1Y4UA

Conformation rearrangement of heat shock protein 90 upon adp binding
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
489
structure length
472
Chain Sequence
MKGQETRGFQSEVKQLLHLMIHSLYSNKEIFLRELISNASDAADKLRFRALSNPDLYEGDGELRVRVSFDKDKRTLTISDNGVGMTRDEVIDHLGTIAKSGTIGQFGVGFYSAFIVADKVTVRTRAAGEKPENGVFWESAGEGEYTVADITKEDRGTEITLHLREGEDEFLDDWRVRSIISKYSDHIALPVEIEKREEKDGETVISWEKINKAQALWTRNKSEITDEEYKEFYKHIAHDFNDPLTWSHNRVEGKQEYTSLLYIPSQAPWDMWNRDHKHGLKLYVQRVFIMDDAEQFMPNYLRFVRGLIDSSDLPLNVSREILQDSTVTRNLRNALTKRVLQMLEKLAKDDAEKYQTFWQQFGLVLKEGPAEDFANQEAIAKLLRFASTHTDSSAQTVSLEDYVSRMKEGQEKIYYITADSYAAAKSSPHLELLRKKGIEVLLLSDRIDEWMMNYLTEFDGKPFQSVSKVDES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chaperone protein htpG
publication title Structures of the N-terminal and middle domains of E. coli Hsp90 and conformation changes upon ADP binding.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone
total genus 130
structure length 472
sequence length 489
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.80 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1y4uA02
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 1y4uA01
3.40.50.11260 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1y4uA03
3GIGB 1YC4A 2ZBKB 4EFTA 2WI7A 3TZ2A 5GGZA 4EGKA 3A0RA 3LPSA 5CTYA 2QG0A 2XHRA 1UYEA 2XCMA 3R92A 2YEIA 4ASBA 3HJCA 2YECA 2O1VA 2QFOA 1QY8A 4XTJA 1UYIA 2O1WA 4ASFA 3T0HA 3O2FA 4HY6A 2VW5A 2YGFA 1YSRA 1UYKA 4XITA 3K97A 2JJCA 2BU5A 4XIRA 4JQLA 1I59A 4CWFA 3TZ0A 5J6AA 3CWVA 2QG2A 3U2KA 1QYEA 3U67A 3H80A 2WEQA 3CGZA 2UWDA 2YKCA 4GFNA 5CTXA 4KSGA 1R62A 3K60A 3SL2A 2HG1A 1YT1A 2XHTA 4H85A 4CE1A 1TBWA 2YE9A 3FT8A 5IDJA 4CE3A 2CCSA 4B7PA 1UY6A 2YE8A 5IDMA 4FPPA 4LWGA 4HZ5A 4YKQA 3A0ZA 3ZXOA 5M4HA 5F3KA 5D7CA 1UYHA 4BQJA 4MOTA 1Z5CA 1YC1A 5M4PA 4XC0A 2WI1A 4EMVA 4O0BA 4LWIA 4MPEA 4WUBA 1B3QA 1EI1A 4AWQA 4WUCA 4XCLA 1Y8PA 4ZVIA 4BXIA 3EHGA 4L8ZA 4I3HA 1ZXMA 2WERA 4LWEA 2YI6A 2YEFA 2XK2A 3IEDA 3GIGA 1U2OA 4LWHA 2QF6A 3Q5JA 5D7DA 3OMUA 1YETA 2YEHA 1OSFA 4BIZA 4HXWA 4BIUA 2BZ5A 4YKUA 3K98A 3B24A 2XX5A 4HYMA 1Y4SA 2VWCA 5IN9A 2GQPA 1UYCA 1NHJA 2BSMA 2K5BA 2BTZA 1PVGA 4Q20A 2YJWA 1KZNA 5F5RA 2YEDA 3JZ3A 2XDUA 4YKWA 3BMYA 2E0AA 4FCPA 5CTWA 2IORA 4XKKA 2YGEA 2YKJA 1A4HA 2WI3A 4WUDA 4K4OA 3INXA 1EA6A 4GT8A 2ZDXA 1TIDA 2YE3A 4PU9A 2WI4A 2XDXA 3EKRA 1Y8OA 3K99A 1UY7A 4BQGA 4URMA 2XDSA 2O1UA 3R91A 4AWOA 4EM7A 1S16A 4X9LA 4KP4A 4E01A 2GQ0A 3OWBA 4DUHA 4PRXA 5M4NA 1ID0A 4R1FA 2BYIA 4L90A 4O04A 2BREA 3TZ5A 2IWUA 3D0BA 4P8OA 4EGHA 4GQTA 4I5SA 1TC0A 2CCTA 2CGFA 2YI5A 3ZKDA 5FWKA 1AMWA 2ZKJA 3D2RA 3B25A 4H81A 2JKIA 3CGYA 1I58A 2EXLA 2H55A 3HYYA 1BKNA 1UYLA 4O09A 3O0IA 1MU5A 3CRLA 4KSHA 4CWRA 5BODA 1MX0A 4DZYA 3R4OA 2C2AA 4XDMA 3QTFA 5D6QA 1NHIA 1TH8A 3FV5A 2Q8GA 2CGEA 1B63A 3PEHA 4EGIA 4L94A 2H8MA 1I5AA 2YE5A 3C11A 1US7A 5FNFA 2IOPA 3EHJA 3T0ZA 3TZ4A 5CF0A 4YKYA 2CG9A 4KTNA 4PL9A 1GKZA 3B28A 1YSZA 4EFUA 3PRYA 4AS9A 3H4LA 5CPHA 3LNUA 4CWQA 1KIJA 4XIQA 1GKXA 3GIFA 4YKTA 2YEBA 4NH7A 4R3MA 4UROA 5M4KA 2YI7A 2XDKA 2YE7A 2YEEA 4LWFA 2VCIA 2FYPA 1L0OA 3EHFA 3RKZA 1AH6A 2YEJA 1BYQA 2YI0A 1UYGA 4NH9A 2O1TA 1B62A 1H7UA 4YKRA 1USVA 2WI2A 4CWSA 4ASAA 1I5BA 4HY1A 2HCHA 1YC3A 4W7TA 4AWPA 1TC6A 2YE4A 2IOQA 1AM1A 1UYFA 1Z59A 3ZKBA 4MPCA 2YE6A 2IWXA 3G7BA 3RLPA 3VADA 4KQVA 5L3JA 2ESAA 2FWZA 2XABA 4R3AA 3GIEA 1ZWHA 4JAUA 1HK7A 1TILA 2YK9A 5M4MA 2YK2A 3ZM7A 1Z5AA 3HYZA 4HXZA 4H7QA 3ZXQA 2YKEA 3CRKA 2YKIA 3A0YA 2WI6A 3KE6A 1Y6ZA 3OWDA 4E00A 4JAVA 3FT5A 2VCJA 1I5DA 3VHCA 1UY8A 3WQ9A 3U2DA 4EEHA 1UYMA 5M4EA 2BYHA 2PNRA 4JASA 5CTUA 2XJJA 2YKBA 1BGQA 1GJVA 3Q5KA 2BU2A 3HEKA 5D6PA 4BAEA 2HKJA 5FNCA 1Y8NA 3R4MA 4URLA 2GFDA 4YKZA 4XKAA 3T1KA 4XE2A 3DGEA 4GGLA 2YEAA 3QDDA 3MNRP 4B6CA 5BOCA 3Q6MA 4MBCA 3VHDA 3A0WA 3R4NA 3G7EA 4V26A 3HHUA 5FNDA 5C93A 2WI5A 4LP0A 3INWA 2YGAA 1AJ6A 2YJXA 1JM6A 3HZ1A 1BXDA 4XCJA 1QZRA 2ZDYA 3A0TA 1YERA 4GCZA 4MP7A 1U0ZA 3VHAA 4CWOA 2Q2EB 4FMTA 3RLRA 3T10A 4NH8A 2Q8FA 4GEEA 2AKPA 4V25A 2BU6A 2FXSA 3Q5LA 4CWTA 2YEGA 3EHHA 4FCRA 4U7OA 4XD8A 4MB9A 3OPDA 3O6OA 4ASGA 3WHAA 4CE2A 4ZKIA 4QPJA 2XD6A 3T2SA 1Y4UA 2BU8A 1YESA 3G75A 3RLQA 1NHHA 2XJGA 4O05A 4HZ0A 4XKOA 1YT2A 3R4PA 1USUA 1ZW9A 4XIPA 4E02A 4URNA 2CH4A 4U7NA 4KFGA 4QPKA 3HZ5A 4U93A 1I5CA 2CCUA 4O07A 2XHXA 5J71A 4MPNA 3A0XA 4HYPA 4YKXA 1YT0A 3TUHA 2BRCA 3BM9A 4LPBA 4FCQA 1Z5BA 2BT0A 1H7SA 1YS3A 4P7AA 2XDLA 4CWNA 3C0EA 3PEJA 2Q8IA 1S14A 2XX4A 1ZXNA 3Q6NA 5D7RA 2XX2A 1AH8A 4L93A 3TTZA 3OW6A 4L91A 2XJXA 3B27A 3D36A 2BU7A 4CWPA 1THNA 2IWSA 3NMQA 3EKOA 2FWYA 3B26A 4PRVA 2Q8HA 4MP2A 2YE2A 1UYDA 2WEPA 1UY9A
chains in the Genus database with same CATH superfamily
2C38B 3C6BA 4TL8A 4IXNA 2YY7A 4UAVA 2XMRA 3H6HA 2RIPA 1TAGA 3Q8XB 4O1MA 4B3MI 4DMUB 3ZK7A 1ZS9A 1ZNXA 1R3DA 1UP7A 2WJVA 3IV9A 4FYJA 5L4SA 4R5HA 1MQSA 2D1TA 4XE5A 3M1LA 1BXGB 4CV0A 2Z1NA 4DMRA 2X9VA 1ZUNA 1Y8AA 1PZGA 2XVAA 1RVV1 1OAKA 4Q9NA 1AHNA 4AQYI 1SPXA 2QE6A 1QGUA 1EUQA 3ZKWA 2QQEA 2AF3C 3UAOA 1LZLA 1G5HA 4HX5A 1KAOA 3EFOB 1U28A 5KHOC 1Y7LA 2YQ5A 2DPHA 4BNLA 4U3BA 4QSHA 1ML4A 5YASA 1EGMB 2QRNA 4IOKA 1JR2A 4W6QA 4N0DA 3TBKA 4PWYA 2C42A 2W2KA 5HS6A 1OSNA 2Q5OA 3I5UA 4NH4A 3QT8A 1QE0A 4D3ZA 3U9SA 3PQ2A 4Q3CA 3QPBA 1DQZA 3BZUA 4LFCB 1IBMB 5FV4A 2JRLA 4R1UA 1G3IA 3WLEA 3BHMA 3MK31 5FHQA 4LECA 1RWQA 1AUVA 1NV9A 2VSNA 1F0PA 4N54A 3FCYA 2CBGA 1E3QA 4IDGA 2O4CA 1PR9A 4ZHQB 2MHCA 4K8OA 1ISHA 2VPWA 4OQEA 3KQPA 1HA3A 4OX9B 4LGMA 1AMWA 2WMOB 3FCUB 2OBFA 1XJ0A 5F7JA 1P33A 1MZPA 2CFTA 3ZTWA 1XSEA 1CY1A 2AJDA 2BW0A 5T8KC 1A9ZA 3OM8A 2EL7A 2BEWA 4MPTA 2RSLA 3A1CA 3ANTA 3MWDB 5C51B 4B3XA 1V4VA 3I9LA 3ITNA 1IDOA 4X7RA 3FJ1A 2OILA 2WP8A 4P7BA 4IRMA 3PCXA 2AFVA 4QU5A 1NVGA 4J3JA 4RMNA 2V4UA 3IXLA 4K0RA 1V8ZA 4JJ4A 4DSTA 3GD5A 3TQIA 4KHPE 4B6FA 2J0SA 2VZLA 3PYDA 1YD7A 5JECA 5DX1A 5IH3A 3EXHA 1N6HA 3WGQA 3RS2A 4HHEA 5L3JA 3BBLA 1RQ2A 3WA7A 4ZARA 1SG6A 4KWTA 1RYDA 4UTPA 4DV3E 3QXHA 3WJ7A 1VCNA 5EEHA 1YH8A 3ISJA 5KYUA 4C7OB 1FRVA 4ARAA 5BN4B 2CJWB 2C29D 1E20A 2BUAA 2P1DA 1LF5A 4AG5A 4R2MA 3PDUA 4MYSA 1J22A 1DEHA 3TI9A 4IO1A 5TEVA 2K7FA 3I2HA 2E1RA 5A5DA 1KRXA 5K0ZA 4HLQB 1XVAA 4U7OA 2QLTA 1P91A 3VC2A 1XMJA 2ODTX 2OUKA 1QIFA 3RFVA 4LFAI 1BHQ1 2QNRA 1XN4A 3DZBA 4ON9A 1ZM3A 1QQ5A 3CZ9A 2YN2A 5ARDA 4U93A 2Y1LA 2FHPA 1OIXA 5LVAA 2V74B 2G83A 4U0JA 2Q45A 4AO8A 1NT4A 1TT5A 1YL6A 2AJ4A 1H0KA 2W2VA 4LPFA 1CQJA 4IEEA 4USKA 4OJMX 1Y89A 3BM5A 1HM5A 1FS5A 1T15A 1MG5A 4P93A 2W0SA 10MHA 4F21A 1Q20A 1OLUB 4TSFD 3G5MA 5EXPA 2P6OA 3W4IA 4Q9KA 2ZIZA 2POQX 3ZIDA 4L9WA 3E2PA 4ZU1X 2ZYUX 1XRMA 2DUNA 4RA9A 1Z82A 4NJMA 2Q6TA 5IAOA 1WLYA 2E21A 4RH3A 4NONA 4TZ6A 2DMRA 3OZWA 2XMZA 1BE0A 2BEKA 3LVFO 5DSZA 1N3BA 3KYDB 2I8LA 4NP6A 4O8CA 2OD9A 1F2DA 1UWVA 4HZUB 3NV9A 2FQXA 1D0IA 4OO1A 4D81A 4PC3A 1C30A 4AY2A 1A76A 4R83A 3K9HA 1TGYA 2CKMA 4KIUA 2PNMA 2CMFA 3INYA 1P75A 4KPEC 2VWQA 1NPYA 4UQPA 2LV8A 1JYEA 3CLRD 2FSFA 3B3AA 4WL0A 3D6TB 1DC6A 3Q2IA 3EZ2A 5E9QA 1PS9A 2QAGA 3IKTA 2D7DA 4F3RA 3O8LA 5LZ8A 5FI3A 3VR6D 2IGBA 5L3ZA 5BR8E 3AHGA 2X3FA 4X45A 3AOGA 1VCOA 5GWXA 1Y9AA 5CDSA 2YV3A 4HFMA 5J59A 1U94A 3VPCA 2WDZA 3GROA 2FA9A 2PS1A 4UMFA 2Z5VA 4KACA 4FCTA 3A36A 2UKDA 4RDHA 4DLTA 3UH1A 3VR5H 3O3CA 4PN3A 4AXBA 2VRBA 1HF3A 3IHWA 2Q1SA 4DCJA 3PIRA 1XDUA 4LQLA 2ZB4A 4Y0NA 3OTHA 1HYGA 4GX1A 1ZK1A 1JUDA 4QOSA 4YCBA 1HFEL 3L1KA 2Q1YA 5AOVA 3JPWA 1QH8A 3HH8A 5CDFA 5M4NA 3HPQA 4RSGA 2O0LA 4ZT7A 4I9NA 3K15A 5HQ3B 4KTVE 2P4EA 3GMIA 3A1FA 1Y9EA 3OCVA 4W8OA 4EZEA 2PD4A 2QZZA 5SY6A 1XEFA 3VC1A 4R7ZA 3GZNA 5EIOA 2P6UA 3PQDA 1P7YA 1A96A 1PF7E 2DQZA 1B00A 1KI6B 4KRXA 2ZJ7A 3CRNA 5HZMA 3FDXA 2GTIA 1CUHA 4KHZA 1WJGA 3LDAA 3INNA 4LJYA 5DEOA 2O1XA 3FWNA 4V1CA 3MS2A 1JWBB 3I12A 3CH6A 2ECQA 3PC4A 3ED5A 1L3IA 1CUAA 3LPNA 2D6FA 1V16A 1Z6TA 2SKCA 2Q7DA 7GPBA 2PHZA 1NQUA 4HDNA 2G0TA 2BTQA 3EX7C 3IKJA 4UNIA 3SWWA 5ANRB 2WP8J 1NFRA 2VCJA 2ZJ8A 5M4EA 3DMRA 4CFZA 1A1SA 3N5CA 4IDCA 4QPNA 5EJIA 4C6TA 2Z5CA 3C5VA 3TKAA 2CN1A 2Q1UA 3EWAA 2PPLA 2H0RA 1FXUA 5DZSA 2YASA 4KYTA 4AULA 4JR1A 5A04A 3SSNA 1CIVA 2RB4A 1XXEA 5EHNA 2O8BB 2DETA 4Q7QA 1GPWB 5CAEA 5CCDA 4Z99A 2C7PA 1W49A 2ERYA 3JQAA 2FXSA 5AVVA 4QXAA 3T38A 1SVIA 2C2GA 1KZ4A 3PPYA 1YVEI 3H3XA 1JLRA 1I14A 4DLXA 4FJ0A 5FAXA 5G0TA 4DBLC 4RZSA 1XEAA 1XLUA 3V8VA 1ZW9A 1D1PA 1SBYA 5LSAA 2GN8A 3QXJA 2AF4C 1Z4JA 1OXUA 5F1PA 2YS6A 2EJUA 3OLYA 3GJ5A 3DMHA 1UMKA 1G59A 4CIDA 3DLIA 2NM0A 2JEYA 3CHYA 4IR7A 3OLWA 3FVVA 1L4NA 3BGWA 4ZQGA 2V6JA 4NXNI 1LBTA 3N3BC 5KTNA 3EDCA 1P7ZA 4G9GA 4NPAA 3PNSA 3ZGYA 4X5OA 3I04M 4GYKA 2PR2A 3CUYA 4MRVA 3T9EA 4OX9Y 4EPVA 5T3UA 3M6FA 2WAXA 3OG9A 3K0CA 1QH1A 2ZBRA 1TUBB 1ORRA 5JAMA 3IVGA 2NO6A 2II6A 2XD4A 1JDSA 4PSAA 1RLOA 5LMZA 1QYEA 1XMOE 2GBCA 3NO4A 4BO8A 4CR7A 4ARIA 3QF4B 3OMWA 2I62A 2LE0A 2OHGA 3PXAA 4PIPA 1EX6A 3PKJA 2NVUB 3F96A 4PN7A 1V0JA 8ADHA 3BCSA 2I34A 1CUIA 1LRLA 2QHXA 2B82A 2G77B 3CBGA 4HV4A 3GFPA 4EZIA 2ONZA 5BVHA 1X6VA 4NG5A 3KALA 4D9NA 2R8EA 1ZNZA 4DUGD 3A31A 3S6JA 4EKIA 3GHHA 1RHYA 1OYRA 1TIKA 2JD1A 4R2IA 1UP6A 1MJHA 4QG7A 5BP7A 1AQ6A 1L8XA 1E92A 4QUIA 4ZVUA 4FSXA 3WWPA 1EDZA 1GCIA 3HADA 4L78A 3ZGOA 2XDXA 3ZV6A 3LDHA 4L9RA 2ODWA 1UBNA 2JF0A 4MKHA 1UZAA 5WRFA 2YWXA 5B37A 5EIEA 1Y7TA 5EP2A 4I1VA 4K0KE 3JAKB 1VA4A 1BOOA 4Q4LA 3OPYI 1XALA 3QUQA 4YCCA 5AK6A 3ND9A 4QGBA 1Z25A 2QR2A 3RUHA 4UVGA 3PEEA 3ZD6A 4EG1A 1XZJA 1GGJA 5JEAF 5JLJA 1YUNA 3CLVA 4OLJA 1XZPA 5CNJA 4IP0A 5DV9A 1I94E 4O4HB 4IPTA 4C29A 2JFNA 4R8RA 4PG4A 3M70A 4WE3A 2ASEA 3OZFA 3OEED 5LOVF 5A5EA 1W8IA 4RQBA 3NANA 1YQWA 3TUZC 3FF1A 2EW1A 5BSRA 2PTGA 2PGJA 5E1BA 3TINA 4L85A 4EEKA 4G24A 1OT3A 4TQAA 1NA5A 3WGVA 4DLRA 5IT9C 3KSMA 1TO6A 4AWXA 3AOEA 3BGIA 3OTGA 1QNFA 1BX3A 1QP0A 3DO5A 4P9NA 3HUDA 4WW0A 3RAEC 3VJKA 4HYYA 3OAAA 4MVJG 3W04A 1R3UA 3O8DA 5FP0A 4JAUA 1PJ3A 1QYDA 2UYOA 4RW0A 5L95A 3T3NA 3PC2A 4HEJA 4A8PA 3W6ZA 3ORHA 4R51A 1PR0A 2DTEA 4OU5A 1XHKA 1WDKA 2V2ZA 1QHHB 4KR6A 4URLA 2FCAA 2PA0A 3THWA 1L1EA 4GUAA 3RKRA 1ZESA 1XP5A 4RD2A 1RZRA 4LF8I 4D9KA 3QMWA 4TVSA 2AR9A 5JJ5A 2AB0A 1HT3A 1Z0AA 2J1LA 1LQ2A 2AOTA 3HNOA 5CX4A 3STVA 3FPKA 1Z9BA 4D4MA 4D92A 2EW2A 3AVOA 3BSYA 1EIZA 1N32E 2BGIA 4D8WA 1CB7A 1KU0A 1Z0DA 1NVDA 4IW3B 4A1FA 1ACLA 4LWZA 2C03A 4AVYA 4FNAA 4EVSA 4U7NA 5DM1A 3DTVB 3PHJA 3BDAA 1K6MA 3KYIB 1Y81A 3H1BA 2OBNA 1Z6AA 2JEAA 3E6AA 4ASUA 3AW9A 1U0LA 3S4YA 2OY0A 4ZN6A 4FGSA 4LY3A 3VSCA 2QVXX 3K8OE 4YPOA 1SUSA 1YBHA 2JVIA 5DMXA 3TQHA 1CIPA 2WTXA 2BM9A 2F1DA 4I1PA 4D6PA 2J6CA 4QARA 1R6DA 2DKOA 4WLNA 4XQ9A 4L57A 2Z5FA 4WEOA 1IEQA 3GAAA 3H75A 5EVCA 1SELA 2EWVA 1E2PA 5DNWA 3MS7A 5IT9Q 3D7RA 4CV2A 3GHYA 2A4MA 5AW8A 3CTPA 3C7AA 3OJ0A 5LYJA 1C3OB 4ZZ2A 1F9EA 3QE2A 1Q16A 1M1UA 4YRZA 3F3YA 4JI6E 5DI3B 2I2DA 1SG0A 1P44A 1OVGA 2QRPA 3SL2A 3UV3A 2HAEA 1M34A 2YE9A 1T29A 1HNZB 2VJOA 3QENA 4ZVQA 4JYCA 5HQJA 4G2TA 4LZOA 4RNDB 2WNIA 3IQZA 5B3JC 3II6X 4M76B 5K0CA 2KQUA 1ZM9A 4ZAWA 3SF0A 1XU4A 4RABA 4FGUA 4C7XA 3SHOA 4Y18A 2IYOA 3BMNB 4KNWA 3LC2O 4IVPA 1L8OA 5ICEA 3OQBA 2A57A 4P4TA 1M8FA 3EF3A 3A70A 4KJXA 1BGWA 1NVFA 2JKZA 1Z0WA 1UBEA 2Q9UA 3CLKA 2PT9A 1AZTA 2HJRA 3CRQA 2YEHA 4P22A 4HBGA 1BGXT 3SDBA 1SNYA 2XX5A 4YP7A 2WKQA 1V26A 2V1XA 2ZR8A 1DUIA 5AYVA 5AW1A 2CXXA 3R41A 2LKDA 2R7LA 2E6KA 4QC2A 1RWXA 4LX0A 1Y1LA 1NE2A 3A8TA 1V8OA 1LLCA 1Z0UA 1A4HA 1M9NA 2ZDXA 2QPLA 1QQ7A 4JLUA 2BYTA 5FUVA 2AS0A 2IHNA 1B2LA 4CM9D 2TMGA 2VA9A 3KQOA 2NN6F 2GAIA 4E22A 3I9OA 4FW6A 5BN5B 1JZSA 1VKZA 2W2LD 3U3RA 3BRWD 3Q88A 3FMPB 1RM5A 1RYFA 5LBUA 2FW0A 3EVBA 4W5JA 5ELMA 5EHQA 4F46A 1I58A 1ODCA 2Y1CA 2HCRA 1MR3F 1L7MA 3EZLA 1MAAA 1VJGA 1T8TA 5DYYA 2OGTA 2PIDA 3VR3D 5TVKA 1N2JA 1YB7A 2GBFA 4RMGA 2DWUA 1REQB 4IJWA 2IH5A 3VAYA 3AZPA 4OJNA 2ZIFA 4A8HA 3CEPB 3B28A 2I1WA 4G9EA 4BGEA 4E4TA 2P2CA 3BREA 3TIFA 4J0EA 4LWFA 2YDYA 4ZVNA 2F1RA 2QN6A 3G7NA 2VSOA 5DBGA 1X2EA 5ENVA 1Q0TA 1M2GA 2Z95A 2X1HA 2ECOA 2FEOA 3KKNA 3A3PA 2YCBA 1WBJB 2EZ9A 3O3OB 1IG3A 3F4BA 3ICWA 3GLKA 3ZKBA 4F72A 1OD6A 3NLLA 1JEYB 1E2IA 2H1WA 3P0IA 4P54A 1N5MA 4HACB 2YK9A 3KAPA 4J29A 2X5NA 4L16A 2DR2A 2UZ1B 3LF2A 1XZAA 1VI6A 3VDMA 2IPXA 3FBGA 3VXKA 3EPPA 4EHJA 2FSGA 4CG2A 3AVWA 1E60A 4UM9B 1JEQB 3ZWQA 3DC2A 2AEJA 1BDMA 2QTHA 4FE4A 3IEKA 4IO0A 2WJHA 5ALSA 1K7FB 3AFMA 3MIZA 3KD3A 3BRQA 4E12A 3ABRB 2HRBA 1RWWA 1ZXBA 2W0MA 2A0UA 2F64A 3H16A 4GKAA 4LWOA 1V8FA 4K87A 2J45A 2QMUA 3LGAA 3AR4A 2IV7A 1RWKA 2PO1B 1VQ1A 3TKYA 4ZAVA 1LSOA 2XMGA 5KYYB 1I3CA 1I5RA 4EY4A 3WKBA 5F7ZA 3VHLB 1C2YA 5L40A 2NOAA 1Q91A 1WIWA 1D2EA 4I50B 4KPFC 2LZ0A 1PQPA 1SB9A 2CXTA 3HFSA 1F2UA 4J75A 1UC8A 4E02A 4G41A 2CCUA 4IRUB 3O2QB 3HZZA 1X7ZB 1GUDA 2B6NA 3O4FA 1J1UA 3I2JA 5EZSA 1VL8A 1PSZA 2Q6OA 4N48A 2C4UA 4YV1A 4DNQA 1YBMA 3FW1A 1KFCB 1XZMA 5G1PA 2WI7A 5CB4F 2K4MA 1RTKA 5J47A 4DHWA 2I6TA 2E3JA 2WJZB 3O8OA 2Z6QA 4C6SA 3VJMA 1AXRA 4WCFC 1DIRA 2VXOA 3M33A 2WM8A 2HHIA 3D4IA 4HQ6A 4HPJB 3A4NA 4I9FA 4RKRA 3ZWKA 1AQJA 5I8WA 4YT4A 1X39A 4Q34A 1SKMA 3CO5A 2I8AA 1ZW1A 4LVNA 1ZI9A 4UD2A 4Z54A 3C1UA 4OGFA 2EW8A 5AM5A 5A0TA 5IDXA 1QV6A 3Q7EA 4WUBA 2LNDA 2HWYA 1B8NA 1Y8PA 1D6TA 1LLUA 1B6TA 4W9NC 1KJ9A 1A7KA 3G49A 3OOYA 3GFTA 4PANA 5DIZA 3VOTA 3KRTA 4XYMA 2FMHA 4BIZA 1K88A 4QIHA 3K0KA 4BIUA 4F2WA 1W2HA 1ADJA 2FUG1 2GD1O 2WSSA 3ZXXA 4G2NA 4IIUA 3B1FA 2GT1A 2WUGA 2VYCA 1PYDA 4XD7A 1OGYA 4LJ4A 5J23A 1DX4A 1PWEA 3N39C 4BFCA 1DJLA 2NZ8A 1BQ4A 4JB8A 3ESCA 1MTZA 1UDWA 3I28A 1YWGO 4M86A 3NEPX 4MSUA 3SZ3A 5KMGB 4NKRA 2QSUA 3L18A 1GU1A 4IDFA 4COKA 3DZJA 5LLDA 3FG9A 3CXRA 3EIHA 3L4SO 1EAYA 1XZIA 4PCLA 4DRXA 2DAPA 1VIAA 4RE6A 4KG7A 3TZLA 5BWOA 4LS3A 3S70A 2P1RA 3L02A 1NAHA 3MINA 3KL4A 1JFRA 2HBRA 4KUEA 4JROA 4W5RA 4UQOA 4NV3A 1CJTC 1JQAA 1SAYA 5A6SB 5BWLA 5CYFA 5GZ3A 2JIMA 1LD3A 3P27A 1BROA 5IASA 4XLTA 4DPLA 3H9EO 4HS4A 4Z51A 4R8SA 3DBHA 3ELBA 4W7TA 4OHVA 1WOMA 5GMDA 1E2UA 3BGVA 5EHGA 4JT9A 1N2XA 2R2GA 4I81A 2DUUA 5JC8A 1WSWA 2W70A 1E4EA 4JI1B 2BT4A 3A0UA 1E9BA 4FFWA 1EK2A 2OV1A 2HI0A 3VFDA 2GAAA 5TC4A 2GJ9A 1XR3A 5AI4A 2G6TA 1ULAA 5IF9A 3EEBA 3LV8A 1EJBA 2XXBA 3CZCA 1FJGE 1JIIA 4JA2A 5IFLA 1M0EA 2X2EA 3DC7A 4UREA 3E9ZA 3FCCA 3JQQA 5BOCA 2EJTA 3Q7PA 4CNBA 1MJFA 2CUNA 3L82B 1EX9A 1VHTA 1FFWA 4ZMBA 3KZVA 2IZOA 2I22A 4U8GA 1WB5A 1OBOA 1RAEA 3BILA 3IBFA 4KYVA 3ZWDA 4QPZA 4HN2A 1JTVA 4YPVA 1MAWA 1QC5B 5DJ5A 4TTVA 4QPJA 1SC3A 1UK7A 4JXZA 4JZYA 2QYOA 3UM9A 3REFA 1Z88A 1USUA 3EAFA 2XRMA 2HRDA 2ANBA 2GRAA 3SZLA 3K16A 1OYWA 2ATIA 3Q0IA 1YKSA 3HZOA 2WT8A 3BK1A 3LX6A 3GMDA 3IHLA 3TSWA 2UUAI 4LSWA 1AH8A 4RTRA 2FVXA 4UTNA 1ONOA 2AFHE 3NMQA 4I4LA 1OXTA 3F90A 3V42A 3ZHOA 1J2JA 5F33A 1WZIA 2W7TA 3ZU3A 4PC1A 3KQHA 1TFRA 5BQ3A 1SZPA 1WDMA 2NV6A 3DZHA 5JAIA 4JX8A 3WQQA 3V8PA 3PNVA 4DMKA 2FTKA 3KXLA 5FNZA 1H2FA 1DJOA 4KFCA 1HR0I 4S04A 2PQ2A 5ULLA 3ZXUB 2R66A 1QHIA 5K8JB 1N1EA 3GPCA 4W8GA 2HADA 3AUFA 4RXUA 2ZAMA 1WF6A 4TN5A 3MMSA 1H5UA 4JEMA 2WKSA 1Z2OX 2C0PA 3ICEA 2RHMA 5F3KA 2Y1KA 4ZXFA 2QYSA 1U9JA 4C0XA 4DV6B 1YR9A 3W1VA 4A0FA 3A4YA 2QF7A 3NHLA 2R7KA 1HZJA 3MYRA 3JV7A 5L7YA 1NC1A 3IRUA 3C4VA 3KRNA 3LUCA 2DFLA 1XCGB 1KO8A 1NXSA 1YQXA 1KYQA 4WA7A 4PCAA 4FYMA 3BFPA 4NJEA 1PEKE 3PUJA 3DD5A 5BNTA 3AJRA 3EVAA 2FEMA 1O87A 4BQNA 2WQ6A 4QYWA 4MO9A 1Z0CA 3GCWA 4N3GA 4G23A 4E1BA 4XXHA 4OI0A 2DERA 3P96A 1Z6QA 4EM7A 3B7WA 3OD5A 5CA0F 4DR6I 4PLFA 2JIBA 1ZQ1A 3EIXA 4K26A 5HFJA 4BMYA 1ULHA 2BH2A 4EFLA 3HWWA 4Q7JB 3HU2A 1R0YA 1SCQA 3BF7A 5EMNA 4Z4CA 3EBOA 2ZLBA 2J3IA 2EBWA 1ZD1A 1I5EA 3ZD8A 4UAGA 1FB5A 1KQGA 2HRCA 3VDNB 2EKLA 4P3NA 4DV0E 2C5GA 4KXQA 4JY7A 1KSFX 2VPYA 2IGTA 3L4EA 4LF5B 3L7KA 3JAMA 4K9NA 5DT9A 4LGCA 2BUCA 2WJJA 2QLBA 3QU7A 4OREX 4LJSA 2J9XB 5B1DA 3ENZA 1SUDA 3I76A 3N0TA 1H3EA 4Q15A 2Q6VA 1LI4A 1N0WA 1W4BA 3BMOA 5KWVA 1LSSA 1YC2A 4FR5A 5A1TA 5CLGA 2XR1A 2H5JA 1GRNA 2YJ4A 2RGCA 4BGVA 1RDFA 2I6FA 1DQRA 4LXHA 4IGIA 3HCEA 1E79A 2IYEA 1R50A 2B36A 4DR3B 5BVGA 1C7EA 1UH5A 4BO7A 1JAXA 2P6PA 5KIAA 1DAHA 1K0FA 2HYIC 3VHCA 4G4GA 3HFGA 3H1EA 2HO5A 3EEIA 1FRFS 4OHUA 3IYLW 4YC7A 1WZ2A 4XM0A 4UBKA 3A58B 4EG6A 3HR8A 4DV5I 3T7RA 4QTTB 5JPIA 1C3JA 2CXPA 1I0ZA 2Q5FA 4OI2A 1Z6ZA 2W8BA 4B6RA 4G1MB 2F4VB 1TYDE 4DANA 1W7AA 3AX6A 4EF5A 2W22A 4F38A 3V55A 2QQ0A 3K9CA 1F5SA 4AJEA 2OA0A 1NW3A 2VJPA 4WZAE 4US0R 3DE5X 2WAYA 5KVSA 1U6IA 4MR7A 3PHLA 1OGIA 1C1XA 3U4QB 4QLAA 5EMHA 3C24A 3ETHA 5JIBA 1I2BA 1SKAA 2XZPA 4L0MA 5EXEA 2ZJBA 3VHRA 1R00A 3D31A 5ALZA 2FEXA 7REQB 1ENPA 2AN1A 2ZI9A 1ZAKA 3ZWWA 1IZYA 1LPSA 2OQ2A 1P17A 3DKRA 4R1QA 1JS1X 1EHIA 4J3DA 3JW8A 3BJRA 3FPHA 1NMZA 4KO3S 1G8JA 5IBQA 3B12A 4ESHA 5DWQA 2HPHA 3VM6A 5ILQA 3B60A 4HLCA 3BWBA 4E11A 2H4ZA 3KWLA 4D0NA 3A6HA 3KCNA 1XMQE 4DM3A 3WO1A 4N5LA 4X62B 1GR0A 3D6HA 1S8OA 1LK0A 1G9SA 1WHTB 2CLHB 4DDUA 5EKUA 1DAEA 2CE2X 2WP0A 5JNSA 1NQWA 5K3OA 2BU5A 8GPBA 4PY2A 3I2YX 1FP6A 2ZIEA 5JQGF 2GWHA 2HJ9A 2QG9A 4X64B 5LQCA 1HL7A 4LYJA 5JNWA 1YJAA 4BBAA 1CYDA 2GS9A 3DKKA 4XGRA 4B87A 2CYAA 3QT5A 1AB6A 2QZJA 1UDCA 3KQWA 3T35A 3WGZA 3ZHRA 2R42A 3DMGA 3TFWA 3WK9A 1EQUA 1FW8A 1O7JA 2C95A 4R9UC 1J0AA 1EFPB 2WYWA 3CW9A 4RM2A 4BRZA 3RR2A 1SXJB 1EVYA 1OWPA 2WVAA 1A2BA 1X7GA 1M73E 2ZPUA 3CF0A 1KK0A 2H0AA 1QR6A 5BQFA 4BEBA 3KLPX 3GUZA 2X7XA 5K4AA 2MYPA 2QRVB 3TOCA 1WA5A 4JLSA 4XH9B 1YI0A 4F6RB 4FPXA 5LQKA 1YQ9A 3V4VB 5IZCC 5IHXA 4FEEA 4M9SA 2QJRA 2YZ2A 2PCLA 2PVSA 5BURA 1TRHA 2VT3A 3TTUA 3THOA 4CQMD 2R00C 3P0RA 3G2OA 4DXDA 2RC6A 3OPYA 2WICA 4UFOA 5C0XD 3WMXA 4TTPA 1VPTA 5KTRA 4FI3C 4QNKA 4A6DA 3EF1A 5B1HA 1XL1A 2W48A 4DCVA 2PX3A 1Q7TA 4W7IA 2HGSA 1BC5A 4JJ8A 4DOMA 3KTAB 1KAEA 2BFFA 4IXDA 4KB5A 1XUOA 4M98A 2OVBA 1UJ6A 3JALB 4F1KA 3EODA 4XJSA 3IOYA 1QTNA 4HVLA 3BE8A 5JDCC 4MQ4A 3DFKA 4X9XA 1C14A 3LBAA 2A1UB 3PEHA 2ZRFA 4YLYA 2HQRA 1I9GA 3ILSA 5GGXA 2QZ9A 3TZ4A 4CG3A 3AERA 3DZGA 4TXLA 3AL3A 1JR4A 3DHNA 4WNAA 4DQ0A 4NAHA 2XAUA 5I8ZA 1BA2A 2ILTA 5GOTA 1UMCA 1JAHA 2NXJA 3O21A 2DVMA 1S7GA 3S8MA 3MJHA 1CRPA 5GMOA 4V0OA 2REQB 3WSVA 4HDCA 4IX9A 1CSEE 4FE7A 3A04A 5KINB 4M0DA 2VHUA 1ZJZA 3D2BA 1UYFA 1Z59A 4X0EA 3ZU5A 2FPMA 4V0SA 5DYTA 4Y98A 2GS8A 3ZZUA 3TYXA 4OHXA 2Z5GA 4ACAA 3Q9NA 5I7HA 1NOKA 4YDSA 4DSZA 3TH5A 4F71A 5SYNA 1QIIA 1F9AA 3HRHA 2FG6C 4D43A 4ND1A 4YJ3B 3Q41A 3HO6A 1QJCA 1KZGB 4MQYA 1HNWB 2HKJA 2XCUA 2DWOA 5IT4A 3EARA 4DKXA 5JDIC 4W5HA 1U5AA 3G7EA 1Q19A 1DI0A 1A5AB 3PPIA 2OEPA 2EFEB 4GCZA 1XAGA 1ZUWA 1LBHA 3C0KA 1P2VA 1VHDA 2V6IA 2M32A 5I4IA 1VPVA 3DLAA 1GUYA 1P1FA 2A4KA 1QVWA 3OPDA 1WW2A 3A25A 3SSAA 2ZTHA 3V6MA 2VEDA 1QGAA 1QGDA 1AD2A 3T5PA 1IL0A 2HUNA 2QJOA 1HFJA 1JSXA 1N5IA 1U0HC 3N2EA 1E61A 2OHJA 4B8ZA 1VKOA 1ZH4A 3E3OA 3AVVA 3P4YA 4EVRA 2UZ3A 3GAFA 2YTZA 4MUKA 4EY6A 1YO6A 1QIJA 4NATA 1FFCA 4ZP1A 1NKTA 1FK8A 1I9CA 3KJQA 4U7GA 2XRFA 4OHFA 3V2GA 5FWYA 2BU7A 1A2OA 4WLOA 4F12A 2FWYA 4Z9BA 1PJBA 3QOXA 3HXPA 1OZHA 1U7ZA 3TZ2A 1LEHA 5HS4A 3SU8A 4US1R 2JJ1A 3HU5A 2O3ZA 5TPWA 1F17A 2ATXA 4OBEA 1CWUA 1CQXA 3IKVA 1A9OA 4L4ZA 2X0NA 4FQ5A 1HTWA 4RO0A 3PJDA 4NENA 3ASUA 3T3EA 5SV2A 1C9EA 1IVSA 3TZEA 4AJJA 3TE6A 4QDUA 2QNIA 5A0VA 3H80A 3WLFA 5EWJA 2H1VA 4IQ4A 5A5GA 4HO1X 1LBSA 1UBKS 1XEWX 2N1BA 3TRIA 2I2FA 3HKCA 2WSBA 3UBMA 2AV6A 1PE0A 3Q8KA 3BS4A 4Z0PA 3REGA 1PK9A 4LWIA 2VDRB 5GY7A 3FR7A 2PZ8A 4YUZA 3KOUA 4G1VA 4KWEA 3L0SA 4B5KA 4RANA 2TYSB 4GBGA 3EG9B 4AYWA 2K2QB 3V1NA 5JAZA 3IAFA 2QEQA 6ABPA 1U8ZA 4X24A 5EC8A 3QE4A 1LUAA 3E9YA 3WLKX 1RD4A 1Z39A 1J56A 3H1PA 1THTA 5KYVA 4C21A 4G5HA 3D3KA 2UUCI 4J0IA 5IJ0A 4R8MA 4YHBA 3VYWA 2FGKA 5JBNA 4RESA 3LCRA 2I7TA 3OX3A 4A27A 5ELWA 2O14A 2PMFA 4PRXA 2J4DA 4YJHA 2GD2A 1L7VC 1SKYE 4J2OA 1N0HA 2WUVA 3E9QA 3EZYA 4P8OA 1G16A 3KDAA 5AKJA 3K09C 3PHBE 5CYGA 4OIFA 1CNEA 2J0UB 4YCAA 4NU8X 1FZQA 3VOSA 1OU0A 2BR4A 3CN9A 3GY0A 4EO4A 5BYBA 1MBZA 4CTKA 3I61A 4YJ2F 5GMEA 1T8PA 4QREA 4IDPA 1XLVA 1RXVA 5A2QA 3JARB 3QXCA 3DOIA 1NOJA 3U2QA 3H4LA 4ENUA 1H5NA 9ABPA 3B48A 4R1NA 3PUWA 3AI1A 1XD2B 2GRUA 4EMTA 2OGZA 3FDZA 2J85A 1YR2A 4FWHA 1PJRA 3N2KB 4X66E 1F6DA 5EFOA 2CLOB 2H3HA 1L7EA 3GJSA 3R6LA 2VQFE 1KYWA 1H1DA 1UKCA 3SLGA 4C0SA 3SZRA 4WZBA 2I66A 1N33I 3QLUA 4WK0B 4AXXA 1VOTA 5FR2A 1AVTA 1GQ2A 1I36A 1SWWA 4KOAA 3QTTA 1L5NA 2R5FA 1RI1A 4Q6WA 3TVTA 2CXQA 4BKPA 1V6AA 2FFRA 2DJIA 5B2FA 1SCDA 2FW1A 3SGLA 4YROA 4FHFA 3CZQA 1KMHB 4M0UA 3R0QA 3SKXA 3HP7A 2R25B 4BX2A 4RCYA 1ZJYA 1JNXX 4ISCA 5K6TA 3NDIA 5JAUA 4ZICA 1SXQA 2CD7A 1GKUB 4DPXA 1TZKA 3UFXB 4V25A 2GHQA 4UZSA 3GNSA 1VE6A 4CNQA 3TCNA 2Q29A 2QI9F 4N5DA 5JEAA 2GGSA 1E5XA 4MYCA 4QEKA 1K06A 3PNBA 1J06A 1NHGA 4MDFA 3B9QA 2B1IA 1M3SA 5GVRA 5LOVA 4O07A 3WYFA 2TMYA 1T35A 2FRDA 3QT7A 4YJGB 4JQZA 1IK6A 1OH5A 4MUGA 3A9TA 2MMCA 3N8HA 2XDLA 1R4AA 1E2JA 2OORC 3WU5A 5AKEA 1EPUA 4G97A 5IKMA 1MO5A 5IXYA 4M37A 3A4TA 3LBNA 4QXPA 5KJCA 1GXSB 1Y98A 5TB5A 2INGX 3AM1A 3OOJA 4IF4A 4DIFA 3V2UC 1OAOA 2GX6A 4BU1A 1UDQA 5LBTA 2A9JA 2Q7XA 2FFQA 3LP5A 3CC8A 4YUXA 1C4XA 4YMVA 3O7WA 2ZSIA 1ZHHA 4K88A 4OQ4A 4X1OA 4BMXA 4XSHA 1UWCA 4FU0A 1EVJA 4OMUA 1YB6A 4NK5A 4EJSA 3VC7A 5DLQC 2FPGA 1E7SA 1VI5A 5A4DA 3E8XA 3FOZA 2JFHA 1GZSA 4LDRA 2B5OA 2YL2A 2QJFA 2GCIA 2YKCA 5CTXA 3OOEA 3UZUA 3SLKA 1P8JA 2YRXA 3NC1C 4OI4A 4KU4A 3EFBA 2HZBA 4DSOA 4PFSA 2C83A 4GO1A 5HQTA 4ECAA 2HMVA 1P9RA 1ENZA 3CH7A 2Y76A 2IITA 1M6VA 2MWMA 2JI4A 4K3VA 4GPBA 5DWVA 4X65I 3G8DA 5H3LA 4B6PA 1NUQA 2ZM5A 1SIUA 4U4AA 1RZVA 1RFLA 3ZCQA 2XCLA 3T5DA 1O77A 3GLFA 4E09A 2CNDA 1Q12A 3OCYA 4MICA 4MRNA 4PYLA 5LMNI 3K1AB 4MW5A 3HLKA 1EK1A 2X8JB 2KBFA 2W6IA 3LBIA 4KP4A 2LD4A 2R8RA 4YJDA 3I9V1 5CPFA 4B3DA 2ZULA 1N0IA 3V2HA 3PEFA 1BOFA 1E9FA 3KKPA 3GDGA 4YEDA 1BNCA 3HE3A 4P2GA 4IDAA 5IJ9A 2EGHA 4JI3I 1MX0A 3SQNA 3LPLA 4C1BA 3DS8A 1QHGA 2V7QA 2ZE8A 1B63A 4Z5XA 3H4MA 1IXKA 1QOPB 3H2SA 2D62A 1D6NA 2ZTLA 3PHHA 4URFA 5T57A 5JU6A 3QV1A 3QPAA 5EUCA 3RYIB 2HWKA 4X1KB 2RCNA 2ID7A 1DQNA 2AA3A 1K08A 3Q3GE 1U0BB 1KQPA 3FOAA 4YKRA 4KR7A 4Y7DA 1N7JA 4ZCTA 1SPBS 3QYAA 2IA5A 4MLCA 5JJKA 2IWXA 1VJRA 4MUEA 2AN4A 4CIAA 1KS9A 5HMMA 2PSDA 4K1LA 3GLIB 4YB8A 3GPLA 1E98A 1L4KA 3VU3A 3A28A 3S5TA 2JHPA 3KQQA 2IERA 4B40A 3E7DA 4CKCA 4MVJD 2R48A 5KX5B 3VSDA 4H6PA 1RI4A 2E49A 1M2JA 1XAIA 521PA 4ENSA 3MGCA 2YKBA 4OMDA 1Y8RA 4KQCA 1E63A 5C0XE 4HNAB 3T9DA 1M2WA 2JFGA 3NHZA 1MUUA 2OV4A 3T0FA 5ITSA 1Z0TA 2NN6A 4YWJA 1ECCA 4W8HA 1BXDA 5JRJA 4LYEA 2XA9A 4HLNA 3QU9A 2MSLA 1AUPA 3QE3A 3KJHA 3IDFA 4GEEA 7YASA 2ZI4A 1U0OC 5CG2A 3U4IA 4ZQBA 1ZRNA 4U2GA 4GMDA 4AU1A 4D46A 1Z5GA 4JKYA 3HY4A 2NZWA 3LYLA 2Y05A 4X8HA 1E0SA 1L4HA 1JHQA 2EKDA 3JYOA 5KBYA 3LY8A 3AEKB 3QELB 4PZ0A 1MB2A 1ICEA 1VL0A 1Q3KA 3O8QB 1RXWA 3B1YA 2BMWA 1GD1O 4A8JB 4HX2A 4J2HA 2E5WA 4ZEMA 1X1QA 1JEOA 3ZCRA 3FTEA 1G9TA 3C5CA 1KC1A 3DAGA 1UYEA 4MULA 2O1VA 2AN9A 3KJNA 4I55F 2LGJA 1E3JA 3WHIA 2DSTA 3PNYA 2RGNC 4E46A 2PH5A 1ZKMA 4A0GA 2FOIA 4MMXB 1RE0A 3RT7A 2EERA 1JW9B 4D99A 5EJMA 5IJAA 2J6BA 3KT6A 3ZEIA 1WM1A 2BHSA 2F1KA 4YJKA 2UDPA 2XVYA 1JN0A 4TV8F 5JRZA 3NXSA 1JLLB 5IDQA 3GBPA 4W82A 4QQFA 3OT5A 3V7FA 1CE8B 1MW9X 1G7CA 1NMQA 5M04A 4RWEA 2UYGA 4UPVA 3RFTA 3E5RA 4N5NA 4RDXA 5KVCA 4XWWA 4MV7A 4HATA 3R0VA 3HYLA 1VMEA 2R97A 3LYHA 2NTNA 1Q1AA 3CEJA 3CLRC 1LPMA 3BSWA 4P58A 2QF6A 5D7DA 2B1RA 1H2BA 2OMKA 2GXSA 2JGEA 3FUUA 5KYGA 2QGFA 4OB8A 4OUDB 1JDZA 1COZA 2GA8A 1ORIA 2PX0A 4CTMA 1JIVA 4TMVA 3V33A 3WZLA 1QP8A 2A84A 3F7MA 1J09A 4PG8A 2Q3LA 4OH1A 4CUKA 8LDHA 3WIDA 5GADl 2XQFA 4OSOA 2XUZA 4AN0A 4AWOA 4G5QA 1A88A 4H3VA 5AVYA 3B78A 3BF8A 4FM9A 4PONA 5CB4A 4TYYA 1G7RA 3M49A 2FMTA 1E6EA 4ZCLA 1E2KA 3TL2A 1FNBA 4OYLA 3T5AA 3EOAI 4CUJA 2OAGA 3GH1A 4NE7A 2J3KA 2QRMA 1M7BA 5DCYA 3DVQX 3O2JA 1NDQA 1S4QA 3FYSA 5E7QA 2JL1A 4HNUA 4CWRA 1R0RE 1ZDMA 4YRJA 3P2IA 1ZJ5A 1PD1A 5I7SA 3TR6A 3L7IA 2MDTA 2JI6A 4NWIA 3DAHA 3RS5A 3PUXA 3SC2B 4M1ZA 5HZHA 5I7UA 5EIBC 5HKOA 1XXHE 3ETCA 5HKAA 5E8JA 1SRRA 4TKVB 3LX5A 2QMQA 1QQ6A 4DCCA 3TLGB 3FWHA 1ZOOA 4P5DA 1UBTS 5LC1A 3E7XA 1JFTA 3LCJA 4MPPA 3QUSA 1V7PC 1YMUA 4J7AA 4MPCA 1ODTC 5KCZA 1T6YA 1JE1A 3GIEA 1E2DA 3IT2A 2UUBI 1PLLA 3AR5A 4PNPA 1XJCA 1LTHR 3JD4A 4D56A 1FU8A 3GZJA 4ZYYA 2IYZA 4UEQA 3H2KA 4F3KA 4Q3AA 3ZZ0A 3H99A 4C0WA 1CS0A 1BO6A 4GSLA 1GEEA 1YQGA 4H7DA 3LUBA 4D6XA 3HR7A 4NZNA 5MN4A 2YIMA 4HZIA 3FGOA 2DF8A 2ZBUA 4MGZR 3NTRA 4YJFA 2PMKA 1UKBA 4MUAA 4FT2A 2GBIA 4FEGA 5K8LA 4DS3A 1U0ZA 2VNJA 3DEYX 2GCOA 4NS4A 4DYDA 4NDZA 4LJ7A 1UANA 5LFAA 4Z7NB 1GHTA 3E35A 2X14A 1BMDA 1UEKA 3V97A 1PVOA 2WTMA 4LHSA 3IIEA 1IBCA 4BMPB 1V43A 3EWNA 1YRYE 4AP5A 1OROA 3HKDB 2HHHB 3X1MA 3U19A 2B7CA 2JCYA 2JARA 2H48A 1U4OA 4RGBA 4YRGA 1RWPA 4BKOA 3TX6A 2QTVA 3DQZA 3ZLJA 3P0JA 4PU0A 3HL0A 3EXIB 2YVQA 2WIJA 4KXVA 2Y1XA 5AHRA 4II2A 5CK5A 1NQTA 1O54A 5E95A 3QBDA 2KLBA 3CT6A 2VYND 1NVTA 1TQ8A 2GO7A 2IESA 3D6FA 1J5XA 1W52X 2ZSJA 5A1JA 2NYRA 3VSBA 1QLJA 2P4QA 3BJMA 2W6OA 4EJ0A 4EI2A 2GERA 4DR7E 2QZ4A 4TM7A 1YZTA 3C3JA 2BJVA 1KDYA 5LCXA 5D5PA 5KNBA 2M6KA 4L2IB 1ZYUA 2B2CA 1SQGA 1TBWA 2WZQA 4HDSB 3VU9A 1SVUA 3W5VA 2YVUA 4OY3A 2JK1A 4UAUA 1WWKA 4LMRA 4EFMA 1XQ1A 3BWXA 2A0FA 4WAUA 3PSHA 5MF6A 2W42A 1EWVA 1KL7A 4MQUA 3UQYS 1XF9A 5IEBA 3WRXA 4F4DA 4EW3A 5K36D 1WW8A 5GZ1A 1JP7A 3NKLA 1N34E 1ZO8A 1QWSA 4UDOA 1V5GA 3C3XA 1UXGA 5FWAA 4WVLA 1P2UA 4A82A 4FHDA 4FR2A 4DF3A 1SCUB 1SKQA 1CY6A 3EMBA 2YHSA 4GKJE 3B2QA 3X1ZA 1WOYA 4DV1E 4DCGA 2C2BA 5D00A 3ENNA 2ZRLA 3MQ4A 4FCWA 2K5BA 4JI8B 4N49A 5BWBA 3ICOA 2WHEA 4FCPA 1ZH8A 5FLKA 1OY1A 3A7DA 3WGLA 3ZH9B 3URKA 3NIWA 2BFMA 3P9NA 4C5AA 1SVSA 4AURA 5F1KA 3K99A 4MNTA 4MXDA 5GQSA 3NHKA 1Z0JA 4GZ5A 3I5MA 1CUDA 4CM3A 2QAIA 2ZJ0A 5JAPA 4G09A 5H83A 4EDHA 3HU1A 4GI5A 3H8SA 5AJZA 3Q3IA 3ZDYB 3PFCA 4DEVA 1T1EA 4RZ2A 1CULC 4YIKA 5P8WA 1DB3A 4N0EA 2LW7A 2Z8YA 3NHRA 2HF9A 4EFDA 1YQQA 3DVLA 3VYTB 3Q0TA 4FOLA 1A1VA 4W1RA 2AG8A 2CGEA 4AJOA 5B4VA 3JRNA 3H9QA 2M9MA 4ZA2A 1Q7CA 4JBHA 4Z7QB 3O2SB 1V45E 3I8OA 4Q9LA 4OFXA 1P4JA 1SBHA 2VIIA 2CG9A 3QVUA 3VAAA 4L8WB 5K6AC 3SAJA 3P9QA 3HN7A 3JQDA 2ZAYA 4LTMA 1ZGCA 5CNMA 1FFEA 4DE5A 1HKHA 1CJMA 1XTJA 4N3BA 2PMCA 4CM1A 4GPAA 1PBTA 4N9WA 3MTDA 3IUYA 3M85G 2V7VA 4PAMA 1D0SA 4M1WA 3AVPA 4YTEA 3KSZO 4AQDA 1KJ8A 4L5CA 4YI3A 3T4UA 3GLHA 4HCJA 3STHA 4BTLA 3SPXA 3ZM7A 1XK6A 2DH5A 4GX5A 4ZK6A 5IDYA 1A97A 2P6NA 5IZ4A 1FP7A 4LRQA 5KNCA 1U3TA 4H4CA 3ECCA 3BD8A 1TQHA 1U3FA 3AJDA 3KJEA 8ATCA 3NBQA 3W3AH 5HIIA 1XZBA 3CZRA 4UVEA 3WLTA 4RDIA 3R40A 2HKEA 1K8QA 3BWVA 4I5IA 1QTIA 4NCNA 5CA0A 1FUUA 1PTJA 2HTEA 4TTAA 2ZDYA 5DBHX 1YDGA 5EYPA 3OF3A 2Q2EB 2YDXA 3U6KA 4GMHA 5AXBA 4JJ7A 3MAJA 1KSHA 4WFIA 3SDSA 1LF0A 2HA3A 3PR2B 2OPHA 5CFLA 4Q48A 3O93A 1WU7A 1DC5A 2RHBA 1Q1ZA 4UCWA 1YRAA 5DGTA 2YY6A 5EL0A 1H8HA 2GPTA 1Z45A 1FJ2A 2ZIUB 3KSUA 1MEOA 4FZJA 2X2FA 4K6MA 3MBKA 1E2MA 1V4NA 1SC9A 4I4TF 4D8XA 5KPJA 3A0XA 5JTUA 5IN4A 1JHYA 4GGOA 2BKLA 1H42A 2VCYA 1Q0HA 2I2CA 4L22A 5K2OA 1W96A 4CMAA 4BVAA 1MB4A 3OQIA 4B3SI 3GLRA 2R44A 2IX3A 5BRNA 3B26A 4KITB 4WUVA 4AT1A 4BC0A 1LPPA 4AFNA 1E3IA 2Q5EA 1G1AA 4IYJA 4QDZA 2QDXA 3F1KA 4MVJE 3WC4A 3D3NA 4NZZA 3OEHA 2WYHA 4FC7A 1GDDA 4EF6A 3B3JA 2GF9A 3LQ1A 5I4KA 2OM2A 1IPHA 3NEAA 16PKA 1BMTA 1YASA 2H52A 5BR1A 1Y5RA 3B85A 3LXUX 2H8KA 3ACDA 3ZBPA 4WSOA 4J1TC 4BU0A 1ZU4A 3M4YA 3ME5A 4LCEA 1JEJA 4QPDA 4LQ4A 5IARA 2CW5A 2FW6A 2VXCA 2WVJA 4A36A 1F14A 1BCRA 4WWHA 1RKXA 1PI3A 1SCKA 4DR1E 3BL8A 1D03A 3HB9A 4PZ9A 4HTFB 4L8FA 4M8NE 2EFYA 1ES9A 1XRJA 2WWTA 1JIXA 5TARA 2JGJA 2BHRA 3R4VA 3VHQA 2X58A 4UASA 1YMQA 5HK9A 2XH8A 3B8HA 4HN9A 3JQ7A 4OAQA 2HSZA 3KB1A 4I66A 3FWPA 1I2DA 4YV2A 2VQSA 1WP4A 5CHEA 5M7EA 3GFQA 4HAWA 3G9ZA 2WPDA 3VO8A 1RKBA 4HF7A 1Z74A 3WB0A 3G0OA 5EJ7A 3U7FB 5DBOA 2JAXA 1G64A 3OHPA 3N2NA 1W4LA 1KF0A 4DG5A 3WGJA 5B57C 4D4HA 2NO9A 3ZCUA 2AC4A 4JC4A 1ILWA 1PT8A 3O83A 1QRTA 3DR3A 1E1QA 1KVSA 4R1FA 5BUSA 2J67A 2IWUA 2G17A 1R5BA 5C32A 1QO7A 4B4UA 3ZWMA 4GVXA 4YALA 1GTSA 4NU0A 3OZ7A 2ZKLA 1RQNA 1XWFA 3QVGA 2ZZNA 3IDOA 1POXA 3FV5A 5JQGA 3CWCA 2IYPA 4H1HA 1JQKA 3COZA 1QYWA 1WS6A 3R8XA 4L94A 3P0HA 1JFLA 3AKDA 3A32A 2NUPA 3QA9A 3HWRA 2XLBA 2HY7A 1SHUX 4TKUB 4X6UA 2KBEA 5AP9A 4IJQA 3H5TA 3QV2A 4BLPA 3KVNA 2HMSA 3LCCA 4C4OA 1H72C 4ETMA 1U02A 4QUBA 4MW6A 4LYHA 1YA4A 2BMDA 3TO5A 1PDWA 4ASAA 3E9MA 1QV9A 5T8KA 4OD0A 2EHDA 1IE3A 3H2IA 3ZNOA 3ZHYA 4Q05A 5AUPB 2WQ7A 3RYHA 1QHSA 1BS2A 1Z0IA 4KK3A 3L4BC 3ZWNA 3S99A 2I9PA 4MA0A 1UYMA 4NHOA 4U3DA 2BC9A 1NW7A 2FZGA 2CHEA 4IIYA 4WOBA 1J90A 4M1EA 3KBBA 2R68A 4LFBI 1C3LA 2TRSB 2NYAA 2BGTA 1XLWA 3TTVA 2PZAA 2V5AA 3ZVRA 3L8MA 4E4RA 2AEEA 5DRRA 5FI5A 3AHEA 2GJKA 2TMDA 3P45A 4EUEA 1GY8A 3LF1A 3M1IA 2B25A 1ZPDA 2JW5A 4AZSA 3KEQA 2J5QA 4EQZA 2EKBA 4Q4AA 4CKBB 3PNLA 3P2YA 5ELXA 3W9SA 1DJNA 2D5BA 1TCUA 2XTNA 3FPCA 1FVFA 4LBVA 1MFPA 3ZQ6A 2YJ3A 3ZLVA 1CNFA 1NYRA 1ZJWA 3LFHA 3IVMA 4WBXC 2B30A 2Y3IA 3NOVA 1XNRI 2A0KA 2VF2A 1EVZA 2J5XA 5C3UA 4KSBA 2PXXA 5D7RA 2GTPA 1CNMA 2OD2A 3AF0A 1UAAA 2A9PA 1U7OA 4RZ3A 3RIEA 5E6SB 1V3QE 4B9EA 2HDOA 4KMRA 5D2CA 4UU8A 2ZCVA 4OFWA 3AFOA 3PK0A 4C7MA 3VU1A 5EWMB 2PJDA 3Q15C 3IPRA 4M87A 3DHYA 1V3UA 2YYSA 2VEOA 2O1WA 2OKCA 3HB0A 3G2MA 3C6YA 4QO7A 4R9VA 4KQ6A 4IQFA 1ELOA 1BE1A 4HH4A 4DLUA 3LL7A 4GXRA 3TZ0A 1NUUA 1VLZA 4YRPA 1JTFA 4X3OA 4MI6A 4JI4E 1IC6A 4FI3F 3ZI0A 2HK3A 2Z1MA 3L06A 2A5DA 4LOKA 5FUYA 3LKZA 1LVUA 1V8BA 4HGRA 3UNXA 2XT6A 3N2GB 5JHGB 4WECA 3QFCA 2IU0A 2MSDB 4YBZA 1JBQA 1NXQA 1VJCA 2EHJA 1EG2A 2X13A 2QY9A 1MN6A 4GMFA 1EDEA 4IH1A 4RADA 3FNEA 4AIMA 3W9BA 5TQ2B 2D4HA 1W36C 3I01M 1MABA 1EA5A 3RKUA 1U99A 4DJJA 1G21B 4DW8A 5E7MA 1KARA 3ZHXA 4G0OA 3IJPA 2VWCA 4KXXA 1JQDA 3TNYA 1TC1A 2IOHA 1X42A 1JXMA 5EHZA 1L4UA 2IPLA 1UC9A 1VTKA 3IEPA 3FNFA 1XA0A 3RDPA 5ILOA 5E3JA 3TW8B 4FS3A 1JR6A 1ISRA 3CPEA 1CY4A 5FPPA 1QNLA 2HBQA 2X0FA 3LT5A 2VUIB 1CZOA 3WAGA 4V03A 3CRZA 1CQPA 2XWBF 3H2ZA 5CX1B 3PJEA 1HWYA 1AMNA 2G82A 3QLVC 1MB9A 4YMHA 4DDHA 3S1AA 1DLJA 5LR6A 2HV8A 4CIXA 4L90A 1DMSA 3DKIA 1D2MA 1DOHA 5HIMA 2A35A 2CGFA 1UMBA 1VJ5A 2XNHA 4EBFA 2QN9A 2PUDA 4F56A 4DPWA 1YA8A 4EF4A 2Z08A 2JIZA 1YA6A 4C05A 4OQDA 4H0NA 4I1SA 4MS3A 1ZBDA 5JANA 3CVVA 5B1IA 4U8HA 2J07A 1H9CA 2ZREA 3V8BA 3E70C 5ESDA 3UJHA 4Q12A 4UROA 4NBTA 1CYEA 5K36E 3OA0A 3AM3A 3MTAA 1BYQA 2ODNA 3ZX4A 4S0ZA 4BNJA 3QKSB 4CLOB 3HA5A 5DGHA 3SQMA 4JYZA 2FOLA 3UK0A 3AIMA 2RK6A 2ZI3A 5AVTA 1NVVQ 4FR0A 4H7QA 1DC3A 4JYPA 3MRSA 4FKMA 4A2PA 3W2FA 4TSKA 3IUBA 2AIRA 3SJ7A 3WNDA 1N36I 1ZUHA 3DE3X 3QJYA 2FZCA 3QI7A 3T52A 5B1YA 3URMA 1UQRA 3JWGA 3MVEA 1CUWA 1EFTA 2OT3B 1EINA 1W5BA 5E2BA 2WLSA 5CJ2A 3J81C 1CHDA 1XZFA 3TQTA 3THSA 4B6EA 5J5VA 1PCXA 4EYOA 3EPHA 3K2QA 4Q4JB 3BB4A 3KPWA 4MS4A 1T0HB 1COWD 4F8EA 1MAVA 5T5QA 1XCPA 4UCXA 4W63A 3UCFA 3FYUC 4KSCA 3PDIA 1Y3HA 5DLYA 1PL7A 3H2YA 1YBAA 3A9WA 1NU8A 3ESYA 1NHHA 3QMMA 4Q66C 5LD2C 2X15A 2I6QA 1GIAA 4YJ2A 5BRAA 4UHKA 2C04A 3WTBA 1JHZA 1U2DA 1HG0A 9MHTA 5A6VA 2QQFA 3BFKA 4MEAA 5COQA 2WHXA 3ZJUA 2W2PA 2HA5A 1A8UA 2PS3A 3QX7A 4Q82A 3DL0A 2Z8XA 2VPTA 1KEWA 1M76A 1L9KA 2UXDB 2P5SA 2Y67A 1YZFA 2A7XA 1RNLA 2W6PA 4N9QA 3T5GA 4PHFA 4FGWA 5J1TB 4JQSA 4DV2I 4E6PA 1GCGA 4TUYB 4M53A 4R9NA 2RFLA 4RZUA 2J0VA 1U8AA 1YZGA 2PZBA 2Z6VA 2QMEA 1KWGA 4KO2S 1KBQA 3ZJYA 2WTBA 3HJAA 3CVWA 2R3SA 3ASZA 3G8CA 1LBEA 1NM5C 4CM7A 3TDMA 1GARA 721PA 1EX7A 3K60A 1BMFD 4F9EA 3GPDG 3ADOA 3GP5A 3PJFA 2P2YA 4DLAA 4KBGA 2OXFA 4E51A 4BCCA 5J2UB 4BL5A 1F51A 2AG6A 4YAGA 4XC0A 3T41A 3QWAA 1ID8A 4Y9TA 4I46A 2A59A 4AWQA 1VLVA 3A3KA 3ZQKA 3QEJA 3WGMA 1UM9A 4BE7B 3J81Q 3VC3A 4MVYA 1GO2A 4JI5I 3Q1QA 3G9TA 4QDXA 5C8YA 1PFWA 2BTOA 3QVXA 2AFIE 1BE6A 5EWLB 3FVWA 4D4JA 1IZ0A 2Z56A 1E9VA 1ONBA 2P2SA 3INGA 4RLQA 5E4TA 3IC5A 4DLPA 3MGBA 2C7RA 5U4XA 1U8TA 2Q5JA 1X38A 1GQOA 4DUPA 1UY7A 5IWAI 4G0UA 2YMPA 2P8JA 5EKXA 1HNXB 3NWEA 4IYRA 4MQ6A 1XPUA 2VDOB 2WI8A 5D5HA 4HQNA 2B92A 4KE7A 3RYCB 1ZN9A 1LGYA 1F8UA 3SE0A 3L0OA 5H59A 1TVEA 4BGUA 3PFHA 2JDIA 1DKRA 4DPUA 1NRWA 2VRNA 2OB2A 4NTZA 1MNAA 4Q16A 3V8QA 4D80A 4Z3OA 4GOJA 1J0CA 3K0FA 1JPJA 3OOHA 1OVMA 3T3OA 1KVQA 1X8LA 2AQHA 4HB3A 2JFBA 3OFVA 3K70C 3DP9A 4DV7I 4QXMA 5JH7F 2UU9E 4ZPXA 4J03A 5G4KB 2Q4EA 4R8VA 4N5HX 2IP1A 3VH1A 5DASA 1Y9DA 1VLLA 1KPGA 1TLTA 3LC1O 3IH5A 1KJYA 4FQ7A 5AKIA 4RA6B 4EG7A 2ZJYA 5F4BA 4OM7A 3BE4A 4RF2A 2XYVA 3LPCA 1U7XA 2YHAA 2J9YB 2OHIA 1DSSG 3KLMX 3RQSA 1PT5A 4GI7A 4CODB 2H06A 4I7EA 2H2WA 3DT9A 3LGXA 4K9SA 1V37A 3NP7A 7AT1A 4N5MA 1E0KA 1E7RA 5IT9A 2BONA 1YMVA 1VPWA 5IC5A 4ENQA 4DV4E 3R5JA 3VR5D 4QDOA 2VPQA 1JMKC 3PEVA 3GFRA 3O75A 4YAUA 2O5RA 4JL8A 3LIIA 4ESOA 5HE9A 2HLPA 1ETHA 4FMTA 2OD7A 1NVMB 1TD1A 1CUFA 2WFMA 4G0XA 4FD2A 1XHFA 1J5EB 4QX6A 1J1ZA 4IINA 3QKWA 4PAWA 4LQCA 1JHRA 2FPXA 4AKEA 3X44A 1L4GA 1F2TA 3WLQA 5DROA 2QTCA 3I1FA 1FFGA 3EVFA 1RQLA 1RAHA 3LCMA 1XB2A 4EB6A 2QUAA 1ZL0A 1E1NA 3JQFC 3WYGA 2NXNA 3PRJA 4EJMA 1WL8A 3CRW1 1ITZA 1R0BA 2N0SA 3HY6A 3EBPA 1PZFA 1YT5A 2V9ZA 5FIUA 4JNCA 2D8MA 4LJ9A 1XQXA 1H2XA 3HN2A 3OT1B 4KLAA 5IDVA 1QIMA 5INTA 3MQFA 3WIOA 5FBZA 4YAWA 1YDFA 4R81A 1WCYA 2EQ5A 4LXUA 2VK8A 4LY0A 3ZY2A 3FUVA 2HA7A 2I3AA 4AN4A 4C1NA 1QGYA 2B9EA 1H65A 3K72B 3PITA 5FX2A 3RBAA 4KVZA 2HMYB 1QP4A 2CDRA 3HEBA 1HYQA 2OKGA 4A6XA 1EB8A 1W35A 3FOCA 2VJYA 3DDCA 2IEAA 4UU7A 3C8DA 3HQ4O 5D6OA 1LBIA 3HJBA 4Q21A 3OURA 2YMQA 5D6NA 2Y0EA 4BMCA 4JZKA 1RXUA 4LWGA 3STXA 5CTAA 3MTJA 5HIJA 5DCLA 1U2ZA 2CLIB 1IHOA 3DULA 2ALJA 4HVTA 2XBUA 1NXXA 1J8DA 1PKPA 5KUTA 2I3GA 1UWLA 1P77A 3FPJA 3WKCA 5B3JA 1DC4A 3H5NA 1PWHA 4PO3X 3GYGA 2JJ8A 3GZ4A 1HURA 4LC0A 3MT0A 5JD4A 3UKJA 2FSIA 3MCZA 5LMCA 4H6XA 1IMJA 1DAIA 2CVFA 4HQLA 2AOVA 5TMBA 2PS0A 3KTDA 3PT5A 1Z07A 5FR1A 3NOXA 4M46A 1L4MA 3DOOA 1RRMA 5H70A 5A3JA 1KSJA 3KXPA 4I6EA 3HTXA 3EDOA 4DUHA 4ARZB 3O4RA 2B1JA 2J30A 3EC7A 4Y2SA 1YIAA 3I37X 3NHBA 3NHYA 1NBHA 1Y1SA 3G8YA 2A9RA 4E5YA 3T99A 2YOFA 3QHQA 1HYBA 3G0GA 3ESZA 1P39A 4I55A 1N9GB 2IOFA 3R4OA 2C2AA 5AW0A 2AHRA 1RC0A 1QJ4A 4LHXA 4BVBA 3ACCA 1XVLA 2XMDA 1UBSB 1UPUA 1D9XA 3ICCA 5JNRA 2M6SA 2XXAA 5DDIP 4TV8A 2WV9A 1W85B 4H4DA 4XX1A 1TVKA 3ZNPA 3HEAA 1U0GA 5C8YF 4CEHB 3LKDA 4QOIA 1E2GA 4WTOA 1L5HB 3D5QA 1XEXA 4FHEA 3VR2D 1MX9A 4QTZA 4LK3A 1VFNA 2GN9A 1C81A 1LLFA 1VIVA 3TUJC 3V6LA 4V0LA 3OIUA 2CZ9A 2AG0A 1OIVA 5L3RA 3RIXA 1OW3B 4WUTA 1CJSA 4IS3A 1GPLA 1ZWHA 5EKWA 3CLUD 5BMVF 2VDVE 4NULA 4BEWA 1JLHA 1PR4A 5BPHA 1GSHA 2ZI5A 3AXSA 1IBLB 2GHIA 3WL3A 4FYYA 4B1FA 1E2HA 3BQ9A 2BU2A 3REQB 2FN7A 3C3PA 3IUSA 1FYVA 4LOMA 2ZUTA 4D82A 4RAQA 3IQHX 1ESNA 2ONJA 2NUTA 1AGYA 5H02A 4F5WA 3SSMA 1JFVA 3U1KA 2FMIA 1JJIA 1B15A 1N8TA 1FYEA 1IVYA 2CCJA 1NVAA 2L69A 2Q8FA 4GF5A 1THZA 3D81A 2ADOA 5KC8A 1HC7A 5FL7D 4YQFA 4QFBA 3D7SA 1POWA 1NJ5A 4B71A 5FF9A 1TTPB 1UPCA 2IPOA 4OUKX 2JHAA 5ENDA 1EH5A 5IW8A 1QYRA 3O1HB 3A6GA 3B6JA 1EFUA 4QASA 2Z5EA 3JQBC 3ZBQA 2X1LA 1MORA 2ZAOA 4URNA 3SM9A 4DUZB 2Y66A 5DM2A 2HJGA 1IWPB 1S3GA 3SLRA 5G02A 3OM0A 4N0PA 4LPBA 4IGKA 3C74A 3CJTA 1OYPA 1H7SA 2HEIA 1HSZA 3NW9A 4JWTA 4IZOA 2EWWA 3PNKA 3H18A 4DSAA 1ZW6A 1MPTA 4PRVA 1OLOA 2TSYB 2JPDA 1L5QA 2TMKA 1W0JA 1RRCA 4D41A 4PZDA 1I7DA 5KOJB 2FSHA 4HGPA 4G5FA 3K92A 2ZDGA 4BO0A 4P7GA 2QENA 1UPXA 1T5TA 3FSGA 4CWAA 4H7EA 1U9IC 2QN3A 1S2IA 5EL9A 5B1SA 3JSAA 4KPUA 4MYRA 4FMDF 1ZVJA 1KFJB 4XPZA 4EMBA 4J4BA 3GH3A 3I5AA 4LDNA 2HSWA 3GMSA 2P2GA 1WB6A 1DTWA 5L3SA 3I9JA 3IMEA 1T10A 1B1AA 4U5XA 4LF9B 4IIBA 4ZC1A 4IHKA 1JHOA 5B7PA 1PTKA 2PBLA 1DVRA 3UICA 5JE8A 3GNTA 3ULKA 4WCFA 1QFXA 2O0JA 5A9TA 4NS1A 1QXSA 1V2GA 1II0A 4CV1A 2WFAA 4UC0A 3KVYA 3OE7D 3QUCA 5C5EA 4ZVPA 3L79A 4NNJA 2PUWA 1U4SA 3SE7A 2XW6A 4PWZA 2R1TB 1KI9A 3KOYA 5AK3A 3BYZA 2ORIA 2ZTMA 2LCQA 2ZRHA 4ZVKA 4BV8A 1UZNA 3TUIC 4L50A 3RUFA 4J07A 1Z7WA 3VNQA 1P0CA 4DDVA 4ZIRB 2OZLA 3UXYA 3V1TC 1WDLA 4LY6A 4W9NA 1EXWA 1IM2A 3R1IA 1IN5A 1NTOA 4QNMA 4FGLA 5ALNA 1JJVA 4FHZA 4U0KA 1OXXK 1I94I 3WZ2A 3BTUA 2PZGA 4DMLA 4R9SA 3CV3A 1R64A 2HWUA 3HB5X 4QLOA 3ZK9A 4IBOA 3EVTA 4R05A 4CQNA 2HC9A 3CW2A 1H0SA 4L4YA 3Q8LA 4JLBA 1H4TA 1X7DA 3PSAA 3NI2A 5CCXA 3LMMA 2PSEA 3LJKA 2AZMA 4DA7A 2O8DB 1TYEB 3K6KA 1FUYB 4NARA 4U2CA 1EP2B 1J07A 3LT4A 2XTJA 3I4FA 1W34A 1FYWA 1FC0A 1PGOA 1VLMA 2WM9B 5E4JA 4G5SA 2Q7OE 4KO4S 1E62A 3H83A 1JZTA 1DKPA 1AKVA 1ABBA 3AF4A 1GAJA 2COKA 2GAJA 4O4JF 2EFDB 1W4AA 1WEKA 2OZPA 3W8EA 2WJIA 1E9AA 4CCAA 4L08A 3CR3C 5PGMA 4U9HS 3Q8MA 4ITRC 3ITEA 4FQ8A 3LQQA 4EUNA 1DG3A 1VI2A 5TT1A 4WX2B 1WUIS 4B3TB 4R98A 5EPUA 3RTAA 1CJUC 1NAIA 2OXEA 1IXSB 4ERNA 1PJLA 1I5DA 1G9XA 4L3VA 5I9BA 4RKYA 4JBXA 2PRKA 5LKAA 1BQEA 4EA7A 1G19A 1SMKA 2YV5A 1DJMA 1CDZA 4FN5A 1ONNA 3VPAA 5JCOC 3MXOA 1Z2DA 4O3MA 4ZXPA 3FFAA 3LBYA 3M7NG 1FFXA 1GQQA 3AESB 1IQPA 3PC6A 4MV4A 1DS6A 1A2KC 3H2HA 1QDUA 2GYUA 2ZUSA 5J3JA 4GFDA 4B35A 3Q5LA 4EG0A 3ZNQA 3VZBA 4QGFA 5ALJA 1I32A 2B0CA 2PM8A 1GPJA 4PZLA 2BU8A 2BR5A 4HDKB 5FBLB 3KAQA 5AW3A 4KQ2A 1Q0RA 1C0LA 3S5UA 3UJPA 3DEIA 3B5EA 2E5LE 5KTPA 1N5LA 1A98A 2O2DA 1I8TA 3AY6A 3BK7A 1W59A 3BM9A 4RD1A 4UEWA 1KZYC 1PR1A 1AT1A 1ZXNA 2F67A 2OO7A 4CJXA 3E3LA 3L2OB 3QPUA 3RFXA 3R6GA 3QFTA 4WK2B 3CH5A 3CKLA 1IXZA 3ADPA 3CDJA 4FW9A 2GARA 5GVSA 1K5HA 4XEHA 5IDWA 1KOGA 4CETA 1WV0A 5EINA 3UT5A 2I6GA 3BRCA 4O2BA 3OCXA 1T2NA 4QOFA 3FMVA 3BICA 1PU2A 2VJDA 1XG5A 4DQXA 5HDQA 5ALFA 3DM9B 4K9QA 3DBLB 1R4MA 1VSVA 1YR1A 2G0NA 3M3HA 4BRSA 1U0EA 5HTKA 4CKXA 1AZLA 4RF4A 1XCJA 1EGAA 1KXZA 5I9LA 4JJFA 1ZIYA 2P5UA 2ATVA 4MP6A 3D7KA 4V2UA 5LJIA 1R1DA 3C6XA 1VCHA 3QPVA 4H3HB 4QVKA 3EZXA 2V7WA 1N3LA 2UZ4A 1VMKA 5ARBA 4HZ5A 3DDWA 5F7XA 4P5EA 5JPCA 3ROEA 2V7XA 4MK4A 5CCEA 1C4WA 4RY2A 4BXIA 1UK8A 3EHGA 3UK7A 4TV9A 3WNBA 4MUHA 2JEBA 5H5JA 3QTBA 5ALRA 1GRCA 5H4GA 1E9RA 2VYVD 3VR4H 1QP7A 1Z56C 1TYZA 1PX0A 2QTZA 1CFJA 4NZPA 1YS7A 4UCQA 3SIWA 5I9IA 3N8IA 3OTOB 3GEMA 2VATA 4Q02A 2YWDA 2BN4A 4I4TA 1N2BA 1G20E 4LXTA 4IZJB 4ER5A 1C5KA 1WXXA 1NG1A 2UZ0A 1R0LA 3KR9A 4LI3X 3BAFA 2IEGA 2NP7A 2HCTA 2AR0A 4EJ6A 3VO1A 2I65A 4JLOA 1W5SA 3ZHUA 5HVNA 1HRKA 1UAYA 1ZGHA 3CNOA 3V9AA 1KK2A 3G0BA 3F98A 1MW8X 1PJAA 1X1SA 5DMHA 2CCTA 5EZYB 4QDKA 3N0RA 5DNVA 4QICA 4H3KB 3AMVA 5I9SA 3BJIC 2V3VA 1NXWA 3W3AD 4NBVA 3L5KA 1CERA 5DNXA 5ALUA 3GLLA 4LC9A 2D4AA 3CUTA 5AXDA 3G6KA 1ECGA 2D1QA 2H8MA 2QPTA 1US7A 3AO0B 2C1GA 4ZOLB 2P62A 2NU8B 1OHHA 1EFVB 4GD3Q 4XPIB 5I6DA 1SFRA 2JJMA 4AS9A 4JLVA 1UKZA 2VNKA 2GF2A 3OIWA 2Q2WA 2P6MA 4Q00A 4YCSA 2C4NA 1IB6A 2XZTA 4FBGA 4IDDA 4II7A 1A4IA 2DUWA 4IDOA 1RPAA 4GQAA 2WIBA 3K05A 2HPZA 3LHIA 4INAA 1JQEA 1FMCA 1KJQA 1TC6A 3M85D 1GKYA 3L43A 2QGZA 5CD9A 2UYYA 2ZJ2A 3S2FA 2IT1A 3OJOA 3DL2A 1E3EA 2P90A 3GRAA 3UUGA 2W2XA 3ZLBA 1E2BA 4KLCA 3JQGB 1TK9A 4BCDA 2D06A 1I7LA 1YHZA 1UJCA 4FONA 2ZIAA 3SNKA 1UJMA 2OFXA 3ZDXB 1H6BA 4HNHA 3D0OA 2VTVA 2W6CX 2QY6A 1Z34A 4D8VA 2RARA 3GGCA 1OLSB 5EXTA 3EPRA 3HHUA 4BX9A 1NI4A 2G28A 2MYNA 2V7GA 1KAQA 4LP0A 1X7HA 2Q1XA 4AICA 1YULA 3DP7A 2DU8A 3T06B 2VFAA 1SQSA 4Q4HA 3HO1A 3DZFA 3UN1A 4MH0R 1QMGA 5A05A 3N59A 2GK6A 2FZEA 4BUCA 3A2MA 1NN5A 5DRYA 1RQRA 1P3Y1 2IS1A 4FIDA 3G5UA 5LQUA 4KFRA 2NUBA 4IV0A 1FUEA 1A5SB 4CM4A 1NVXQ 4C2AA 1X14A 3GQVA 5J2TF 1QYCA 2Q0XA 3GCDA 5JSQA 4XDGA 2XX4A 3V4PB 4UMEA 4GQBA 4OGWA 4GKKB 2Z4TA 4C6RA 3EQZA 4MP2A 2UVQA 3H1GA 1UYDA 4U39A 1VSBA 3N6VA 2I7VA 5I3ZA 4JP2A 1RHUA 4LFCE 1IBME 1Z5PA 1CQWA 5CW2A 1K7CA 3R0IA 3O1IC 2YBEA 2CLFB 1K63A 4BQPA 4IQGA 2AW3A 2FWPA 1UYIA 2J8ZA 1H9BA 2EJBA 4ND4A 2IYWA 3QMVA 1JR3D 1FP4B 3S2YA 4JI0B 1I80A 4KRYA 1RKQA 2HF7A 1Z4PX 3TZBA 4OPMA 3NS7A 3K3PA 1YT1A 2WF5A 4OLHA 4CE3A 1N0VC 4OX9E 4ZCSA 4MDEA 1IJBA 1K7XB 1GM5A 1NU6A 1GPAA 4HQRA 1NE7A 1G42A 5GPBA 3S68A 4MU3A 1DWOA 2Q3MA 5AQ1A 5LP1A 2DBYA 2E4UA 1B3QA 3FIUA 4DCNA 4KH0A 1BH2A 3OOWA 4ENRA 3NTOA 4N40A 1TZ2A 2GAOA 1QTRA 2MMGA 1LW7A 3DTVD 3KUXA 1A27A 4A15A 2ZT6A 2YYYA 2YEDA 3LWDA 5HA5A 1QZ3A 1LS6A 3UQZA 3FLMA 1PV1A 3RGGA 3RVKA 3S2EA 4O2BF 5A71A 3T8YA 1UQUA 4R5MA 1TEHA 5FPTA 3Q5EA 1JHVA 1XDBA 3ZIAD 3HV2A 1VE1A 4OB7A 3Q7QA 4E01A 1Z3IX 1ZUD1 2IJGX 4BKMA 4RHCA 2XRYA 1N2CB 2BRUC 4M7PA 3ZY4A 5IZCA 1I4OA 2KE5A 4PVDA 3T94A 1NP3A 5CT9A 4PBSA 1Q7GA 2QDKA 4F5YA 4EMSA 5L7WA 4W5WA 4TMYA 3RS4A 1XZGA 4JUDX 5FTWA 1B93A 2M2IA 2VZEA 3PQEA 3H65A 4EUHA 5DH9A 4EPRA 4XB1A 2CZCA 2PXAA 3IQGX 5HUHA 2NTYC 1HPLA 4QOHA 4MLZA 3LC7O 4KN8A 3WWEA 4DXLA 4TV9F 1EUDA 2RMKA 3LRTA 4BAUA 1F48A 1T24A 4DIUA 3AQ4A 1AKRA 5JUWA 3GDOA 4EWLA 1S96A 5ISMA 1XNQB 3MCAA 1LI5A 1JFFB 4MS1A 5HKBA 4IMPA 4POAA 3VPSA 4DC1A 2ZWAA 4LI0A 1YDEA 2WABA 1PO7A 5C4GB 5JDCA 1PVVA 2RIRA 3QY9A 2D2XA 4GGPA 4CKYA 1I0IA 5D3ZA 3O3MB 3G7BA 5HBRA 2EBHX 1CEXA 4YASA 2XNDA 4FDLA 2QUIA 2O06A 2RGAA 3QK7A 5ES3A 1H2WA 4ILKA 1GNRA 2C4WA 4LF7I 2FI1A 2VJNA 4C2BA 1SD5A 3HA2A 4U1RA 1TVCA 3A0YA 2DPLA 1E5LA 2IZ6A 4D8YA 2LPMA 3QEAZ 2Q9BA 3WSWA 2CVQA 5JSZB 4BLQA 1MDFA 5HSGA 1X13A 2CK3A 5FL3A 4BAEA 2BSQA 4K03A 1QONA 3SJUA 3T3MB 4Y6RA 3NXKA 3R3ZA 4AF6A 4K86A 1EGVB 2AMLA 2XQGA 4UDXX 2R8OA 4M7OA 4UCFA 4I5DA 1D5CA 4O2AF 1G2IA 5HTOA 3HJGA 3HDTA 4N7JA 1E0DA 4YO7A 3NYIA 4I9GA 4XIGS 4F5EA 3CE9A 3JQEA 4G25A 4TZ0A 5JDIA 2SCUA 2JGNA 2J9FB 3PPWA 3ZWAA 2CSXA 2PUJA 4BNDB 1W47A 4X8LA 1MRSA 2R5NA 1EWRA 1ZA2A 2C82A 2GOYA 4GBMA 4YMTA 4PR3A 2GHTA 1HV8A 3DZIA 3LHDA 2ZYWX 4L6CA 1YH3A 1E0JA 4HAZA 4PZYA 1OMOA 1WB9A 1JU4A 4C9BA 4FINA 1JXAA 5HF5A 2CVEA 5IVHA 3PVSA 2PKYX 5TGZA 1W75A 4XWKA 2BDTA 2W6QA 3WLNA 1QLHA 2G1PA 1M1NB 4NBUA 1QY8A 1Z0SA 1PKEA 2F6RA 5AUOB 4UM9D 4WXPA 2VF7A 5JENA 3LFTA 3MUOA 3SXUA 1VRCA 2Y0CA 4JQLA 5TF4A 2IHYA 1RBQA 5K7SA 5IX8A 3TNDA 3EA5A 1Z47A 3K9BA 5F52A 3RPEA 1WZUA 3RBXA 3QE9Y 4U6SA 3C7TA 4RA9B 2YHIB 3QT6A 1ZCAA 2R751 1R27A 4L3WA 4Q3NA 4JR2A 1OX4B 2CHGA 5GV8A 1AHPA 3DKPA 3FTDA 4FMCB 1TM1E 2OCAA 3E9EA 4W1SA 2GKGA 4L8GA 4OXYA 2OENG 3L7YA 3S27A 3KPUA 4L8ZA 4E6EA 1E1KA 4TWBA 3D8HA 2DWQA 2DKFA 3RTGA 3HR4A 2CFCA 3UMVA 2VPPA 5KYKA 1D7AA 3E2MA 5A4JA 5E7IA 3LQRA 4CF5A 2PS9A 4JFRA 1O5OA 2FNAA 4KZKA 5F98A 1N3YA 2C1IA 4WGGA 1BHJA 3GT3A 2I87A 2WI4A 4JC5A 1EXVA 2WHPA 4IJ6A 1RJFA 2C8VA 4BQGA 4X1IB 4YIHA 3JCZA 2J4CA 3GIDA 2FG5A 2QU8A 3KZCA 1S4EA 1V6CA 2I7XA 3OQPA 4P53A 2MYUA 2UUPA 3H1AA 1MPXA 3TFOA 2UYHA 2XQIA 3P0EA 2FZWA 2X36A 1CC1S