1Y4UA

Conformation rearrangement of heat shock protein 90 upon adp binding
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
489
structure length
472
Chain Sequence
b'MKGQETRGFQSEVKQLLHLMIHSLYSNKEIFLRELISNASDAADKLRFRALSNPDLYEGDGELRVRVSFDKDKRTLTISDNGVGMTRDEVIDHLGTIAKSGTIGQFGVGFYSAFIVADKVTVRTRAAGEKPENGVFWESAGEGEYTVADITKEDRGTEITLHLREGEDEFLDDWRVRSIISKYSDHIALPVEIEKREEKDGETVISWEKINKAQALWTRNKSEITDEEYKEFYKHIAHDFNDPLTWSHNRVEGKQEYTSLLYIPSQAPWDMWNRDHKHGLKLYVQRVFIMDDAEQFMPNYLRFVRGLIDSSDLPLNVSREILQDSTVTRNLRNALTKRVLQMLEKLAKDDAEKYQTFWQQFGLVLKEGPAEDFANQEAIAKLLRFASTHTDSSAQTVSLEDYVSRMKEGQEKIYYITADSYAAAKSSPHLELLRKKGIEVLLLSDRIDEWMMNYLTEFDGKPFQSVSKVDES'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chaperone protein htpG
publication title Structures of the N-terminal and middle domains of E. coli Hsp90 and conformation changes upon ADP binding.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone
total genus 130
structure length 472
sequence length 489
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.80 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1y4uA02
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 1y4uA01
3.40.50.11260 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1y4uA03
4XDMA 1Y8PA 4H85A 2XDSA 3INWA 4URLA 3D2RA 3ZKDA 4O05A 4H81A 3GIGA 3OW6A 2YE4A 2YE3A 1UY8A 4XC0A 4CWSA 4NH7A 4BIZA 1AMWA 2VCJA 1Y6ZA 2QG0A 5C93A 4I5SA 1NHIA 2E0AA 2BREA 4KSHA 3FV5A 4ASGA 2CGEA 3B24A 1EI1A 4MP2A 2XHRA 3KE6A 4U93A 1THNA 2YEHA 4L90A 4QPJA 2BU7A 2ZDYA 5D7RA 3U67A 3IEDA 4BAEA 4EGKA 4WUBA 4ZVIA 4GGLA 4YKTA 4E01A 1TC6A 4L93A 3PEJA 4R3AA 3MNRP 1HK7A 3B26A 2YECA 1I5BA 5M4KA 1UY9A 5CTUA 2IWUA 1H7SA 2UWDA 3TZ4A 3QTFA 3RKZA 4XCJA 2YE5A 4CWTA 4HY6A 2QG2A 3H80A 2XABA 1NHJA 2XJGA 4JQLA 5F5RA 2XX2A 4LWEA 2O1VA 5CPHA 1GKZA 4XKKA 5M4NA 4CE1A 3HZ5A 4YKYA 3HYZA 4MBCA 2IWSA 1UYEA 2JJCA 4L91A 2YEIA 1MU5A 4L8ZA 4R1FA 4AWOA 4MB9A 2CCSA 3VHDA 1I59A 4EFUA 4CWQA 2VW5A 1L0OA 2XJXA 5IDMA 3LNUA 2Q8FA 2WI1A 2XCMA 3JZ3A 4XD8A 1S14A 2FYPA 1YS3A 1Y8OA 1YERA 5L3JA 3TZ2A 1UYMA 2IOPA 4MPCA 5IDJA 4E00A 1Y8NA 1Y4UA 5M4HA 1Y4SA 3CWVA 4NH8A 2O1UA 1S16A 3FT5A 4KP4A 2XJJA 2WI3A 3EKRA 4P7AA 2FWYA 2CGFA 4LPBA 1EA6A 2BYHA 3QDDA 5CTWA 3R92A 1YC3A 4H7QA 3OWBA 2YE6A 2YE7A 5FNCA 1I5DA 4KTNA 5CTYA 3K97A 2C2AA 4PRVA 3O0IA 2H55A 1TIDA 2HKJA 2CCUA 4R3MA 3TZ5A 3DGEA 4BQJA 3LPSA 4HYPA 1YESA 1PVGA 2WI5A 3PEHA 2FWZA 3H4LA 1GKXA 1MX0A 1BXDA 3Q5KA 2Q8GA 2VWCA 3K99A 3R4MA 3K60A 4JAVA 2XDKA 2HG1A 2WI7A 4GQTA 2YEGA 4UROA 3ZXQA 1BGQA 1U0ZA 5CTXA 4URMA 1YC4A 2YEBA 2YEEA 1I58A 1QYEA 3GIEA 3FT8A 4DZYA 2BU6A 1UYCA 3HHUA 1I5CA 1ID0A 4CWOA 2GQ0A 4HXWA 2YKJA 5M4MA 2YE8A 4GEEA 2QFOA 4GFNA 4V26A 3O2FA 1TC0A 3T2SA 4BIUA 2XK2A 4EMVA 5J6AA 2PNRA 2WI4A 3BMYA 3T0ZA 2YI7A 2BSMA 2YEJA 1ZW9A 4XTJA 1UYKA 4HXZA 1UYLA 4EGIA 2GFDA 5F3KA 5D7DA 4YKXA 3BM9A 4XIPA 1YT2A 2YGFA 3R4OA 4B6CA 4P8OA 1AH6A 4AWPA 1AM1A 2YE9A 2BTZA 4Q20A 1TH8A 2CG9A 3R4PA 4FCRA 2XDLA 4PU9A 4MOTA 4KFGA 3ZKBA 3TTZA 4LWHA 2XHXA 1YC1A 3TUHA 2ZDXA 4CWNA 2H8MA 1Z5CA 3T10A 4QPKA 4BXIA 2YEFA 2WI6A 3NMQA 1B3QA 2YJXA 1UYHA 2ZKJA 4AWQA 2BT0A 4MPNA 4O07A 3INXA 4I3HA 2BZ5A 4YKZA 5M4EA 1H7UA 5M4PA 3WQ9A 4LWFA 3U2DA 1TBWA 2WEQA 2ESAA 1R62A 2IOQA 3HJCA 2FXSA 2YKCA 2ZBKB 3CGZA 4YKRA 4K4OA 4CWRA 5D7CA 3WHAA 3RLPA 1Z5BA 3A0XA 1UYFA 2IORA 1UYDA 3A0RA 2Q2EB 4JAUA 2CCTA 2VCIA 4KQVA 4ASAA 1KZNA 3GIGB 4WUCA 4EEHA 1A4HA 1UY6A 3HYYA 2O1TA 3A0WA 4CE3A 4E02A 5CF0A 4GCZA 5GGZA 3K98A 2XHTA 1USVA 1UYGA 1YSRA 2BU2A 4O0BA 4EFTA 4O04A 3EKOA 4HZ5A 4YKUA 3HZ1A 2YKIA 4B7PA 2WI2A 2XDXA 4YKQA 4HZ0A 1GJVA 1ZXNA 3CRKA 4ASFA 3G7EA 5D6QA 4HY1A 3Q5JA 3EHHA 3OPDA 1Z59A 4JASA 2WERA 4LP0A 4XKAA 2Q8IA 3CGYA 3HEKA 1OSFA 1YSZA 1ZXMA 3A0YA 3SL2A 3ZM7A 2YEAA 2BU5A 2BU8A 3A0ZA 2K5BA 1QY8A 4LWIA 3G75A 1NHHA 4W7TA 4CWPA 5D6PA 2GQPA 4FMTA 2JKIA 3TZ0A 2XDUA 1B63A 3EHJA 3C11A 3R4NA 4FCPA 3T1KA 4FCQA 3RLRA 3B27A 1ZWHA 2IWXA 4FPPA 3VHCA 4MPEA 4NH9A 4ASBA 2CH4A 4V25A 4EGHA 5J71A 1US7A 1U2OA 2XD6A 1USUA 3EHFA 4X9LA 4CWFA 4O09A 3U2KA 1YETA 3Q6NA 1AH8A 4KSGA 5IN9A 2YEDA 2XX5A 4XIQA 2WEPA 2YI6A 4XKOA 4XIRA 3RLQA 3D0BA 3O6OA 3B28A 4ZKIA 4EM7A 2YK9A 3OWDA 3Q6MA 2YGEA 5FWKA 1BKNA 5BODA 2Q8HA 2BRCA 4URNA 2YI0A 3EHGA 2XX4A 2O1WA 4DUHA 3VHAA 2YGAA 1AJ6A 2YKEA 4YKWA 2BYIA 3VADA 4U7NA 3ZXOA 4XITA 1TILA 3OMUA 3Q5LA 2AKPA 4GT8A 3D36A 4LWGA 1UY7A 2QF6A 2YI5A 1Z5AA 1QZRA 3PRYA 4U7OA 5FNFA 1BYQA 2YJWA 4XE2A 4L94A 3R91A 3A0TA 4CE2A 1YT1A 2YKBA 3C0EA 4WUDA 2YK2A 3B25A 1I5AA 2EXLA 3CRLA 5FNDA 4PRXA 4PL9A 5BOCA 4MP7A 3T0HA 4BQGA 2HCHA 1YT0A 3GIFA 1UYIA 1KIJA 4XCLA 4HYMA 4AS9A 1JM6A 2YE2A 1B62A 3G7BA
chains in the Genus database with same CATH superfamily
4IZJA 1NBEA 2ATXA 2JAOA 1I5RA 1WQ4A 4NG4A 4LJKA 2GM4A 3I05A 3RQIA 1Y98A 2GPBA 3NWJA 3G2MA 4D9KA 3EY4A 5HE8A 2GZ3A 1MQ9A 2PNZB 2A5LA 2ZTHA 3EARA 3TLCA 1Q57A 2JFPA 1V1JA 1QHIA 4NHEA 3W2IA 5ALUA 2ID4A 1PEYA 1WCIB 3OQPA 4RJ2A 1BCSA 1GA4A 2UUAB 3I4LA 4PV7A 2FPKA 1ZLYA 3PKIA 4V1CA 2XIQA 2XMSA 3TEMA 4IKPA 2OZLB 2ZYAA 5COBA 2FEMA 3WQBA 1SOUA 5IUKC 3KOWA 1XU7A 2HNBA 1Q1GA 5EIFA 4H7QA 4RHCA 4OO1A 4A0SA 4BNGA 5I9TA 5EWLB 5KWSA 5AW3A 1WUYA 1KQGA 2ORVA 4RQBA 4MQEB 4JI3B 1NNI1 1HNWE 3BQ9A 3LTEA 2PG3A 1CJCA 1YCHA 3P8ZA 1YB2A 1MD9A 2PGDA 1I6MA 1YR2A 2WG1A 3O4RA 1CUBA 3R5XA 3G23A 4RFSB 1AU9A 2BSMA 2YEJA 1XO1A 2O3RA 3HU1A 3THYB 1XFDA 3CV3A 2P9QA 3L6CA 1YZNA 5LB2A 5HQ3A 4X71A 3LP6A 3DL0A 3CMCO 3OD5A 1N2CE 5IHXA 4IFDF 1YVDA 3PIDA 1FS4A 3TXXA 2D5LA 5U1PA 4QBIA 1T1EA 2NNLD 2ZRQA 2JLUA 3PXCX 3GEDA 1UPTA 1M1YA 2Q29A 3DEJA 4TTAA 1VSQA 3YASA 3PNBA 2W8BA 4DR1B 5ESDA 3I1IA 5A5EA 3LC7O 1VL6A 1ISFA 1N75A 2PXXA 4JFRA 3CCCA 1RQNA 2Z08A 3ZBQA 2P91A 1RC8A 4HZ5A 2B6NA 1DAPA 3H18A 1KMCA 1J56A 4N40A 1C2YA 3OTIA 4EG3A 3EEBA 3ROTA 1N2CA 2A59A 1X9HA 2F3SA 4KPEC 5K0SA 1Y3BE 1Z59A 5DULA 4IIBA 4EJFA 3I8OA 1HUQA 3PE3A 1G4HA 1RMTA 4UMFA 2H2HA 3DZBA 1H2YA 1JA9A 1N57A 3EVAA 5IANA 2H0RA 4ICIA 4BNYA 5T5QA 4DLVA 5DWVA 1V5IA 2NIPA 1ULHA 4V25A 4EGHA 3ET4A 4JZYA 3BDVA 1CRZA 3P3EA 2VAVA 4AWAA 4UAVA 1M34E 4C14A 1JU4A 4GKJI 4CTMA 5ALTA 5K8CA 3NC0C 1TAHA 5C8YA 2QTAA 4ND1A 1J21A 2PY6A 4U7GA 4GMDA 4DPYA 3SEZA 4BEVA 1L8AA 3DDWA 3FPKA 5FNFA 2NADA 2DQ4A 5A9TA 5JUWA 2YK2A 2ETVA 3ENVA 2NZYA 1U3TA 2DPXA 1NW3A 3S1SA 4IOJA 3H16A 3IV6A 2CXPA 2AQ8A 3PIRA 1YT0A 3HBJA 3T1HB 4D9BA 4KQMA 3BICA 4DQUA 2YQZA 1RTKA 3VDMA 1JG2A 4Z0PA 2PJDA 3HCBA 2PM8A 2H3EA 5TGZA 1VPWA 3TQTA 4BLQA 2B1JA 3U17A 3CVOA 1ADFA 4RVSA 3NRBA 3KK0A 3EGXA 4Y9RA 4KXMA 2JI7A 3ECAA 5LOVA 4LRUA 4AS1A 3F4LA 1RCFA 1D6TA 1TTPB 4XWTA 4X44A 3AYZB 3UEOA 1AXEA 3HDHA 1THZA 3QMWA 1B43A 3K15A 3C5VA 1G20A 4RPCA 1R00A 4N03A 1IOZA 4I6JA 3L1KA 3EC2A 4NFSA 2XJGA 1H66A 1YIAA 3AF2A 3R4VA 3IFSA 3F5DA 1NBMA 2OHGA 1YL5A 3PHIA 1M1XB 3BBPA 4QVKA 3VHXB 5JC8A 2C07A 5AT1A 1WBBA 1I2CA 2OQVA 2FFQA 1GNVA 2O2ZA 5CP8A 4F3CA 1I30A 5KYUB 1NX9A 1JG3A 4YHHB 4TUYA 4RXUA 5L3JA 4KQJA 1E62A 1SZCA 4WA7A 2XB4A 3MWYW 5TMDA 1XZCA 2HRZA 3FPFA 3FB1A 2Y1XA 4MV4A 1NVUQ 5D00A 1SUAA 1BD3A 2DFDA 1GQSA 4PG8A 1AV7A 3LUJA 3FOAA 4LBYA 4D9JA 5ALWA 3A2LA 3OSZA 4QFMA 5MN6A 3IBSA 4G4SP 5HJ2A 1NMQA 4LZPA 4Y2PA 3K8OE 1FFGA 3BGIA 2FEPA 2PKRA 4IJ5A 1YA6A 1Y48E 2RSLA 1I5CA 3P0FA 2AFHB 3RFFA 5JSKA 1CNFA 3QEOA 5D85A 1H42A 4EIWA 1NG1A 5JD5A 4CPDA 4BIUA 2ASEA 1E9DA 2G82A 4LXGA 2BRUA 3IAXA 1UYKA 4BC0A 4JBXA 5E6SB 1J0DA 2EFHB 3OTOE 3K4QA 1ZMBA 1F3LA 1YQUA 1N0HA 4WXYB 4JKOA 1WP4A 4JEMA 3C7DB 3ILVA 4MTLA 3K4PA 2EV9A 3KCQA 4IPTA 4LRQA 2JCSA 3I5YA 4F6RB 2CJWB 5K36E 2R4QA 1P29A 2CXOA 2I6QA 1L5QA 3OH8A 4KQGA 4Z9AA 4D6XA 3H2JA 4YKZA 2N1BA 4N8EA 2REOA 4KAAA 4BO8A 5KYYB 3NCTA 5ALJA 8ATCA 2RBKA 4E2FA 4RSMA 2XPCA 4RLHA 4C08A 5I6DA 4CRWB 2HLPA 3WAGA 4RTLA 3O7MA 4B3TE 4WZ6A 1E3HA 5FXMA 3TMYA 4AI6A 3IVCA 4IHAA 5BR1A 5EJ8A 2P7IA 3OZFA 4EFTA 1X87A 2H16A 1FDWA 2OBBA 1XMVA 5H80A 3EGEA 1V3VA 1I7LA 1KS2A 3TG8A 1B0UA 3B2EA 4DPUA 2ZRJA 1MPTA 5KJ6A 5KJCA 3SL2A 3P9ZA 2J45A 5IABA 3NWPA 1ZC3A 5M3BA 3KPYA 3H86A 4GT1A 1W4AA 1DFGA 2UUBE 3PUKA 3EHJA 4BKRA 2HSEA 2OQRA 2HYDA 1EJBA 2BW0A 3F74A 1QLJA 4D42A 5JJKA 4CIVA 1USUA 3O74A 1Z6QA 3TD6A 2PWBA 1CUSA 3B28A 4FNGA 2NO7A 4JSYA 4BVLA 1AZLA 4MUMA 3DV2A 1MAUA 4YKWA 2IH2A 2JIZA 5J2TA 3AEKB 2F4NA 1TCBA 2JGNA 2FEOA 1KDTA 3NO4A 1IOWA 3VKFA 4V38A 3IQXA 2C9YA 2J5KA 3MJSA 1R7RA 3SSMA 3QITA 1XAGA 4HX9A 1C3OA 2PBRA 3QJYA 4OKGA 3KB6A 4KYTA 1E8NA 4JBGA 2B3TA 4MV7A 3JALB 4PXSA 1XCGB 5J5CA 1DVRA 2E48A 1HI9A 3S8EA 1R6LA 2PEZA 5ICCA 4MH0R 4UFPA 4K3VA 2P1RA 4FR2A 3C39A 3Q15C 4WASA 3AESA 2HHIA 5J47A 1NNUA 1H4VB 3E8XA 3HNPA 2YZKA 4PX9A 2E4WA 3SIXA 2PUJA 2X0EA 3EK2A 3OVMA 5BSUA 3LI2A 4RDCA 4DV0I 4KREA 3ICOA 4DC0A 4LNHA 3BGDA 3T9DA 3ZCPA 4YLYA 3F2IA 2NUTB 3G0IA 4EB8A 3NTRA 1U8TA 4Q1EA 1ULBA 1GG9A 1A72A 1GGVA 4MYSA 3E0XA 2IP2A 1NUTA 1RFLA 3GDOA 2H1VA 4F91B 3TR6A 3EXHA 5H70A 4W1SA 4MU3A 3DZKA 1IUKA 2MU1A 3FH0A 2ZI7A 5IJWA 5J23A 4JI1I 3IH5A 4WW0A 4AG3A 4MYHA 5KSWB 3PF8A 4P4NA 3L7MA 3KPVA 2UZ3A 3WGNA 3SEFA 4Q4AA 4UU7A 4DE5A 3AIIA 4GLJA 1GZ3A 2W2XA 2RHGB 4LXHA 1TO6A 4L7VA 2X22A 1V25A 3E5HA 3W7AA 2B9VA 3PDIB 3K99A 4JAVA 1H8EA 1RM0A 1GPKA 3BTUA 3S6JA 4GQBA 2C7GA 1GUDA 2YFQA 3RW9A 1KOLA 1TLLA 1GCOA 3LCCA 3T5BA 2VHWA 3LY9A 4LDNA 4FHEA 2C2GA 1N34I 1ZOSA 4ZFNA 4RORA 5HJ5A 4YGXB 1STOA 4DLNA 3KXPA 5JSZA 1U0LA 1JZSA 1T8WA 4C22A 1HNXE 4REQA 3KLNA 5KSOA 2V7UA 4DUZB 3H1CA 1ECFA 1JKJB 5L3SA 3KJQA 3OIWA 3DHYA 1IDN1 5ALZA 2WJYA 4TMWA 1E9CA 1GEEA 3NUQA 3AEQA 3OZSA 1UL1X 4MRNA 3DF7A 5CR9A 3GAFA 3ZV4A 4NZYA 5JLAA 1IEXA 1D4FA 3VR2A 1JVSA 5D3MB 3T7CA 2NO0A 3CR8A 4G5SA 4CLDA 4FBGA 1UH5A 1MXFA 1QG6A 5IDXA 4F3KA 3KQUA 1SNYA 2WU0A 5EFZA 2HQRA 3WXBA 4BJ1A 4BQNA 2FW9A 3VJRA 1H22A 3LO5A 2Y68A 2DG2A 4JJEA 1DRVA 3W6ZA 2M6SA 5AKLA 1XMOB 4CN8A 1NJ1A 4TOIA 4CXMA 1IE3A 4QBTA 4K9NA 1R4NB 2VC2B 2BYTA 2GFQA 3PHJA 1GPLA 3Q3VA 2E3JA 5JBNA 3MS2A 1KYXA 5D6QA 1TU3A 1Z63A 2AR7A 1CBUA 3CVVA 2BUCA 3N2LA 3G2KA 3G2JA 2PX4A 3NYIA 3RQSA 4LFBE 4ECAA 3F5MA 4WXMA 4CE6A 3TVDA 3OOYA 1P9WA 3BH7A 1IAQA 3NWOA 2NSJA 4G67A 3LZ6A 4LKOA 4MVJG 3VDQA 2Z2JA 5BNIA 1VBFA 2QKYA 3AH8A 1UC9A 3M7NG 1NJFA 3DMPA 4PM4A 5ETJA 4W8GA 2XITA 5MN5A 2UUCE 3NBKA 3MJTA 4BP8A 1GPYA 3FPCA 4O5OA 2R7MA 1YKGA 2QLLA 4HBGA 1JQDA 1X14A 5KNBA 2C1EA 4ALIA 5CFPA 4L73A 1AOXA 3U16A 3FCOA 2C5AA 1NBMD 2C38A 1VL8A 1ISGA 1EMDA 3CNLA 2GLTA 1I2ZA 3IODA 4TQUS 4W9MC 2F17A 1PJ3A 1PL0A 4LBWA 4AF7A 2F4VB 2XCSB 4A8PA 5FDFA 5EINA 4KKVA 4JLBA 1UYIA 3V00A 2VHTA 5JMWA 4NENB 4QOJA 3UAZA 2TECE 3I9NA 1PBNA 3H42B 4G9EA 4Y6RA 5HSGA 3TGLA 1U4SA 4ZHQB 1ARZA 3STUA 2HPHA 1JKFA 1UDBA 2CDBA 3KV3O 3E4DA 3U44A 3C43A 2W2KB 4H2DA 2OGZA 1CQIB 3OFSA 4JLUA 4HQ6A 5ULLA 3IMGA 2AUMA 2YJTD 3IUJA 3ESQA 1A8UA 2XBUA 3AI7A 4AULA 4G0QA 2BTOA 2PBFA 2SKCA 5F1OA 2Z2XA 3WKEA 2QG4A 4S1TA 5SYMA 5KWEA 1I5BA 5GVRA 1KBQA 4EY3A 4UUOA 3PT9A 1HLDA 2QYOA 3G7SA 4TLDA 4DLWA 4RJJA 1JEAA 2EQAA 4UVDA 2H63A 3H80A 2VAPA 1T9GS 3QFSA 1LI7A 2A0XA 2X6QA 2VF5X 3HYZA 1D9XA 3O3CA 1WU7A 1UJ6A 2ICAA 2FN8A 4EA6A 2OM6A 1L0OA 4Q93A 3HZZA 3ICQB 4XPIB 3EOAI 1KO8A 1XDZA 3MS7A 8LDHA 1Y8NA 3MJHA 4CLRB 4IRUB 3OT1A 4EG8A 1H9AA 3FPAA 2P8JA 3V2IA 5JRJA 3BHNA 3FKSD 3O8OA 5TQ2B 2XUHA 2DFKB 3TZ5A 1YS1X 4ZANA 1NVKA 3LYUA 4KPGA 1F2UB 2HBQA 1NM5C 4QATA 1KF0A 1BGQA 3GRVA 3TLMA 4R51A 4NAUA 4PSCA 2GX6A 5JO0A 1XLVA 1GTL1 1TMOA 1K5PA 3KELA 4BWFB 4FDLA 1MOQA 4YCMA 1G2QA 4GMFA 2O8BA 4FFPA 5D3ZA 2REQB 3M9XA 4QPPA 3A1SA 4CTOA 1DARA 4YIHA 2PX0A 4HDRA 3GLFE 4CMBA 1T8TA 3KUUA 4UHEA 4XUDA 3VYWA 4MOWA 1R6MA 1WMEA 4ILEA 2PO2A 4F45A 1W6RA 1MX5A 1YHZA 3UJDA 3P1JA 1UC5B 4E1BA 1QX4A 1Z0KA 2P69A 3SIWA 1GXSA 3EIHA 4MWSA 2OBYA 1C4WA 1HH4A 4CU2A 4JI4I 1YDWA 1RCTE 3QU7A 1N9GA 1PR2A 1P9OA 4O3FA 1MXHA 1VA5A 1RYFA 2WEQA 4ZYVA 4L08A 1IN4A 3AI3A 5AHRA 3K2BA 3E4CA 2IU0A 2XT6A 4WQMA 2HKEA 1ISSA 1V3QE 1KXZA 4RZXA 3CLVA 3FF1A 1VXRA 3TKYA 1BDBA 4TL9A 4AS3A 5JEAB 3H9EO 2Q46A 1NZJA 4ASFA 4YRNA 2A92A 1A7KA 1K9VF 3MWKA 1N2XA 3RYIB 3BFPA 2PT6A 3PFFA 2WW4A 5HRUA 3OMLA 2WTEA 5SY6A 4PTLA 2BDUA 4F71A 1VB3A 4YCJA 4JJFA 1KI1A 5L4NA 1OH8A 2DWPA 4QXOA 3UOGA 1U2OA 4E5NA 4O02B 5K3OA 2IP4A 5IN9A 2X2FA 2V58A 2BWJA 2ID9A 3WZMA 2AEMA 3RTDA 2GTHA 2F3PA 1UXJA 1YJAA 4O25A 2XQIA 3EFEA 1TYAE 1NUPA 2P27A 2G88A 2FZGA 4LDJA 4RTNA 3WX0A 3HDGA 3PFHA 3O4VA 1G9XA 5B1DA 4AUKA 1FNSA 2X2EA 3FCEA 2PO1A 3NHUA 2N3ZA 4BFLA 1E2FA 3WGJA 2PA3A 3DP7A 3WWPA 1PP4A 1M2OA 1P8JA 1DAMA 4FJ1A 3CPHA 2QZ9A 3CTPA 3HWRA 3ER6A 2VKQA 3S2EA 5DI3B 3RK4A 4OXYA 4GOLD 2ZJYA 4CFSA 4B3RI 4PNPA 3ROXA 4P0PB 1QHXA 5KYWA 3MYYA 4BO2A 3A6HA 4LF8B 3QEMB 1QQ6A 3U13A 2BF7A 2HREA 4DMKA 3HN7A 1FFBA 3I5UA 2C31A 4MDFA 2GJKA 3LYAA 3AFGA 3QKRB 3QLUC 1OXKB 5IAJA 3RLIA 3THXA 1NMEA 4ID3A 4XC0A 3A05A 3A4LA 4BKOA 5BR8E 1VKHA 4DOMA 3IAAA 1PJCA 3KFXA 3HDVA 2ZCVA 3RYFB 4U1RA 1Z4MA 3I6QA 3MAAC 1PBTA 4NMXB 1KKLA 2G36A 4P4SB 4QEZA 2O5VA 4DSTA 4ER5A 3ZZNA 2OZPA 3TQQA 3WNVA 4BO9A 5BOVA 3LHFA 3ID6C 3NZEA 1CJTC 3IUPA 1NW5A 1Z8FA 3TPFA 4QIHA 3KE9A 2BGWA 2I2AA 2O1VA 3BF7A 4TRRA 4CBVA 1F8UA 4G09A 4N5HX 4RV9A 2YWFA 4RK6A 1K2WA 2DWQA 4Y2UA 1FNCA 1JJIA 5DM1A 2F6RA 1L8LA 4EF4A 3FDFA 2XUQA 1O57A 3MRVA 3THWB 5M4HA 2EWMA 5F2NA 3OESA 3BOSA 4P7AA 1SVIA 2K7ZA 2C9ZA 4LZLA 3N3BC 1RPZA 1BEEA 5KS2A 4BQJA 5I3ZA 4NQZA 1TVKB 3S29A 2WINI 1PSDA 5I8ZA 3DT6A 4BJHB 3CDIA 2CXTA 2JGDA 1ST2A 5AK6A 1AUPA 2XD9A 1E3WB 1QE5A 1QZUA 1Z73A 4WKPA 3DAHA 4QZVA 2ZR0A 4DV7E 1FUKA 2QV7A 1N5OX 2ZRCA 4G89A 2OCLA 4GMGA 5DF1A 5LP6B 1K8XB 3SF8B 4YUZA 4Z53A 2X2OA 3PC8C 3QSYA 3F6RA 1W25A 2BTZA 1AB6A 3LX6A 4BTLA 3FKJA 1J8QA 2IIVA 2YCLA 2W6ZA 2OHVA 2CLFB 3V8MA 5D6NA 5KSPA 4XX0A 3TVTA 3ZBPA 3BL8A 4K0KE 3WR5A 4KBFA 1ZJJA 3OLXA 2H1IA 4KRYA 1GNSA 4Q34A 1E5QA 4UM8B 2XXBA 3MRSA 4BMCA 5B1SA 3AF3A 3GGSA 2PJUA 2AEJA 1L4MA 1GNQA 1ZJWA 1P1JA 3RVJA 4JNCA 3ZZ0A 3PFIA 3QVJA 4TLBA 3SQLA 4M86A 3D5TA 3HKEB 4CE3A 1C9NA 1LQ2A 3X2FA 3OJEA 1W59A 1XQ1A 4WA8A 3A6FA 3EKOA 4M8SA 2FE4A 4N5MA 3KDSE 1DL5A 3RD5A 4FQ5A 2XNCA 4ENVA 5IT9A 2YNMC 4G5YA 4EFMA 1D2HA 3ZHCA 4RPFA 3LX5A 3CQ9A 3Q2IA 2IXTA 4FYMA 2WA1A 2R5FA 5BXQC 5ADVA 5HF5A 3ZJ5A 2DHDA 2EWVA 3BIOA 2V96A 1X1QA 2V4UA 3G0DA 5BN5B 1UEIA 1RCUA 5J71A 2XD6A 4TQAA 3THRA 4XIQA 3D4NA 3WL7A 3B4TA 3ERCA 5FTMA 4RU1A 3Q9NA 3PA8A 1W8IA 5GM1A 4FU0A 4LNUB 3WQRA 1GTMA 4IDHA 2ECOA 2NU8A 4NXNB 3VAAA 1NXXA 1UEJA 1S2LA 3P5SA 5JI3E 1QAOA 3C3KA 2QTMA 4S3MA 2P2GA 4LZZA 5BOSA 1WP9A 4EG5A 2IEZA 2AYYA 1XFAA 1L4EA 1H6CA 2JKVA 1QGOA 4G4GA 2QR5A 1UBFA 3NM5A 5L3QA 1HNZI 3R7WB 1B0ZA 1JJAA 3IEXA 2G5GX 2UXDI 2DFVA 1FFYA 1FNMA 3EIXA 1J1IA 4KG7A 1MC4A 3TECE 5HFNA 3F78A 3H9BA 4UBNA 1W8DA 2GZHA 4B79A 4ZV4A 3B24A 1RM3A 1Z4KA 1G63A 4DIDA 4I1IA 4R1LA 1QCYA 4EB6B 2XB2A 4HRYA 4OHYA 4PSUA 2A0FA 2LKDA 1M72A 4BQEA 4JUAA 4Z7QB 3DBHA 4KQEA 1V9SA 4ME6A 4AG6A 1M6VB 8GPBA 2QXYA 621PA 4QYIA 4HXYA 2RKWA 1KZGB 3JQ9C 4PRZA 2G04A 3PJDA 4C2AA 5M4NA 1YJQA 5BWMA 3LHDA 1UYEA 4L91A 2Z83A 1JMKC 1H2RS 5EXEA 5JFOA 4Y0AA 1L7VC 3K96A 1QRTA 3LDAA 1QFSA 1TUBA 4UZSA 4HQRA 4CF7A 4HYYA 1GTVA 4YQZA 5ALDA 1U65A 2W22A 4XW2A 2CGFA 1X8JA 2X3UA 3UH0A 4HFJA 4KVGA 4N6NA 1F06A 2C4HA 5BN3A 4M1EA 3T52A 1QF7A 3NAMA 2V7WA 4DV5B 3TNJA 4HYQA 2H31A 2IU4A 2O4UX 3R2JA 5JDCA 2QN8A 3FNQA 5GZ6A 2FX5A 2YEEA 1Z2PX 3O8QB 5HIJA 4OGGA 2W2NA 5KU7A 3WSTA 4H7IA 4YHBA 2W4IA 1QR6A 3ANNA 1CS0A 2DY0A 4PTYA 1LFAA 4MEJA 2GVZC 3CLKA 3E2IA 1TZJA 1U8UA 3CVUA 2XAAA 1EP3B 3EMKA 1YT2A 1URPA 1JNYA 3T3HA 4LNAA 4OBWA 3FBGA 2XWQA 4P5PA 2ATIA 3KETA 1AM1A 3HCFA 1LTQA 5A3VA 3V8NA 3JQ7B 5JXHA 1VG9B 1OOEA 4CCYA 2IH5A 3L7ZA 1ZGGA 1IL0A 1XXHB 1B76A 1U5BA 3H5AA 3SNKA 3K0KA 1N3YA 3RR2A 4FGJA 3BJMA 5L6LB 5LZ2A 1DV1A 1M67A 3UJ7A 1F3OA 1V8PA 8ABPA 3V5NA 2VZ8A 5SZKB 1JDZA 1LWNA 2XZLA 1D03A 4KXXA 5F3DA 3PCTA 5E4JA 2IE0A 1ABEA 1GKIA 4UOEA 4HOYA 1D0IA 1RYEA 4HAVA 1ZD8A 3U26A 5EWJB 4Q9AA 3C6XA 4TMYA 1OLXA 3EA5A 1QZ3A 3KVRA 1VYUA 3ANMA 2FF5A 2Y9PB 4PAMA 3FKQA 3GGDA 3FYUC 4YUWA 4P22A 3RRJA 1EFLA 4PPNA 4GL4A 1QGED 1KMIY 3PQ4A 3OZCA 1F8FA 2WAMA 2HMSA 1JLHA 4DV3I 3KJIA 4ZO8A 1ZXBA 3E7WA 4LQLA 4NU8X 2WAAA 5TC4A 3EIQA 1DIGA 5F1PA 2FP4A 5DCYA 5JJLA 1WJGA 2FEWB 3QX3A 4X62E 4OXRA 4XGKA 2I7TA 4DCPA 2WHXA 1KZ7B 4FW4A 3UICA 4RMNA 1EE9A 4AG5A 3WBBA 3GLQA 1UZNA 2I3DA 1YU6A 1Z15A 5A2GA 2HFSA 3D8BA 3H5VA 4WBNF 4KK3A 2XMGA 1NVBA 2FU5C 2G4LA 1YQEA 1ZUIA 1JFFB 2WWVD 4FWBA 1E2EA 4BNTA 2NGRA 3ITKA 3NM6B 2OYRA 1IY8A 2FMFA 4ZVTA 4N41A 2CJPA 3CG0A 3HCCA 2CVZA 3B7PA 5A3QA 1MABB 2Q3CA 3GEBA 4KLRA 3T0FA 1Y8PA 5JSHA 1NQTA 1AV6A 3BCRA 1VJCA 3P2YA 5B37A 4HYEA 2FDCA 4FS8A 2OR3A 2TS1A 2AMFA 3CMMA 2OAEA 1KFKB 1NI5A 4GXNA 5CFQA 3AUXA 5CNIA 5A5VA 4OFWA 1GCGA 3QY0A 4YAFA 4HJRA 5DRYA 3GUHA 3HLYA 3L5KA 3I2IA 1XELA 5T3UA 2AR9A 2J32A 4C89A 3Q4GA 3WL8A 1XCLA 4WFJA 2XCUA 1OH5A 1PKPA 5T41A 2RK4A 2CFCA 5CA0A 1QO7A 1IU9A 4WNCA 4WESB 2D06A 5K20A 3QG5A 5LQKA 4E22A 2QTVA 2QI9F 4JQLA 2B8EA 1W4BA 1G1AA 2Z6QA 3KXKA 3BFVA 3VZCA 3QJ5A 3HKDB 5A6VA 1S9DA 3ZK9A 3AU9A 4KVAA 5FNVF 2VK8A 3M6AA 3P27A 4X7PA 1APBA 1ZRMA 3LUDA 4KO3S 3TW8A 3MJRA 1VDMA 2JLAA 4EHDA 1E7SA 1ZQ1A 2GDZA 1O97C 4OF4A 1DKQA 2JGIA 1E3TA 1EM8A 3OJXA 4AYXA 3CWVA 1E2KA 1PUXA 5LZ9A 4L6IA 3UV6A 1OPXA 5BY2A 5B2EA 4KHPB 3I30X 3DO8A 3HRIA 2PV7A 4M0EA 1FTYA 3GRCA 5FULA 5C5EA 4ZZ2A 3IBFA 1FVHA 3HUDA 3SVZA 4GWLA 3ZGXA 4AXBA 4OB6A 1KBOA 3GA7A 4Z51A 2PNJA 4B3IA 4HDNB 2PWPA 4TV9F 3EGDB 1XAJA 5AI8A 1C4KA 4MR8A 1Z26A 3G85A 3KZOA 3G1TA 3UHJA 1PS9A 2QM0A 1L1RA 3H65A 3MWEA 4LOAA 3KLPX 3KZXA 3G13A 4DHWA 5BVGB 1RWMA 4YQFA 5AMXA 3VU9A 3RK1A 1FJGB 3I72A 4KR9A 1HL7A 4D8YA 1OY1A 1WB9A 2C96A 2D59A 3ETGA 2N42A 2QROA 5AKHA 2QVXX 5K0EA 2UKDA 3P76A 1NULA 1ZN7A 1SCUA 1AXRA 2H57A 3K2IA 3SHWA 5HRCA 5JVDB 1QHSA 4GRAA 3TZHA 5FT9A 3K8ZA 3FF4A 4YRGA 2AG5A 3VKWA 3MPUA 1H2EA 4R0VA 3UAGA 2VA9A 5GTDA 1YDGA 3HDTA 3IP6A 2DX7A 1L7DA 3PK0A 3ZIAD 4GFDA 5D7BA 4ASAA 4R0MA 2RG1A 2MYUA 4TTTS 4X8MA 5DBIA 1JHVA 4GCZA 1SXHA 3H5NA 2HWYA 3D6HA 4LJ9A 4MQYA 3FWNA 1ZN9A 5BN1A 1F60A 2OXEA 3ZW8A 1CFJA 5E8JA 4CM1A 4FCWA 3M1LA 3IL2A 4AX8A 1JWLA 4J1NA 2BU5A 4PLZA 3HTXA 4TV9B 4DLLA 4OFBA 1FLAA 4W7TA 4HYTA 1VIAA 2ZSUA 1K8RA 1QK4A 4M1QA 2C39B 4MP6A 4EYKA 3FNBA 3LW7A 1QWSA 4QXAA 4OO1E 1FMTA 3WB1A 1HR0E 4JWKA 4EHIA 5TGTA 2X13A 3F5QA 1C4XA 3UWPA 1B6SA 1NBOA 2EKZA 2V7EA 4BYGA 2P2ZA 5CA1F 1XZEA 2VF2A 2YYAA 2HZBA 3HXKA 2JFQA 4KB5A 1RW4A 3W1EA 4BP9A 3ZYCA 4BVKA 1AQLA 2YKEA 4ZQCB 2Z3WA 2GO1A 3H8SA 1FX0B 5KVSA 3LZDA 2AUNA 1SC1A 2R1VA 4AJNA 5K0CA 1SUEA 1B1CA 5HX7A 4C3OB 4U7OA 4Z4IA 1S02A 3GLRA 2R1TA 2IERA 2JRCA 4MI6A 4F9EA 1VPVA 3OICA 3PITA 4Z6KA 3N2IA 2P68A 5AI5A 2C3YA 3WWCA 1ZI6A 2V9PA 3FTDA 2A2ZA 4CUKA 3VM6A 5AXAA 5BT9A 2IZOA 1H5NA 1M1YE 5DNWA 4X97A 1P2TA 1I01A 3ASYA 3H9UA 3U60B 1P2GA 2PO5A 2RHJA 1UXGA 3OJ0A 2BREA 5EJIA 1YXMA 5EE9A 4OBEA 1DQSA 4FFBB 4RA6B 3DKPA 3ZWYA 3HCWA 3V6LA 2ZWPA 2O07A 3VR5H 4AUMA 3TLGB 5IK2D 5CA1B 1LC3A 2ALJA 4F9TA 2AR0A 1ZD1A 4Q3NA 5FWYB 3WYEA 1Z07A 5E7IA 5JDIA 3PNKA 5KX5A 4XGRA 2C84A 5LBIA 4P54A 2JJCA 2JEOA 5AQEA 2V1XA 2C2HA 4R1FA 4L28A 2HO5A 4OQQA 6REQB 4AK9A 4C29A 3AVUA 3E7FA 4Q16A 3JZ3A 1L4GA 2HSWA 3AIOA 4J0HA 2PS9A 1E3MA 3D5QA 3HXQA 4A8JC 4BV2A 4RM2A 4UNNA 2X86A 3HVRA 3O0IA 4FP9A 3OTGA 3OMWA 1MA3A 3PEHA 1V2HE 3LQ4A 2AMYA 1XCBA 2RB5A 1II8A 4ZK2A 2Z2ZA 4TXJA 4XQCA 2GQ0A 3OM8A 2GUGA 2UUAI 4BFWA 5FOTA 2GI4A 2OD7A 3HCOA 1VMKA 4KRXA 1AGYA 1ONOA 2DTDA 5G0VA 1B23P 2MSLA 5DTRA 2VYND 3ZK7A 2PKYX 3MWFA 1I4TD 3WQSB 2HMVA 3H4VA 4HI0E 1Z47A 3K9LA 3E6AA 2YHUA 1JTEA 4I8DA 3G5LA 4F84A 2PRZA 4Z3OA 3HKMA 3WBFA 3ADKA 5KDOA 4IFDB 4GP9A 4JB8A 3T10A 3NNSA 3NQ41 1YR9A 4IIDA 4L8GA 5EIBD 2ZE8A 4AP9A 1PZMA 2J3MA 4HVAA 2VHYA 4RWZA 2WABA 3EPPA 2UXBI 2EG9A 2DPGA 1ODJA 4LHWA 4FW7A 5CD9A 3COWA 2NSDA 2JEZA 1U1IA 3LUKA 1OXMA 1U98A 1O4WA 1BTOA 5IBRA 1XV5A 4HZIA 4EDHA 2WQ7A 2NXWA 4JFAA 3A1EA 3KJEA 4NEQA 2QQFA 2OKGA 4EA7A 4GEGA 3ON5A 5CYGA 1N5JA 3R8CA 2C95A 2R8XA 2ZBGA 4F46A 2BR2A 1G20E 2R7NA 3I6IA 1R6AA 1LTKA 3FHOA 4PYQA 2OQ2A 3G2QA 4CCAA 1S4MA 3O3OB 5F9HA 3VSDA 2C9BA 2HWWA 3WP0A 1NBME 3E70C 1RLJA 1DX4A 1CQWA 4Q4DA 3FVVA 3FZGA 3SXUA 2ZRFA 3KE8A 1UZLA 2VTBB 1JPUA 1NC1A 2QVLA 3WNQA 3NJRA 5IKOA 2XE6A 3UANA 2LV8A 3DG9A 4I66A 1JXAA 3OZIA 1XDUA 3CRQA 4HX2A 4ZICA 2Z9DA 4ARSA 2QZ4A 1DX9A 1ADCA 2Z2KA 1RI3A 2XMQA 5K0BA 3L1UA 5C52B 1MR3F 4XWWA 4GNKA 3JV7A 4LZNA 4YIKA 3VO2A 4P7KA 5DNYB 3U49A 2OLEA 4EPYA 3IMCA 4C05A 2IW1A 3RYCB 2ET6A 1CUZA 2QZPA 5IVKA 4IJWA 3RARA 4ZIRB 4GT8A 3F1LA 4ZMSA 1KORA 1NQ5A 2PUVA 5AKIA 3DHNA 3C41J 4L0QA 1JJ7A 2B20A 5KYXA 5K3EA 4LHSA 3WLTA 3ZE6A 1LNQA 2C9OA 5KAPA 1PJ2A 1Y3FE 4EPTA 1IMJA 1ATZA 1Z17A 2PMEA 4B3SB 2BFAA 2ZPAA 2H54A 2R8BA 3Q9LA 4DJ5X 3VR1A 3B3JA 1A5BB 1QKJA 5C46F 3N39C 4Q4JA 1EEHA 3HA7A 3AHCA 3EDYA 2Z5LA 2HH9A 2IF2A 3GDFA 3EISA 1SCNE 2O7QA 3LX4A 4HADA 3KKPA 2JI4A 4OGLA 5E7JA 3UOWA 4MW5A 4BEBA 3CC8A 3TO5A 1JFRA 5ITZB 2VCYA 2IYYA 1OBFO 2GXQA 1GV1A 2N46A 2AF4C 5I9SA 1ZAYA 4N0PA 1HM5A 4PF1A 3KTAA 2M1ZA 2K5UA 4NATA 5FLEX 3E58A 4DQKA 3PRHA 2WJZB 3UKOA 3PR3A 4HZUA 1NUSA 2RHBA 4KLAA 2NQ8A 2F1DA 2WMOB 2C2BA 2BSAA 1Y0BA 2X8AA 5AVWA 1U31A 2DECA 4KXYA 3PX3A 5HF6A 1VI7A 3LLCA 3DLIA 3LECA 1D2RA 1BIFA 4CEJB 4OJYA 1NMSA 4UM9B 2Q4DA 2X1HA 2E5LE 3H9JA 4NOLA 4AJKA 3ZDFA 1ZOIA 5A04A 1GAEO 4DR4E 4QHSA 5DI9A 3W7VA 1NQUA 3FKSA 4JXKA 3ZN2A 5C8XA 4PAGA 4IIVA 4JI6B 4MK4A 1P1KA 3BMCA 1VL5A 4X6XA 2V5VA 4FYPA 2JEAA 2GDJA 1L7BA 3EZ7A 4NONA 3KKZA 3G2NA 2Z04A 4M8NE 1N9ZA 1R8QA 2OD9A 3NKVA 4KWHA 3B9RA 4FC7A 2P3SA 2EXXA 2CKDA 1EXDA 1AQNA 3WADA 1Z5WA 1W19A 2PIAA 2A6PA 1H2WA 5IAKA 2Q4BA 3O4HA 5DX8A 1KOFA 1XAIA 1ATIA 3W8NA 3ZR4B 2XB9A 1KNQA 3GROA 3HMKA 4QAJA 3UQZA 1V7ZA 4YHHI 1SOMA 1PJ4A 3UJ9A 3KSRA 1JLLA 5THXA 1A9YA 1M73E 3QX7A 1KH1A 2CNKA 2GXSA 3DLCA 2G9VA 3QLTA 2WIJA 3WLJA 2P2SA 2HLNA 1KAOA 4M8KA 3S5UA 2XF8A 2PMDA 1P6QA 2OBXA 1WBDA 1TBWA 4ZYZA 1IEQA 1JI0A 1E7WA 4CEHA 3PKJA 1IEVA 2X77A 2AKYA 5JEEA 3DULA 2B92A 1JR6A 3TCNA 4Z99A 3JAMA 3C5WP 2YFHA 1XCPA 1GZ4A 3OJWA 2VDWA 3QNWA 3PJFA 4HNHA 2ZRNA 5IVHA 1X7WB 1F6DA 1VLZA 5G1NA 5I9MA 1XPUA 3A0YA 4YJHB 4BMYA 2BTQA 4RNCA 3QTBA 1HE3A 1MOSA 4XIJA 4KV7A 2QTTA 2Q3EA 4M83A 3V1NA 1G4UR 4OOFA 3QW2A 4XD7D 4EF5A 3VR5D 4CM3A 3LXUX 5LQDA 3DEFA 2OORA 1Z88A 2XUOA 4U2GA 3ZEAA 1C8LA 5BNWA 4ZGWA 2EU8A 2IVZA 3LX8A 1QB7A 4J9VA 4S0ZA 4XA8A 2ZR7A 3KRTA 2NP6A 1GZ5A 1XVIA 1KDRA 3PGXA 3EXIA 3U3DA 2FZKA 4I1UA 4ZYWA 3QVLA 4N49A 3RS3A 1M54A 2WOOA 5E6RB 1XPRA 4IV8A 3UKDA 2YWJA 4QQFA 1RRVA 3P0RA 4OLAA 4JT8A 3A4YA 3TIVA 1M8GA 1SCDA 3BE4A 7MHTA 4HDMA 3OKPA 2MIIA 4FQ8A 1JMYA 1XJ5A 4PR0A 4WZAB 5SZHB 1HGXA 5JAOA 1XMJA 1TXGA 5LYJF 3F5SA 4PSKA 1SUDA 3R6LA 2PZKA 3W6UA 2Y0DA 3IPRA 4GXTA 4BRSA 1SO8A 1H69A 3CUVA 3HM2A 3AVVA 3M6VA 3WJ7A 4LGVA 1JAYA 1C1DA 3ZDEA 4ETNA 3CUKA 5C37A 4NYMQ 3Q7SA 2VQEB 2YZNA 1ZESA 4B1FA 2EL9A 1KMHA 2E0IA 2RAPA 3OJLA 4DR3E 5CDSA 3DBRA 1MJNA 3MVEA 4FQ7A 4CDNA 3EXFB 3V7FA 1IN7A 2FG7C 1QMPA 1YRWA 3JWIA 1ZNWA 3KSUA 3Q41A 2P5UA 2ZI6A 4Z9YA 4GDMA 3PDHA 5DNCA 3S5JA 3SC2B 3UWSA 4G37A 2G70A 2BCEA 3AETA 2C8JA 3OTWA 4ESVA 5M5BA 2EL7A 4AWOA 2NXCA 5CG2A 1HDOA 4AJ1A 5EIHA 3DNPA 3KOYA 3DMTC 3KL2A 1XOIA 5GWXA 3DJYA 1X15A 2I3ZA 2RIRA 2VNIA 3VMFA 4DCGA 5LYJB 5B30A 3NGLA 1CUFA 1T5DX 3QPAA 1XRMA 3OWBA 4RD0A 3SHTA 5H68A 1BFUA 2JCXA 2OV3A 3SY8A 4UARA 1ZUNA 2Y92A 4JT9A 2FMXA 5DU2A 4BO6A 4ISCA 4Y6GB 1YH3A 4RL4A 2ZQYA 2GZRA 3V34A 1E1NA 3GRZA 4KN5A 1G7CA 2XYHA 2Q8PA 1C41A 4BCBA 4EATA 3CNHA 3MK31 5E3JA 3BDAA 2NYUA 1AQUA 4XH9B 4A10A 4UVEA 3JQEA 1FTGA 3CRRA 1XSEA 5JWHA 3AM3A 4D9EA 4PHGA 1A71A 2DR3A 3WS7A 1Y6QA 3PPWA 4C4XA 1WSBA 2GHRA 4YXWD 2FW6A 5BUQA 1NW8A 3HB7A 2FZ5A 4IIGA 1UYHA 2J9FA 3PBKA 1UDQA 5BSTA 4R2JA 2BMJA 1TTQB 1WSDA 4EARA 3R44A 4DLBA 2J30A 3DL2A 4GKKB 3HP4A 4G3XA 1RLOA 3TIGA 1P60A 4MO9A 3AJ9A 2OB2A 3P71T 1TO1E 3DOHA 1L5NA 5LQAA 1KRWA 1CUJA 4QASA 1BEUB 3AY0A 2QN1A 4FT2A 5LDDC 3FSJX 1U3DA 2PZBA 3I28A 2FE1A 1XK6A 2D0PB 1OTYA 1M66A 2WJ6A 1FVOA 5BYJA 1TAGA 2ZK7A 1AM4D 1X70A 5LBTA 1NY5A 4GSKA 4DUZI 3SIPA 5L51A 3H3JA 4JASA 3ROMA 1PKXA 2IQIA 2ZJ8A 3QZUA 4JGIA 4NE2A 5IAOA 5AM5A 2PMKA 5J4HA 2XDUA 5IJZA 4XI9A 4KX5A 4EKYA 2HN9A 5EWMB 2DM6A 4I7EA 1A9XB 2RGWA 4FGWA 1KDYA 4MKZA 3RLQA 1FTQA 4XFKA 2IVFA 3RSFA 4LWPA 1XMOI 1P74A 4OYRA 2IYRA 1E0KA 1L5ZA 3F3SA 1TM4E 1SCKA 2OV2A 1K7FB 2ZB7A 1D2MA 3M4ZA 1H23A 1NM5A 1NYQA 2VHEA 2GPYA 1RXVA 4ZT3A 1UJNA 4PFSA 5IJXA 1SD5A 3T7TA 3QWFA 5B58T 2IXDA 2PUDA 1T1RA 2H8GA 1RVV1 2NZ8A 4PRXA 3GNSA 4LVCA 2XLBA 1ODTC 2EZTA 4V0OA 4YO7A 5CDYA 3PENA 1UADA 1SOWA 4DV6E 2CLSA 2I71A 3TXAA 1V48A 2IDMA 4YAOA 1JEYB 4NJMB 3BH6A 5DT9A 3SIRA 2EQBA 3V4VB 2Z30A 1UIRA 1FFEA 3PUHA 1G38A 2QRVA 1OZ0A 3SZ3A 1G59A 2BEVB 4ON9A 3BXEA 4ER3A 4YLGA 2GCOA 4L4XA 3JQFC 4IIJA 1I6LA 3H7IA 1M10A 3FCYA 3BORA 2HT1A 5HF9A 2GRJA 2VH2A 3UKJA 1MH1A 2PO0A 2MSNA 3ZJTA 4HNAB 3FE2A 2F4VI 2GR9A 5JYCA 1GZDA 4Q12A 3MT7A 3KWLA 4PS0A 1EVIA 2ZVDA 4II3A 1LRJA 4KFUA 4F3NA 2HY7A 1W7AA 4OCZA 2Q07A 2RGNC 2FLWA 3FVWA 2C8VA 3ONFA 4URUR 3IHWA 5A5DA 3JRXA 5CDUA 2O8NA 4W5QA 4B35A 3ZJ4A 3CKKA 2ODPA 3H3XA 3M82A 2F3RA 2PH7A 3FTEA 2VPIA 4BFSA 3AHIA 3C3AA 2CBGA 1YWGO 2R6JA 4NMLA 1Q74A 4KPUA 4DMMA 3R4MA 1D7AA 2OCBA 2GM3A 3JQ8B 3HPQA 1W30A 2VPWA 1XA0A 1YC4A 1CUCA 3HR7A 5FI1B 2GEKA 2OCKA 2P9YA 3U5ZB 1PVOA 2E87A 2X7HA 1FP6A 4KQ9A 2A5YB 1KAMA 3P3GA 4QPCA 2XUGA 3EOBI 2WA2A 5LXTA 1NC3A 1WOMA 5DNEA 1CR6A 4N3NA 5LNK1 2PT9A 1BX3A 4CV1A 3JQGB 2QD4A 1NUUA 4AZ0A 1SD2A 2YVUA 4IYRA 5KTSA 1YC1A 1TFUA 4Q1DA 4HAXA 1U3GA 2JANA 2FB9A 4ZTUB 4K6OA 3D3WB 1S0UA 4JZKA 4DV1I 5L45A 3EULA 1GLGA 2IUUA 2W8ZA 4M1OA 2ZW9A 3STHA 5BSKA 3JYOA 4EI7A 4MRPA 2O59A 3TRDA 4B3GA 1ZSYA 1R62A 1Z06A 4A23A 1IZYA 2DLDA 4LSWA 4MTCA 3E8SA 1QGZA 3CZCA 3QPUA 1AMNA 3BIWA 1PW7A 4CTJA 4GRDA 3HYYA 3SFTA 3GQBB 4OKSA 4NAVA 2P9TA 1Y63A 4PWYA 3T4PA 3UV3A 1C30A 1P1CA 5KTRA 4G0OA 4V0NA 4MLZA 5C1PA 1JIJA 1Q15A 1Z0ZA 4ZI7A 3ZDRA 4B6FA 4YRJA 1TEXA 1ZHFA 3BRSA 4MWDA 4HY1A 3EHHA 3U3RA 1AE1A 1E63A 2QM7A 2O52A 4QO7A 4TKVA 2G07A 4DXLA 4JLDA 2XQFA 4G1EB 5L40A 2WFMA 5C5DA 1GP2A 4GWGA 4R98A 3GLUA 2Z1NA 5LLTA 3R4CA 1CFZA 5C0XF 3CF4G 2J3DA 4WKCA 4WPGA 3DMRA 1Z0VA 4TVOA 1VI6A 4YY3B 2QUJA 3NV9A 3AFOA 4NCKA 3Q6MA 4IVNA 2PUWA 1PQWA 4X60A 4FNMA 1A8SA 4RV4A 1P7WA 5BWCA 3ODPA 5CBPB 4ID9A 2XUFA 4FGLA 1PAUA 3NJ8A 4KUEA 2OCPA 3N3AC 3C6KA 3HLKA 1NRJB 3KAKA 2IUEA 5ALNA 4S1NA 2QMZA 2CDAA 4WACA 1QZRA 3CUYA 3A2NA 5E7MA 1O6FA 2GO3A 3A1WA 1UOPA 1IN6A 3KQPA 2WU3A 1XPJA 4EKGA 1I94E 1UM9A 1L1FA 2QYTA 3QG1A 2CUKA 4TXHA 4JC4A 3K2QA 4GMKA 2EOAA 3NBAA 1SZJG 2AD1A 4BNDA 3RTCA 2XKAA 3JZAA 4HPXB 1R5OA 2QRQA 5J2UA 3SZMA 3R5SA 3RS7A 3PUIA 4YJGA 5AK4A 4N3GA 1M2KA 5HTOA 1MG7A 2OTCA 3TTYA 1YH8A 2FXIA 2I6GA 4GOXA 1NVDA 3GELA 1NHIA 4G0YA 1MUUA 4MW7A 2XHRA 3CE9A 3BE5A 5K3DA 5KU1A 3KYIB 5JG7A 1R3DA 4USMA 4R2HA 1QB8A 4NMHA 2IYOA 1VLJA 3HS3A 3HJHA 3KSAC 1C7EA 3WOHA 3D7LA 1J49A 2ZJ4A 1KSHA 2X5OA 2CT8A 4J0GA 3IVAA 4HEJA 2E4AA 3P9CA 1UP6A 3WIBA 2VJMB 1P0FA 1ZMOA 1Z22A 4JLMA 2WD7A 2ZSFA 1NXTA 3BMXA 4NYIQ 2BEUB 1IQPA 1VJGA 4NBWA 1ZONA 3LKBA 5EJGA 2YNMA 3AL0C 2BGTA 3F90A 4KE9A 1C1YA 2CLOB 1PL6A 3TGWA 1LI4A 2GM9A 3VNVA 4LCFA 2ZKLA 3E7XA 1PQPA 2EGHA 3E9CA 4EY5A 4PC1A 3DFFA 3NVAA 3TLEA 4ALNA 3I09A 4UBLA 4OGKA 1GPAA 2F59A 4BLRA 1P9RA 5DBHX 1PS0A 4L72A 1F0KA 3DE6X 1XRRA 3F0NA 3R7FA 2ZBVA 4PN7A 3NM4A 1FKAE 2V8OA 3NDPA 3W9SA 3EEOA 3URKA 4L02A 2QT0A 3DMNA 4RZUA 3OPYA 4RIEA 5FEMA 3OM9A 2GYWA 4Y0NA 1YB7A 5I3CA 2Z2YA 1GVNB 1WNFA 2OB1A 4B4UA 4R3UC 5ICFA 4DMLA 1MQ8B 4ND8A 4MOTA 4KFGA 2AMVA 4QARA 1UOOA 4JJ7A 3DTVB 4N7MA 3H84A 4P86A 4D6YA 2H8MA 2AOUA 4MS1A 1UMDB 3ECSA 4GH5A 2OBNA 3PYFA 4JYAB 4ZCTA 2ZKJA 1G7RA 1JEDA 1RRKA 3INNA 2P41A 2XH8A 1EYZA 4FGSA 5TPWB 3GZ4A 1ZNQO 1DAEA 4D3SA 5IUNC 5HKKD 3WQ9A 1LH0A 3ZIAA 5HFAA 3OPMA 4S1OA 3A27A 3S2ZA 2VLIA 3IQWA 1Y5YA 1QFJA 1II9A 3EVGA 4GVLA 3CTMA 1YZLA 1CUVA 2LKCA 2C20A 1EGAA 4C0HA 1YI0A 1ZFNA 4M1SA 5A2QQ 4C7MA 2WP8A 3AHGA 5HK8A 4QUGA 4YKUA 4YDQA 3CBQA 2E5WA 4KSCA 4KNWA 1Z0AA 2FJPA 3BXXA 3E0QA 3VZRA 3CONA 1M5TA 1IG0A 3FMVA 2HNAA 5KOHA 3DM5A 1O5IA 2I6UA 2Y99A 3O2JA 3GVCA 3B27A 1RJ9A 1EBFA 4HLDA 3KQWA 2Y3IA 4O4HA 1W0KA 5K4AA 4LSMA 4BQQA 3ELYA 1REQB 4E13A 5L6MB 5J4VA 4KH1A 5M7EA 5I7OA 1WY7A 2BF4A 1PTKA 2OLKA 3LVQE 2V1UA 3DTTA 3EVEA 5LU9A 3KVOA 3AC0A 1YC5A 1GU0A 1K06A 1JUDA 3L4KA 3L0BA 2PTHA 4WFKA 2GEVA 3R6DA 2AE2A 1E2GA 1SK9A 4TROA 1V45E 2VBIA 2HM7A 2EFJA 3FPEA 4DV2B 4H6PA 1CG6A 1XEFA 3KHKA 2IEYA 4BY9E 3S2YA 4MAFA 2VDLB 1J23A 3VH2A 1M0WA 4TTIA 2JVKA 3E1GA 5AWFC 4CKCA 2EZUA 1N92A 1EJ0A 2Z9CA 5DNAA 1CHNA 4YRCA 1N0VC 2YY6A 3TEFA 2NUPB 3RVOA 4DUYB 4LJRA 4OMCA 4U2DA 3C3CA 3NBZC 4UTZA 1MZVA 3M70A 2CHEA 2R00C 5KREA 4XLZA 1KEEA 3R0JA 3UC5A 3NW9A 4QOFA 5K8UA 2Q7DA 1H6BA 3UJNA 1V4VA 1Z08A 5AHKA 2J9GA 4Y7CA 1QP7A 1G8FA 3WGYA 3PHLA 1N1GA 4NXNI 1WIWA 1A1VA 4NZZA 4IWXA 2DB3A 5GPBA 1KH3A 4ZAGA 5D51S 4H60A 1HETA 5IK2A 5F3RA 4OBXA 3R6TA 3PEJA 4B9AA 3O1LA 3U4MA 4GYJA 1XK7A 4R3AA 5BV1A 2NP7A 2PKEA 3TSAA 1Y8AA 1G5FA 4DADA 4BRWA 4D9FA 10MHA 4HHEA 1EUZA 1KNXA 3UCXA 3STXA 1NN1A 1G21A 4NNPA 4LDPA 3LW8A 4F1KA 2FW7A 3T5AA 3B1FA 3T12A 3FYUA 4LF6E 2XCMA 1IBLE 2WZDA 2FYPA 3CVWA 1J7JA 3EQZA 1UYMA 5FUYA 3EEIA 3GZNA 3FMIA 5LWHA 1AA9A 4TS3A 5EC8A 4U2CA 4WN9B 3C8ZA 5E7QA 2M98A 1J2JA 4K2HA 4AWBA 4BLTA 4BE9A 3FCUB 3CZRA 1G2IA 2H4WA 1DJPA 4C2UA 4EAQA 1NDHA 1AHNA 3K60A 2D5IA 4DZZA 7REQB 3BCSA 3OO0A 1EP1B 4URZR 2YMLA 1NWCA 4OI4A 3IGFA 2VYNA 4DFDA 4M38A 3T3EA 4YJFA 2I1WA 2NNWB 1K8YB 1Z0BA 2QD1A 1A2BA 1GTZA 1QS0B 1KOJA 2QUBA 1A2QA 4LSZA 2CG9A 2DPYA 2VDVE 2AG6A 1WZNA 2I8LA 3BHMA 1MJHA 3O1HB 2RKOA 2AJTA 1F2VA 2BKXA 1DELA 3VSBA 2FSVA 4HP8A 1SG9A 3NHKA 3WA6A 3ZDBA 4L8FA 4NK4A 3ZZTA 5K0FA 2P9ZA 2Z5BB 4B5KA 1EAMA 5CW1A 5KCZA 5BYAA 1KFCB 1ODLA 2WOJA 3BTVA 1J33A 4AD8A 4TVKA 1PK7A 3K6RA 4E11A 3CGZA 5LMNB 2Q5IA 3I9OA 1DAKA 2BI7A 4FYIA 1M2WA 1M6HA 2R0QC 3AR2A 4G5HA 1N7GA 4HNQA 1C1HA 2ODWA 5LN1A 3KQKA 1PTJA 3I2KA 4Q9HA 4A3SA 3FFAA 4RKEA 1FJHA 4UHCA 4KACA 4UEQA 5JJCA 1E4YA 3RV4A 3LLUA 3WC4A 5DM0A 5FL7D 5J58A 4XZ3A 1KY4A 4RE5A 2HFKA 4WAUA 5E3HA 2GQPA 1O94C 4R2KA 3AINA 1I3MA 3GBPA 4FE4A 4KR2A 1A88A 4NABA 4CKWB 1GYQA 3H4MA 1F51A 1EGHA 3ZLJA 5JTTA 3WK9A 3VHCA 2UVPB 3PQDA 2IP1A 3QBEA 4G9BA 4FWDA 3EXEA 1U7WA 2ORYA 1U0GA 1VBMA 5JEAC 2ETXA 1RXYA 5A62A 3GJ4A 2X19A 4O1MA 5EYPA 2JAPA 2D00A 1U6JA 4RTQA 2ZIGA 4KE6A 4FN5A 1LDNA 5ELMA 3R3SA 1KAEA 2O8FB 3KTOA 4WBNB 3FPSA 3QXJA 3GMSA 2BZ1A 1MV5A 3G9XA 1S5PA 1YRBA 5LMZA 2YJWA 3NUGA 1X0XA 2YZ7A 1FRZA 2HA7A 3UHMA 1YMQA 5AVQA 4MWGA 4JP1A 3D43A 2YNMD 1J99A 3A6GA 3BF8A 1EUCB 4Q1AA 1YDEA 2AX3A 5DYYA 4NBSA 1UK7A 1XD2A 2VP3A 4YP7A 3ETLA 4XDMA 3IPCA 4U3JB 3CURA 2CSUA 1L4KA 5BWNA 5IWAB 2VK4A 1V2GA 3EUAA 1SHLA 2YE3A 5KAMA 3EN0A 4S1WA 1UBKS 1BKDR 4UREA 2BDEA 3SDZA 1Y6ZA 3A6PC 3ROQA 4I9UA 5H3LA 4JLNA 3U0VA 2HXSA 2P9GA 2GCEA 4DSOA 2DSNA 2XDQA 3B3QA 5KEIA 2ZBFA 4JR1A 1T91A 1FYDA 1YR3A 1CUIA 1XTIA 4ML3A 4N6GA 4RLSA 2P77A 4CE1A 5IKPA 3SC3A 2R60A 3D6NB 4MBCA 2FVYA 3OURA 3GFBA 3MQFA 1MU5A 1CDDA 5FNVB 4NP6A 3ZLTA 3RWBA 4C2TA 3L0IB 5IDMA 2PDAA 3S2GA 3RT1A 1K97A 1Y8OA 3A4VA 1WWKA 5IYZA 1T4CB 2X41A 2W2PA 4QREA 3QU5A 1PUJA 3M3DA 1G5RA 4HXGA 3F4KA 3V33A 1A97A 2CFTA 4GP7A 3SSOA 4L3VA 4LV5B 1FPQA 1EFAA 3VUEA 2Z6VA 3AJ8A 1DCFA 1H72C 3SSAA 2ZE5A 1QOPB 5JCJD 2CVPA 2WJGA 5HVNA 4OQNA 2XRZA 1PN3A 4V0KA 2B0CA 3TTXA 3TI7A 4NYJR 4ETIA 2YE8A 2Q6LA 3P9PA 4G36A 2RCNA 3OPNA 1RYNA 4RABA 4URHA 1AQIA 3LDGA 3P4YA 3TZBA 3PYEA 1NURA 4TLMB 4QSMA 3TQHA 3MT9A 1WXFA 3OZTA 1AH6A 1QIKA 1TPZA 3OTQA 3ZDZB 2FFHA 3BA1A 3VVBA 1W0KD 2A9FA 1LPSA 2AE8A 2Z98A 4KHPI 2PL9A 3RLFA 3VGPA 2BEKA 1OX4B 4LJSA 5F3WB 3L6UA 4EY8A 1WXEA 1DJNA 1DDGA 1PFKA 1F5NA 2PK3A 5G3ZA 1Z2NX 1VFPA 2B35A 4G56A 4QRDA 3LDFA 2FZ4A 2VZ0A 4IFIA 1OH6A 5LP6C 3TQIA 1GRCA 1KPIA 1MTZA 4LFAI 1J20A 3N8NA 1U0EA 2ZYUX 2BFFB 3W4JA 1KJ8A 2QNBA 1FU8A 5KKCA 4DCNA 3OEED 3OJOA 2IIBA 3ZPXA 2XHTA 2ZIZA 2RGCA 1LJLA 3F3MA 4TYYA 2CLDX 3OFVA 1SQSA 4C5AA 4ZRMA 3CRKA 1FJGI 1S8OA 2W2MA 4Q4HA 5F98A 3A6DA 4BEWA 5EE3A 3FUXA 1YGPA 4PYOA 4JY7A 1NPTO 4XD7A 2BSQA 1TOAA 3VR5A 5JCZA 4JXZA 4E6EA 1VGRA 3RVDA 1QHFA 3PVZA 1TK2A 2QG9A 4BMVA 1Y1QA 2C03A 4TWBA 1Z7WA 3TLAA 3NHZA 4C3UA 3BL6A 4LOMA 3UT5A 3EZ2A 1UPFA 4R6XA 3L93A 1SB9A 2H2FA 5K45A 4AY2A 2IHKA 1DCMA 1SG0A 1LF0A 1KDOA 2ZS7A 4FYYA 5ALLA 2C82A 1DQNA 4ZCMA 3RGGA 1BXZA 3A58B 2ON6A 3REQB 4EO9A 4EG0A 4JB0A 1QO9A 4NX2A 4HQLA 4QDZA 2OI2A 1QIJA 4EKNB 3PRYA 3W6PA 5C4GB 4LXYA 4MWTA 3MTAA 5AIBA 3WIDA 3CW9A 2ZSJA 2QMQA 4UMEA 4YK7A 1UBUS 1WXWA 4DMGA 1NONA 1UZUA 5KDLA 2PN1A 3Q3JB 5REQA 1NKTA 4BFXA 1G291 4KPYA 3K5PA 4LPFA 3L46A 3O8RA 4MYRA 2XDSA 4OBBA 1XTQA 1ENZA 4J7UA 2I99A 5JZSA 3NT5A 3ZWNA 4RMJA 4MWCA 4LYJA 4OLJA 2EBHX 4JXXA 4HATA 1XNQE 5FA5A 3CJRA 4C4AA 2VCJA 3IELA 4LYDA 1TW2A 4DRXB 4CTKA 1KYIA 2QTHA 3ZHBA 2QJWA 4H08A 1M6YA 2AOWA 1VSUA 4DLSA 2ORED 3E22A 1KI9A 4QUBA 2V74B 2QENA 3DLPX 3L8MA 3KOOA 1NOIA 1KAGA 3NHYA 2JE6A 3ZHYA 1RWKA 4JYBA 1X94A 4PPQA 1FDOA 2VJQA 4NCNA 4WZBB 1DQPA 2YVKA 2X9LA 1H0SA 4I8XA 1Z8DA 5TRTA 1E5TA 1J5EE 2X8JB 2BLNA 2O2GA 2WG2A 2OBFA 4K6HA 1EFVB 1PDOA 1WHTB 4R1TA 3W9YA 1FXSA 4L8ZA 1DJLA 1EDBA 3TMAA 3G82C 2XMPA 4YJDA 4PZZA 3ZNPA 2BFCA 1BHJA 2C37B 4JI3I 4B4KA 2CFIA 4QU0A 1W88B 4F5DA 1CIPA 3CLSC 3PX7A 4FD3A 1ZM3A 2G6TA 3L7AA 5ER9A 4LVUA 2NVBA 2EKQA 5AUOB 1I5DA 2ZETA 4OQYA 4R68A 3WK4A 4HAOA 4BYMA 4B7ZA 4PZAA 4I3FA 5CNKA 1YIOA 1WV1A 4U6QA 1FMCA 3VU8A 5GMEA 4BNIA 1V9CA 4RD4A 5I9LA 3HY4A 4WWHA 4EHLA 1NJ2A 4L9SA 2BGJA 4MMYB 2C4MA 5KOIA 5C7YA 4H7EA 5HKOA 3W5VA 3L0PA 4X90A 3JQAD 2OVFA 3HZOA 4HXWA 1N7JA 4LOHA 1DDOA 1QUFA 3FAKA 4F92B 2G1UA 2GKGA 4RH1A 2ONJA 2XYGA 1UDCA 3KFLA 3R0VA 1WO8A 2KHZA 1W47A 4BKUA 5EEHA 2DJIA 3ZJVA 3HUFA 2DWCA 3PQ3A 1MQAA 1BE1A 2COEA 2E55A 5G4KA 4YXWA 4YA6A 5U4QA 4EM6A 4O8CA 1RACA 4DR1I 4BIIA 4CEIB 1C8VB 4UAJA 4ZP1A 2OUKA 3T1OA 4IZKB 3ZUPA 1UJCA 2G67A 1PQYA 3G0GA 4AWQA 1O97D 3M89A 2J08A 4UDNA 4F1JA 1DC3A 4KXWA 1F38A 3PHHA 4YJ2A 1YOVB 1NQAO 4B34A 2ZRHA 3GJZA 3CZPA 2VDOB 3LCVB 3TF5A 1V4BA 3IKLA 1Z16A 2V2ZA 2VNJA 2ZIWB 2BMFA 5CIWA 1SQ5A 2Q1XA 1JZTA 1OWOA 1P4JA 1KZNA 1IIRA 4ITVA 1OFVA 3M5WA 2X7JA 3PC6A 3DAOA 2CD7A 3H04A 2BGMA 1VKRA 5J43A 3HU5A 4BA1B 4BX2A 3Q8LA 4Q15A 5MHTA 3WLSA 2FZCA 3LUAA 1A5SB 4N1AA 4QYXA 1TYCA 2ZQ5A 1T5TA 4FN4A 2YS7A 1MW8X 3TD9A 3N2ZB 1JG7A 3DVAA 2HT6A 4QOGA 2QPOA 1AS3A 1QK3A 4N3AA 2ODAA 3GRPA 4EG7A 4B7AA 1E3EA 2GO4A 1L7MA 1VKZA 2VP2A 3JZIA 5EHZA 1FDTA 2WNSA 5JYBA 3A2KA 3UFBA 1EVLA 3ROPA 2AF3C 1ZEMA 2POCA 4Q01A 5K03A 3NHPA 2AOXA 1NI4A 3D6AA 2ST1A 2IESA 4FWIB 4LXIA 1YRYE 4C4ZA 3I8XA 3WGTA 3MT8A 3T1HI 3GLGB 1JYSA 1VZ2A 2NOAA 4QPDA 5GONA 3RU3A 2A30A 4NCIA 2P67A 4O8ZA 4QM7A 2AS0A 4H6WA 2RH4A 3D2AA 3R8XA 4MB6A 3I5MA 3VTAA 3TXYA 1TYEB 4QNJA 4BWGA 3TZCA 4TVBA 1TK9A 4HYMA 4AS9A 4G8DA 2PH5A 2EKDA 3EQ9A 1M9NA 5EE5B 4LOLA 3OC0A 4U3DA 4WCFB 3RREA 4HH1A 1DJQA 5DCWA 1TF2A 4ENWA 5BWBA 1GN8A 1SELA 5C0OE 5GQSA 4CWSA 1DIHA 1Z5NA 4QTZA 2Q9CA 2J48A 2AC2A 1EZ4A 3FYSA 4IGFA 4E07A 3U3KA 3TFWA 3UW3A 3U37A 3JVEA 1NX6A 1FYWA 3UA4A 4GBGA 3GVHA 2QMUA 1K5HA 2WMNB 2CMDA 3QRWA 2D2VA 4E4TA 1IIBA 3NYQA 5K6TA 4W7HA 1BA3A 4Q24A 4LFCE 4BA2B 4B3SI 5ITWA 3KO8A 1X2EA 4R1MA 1IUPA 5CPHA 1P4GA 3WLFA 1C14A 4P4UA 3H87A 2Q62A 2NSYA 1FQKA 1KJZA 2HFUA 1M6EX 1OAKA 3RF7A 1PD1A 1VE6A 3SZUA 4Q6WA 2UU9E 5AJUA 3PXXA 1MAWA 4LHYA 5COQA 3QHPA 2BBTA 4QOHA 4P80A 2EEPA 3KYDA 4OLBA 1QK5A 4UEOA 4HAWA 3W2GA 2AOVA 1YOBA 3PHCA 1KE2A 1NLMA 2MINB 2Q3LA 3GR6A 1NKSA 1DBIA 5CTXA 3NOXA 5F76A 1JDBB 1XMXA 4CKEB 4AMGA 5CXUA 2ZUTA 1ZUHA 2VWPA 5FFFA 4BMXA 4GFNA 3ZGYA 4C7KA 4DGSA 1QHHA 2JI6A 1YTLA 1U8CB 1PW5A 4HWPA 3ZLVA 3DZCA 2ZYDA 2NO4A 1E79A 2PKCA 3EH1A 3NYWA 1PVVA 4FD2A 1HKHA 4CR8A 4FR5A 1E69A 1UXIA 4PVDA 1TH8A 2IUSA 5B4UA 1GT6A 4TTSA 3PS9A 4H77A 2JLQA 3K5WA 1CWUA 1AC5A 3PU6A 1OU4A 1NJGA 2FN3A 2C2WA 1SBCA 4FHGA 1CPYA 1L8OA 2QVGA 5D3QA 5BSWA 4UTXA 4C2BA 2R25B 4CL8A 3OWHA 1UCFA 3UY4A 2QORA 4OAOA 4N48A 4WN3A 4EMBA 3MJDA 2MSWA 3OF2A 6Q21A 3TLXA 2WICA 2AYXA 5LPNA 3A0RA 3DV0B 4JC8A 2QN7A 2WT4A 3ADDA 2H00A 1D8AA 3T15A 5J4LA 4M9UA 2W2QA 1Y60A 4E5UA 1XEAA 4NV0A 1MHPA 1OFUA 1XTZA 2JI8A 4BQRA 4INJA 5CLJA 3DOEA 2QRHA 2K4MA 4UHHA 5G53C 3ISVA 2HDHA 4QQNA 2IPXA 5DO9A 1J39A 1V11A 1H3EA 2ADMA 1R0YA 1VA4A 4GE3A 5JU6A 4OQFA 3TZ0A 1CDEA 4FMCF 5ITSA 2CYCA 5ILOA 3KIPA 1P18A 3TNLA 3P96A 4PQYA 4WEOA 1SHZA 2IWXA 2WW8A 4M46A 1DPGA 4Q1CA 4CLHA 2J9XB 3AU8A 2XYPA 4LOJA 1RR6A 3VGJA 1R9NA 3DMTA 3R9XA 2ZJ0A 4LF7B 4LGYA 1EBBA 3D0KA 4GKJE 3M8KA 3OLZA 5I9NA 3M6WA 1BU5A 4B73A 1Q95A 2NG1A 3ULKA 4U7NA 2NXEA 2IUFA 4WBXC 4ZT6A 3K85A 2XUKA 5B3AA 3AF1A 1SHKA 1N5MA 5TB5A 1Y7HA 1SBTA 1NW6A 4IJVA 1JH9A 2H7VA 1L8QA 3N0WA 1U2ZA 5FADA 3L01A 1OLUA 2VNSA 3T0HA 5ERXA 4D98A 2IJGX 1ZCFA 1P5FA 2H85A 5EZYF 4YAJA 3H5IA 4V0SA 1KTVA 3OE4A 4URXR 4D0NA 3GIGA 4DG8A 1UDWA 4OQXA 1UAGA 1T13A 1NLUA 1FBTA 3RSGA 2VK1A 1FXUA 3RC1A 3OETA 4DR2B 4LTMA 3BC1A 3GMTA 1N6KA 2FQ1A 3HM9A 2UZ1B 5DEOA 4EMDA 3TDKA 5CTJA 4QC2A 4NBRA 3VPXA 4HSGA 3R0ZA 4BB6A 5J40A 5FCDA 5A02A 4IMRA 4UUMA 3I2GA 2DQSA 4KAXA 1U2GC 5CVCA 1C2TA 2C4NA 4IHJF 2HHHE 1JQ5A 2H29A 3RJ9A 3O2QB 3QK7A 2WI1A 3D3KA 2O2DA 3U0BA 1GPUA 4HPWA 2W83A 2FJ0A 2VQEI 1Y37A 1HORA 4D81A 2AFRA 2FPSA 2W2TA 2GRUA 5JZBA 2XCOA 3PT5A 3GUCA 4D4LA 4G01B 5EZYB 4FFNA 1BX1A 4P1ZA 1U9IC 3RH0A 2J6IA 1B42A 1VYVA 4P7FA 3PQ6A 4OMDA 3GEPA 4JP5A 4DCMA 2ZG6A 3ESDA 5M4MA 3REOA 1N36E 2NYRA 3RRYA 3T4UA 4KW7A 1E59A 2OCDA 5DWDA 1N2EA 1HZZC 2Q5JA 2NQ2C 1HMPA 3UJCA 1ABBA 3IA2A 2A57A 4LXXA 3UUGA 3N75A 1JDJA 4YACA 5T64A 1CLUA 3EF1A 5JWRA 3CX4A 2NTNA 4KQ1A 4NCXA 2QVCA 3VU0A 1KJIA 2G40A 4E32A 3WU6A 3AM1A 3QP9A 5BT8A 3HFJA 4KXFB 1VB5A 1MX9A 3GJXC 5C35A 5HKKA 3NAZA 3W06A 2I87A 1YIDA 3UG6A 4R05A 1BVHA 2GD2A 3AFIA 3A9VA 3MQ4A 3PS1A 2C2XA 3AHJA 3W9BA 1UKCA 3OJFA 1RTTA 1XLUA 4KP7A 4QG3A 3IMEA 4FZ3A 3S4YA 4X0EA 3DAPA 1QF9A 1XZJA 3JQFA 2XNKA 4IFDC 1XKXA 1OGYA 3K1ZA 4B7PA 2CLIB 5F4ZA 5TLSA 4DT1A 3JQPA 5KYNA 1EWRA 3NVKI 2ZGVA 2B5VA 1FQWA 2QQ5A 4TT3D 1N3BA 3O82A 2VXBA 1X38A 1AK9A 1NW9B 1GLVA 2XDWA 4JT2A 1H93A 2FQWA 3AUTA 5TMBA 4GKKI 1JQBA 3L7JA 4DSAA 5AM0A 2MR6A 5FD8A 3HCPA 1FX1A 4KFTA 3M3PA 4B4DA 3F7TA 4KIFA 3H5OA 4DL9A 4E51A 4PGGA 4JVSB 4Q05A 2WF7A 3CM0A 2HXGA 1E6CA 5JMOA 2ZSHA 2DHRA 4URNA 3BSYA 3R3XA 3O47A 5FL3A 4G0PA 4LRXA 5BNZA 1Z4QA 4KE8A 3B8EA 3HXOA 5EVJA 2DYKA 2PFKA 2YVAA 2Z2IA 1P61B 2NU7B 1G6HA 3EC1A 3ZVRA 4J7CA 4AJJA 3F6YA 5KNLA 3HBLA 3MFQA 4JCCA 4I4TA 1C4OA 1CZNA 3C14C 1EVJA 1IATA 4BLSA 1ECLA 3VHQA 4F4JA 3WLIA 3VX3A 4RK4A 1G9SA 3DVLA 4FHCA 1FSPA 3LL4A 4ISBA 2Z5VA 2H92A 3L0OA 3BPSA 4YLEA 4KQXA 4MW4A 4MX8A 1QH1A 1N9KA 5IFKA 2ADFA 2HF7A 3T7EA 3QE2A 2G17A 1DT3A 1JPJA 1WUIS 2ATCA 3GCZA 5T6MA 3R3UA 1UJMA 3VMMA 3RNOA 5J1SB 2Y1DA 4JITA 3TZ6A 4BCCA 1TJ3A 1KWKA 5C7IO 3SR3A 4Y1GA 5K6AC 1Z0WA 3ZGNA 5ALSA 2NU6B 4DV0E 1E79D 4B47A 3B26A 2JLSA 2WYUA 5CTUA 4LXTA 1R5JA 2V03A 3ZX4A 1QIDA 2PKQP 3MERA 4AJ9A 1KK3A 2I1QA 4R7GA 5BQXA 1XVAA 1X1AA 5JENA 3ZCRA 2WVJA 3IE2A 2Y0BA 2XJXA 4L9WA 2JBAB 2V6FA 1IC6A 4JI1E 5EZ5A 4QA9A 4J76A 1CR0A 4UULA 4UU8A 3W5JA 1X74A 2G25A 3TFOA 4DA7A 1IZ8A 3QLUA 2VJKA 1IQ0A 4LPBA 1DEXA 4YRSA 4B3XA 1MFPA 3M3HA 4UDXX 3THOA 3HO6A 3ZWKA 3O3NB 2FWZA 5JRZA 1Y8RB 4NZPA 1GTG1 2R86A 2WB4A 3O73A 5CVTA 2LGJA 4C9BA 4XVHA 3SLKA 2AI2A 3P06A 4M3NA 3WIOA 1V6CA 3EG9B 1N34E 3F71A 3ZQJA 2Q5LA 1LWOA 3O7WA 3FRHA 5ALQA 3GN2A 1G8AA 3SKYA 1JLSA 4A2WA 4YT5A 2H9IA 5LMUB 1JRLA 4EP1A 1YJXA 4AWPA 4RK5A 3L7CA 2BHLA 3IB6A 4UBJA 1LVUA 3KQYA 1DAHA 3GDHA 4MIYA 4R81A 2QBYB 4M49A 1R8SA 1Q7TA 5DNDA 3SYTA 3I5XA 2LPMA 3N86A 4UEWA 1EWKA 4G41A 3UMVA 1LLUA 3UXMA 2ZI4A 1K7SN 2FPIA 2FPXA 4Q5IA 5BPFA 1QH8B 1WLYA 3VNSA 5T8KC 4HN2A 5G0SA 1EGMB 1P9NA 2ZBKB 3FCSB 5JAIA 1BDHA 1NXVA 4WERA 1K4YA 3I83A 2HJHA 3GVIA 3DXYA 2HQSA 1OASA 3J7TA 3OIYA 3CEMA 4BV9A 1PFGA 3PJEA 1B6TA 1Q0UA 4UBIA 4EGAA 5CLGA 4CDRA 1AA6A 4WK6A 1ISHA 1GA1A 1V5GA 4LDZA 3HB5X 5FL7A 3GHHA 3PC8A 3SX2A 4XKAA 2JCVA 2JC3A 3ZHZA 1M0TA 1FFSA 3N70A 5IF9A 1Y1TA 2EX1A 1CUXA 2GKOA 3FD8A 4DDHA 4BNZA 2CHUA 2W0SA 1H4QA 4FW9A 4LGMA 4YAWA 3OQIB 3COPA 5C0XB 1US7A 4MRRA 4FSXA 1A5ZA 2D54A 4CHGA 2JZNA 3PI6A 2YEDA 4CLXA 4REMA 2EEZA 3HVIA 2CV2A 4CGYA 1TU0A 3EFOB 3VBEA 3P19A 2V3WA 4IXMA 2ZUVA 2W9XA 3RFUA 2O1XA 4LF8I 2YGAA 1GGNA 3SNHA 1NBIA 5IHPA 4UM5A 1A7UA 3SR0A 1NU6A 4DQLA 1H4SA 2QF6A 2FY8A 4HTFB 1ODKA 5I7FA 2ENUA 3ZLUA 2YV4A 2GHTA 4W5TA 4CE2A 3HKCA 4US2R 3VDXA 3NDRA 3P2KA 1L5RA 1PDWA 3IPYA 3GIFA 2AMJA 3SVLA 4B40A 3SG0A 1K63A 2VYCA 1U8AA 2H2GA 3HV0A 1E4VA 3N2KA 2H1CA 4YY3I 4LC0A 2W6OA 4G81A 2DAPA 5FF9A 2NTJA 2XT0A 4WTOA 4BL5A 2WHRA 2QG0A 3LBIA 3SP1A 1HT3A 1R66A 4PSAA 5JPIA 3GLHB 2V3CC 4N65A 3LM8A 4B3HA 3FPBA 1ZBDA 3JAKB 1HQCA 4NS4A 2ANCA 1XTJA 5EIXA 1DZIA 4DA0A 4B17A 2HBRA 4AUNA 4IV0A 4DM3A 3BAFA 4TTVA 1QV6A 3JYLA 4F7WA 3RVSA 3T5GA 1SUPA 1JHUA 1EXWA 5DV9A 2YW9A 4BLUA 2ODQA 4KKXB 5GMOA 2P1DA 3FZYA 1GNPA 2J65A 4RXTA 4HK4A 3X44A 4MROA 1SKQA 4BJ6A 3MMSA 3KZMA 5C5CA 3D8TA 1IULA 1W76A 3VH4A 1N8SA 2AXQA 2ZP1A 2FGJA 1WS6A 4I1PA 1Q22A 3ZKAA 4ENQA 1X92A 4R1PA 1UF9A 5K8LA 2H06A 4JUFA 4KQKA 3K0FA 5EUQB 4W9RA 1U2RA 3EUEA 4N01A 2VPTA 5JCJA 4G4SO 1NN0A 4G97A 4L9RA 5KTNA 1KQOA 1FSGA 4DJDC 4FFMA 5TGDA 5A4MS 5IZ4A 3ONWA 4QSHA 1IHUA 1R4MA 1G41A 3BX1A 3M7IA 1ML4A 3I42A 4FYXA 2G8LA 4OU4A 3WICA 3OZBA 5FFMA 1GNRA 2FPGB 2QLTA 3AP3A 4M4SA 4EA8A 2B30A 1KI8A 4JOQA 3IUYA 2Z1DA 3JQ9A 2BHNA 5I7AA 1YACA 4URVR 2EF0A 3ENNA 5A4KA 4YS6A 5H9WA 2Z0MA 5YASA 1I36A 4FCRA 1Q6YA 1WZCA 2JIOA 4X1KB 1TC1A 4QGAA 1Y9AA 4HLCA 1MB3A 2F00A 1AY0A 1SBZA 3K31A 2JD0A 3KHUA 4BXIA 3VV3A 5CLFA 4Y3UA 2EP7A 2GAIA 2VRNA 4EITA 1UDSA 1FUUA 3LJKA 4IIUA 5IBQA 5AW9A 1H1LB 2KX7A 3BS4A 5E0KB 5AIAA 5FTKA 3C3PA 1KEUA 1GEGA 3NATA 5GV7A 3CF2A 3F96A 3SZLA 1T5SA 1Y5MA 4IXNA 4LF9B 3OEEA 3HBNA 2UV8A 3ETDA 5L8VA 3UXYA 3R76A 1Z33A 4C0QC 2L0XA 2XUAA 4E02A 1T2VA 2IPNA 5GGZA 4PEVA 1UMCB 1ISMA 2Y93A 1RQLA 2OEPA 1G21E 3CE6A 4M6WA 5IH3A 5BSEA 1EGVB 3BJRA 3E8MA