QA 4M99A 4L22A 4QBGB 4MK4A 2WJGA 2GLXA 4US2R 1P0PA 4DZRA 5JAHA 3TFQA 1L4EA 3GGSA 2Y0EA 3EKOA 4YMTA 1ZOIA 3T9DA 5HJ5A 2BSXA 1UBUS 1FSGA 5JVDF 4RYLA 4U3JB 4GM4A 3CU5A 1MQAA 4OHRA 4CE6A 4GGOA 1OIVA 3W2EA 2QU8A 1BG6A 1OKKD 3L4EA 4EFKA 3GBSA 3NLLA 2XNHA 1CBUA 5ALDA 1UKZA 2FI1A 3A1DA 4X5OA 5CRIA 2X2OA 1IBLE 1A71A 4YQYA 2OBMA 2HV8A 3WLMA 4AY3A 3GJQA 1I8TA 2ZR9A 2H2GA 2WT8A 2XNDA 3NGXA 3R6LA 3R6GA 2R65A 3SE0A 2O50A 4UDXX 1Z5AA 1BCRA 5F2NA 4KQHA 1MAHA 1BDMA 2X0KA 1W5BA 5HFJA 3FF4A 1DMSA 4Y2UA 5CJJA 1HYQA 5J2UB 1ZH0A 4QYIB 3FUCA 1IJBA 4IL5A 3CX7A 5HOEA 2YS7A 3B20A 5KOHB 2XE8A 3PQFA 3GUZA 4DCUA 1XQ1A 3U2KA 1QP4A 2G72A 5BQPA 3KKKA 3DPSA 4KP7A 3RBXA 2ZRGA 4OQNA 3UHMA 1YV9A 4DL9A 2NAPA 3HEMA 4BFCA 1UM9A 4UVDA 2NN6B 3FGNA 4GLFA 4JI5B 3URKA 1QCDA 2C2OA 3U49A 2R6ZA 1W36C 5IG2A 1FPMA 3AUAA 3EPPA 3Q5GA 2OMEA 1XKQA 2CL5A 5FUXA 2C83A 3OKPA 4YY3E 2VUIB 3VHXA 5A6VA 2KHZA 2W2MA 3EG9B 3WGZA 4IXTA 4U7TB 5FHQA 5JDCC 4JP8A 3MW8A 3TECE 4X6LA 4BNGA 1Y8PA 4RQBA 1CUYA 5JH7A 2EATA 4IS9A 3ROEA 1L1QA 1YC3A 1DS6A 1NJ8A 2X8LA 3F2VA 3HR8A 1D6TA 3WMXA 4BVGA 1RRCA 3FX2A 1P17A 1OFUA 2CDNA 3BSWA 1SIWA 2F8MA 2R6R1 5JDCA 4BXOA 4WY8A 3SKVA 2GEBA 2JLQA 3HUUA 2FR8A 2GAFA 4ND3A 2JL1A 1FKAE 2Z5EA 1OJ7A 1Z38A 4UTOA 3PXGA 3HV2A 1E0JA 1FSZA 1GCAA 5F5RA 2JI7A 3JD0A 4O4HF 4Z9BA 4ZYYA 2RHRA 4GP9A 4N6OA 5TEVA 5JU6A 3IPLA 1P61B 3KYCA 5I8ZA 4KWEA 2BGRA 1QHHB 3TMAA 3AF3A 3W5BA 4IGKA 4LXQA 5I4KA 1Q19A 2B9EA 3FOAA 5CA1B 1U9ZA 2O7SA 2AKYA 1VYVA 1UBGA 3AEXA 3FHCB 2WF7A 3TMYA 4LF9E 4YAEA 1N6PA 4KTNA 2O1XA 1V48A 3MJRA 1HGXA 4CLOB 1XTQA 3PR3A 3RVMA 4OZEA 4TSFA 3E0XA 4Y18A 4Z7QB 1A98A 3R3SA 3NNNA 3H2BA 5JRZA 3WGHA 5BOSB 4ASAA 2BFEA 1EJBA 3D3NA 1ZVVA 1YOVB 3OHPA 4O1MA 3SDZA 3K9LA 3SR4A 4CR6A 4A8JA 1U7OA 1WCYA 1IEVA 2UYGA 2WPDA 2VYNA 4Q02A 1NUTA 3PICA 4IDAA 5G3YA 3RYTC 1YSZA 2E5LI 1ZJYA 3EOBI 2WBLC 3GG2A 3PQDA 4FFVA 3SX2A 2FRDA 2XF2A 3MRXA 2QTCA 2B7CA 2VQ3A 3INNA 3USCS 3TNLA 3J80Q 4RQUA 4GPZA 4N1AA 4EIWA 2QJTA 4EMVA 1JLSA 1HMPA 1P7ZA 2IIPA 2P40A 4PAMA 3SQNA 2FWYA 4CNBA 4CFYA 4RS4A 5CIQA 1ZCJA 3LT4A 2WLSA 2GUWA 1S89A 3KVVA 2HMAA 3NETA 3S2FA 2HRBA 2J65A 2X3UA 5JANA 2XKKA 3A2MA 1Y80A 2OV4A 4I6JA 5KQSA 3T0GA 3HCOA 4NXMB 1VG9B 1I5DA 4ND1A 2O9JA 2CXHA 5JROA 4ZT2A 1ODLA 2WM2A 2O6LA 3DMYA 4ZYUA 1D2RA 4DANA 1V26A 2RGCA 1YC5A 4KWHA 4RA9B 3AYXB 5L3QA 1Z0TA 1H65A 4XXHA 1B0UA 4MUBA 1J6UA 4M3NA 3SYLA 3TW6A 5IULC 1U0RA 2P0EA 1AA9A 1IIRA 2ERYA 2IJGX 3RBZA 4C4RA 3UOWA 5ERGB 4RKRA 3M81A 4PC7A 1UJNA 4YS6A 3WADA 3GN2A 1V8OA 2H8GA 5EJ5A 5TDHA 4RLFA 2YE8A 5FFNA 4ZVSA 3D2RA 4FPPA 4WHMA 1QKIA 2IHJA 2Z3WA 3OZUA 4DYDA 1Z5UA 4QGGA 2FETA 1DIHA 2XZPA 4V0KA 4CQMD 1KMHA 3O6VA 1A9QA 4KQVA 1Y1LA 4GBMA 1DIAA 2WJVA 3R41A 2XCIA 1PGJA 4B3SE 1MG0A 2GSWA 2ZT5A 3ED5A 3R7AA 3F67A 1UY7A 3KPJA 4PYKA 3SN6A 2DHRA 3VOTA 4B7AA 3WU4A 2IY9A 1UXKA 3SHTA 4BFVA 1ZWHA 1SXJE 1WPRA 3PNMA 4BO4A 5CH3A 1HI9A 1IDOA 2WHQA 2YWHA 3FYSA 4X62E 4H3HB 3UPDA 4O25A 5FWYA 2ZS9A 3N2GA 3QOYA 3C8UA 2FH5B 2OCPA 4JBWA 1JB1A 2Q6IA 4WI1A 2OPHA 1QZZA 5DNAA 2ONYA 5IEJA 1HG0A 2WUDA 5I4CA 3RFFA 2GD2A 4PG4A 8MHTA 3V4LA 2R00C 1SHJA 3LGAA 3M85G 1Y8QB 2OGWA 3OMWA 5DCUA 3ICEA 2WINI 1IZ0A 2FLKA 3EXG1 1KPIA 4K6KA 5JQGF 2OGZA 5LUAA 5F98A 1Z37A 3ZIAA 5LUBA 2F43A 2JBAA 2YK2A 4Z1MD 4DR6I 2QP9X 4DR6B 2OGTA 1Z2CA 5IN4A 3UG7A 3CLRC 3EIEA 4PYQA 2Z1DA 1IIBA 3QKUA 4L9SA 1GU0A 4PFJA 2QL6A 2VG8A 4KDRA 3H2KA 1Y3AA 3CUTA 2R8EA 4J9UE 2W6JA 2IGBA 2G9VA 1RHJA 5JH7F 5JZMA 3WGOA 1O0BA 3DFFA 2YQ4A 5T4FA 4FGJA 1TI7A 3TFWA 4V2IA 1DAIA 1Y7HA 3S29A 3NT2A 5EWJA 4W1PA 5SY6A 2Q4BA 3F96A 4LKOA 3B3FA 3GRPA 1ZIPA 1EFUA 4X65I 2XVXA 2C4WA 1E2GA 4CWFA 3M4NA 1N92A 4UMVA 2REOA 3VNRA 1R8XA 2OHIA 3AL3A 4DMKA 3O2NA 2O3UA 5ARBA 1KI7A 5LM3A 1V7PC 3OEED 3MTIA 3R7SA 1PNOA 2X8AA 4BGVA 2IUFA 2UUBE 1JG7A 1UWVA 1SOAA 3I5MA 3KOOA 3ZHRA 5HZMA 4DMCA 1A5ZA 2GK6A 3AVOA 3KQQA 1U0JA 1FU8A 3H19A 3FPFA 5K0NA 1HNWB 4OB8A 3OKFA 3HZ5A 1CUZA 2VAXA 2FYPA 4L5CA 5F64A 2YWJA 2L82A 4DG9A 1U9YA 3LP6A 3WLRA 4MWCA 3BKWA 2EDAA 1L3BA 1RM4A 3CSDA 3DZGA 4MR8A 2JB9A 4LY9A 2DE0X 3QLVC 4CWQA 2NSDA 5PNTA 3GJYA 5IM5A 3S5JA 3SYMA 4DM4A 3AK4A 1Q83A 3A6EA 4Q5IA 5JDIA 1N5OX 1CRPA 5FT9A 1HYGA 2Z1NA 3CV3A 2XGJA 2PNZA 2R42A 1TAQA 3BCRA 1MFZA 2GM5A 3GMSA 3LX6A 2JEAA 3SIRA 1XEXB 4C3VA 1MW8X 3HU1A 2GHTA 2QW1A 2VCIA 3RK0A 1KQGA 2YBDA 4BZZA 5LKAA 3BGVA 4M0UA 3D0BA 5C8YB 4IXDA 2A9QA 3FTPA 3I9MA 3ZNQA 5LU8A 2YNMD 4BB6A 1BD3A 2IZ1A 4CKEA 2BHSA 1EP3B 4EUHA 2G1UA 4RTLA 2H1OA 4REOA 2H0QA 2P9FA 4C5BA 1RLJA 4TTTS 3LNCA 5J4HA 4DILA 5AM2A 4B6FA 2J32A 2PUDA 3BMQA 1HTWA 2PGOA 1AS2A 3DDHA 3FZEA 3Q8XB 5A0FA 2XCSB 4NJMB 5GAJA 3AI2A 4EHBA 2JHFA 2Z2JA 4CE2A 5DPMA 2V7UA 3ZI7A 4EDHA 1QJCA 1TUEA 1VFNA 2AXNA 2ZYHA 2PSHA 4PPQA 3C6XA 5LQSA 4FUTA 3T94A 7GPBA 2AQKA 2CJXA 4JLUA 4F72A 5I48A 4JC4A 3TIIA 5FUBA 4J75A 2NTNA 5K7SA 1E2EA 4MB9A 1XLVA 3EVAA 3EY4A 4GUDA 1V41E 3LZCA 1N32I 2C0PA 1DT3A 1FRZA 1YJAA 3RSQA 3SD7A 3ZY5A 5EZYB 5EMJA 2XV1A 1H0KA 5KNDA 3WZMA 3C41J 2XA2A 3AM5A 3G7BA 1E3WB 1GKZA 2O1VA 2HK9A 3PUIA 3S44A 3EVNA 3L7NA 3DE6X 3L49A 1NXQA 1SVWA 4OMCA 3O8NA 3GD5A 1L5LA 5JTTA 5IT9A 3DKRA 3BMYA 3G79A 3JQDA 3BL8A 1E3DA 5LU9A 4G0NA 3FCCA 4OFZA 3AF6A 1BXGB 5BV1A 3W6ZA 1UKVY 2RHWA 2UAGA 2WJJA 1J49A 3FCXA 3PVCA 4IFEA 3BWXA 1NI5A 5G3ZA 2PQ6A 2HT1A 2UYQA 1UMDB 4UATA 5KNDH 2VCEA 1P1CA 3T0FA 3UWSA 1G66A 5F35A 2P9BA 1QH8A 1DSSG 1LWNA 2VAPA 2VJOA 2K7ZA 3K1JA 4MB0A 1JYSA 2BTQA 1V6CA 3NBKA 4IYRA 1XJCA 2OZEA 1C9DB 2PMFA 2O5VA 2F17A 2XQGA 5GMEA 3N3AC 4KV9A 3VMFA 3HBNA 2YXBA 3DR3A 2NSLA 3GEMA 4LXIA 1MC8A 1PU2A 4IFDA 1DRKA 1XMOB 2X7XA 5KTPA 5AW7A 3V6MA 4L9RA 4I5DA 2O2YA 2BA1G 4Z8YA 5CVEA 5CH5A 3NR2A 5CTYA 1RTTA 3M9WA 5KQRA 1DTSA 3NALA 3FSJX 3RAGA 1WVIA 3M3PA 1Z4QA 3R6TA 5FOQA 3MTBA 4RA6B 3HJHA 3U4IA 4NARA 3WJ2A 2BEVB 3QU9A 1JWLA 3P2YA 1BIFA 1D6JA 2W7TA 1SU8A 4RHXA 5EPOA 1CJBA 3MS4A 3O73A 1N2HA 1NW6A 4LOLA 4BNLA 3DDUA 4PU0A 3EZ6A 4GC5A 4C4SA 3WIVA 1ZN7A 3JAKA 4LOKA 4N47A 3BRWA 3IT0A 1IL0A 1WETA 4FCQA 2H1WA 1GVNB 4YRNA 1O6CA 3AEUA 5JNLA 1R5BA 2VTEA 4I2VA 1TCAA 3HY6A 1BU8A 4KAXA 5BW8A 3PGLA 1ZJWA 5IT9C 2BEWA 1TIBA 1A8PA 1Q6ZA 2HSDA 2JVJA 3AI3A 2V97A 3WLIA 4NJMA 3OX1A 4CLRB 1B23P 3AHJA 1EVZA 3GJSA 1VSUA 3LFUA 4QBIA 2UXDI 4UTNA 5JZOA 1K3FA 4ARIA 1PFKA 1UOEA 1OX4B 3L18A 3IT3A 2CMDA 3O8QB 3WR5A 3MCZA 3NAMA 3QU4A 5EP1A 4FXPA 3BHIA 5F2KA 2CNKA 3O2JA 1JKFA 3RG2A 3F46A 1F06A 1E8MA 1JQAA 2VT6A 1Y4SA 2VA8A 3PGA1 4CIYA 4ABYA 1C30A 4LWGA 2Y2VA 5LOVB 4YC7A 2ZBKB 1B6GA 5E6SB 3KX2A 3OQIB 4ZVMA 1VG8A 4OHCA 4ZKDA 1B8VA 3SXPA 1KERA 3O4GA 4H4DA 2Z8XA 1DHTA 1HT3A 1E8NA 1KJYA 4OP1A 4P3XA 3W8EA 4D97A 3A05A 4JUIA 2UVPA 4ON9A 3RSCA 4A8HA 4B1FA 1YBVA 2VQ6A 3WL3A 1URPA 1FDRA 1GV0A 1H9CA 2IU4A 4JT8A 2W2TA 3AVYA 4TLBA 2Q3BA 2RCNA 1FNSA 4BU0A 3B3QA 1LF0A 3B53X 4B2IA 3D0OA 4TWAA 1GKUB 1LQUA 1Z0SA 1NBOA 2ZUVA 3COPA 4ALIA 4XPZA 2GCNA 3GVHA 5LP6F 1RVV1 1WHTB 4GR4A 4AM8A 2W00A 3GPBA 3KIPA 4BZPA 5BSKA 2QUZA 2W71A 4DLKA 2XDUA 4HCJA 2I8CA 2IEAA 3S40A 3V8BA 3AY0A 3CW8X 4LF6B 3DZBA 5CFMA 3BM9A 3HYLA 5F5LA 4OLFA 4TKUB 4LJRA 2HFKA 4XYBA 2KBEA 1NXSA 1ZK3A 3WLPA 4MEAA 3MMZA 3ZK8A 5FCDA 1Y4UA 4JYZA 1MABA 2XQKA 1S2NA 1QH1B 1U90A 2ZBQA 1ULHA 3I64A 1QKKA 4LWIA 3I2KA 4MAFA 4ZOEA 2HAEA 1YOBA 1DO8A 3JD3A 2QLTA 3S7ZA 2O1WA 1FVXA 2QLLA 2PMEA 4DJFC 4KH1A 3OJWA 4G24A 2X0NA 3EX7C 2ZP1A 4Z9YA 4OFXA 4LY6A 2XTMA 1RQPA 1S5PA 2VHJA 2WSSD 5JJCA 2NGRA 5E6RB 3NAZA 3GRRA 1OQAA 4JVSB 1J5PA 4PLCA 4CLRA 1F51E 1UMCB 3H2GA 3EMVA 1LRKA 2HMTA 3NTLA 3VI4B 1G0OA 1G3RA 2QDXA 2QIOA 2I8LA 4Q1AA 2G36A 3AV3A 4GW3A 2COEA 3CYGA 2YWGA 2YX1A 3L1IA 3L7IA 4FFBA 4GECA 4CU2A 3OU6A 4EQZA 4EI7A 4RVFA 2PNFA 3MGAA 5E38A 2LIPA 3D5EA 3IEIA 2JANA 1PV2A 2P6OA 2FTKE 5LMUE 2UYYA 3U4QA 2RHBA 3HI4A 1AKRA 4RJIA 3D8HA 4JJAA 2MINA 3H5TA 3RVSA 3WICA 1B26A 1H73A 3OUUA 1OYRA 4ZVRA 4DY6A 1U3DA 4BNTA 1PBNA 2PHZA 5EP2A 4X66B 3R5SA 1TH8A 1Y48E 3DE3X 4JBGA 3T4XA 1E3EA 1YT5A 5HS6A 3FT8A 3SQWA 1C1DB 1XTRA 4Y3UA 5A0VA 4OHXA 1FNMA 5D3QA 1X2EA 2BSAA 1OREA 4HRYA 4DMGA 1V1RA 4ZHSA 4FIDA 1E0AA 2W0MA 2FPUA 4PSKA 2QGZA 3B13B 1LC0A 2UKDA 3HSYA 5DBHX 1K63A 1T1IA 3E5NA 4LQDA 3Q1QA 3TKYA 5JYCA 2QRVB 4DXDA 5JY6A 4GLLA 3F2IA 1NOIA 3A0TA 3F3YA 1TC1A 4FU0A 4DRYA 2DR2A 4NENB 1GPAA 2WWRA 3OE1A 4RW0A 5C3UA 1UF9A 2ZRQA 4OL9A 1QZUA 1G16A 5KDLA 3RSLA 1FWLA 1XG5A 2CVHA 4IG9A 1XZIA 3EOZA 3F73A 1PG0A 2HK6A 2BU7A 1J9EA 1RI5A 3K98A 2W2PA 3HA2A 3HU3A 4TV9A 4ARVA 3U56A 2Q3LA 4PLZA 1XMOE 1X1EA 5CDGA 2HQBA 1JKJB 2D74A 3RFCA 4BLRA 3SP1A 3OY7A 5TMDA 1NV8A 2Q6TA 1G6OA 4FP9A 1NBAA 4FYKA 4K26A 3SL2A 1TNDA 3ONFA 1RPAA 2FF7A 2H51A 3AEZA 3E23A 3MB5A 4FD3A 1H5NA 2JIOA 3EIOA 3HUDA 4MVJM 4I4LA 1YS3A 1E79D 2FMHA 3L7ZB 5DGIA 2YRXA 5LBTA 1Z15A 1ZA2A 2AGVA 3GJ0A 3HY3A 5L4NA 3FHTA 1XU7A 1AHPA 4KQXA 2E7ZA 4EGFA 3A3YA 2GTPA 3UA4A 4KTTE 3U7JA 3V1NA 2GB4A 1MV8A 1BFDA 1U5CA 4JZYA 1F2DA 2AXQA 2XT6A 3PXDA 2K6GA 2R60A 3CMCO 4RZSA 2HM7A 2LZ0A 4U3JA 4XJSA 3HXTA 3NVMB 5CGQB 4AK9A 2X77A 5EWMB 1LI4A 3UMMA 4FDTA 1CR0A 4X3CA 1M8KA 4ARBA 1B3RA 4LRYA 4RDHA 2O8CA 1KNQA 2M32A 3G2OA 3KLOA 4PONA 4KPFC 1USUA 2AA3A 1BFKA 2GBLA 3OT1A 3ZDQA 4KRFA 2CK3D 3TZ5A 4R5MA 4EX6A 2D8MA 2I78A 4LJ8A 3U31A 1PSWA 4F92B 4W6ZA 3CGYA 3AR8A 5CTWA 1BXRB 3D6TB 5K3BA 1YJ8A 1S9DA 3LU1A 2JZOA 4FGUA 4XWGA 5DGTA 1I1OA 3S68A 1NE7A 5JSKA 4AQYB 3FUUA 4RPLA 5DV9A 3KM0A 1LLCA 4E11A 4D43A 4RPKA 5B55A 3DCYA 1T29A 2BFFB 4QNJA 4WUTA 5TPWB 4QOFA 4NYMQ 4CKBB 2H6EA 5CAEB 1CG6A 1P0MA 2XIJA 1ZMOA 3FUVA 1M2NA 3RU3A 3ER8A 1WY7A 2KI5A 2GVDC 2HPAA 3CRNA 1Z4JA 4R4JA 4Y2RA 3PSAA 3WA6A 2FSIA 3DT9A 4MP6A 1CQWA 1TLFA 5DCWA 5HQ3A 5GOTA 1IJEA 3VR4H 4BZWA 4BN5A 1GPNA 5DT9A 1CZNA 2X1VA 3B3AA 1Q7GA 1ZZEA 4QHSA 3UWPA 3ORFA 1KE2A 3QBEA 3FHJA 1GO2A 1M2FA 1QP8A 2EL9A 4E5SA 2E3JA 1Y6ZA 3E9CA 4FS3A 2NTYC 2CN1A 2Z8ZA 5J6AA 5F3DA 3ROKA 2VRNA 3TN7A 4QUAA 3DXYA 3HUTA 4N65A 3FN4A 1L5HA 4IHJB 3SY8A 2J5KA 3IO3A 3DOEA 1NF2A 4NPCA 4O4IA 3W3AH 4Z2AA 3W5DA 1DJQA 3OWHA 4GOND 4LS3A 4JEMA 1NMZA 5C32A 1N0HA 2QG9A 3I9JA 1Z5PA 1FRVA 3MF4A 4U9IS 3RVBA 4EVQA 1LPPA 4WNAA 4UAGA 4FFDA 1NW5A 3HEAA 4HX9A 3ZE9A 2BYHA 1JEYB 2VXBA 3NEAA 2B5WA 3AHIA 3KUCA 4EO4A 5CFQA 1RWMA 5JXGA 3TZ0A 2GCOA 4N5NA 4C6HA 1WR8A 2ZT6A 2VDUE 1ZKDA 1W73A 1P6XA 1A8IA 1CUGA 1G8PA 2QW0X 4I1RA 1HE3A 2OHVA 2FXSA 1A9YA 4ENRA 5I7RA 1N3LA 3I6IA 4GI1A 1IM2A 5FIUA 2ZCUA 2VESA 2HLDD 3CNEA 3Q9LA 1DHRA 4MQ4A 2VNKA 5K0GA 4ZYWA 3H5NA 3GZNA 1PL8A 2Z1MA 4U8HA 1X3LA 2A0FA 4DMHA 2BC9A 1ZD9A 4D8VA 2X8JB 5DN6D 1TMGE 1ZOPA 2BR3A 2QLFA 3PL5A 4B3RB 1FMFA 2BELA 3C5CA 4YRZA 3B82A 4EEKA 3ESBA 4XM2A 1HNWE 4XQGA 1KK1A 1UDSA 2IWUA 1XTSA 2P3QA 4UHJA 3LRPA 2PS9A 3A0WA 3JAWB 1U3FA 2QROA 2X19A 4M86A 1OF1A 3DKKA 3L92A 4LG1A 3ITDA 5FUWA 2WPDD 1SUSA 3MBKA 5IVIA 4RTSA 3B1KA 2ETXA 3GR6A 1ZD3A 3OCYA 2VZLA 1RWVA 3BD8A 1VXOA 2OCGA 4RVDA 1G4AE 1KY2A 2C31A 3CZCA 4G5RA 3KZMA 4MVXA 4L5IA 3ILYA 4RORA 2C37A 3CX3A 1M7BA 4RZ3A 4TV8A 2HX1A 3MJTA 3AR9A 5EUBA 2A86A 4KR9A 4E46A 3B78A 3I58A 3VU9A 5C8YA 4OM8A 1NQOA 1ZSYA 4OQEA 3FDZB 5DASA 5BUZA 3PJGA 1IZZA 3VPDA 3H9JA 3LVFO 3E70C 4US1R 4ZV7A 3ZDFA 1WCV1 4Z49A 1HOTA 4OP2A 2ZJ1A 2Q5HA 1DAOA 4I0WB 2G5CA 3LZ6A 1XVTA 2FHSA 2VJAA 1E5QA 3GWGA 3IMCA 5CXQA 3B3GA 5J2TB 3JALA 3EHHA 3O0IA 2E1PA 4Y6PA 2XEDA 4CT5A 3DMFA 1K4KA 4CE1A 1YJBA 3IAXA 3AM1A 5FYDA 4MKIA 5C8DA 2H0RA 3ND5A 3DO8A 1DRUA 3SJCA 5GJVC 1HSZA 2RBGA 1CZOA 2WU0A 3KALA 4MIKA 2FFQA 4L5AA 5AVOA 3RGGA 3VO2A 3HXOA 3DE2X 3EDCA 3VR3A 1QQAA 2OFXA 3IGFA 5L53A 3COVA 4LDRA 1UOOA 1LDBA 2ATXA 2WIAA 3ESQA 1SHLA 4MPEA 1KJNA 2PA0A 3VHRA 5NULA 1NIJA 3K1ZA 4XIRA 4M0EA 1L7PA 2NVUA 1HUQA 3ZZ0A 1E32A 4HRAA 1WUIS 2OZVA 5LJLA 3HWSA 4MBCA 4OHVA 3AB7A 2XBMA 1L4GA 2KE5A 4CQMA 3FIUA 3V1MA 5KYUA 2A1IA 1HNNA 1KAMA 1Z8NA 1P5JA 2XCMA 2UZIR 3VKGA 1JFVA 1UWLA 4C7XA 2CUKA 1PI3A 3OESA 2WICA 4Z4QA 4IXMA 2ORWA 4O02B 1ZQ9A 2QG4A 4DV6E 4L2IA 1LPBB 5B30A 1NVEA 4JJ4A 2YEBA 2CY0A 1Y9AA 3L9XA 4GX5A 3PUWA 3AINA 3ICVA 4MQFA 3RC7A 2HKIA 4R1PA 4BP1A 3LS2A 5DXFA 3D8TA 5DBGA 2JFWA 1DAFA 2YASA 3PQ2A 4Q4AA 4RMGA 1TECE 4Q4CA 5JEAD 4X66I 3JAMC 1R6XA 3IAM1 4GU5A 1IBKE 5JNRA 1RHQA 1WU7A 1I0LA 3RKRA 2O2CA 1RPTA 3L0OA 3LRTA 5LXTB 3A7DA 2ZBGA 3BHNA 5A3SA 1F3LA 2Q8GA 4QVIA 2RGYA 4G0PA 4QQKA 2CDBA 2K4MA 4AP6A 1FDSA 4PG6A 1M54A 1W5SA 4LGYA 4M1WA 5BSGA 1L4YA 5F1PA 3TNDA 3EN0A 4DIKA 3AUYA 5FWNA 3K6SA 1OLUB 2QE7D 4HQFA 4G4SP 1SKBA 1SVLA 2FPLA 2B4TO 3DL7A 3UCXA 5JYBA 2I7DA 3O31A 4ADSG 1C80A 2PFSA 4QO7A 3I9NA 3HN7A 3AEKB 4CM9D 4BLWA 3EUFA 2ZRNA 2VQFB 3V8PA 2FRXA 4RCYA 5IAAA 3IDFA 3D54D 1ZM2A 1OPXA 3LYHA 1DLIA 2AQIA 2JCVA 4FHCA 1AJ6A 1CIPA 4IOKA 2C8JA 2N3ZA 3H9EO 4I4NA 2R48A 3LUGA 4CV2A 4EG3A 2H59A 4PC1A 4QBFA 4DV5B 2ZT7A 4BRUA 2P8SA 1PJCA 1OLOA 4D98A 5K0CA 1QGDA 2X13A 4KXLA 1MX0A 3BSFA 4DMFA 2NZVG 3IVGA 3ILSA 3K8OE 3MQ4A 1PR9A 3QX8A 4PR3A 3S28A 1Z63A 2ZJAA 3OFND 4EB6B 1JQLB 2Q8PA 4CXMA 3S55A 3ZQ4A 5IDQA 2WWFA 3L6UA 3BFVA 1FB5A 4XD7D 5HMLA 5K8VA 4ZCIA 2AFHE 1HDGO 5H3CA 1ZLXA 1QHSA 1YFZA 1C3VA 1AM4D 2I34A 3RLRA 1QC5A 1L8AA 2ILVA 3AW8A 4E7PA 1MX5A 5L3SB 1WXHA 4D02A 1L0OA 1E18A 3A1CA 3QG1A 3CLVA 3RSGA 3OBBA 4WLVA 2C37B 4TV8B 4OX9E 4U02A 1UR5A 1Z7EA 3X0DA 4AJNA 4D0GA 1I7NA 5ADUS 5J58A 4GQUA 2AXPA 2IW3A 5PGMA 2O2SA 1KR2A 4PLHA 5CB4F 4EHKA 1E5XA 2P41A 3ZWBA 1ZEJA 1TQDA 1TGYA 3SZGA 4K9OA 2RGGA 1TO1E 2NYAA 3IHKA 3AVUA 1JECA 4EM6A 3ADOA 3X2EA 3ZHSA 2DLNA 4Z86A 4OI4A 2IESA 5CFLA 4DGQA 1XZ8A 4CG3A 4A36A 2A58A 2QVBA 2AT1A 3K0CC 4J94A 4Q6WA 5CNIA 1W4CA 1I9GA 1V95A 1CY4A 2SICE 3DTYA 2FK7A 3G8DA 1NSTA 1TYZA 4K9PA 4M9CA 3ESDA 4MV6A 3L6DA 5E4FA 3SF8A 3D31A 3LX4A 5AT1A 4EFMA 1AQUA 2CCKA 2CE2X 1NLUA 2WZBA 1GCGA 1P6QA 2G6TA 1JIUA 2AC2A 2HU7A 2NPOA 2QFOA 2HIMA 2Q1WA 1DTEA 3Q88A 1XKLA 4J0JA 4P9NA 2QR2A 5TB5A 5KVCA 2GJAA 2NAFA 3FFAA 2B61A 5FO0A 4MINA 3BN3A 2C00A 4DLTA 1KDTA 4JOQA 4ZZ0A 3KAQA 1NLMA 4TL8A 3J81A 4KE9A 3NS7A 4G1EB 1A69A 1HM5A 1MX3A 1ORDA 1N2CB 4JIMA 4R05A 3WP0A 1KMMA 1GXSA 4TLLB 1A8HA 1NN3A 4TLAA 2CMHA 4ZCMA 2B30A 4ASUD 3GCWA 5C81A 3AKDA 4HNAB 3R3ZA 3BGOS 3FMIA 3AGPA 1RYZA 2R85A 2XD6A 1CY0A 3ENNA 4LJ9A 1A50B 2PZFA 1KSHA 4YA6A 2A2ZA 3Q40A 4II2A 3WO1A 5DP2A 1N7JA 2VQDA 1FQJA 2R25B 4RK5A 3N2KA 4QX6A 4XKJA 3DMPA 1MG5A 3OZRA 3D8BA 4UFPA 3GNQA 1JDBB 2FZLA 2V7QA 2BMAA 4NH0A 3OY2A 4UD6A 3VDQA 1W25A 5JBIA 5DI3B 3OTOI 3QOFA 2QN3A 5EEHA 2YWDA 2GNPA 2I2AA 3T7SA 5MHTA 4K6HA 1R62A 1Z0WA 4GYJA 4C7BA 1SVMA 2G40A 4PHTA 2JLXA 2B9VA 1I2CA 4DUPA 1J8FA 1ODIA 1JTEA 3FWZA 4C0JA 4TTIA 4EJ6A 1K75A 2I2FA 3M6LA 3QIVA 1EB9A 2IPLA 2DULA 2I99A 3KE8A 5CA0B 3HKMA 4HJXA 4QNRA 4G5YA 4OO1A 2RGWA 1YIOA 4TKLA 1GP2A 1XWIA 3B24A 4BJ1A 2PKQP 5B2EA 3LYAA 3O92A 1LJUA 2ZBUA 1TADA 3TNJA 4ZAFA 5IANA 1XNQI 2RI1A 1KO8A 4U7WA 5DGXA 1AKEA 4G9BA 5K3DA 3WL8A 3CF2A 3WHAA 2IYPA 4I1SA 4IMIB 2ZVPX 2NLOA 1F51A 4OV6B 1FP2A 1R88A 2BUAA 1TJNA 4LXXA 4R8SA 7MDHA 2XRFA 1K8ZB 3JVVA 4JLVA 3I39X 3AW9A 4XJVA 1LX6A 4DCNA 1IBKB 5HZGA 4FYWA 4XDGA 1USGA 1OASA 1YU6A 4H7PA 2OLEA 4LRTB 2PVPA 2XX4A 3UQYS 4JASA 5L3QB 2I4LA 2BGJA 1Z07A 3OT5A 4Q7QA 1K7SN 3ACCA 3PWKA 2R9VA 2C2XA 2PBZA 4ENQA 2TSYB 4W63A 4HXZA 1P80A 2V03A 3QTFA 4HNAA 2CLLB 4BVJA 4QAQA 4MVYA 3JRNA 4FYVA 1SELA 2P78A 2IDZA 2JFFA 1P3Y1 1XXHE 5BXQC 2PFKA 2G8LA 5DRTA 4AKEA 2PL3A 4RJKA 5CMLA 4ZI3A 2CHEA 4RXMA 5KEIA 3SQDA 1IH8A 2QJOA 2JFHA 1RPZA 2AZMA 2R66A 3CZ5A 4OAPA 3KHSA 4O33A 4ZYXA 4RV5A 5C0OE 2JJ2D 4X44A 1NNEA 2J0QA 5CDUA 3LTOA 2ABWA 3ZWCA 2XX2A 1N5DA 1QAQA 3AIKA 3GRVA 2WTMA 3ZY6A 1BVHA 1KPHA 1DEXA 3KYDB 3A70A 1A9SA 3OLZA 2FWZA 2X23A 3P5SA 3TJZA 3IQZA 3R7FA 5A03A 4L0DA 1P5FA 4K9SA 1JEQB 4EFLA 2XRZA 1CK4A 3JW8A 2HJVA 5LDHA 3D8SA 1W47A 2OL4A 5EIEA 2QJFA 1QLHA 3HA7A 3CWCA 1XAGA 4JI7I 4MPCA 2O3ZA 1EP2B 3C5EA 1TUIA 4QXOA 3VMMA 5JSZA 1K8XB 2KMLA 2P9GA 3DT8A 2DPLA 3VHQA 5DBEX 5FTNA 4BBJA 4P3YA 1Q15A 1K4MA 1S2DA 1NVTA 1MB9A 2CGFA 5ES3A 5LIRA 1XNRB 2HDHA 4YRGA 1LW7A 4MMZB 1Z0GA 3CRRA 5KOYA 3VU3A 5IDVA 1DXYA 4HMPA 3UF0A 1Z17A 2QRHA 1HC7A 1OBFO 3EXIB 2G1JA 3HYTA 2J5QA 3EGDB 4J6EA 2HLPA 3BZWA 1WP9A 1ZUNA 2JLUA 3I2FA 1PWZA 4C1NA 1I2BA 5AJWA 2A84A 3T15A 1I6KA 4GXRA 1UDXA 4R5HA 4P7GA 3LDAA 1LPSA 3IV7A 3FZQA 4PNZA 4KPYA 4JI1I 3IQHX 1RADA 3RVPA 2VZ0A 4BNDB 2PRYA 1NN0A 1R6TA 1HL3A 4X7MA 1HNZE 3C85A 4N12A 1IBKI 4YBRA 1PX0A 4JD5A 1X3SA 5DHQA 5C5DA 4BNUA 4J16A 2EKQA 1YJCA 4QAJA 5HKBA 1EVYA 3KSDO 1CJCA 3L1KA 1Z0IA 1SULA 1W75A 3CW2A 1AZLA 4E1BA 1HTBA 3PE6A 3DDCA 1JDNA 2YXLA 3O8BA 3Q11A 3Q2OA 2Z3VA 3UMCA 5CBPB 1NYRA 5JAZA 4DUGD 1GT6A 3NYIA 5C0XB 4GE0A 4DEVA 1V1MB 3QJ5A 4CV0A 1ZM4A 1R0BA 1RPNA 2V58A 4L4SA 3EPLA 1TQ8A 5LXTF 3W5SA 2BR2A 1DG1G 1O87A 4ZAGA 1VLMA 5KSZA 1PBTA 2E2WA 4C07A 3EZ9A 3MILA 3IA2A 3UXHA 2JAWA 5D3MA 1HFEL 1RWXA 3EMBA 5F5XA 4DNFA 1R12A 2ZGVA 1P18A 3W5AA 1JL3A 3PHIA 2IDJA 4PLWA 1BEEA 2OFWA 2BBWA 4FR2A 5EQFA 5HGXA 1YO6A 1XRMA 1XOIA 2HSJA 1I36A 3BK1A 4Y9SA 1KZGB 1WRBA 3VHCA 2CWWA 4INOA 3NTRA 3VKUA 3DH0A 3LKBA 1M0SA 3IOMA 3LDHA 1MHTA 1RXUA 3LQ4A 4IDCA 2BM0A 1J0AA 1M2HA 4HNSA 2AFVA 3FLBA 4QUIA 4URHA 4BQNA 3L8ZA 3OC6A 3B9RA 3IMGA 4FMCF 5BPFA 4C7OB 2YJNA 3HKCB 1R4AA 5T4HA 1GAWA 4YR9A 4B2LA 2YC2C 1RABA 3BMNB 5TJHA 5FPQA 3OOEA 1M8PA 3L1VA 4ZANA 2R1UA 3ACBA 3DEYX 1VE1A 3USES 2R96A 5LBUA 2GDJA 3MS7A 3SC2B 3RLPA 3C6QA 2YFKA 4R69A 1C8KA 1DWPA 1QVVA 2GYYA 5HMMA 2XHEA 1W88B 4D4MA 5EJ4A 5KOJB 2SCUB 1RLTA 2HDNB 3CIFA 2CD7A 1WQ4A 4BN4A 2Y0BA 4G0YA 2XWSA 4M98A 2PH3A 3PHJA 5B5SA 2UXBE 1ZJZA 3QU2A 4EHAA 3LTEA 3BULA 3KVRA 4UC0A 4KXWA 1BCSB 4W9NA 4CMIB 2M1ZA 3O8QA 3ZD8A 2OOSA 1Q12A 1VHLA 2UV8A 5E9QA 3F78A 3KVYA 3FNQA 2SNIE 2CNBA 4CL2A 1FXWA 1MQ9A 1UYKA 4RPHA 4U3DA 2BDEA 5DE3A 1UP7A 1R4ZA 1AUPA 2H16A 3CKYA 2Q5CA 1WNFA 2GO7A 3QFHA 3P9IA 1T5HX 1KK3A 4PTZA 2CNWA 4FYXA 5FTWA 1EUDB 1CEEA 1Q1QA 3HJCA 3B85A 3O7WA 4BRSA 1KJ9A 2IYUA 1O3YA 2DWOA 2XJGA 3T1YE 1DADA 2RHTA 1P6UA 3BE8A 3DM9B 1BJKA 3GK3A 2V96A 3GYBA 4KE6A 4AURA 1GG2A 1DBWA 5AKGA 1JQBA 3PRKE 5KDOA 3B6KA 5BN4B 4BGDA 5B53A 4URMA 2OGUA 1A27A 3J81k 1QFSA 4BNJA 2YWCA 4BO8A 1GSHA 4A0SA 1AU9A 5KQPA 1CUSA 4Q48A 1IY1A 3UCEA 4BWFB 1Z0KA 1VCIA 3RSSA 1B8NA 4I9NA 2I65A 3RSFA 2H2HA 3THOA 5LXTA 1J1IA 3T3PB 1V7CA 5IN5A 1UK6A 4KRXA 1WCIB 4J07A 3OTOB 4LBWA 3CX8A 3E9NA 1X6VA 2OXEA 2QQFA 3NCTA 4PHFA 3KETA 3AESB 3GFRA 4RD1A 1NNSA 3JXEA 2OAEA 1UDQA 3L7MA 2YXDA 4LDZA 4HEA1 4HS9A 2RGAA 2IHKA 2AFHA 3L7DA 4ND8B 2R44A 3LBAA 5DF1A 3MWKA 1N36B 4CL8A 5DO9A 4LWZA 3R8CA 1RXVA 1OXBB 1KJJA 2YNMC 3P20A 4QHYA 1F60A 3K3PA 1RM0A 2Y1DA 2FPIB 1KZ6A 2Y6VA 3KUXA 1GTVA 4G5GA 3LSYA 4MQLA 2H1FA 1M1NB 2AVNA 3EJWA 1A5TA 3MB8A 4RXTA 1H23A 3FKSD 1YB1A 4PZPA 5BNWA 5DOZA 5HWSA 1JEYA 1R15A 4RSGA 1BWRA 1Z8DA 2QMUA 1KFEB 1IM8A 4YP1A 1QB8A 2LCIA 5FL7D 2XUFA 1U1DA 5KX5B 2VDNB 1ULZA 4D6YA 1IPFA 1O94C 2EU8A 1KZ7B 2QD5A 4CMGA 3GVPA 2X7HA 2OCLA 3WDLA 1ISHA 2QD3A 1W36B 1GRRA 2BV3A 2HSEA 3ZYCA 3WFJA 4CTKA 1E79A 3F7OA 1YFLA 1IN1A 2OZLA 3VHLB 5BNTA 3CX6A 3FH0A 1JZSA 3D64A 4OTZA 2HCTA