1QY8A

Crystal structure of the n-domain of the er hsp90 chaperone grp94 in complex with radicicol
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
266
structure length
225
Chain Sequence
KSEKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELTVKIKCDKEKNLLHVTDTGVGMTREELVKNLGTIAKSGTSEFLNKMTEAQEDGQSTSELIGQFGVGFYSAFLVADKVIVTSKHNNDTQHIWESDSNEFSVIADPRGNTLGRGTTITLVLKEEASDYLELDTIKNLVKKYSQFINFPIYVWSSKTKTVWDWELMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords Endoplasmin
publication title Structure of the N-terminal domain of GRP94. Basis for ligand specificity and regulation
pubmed doi rcsb
source organism Canis lupus familiaris
total genus 70
structure length 225
sequence length 266
ec nomenclature
pdb deposition date 2003-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 1qy8A00
1YC1A 2VW5A 3OW6A 5D7RA 1S16A 4AWPA 3ZXQA 3A0XA 3GIGB 2O1WA 3Q5LA 4WUBA 2XHXA 1UYEA 2WEPA 4P8OA 2YE8A 4KSHA 3WQ9A 4XE2A 3U2KA 3OWDA 1AH8A 4U7OA 4LP0A 4ASBA 2BTZA 1U2OA 4BQJA 1US7A 4WUDA 4KSGA 1Z5CA 4NH7A 2Q2EB 1UYIA 4XCJA 4FMTA 4BQGA 4NH9A 2BSMA 1UYCA 2WERA 4CWQA 2ZDXA 2YI6A 1Y8NA 5GGZA 3TZ4A 4HY1A 4XKKA 3R4MA 4YKUA 1TH8A 1OSFA 3EKOA 4BAEA 2CGFA 2EXLA 2YE2A 2HG1A 4MP2A 3CRLA 2AKPA 4BIUA 1UYMA 2XDSA 4U93A 2IOQA 4L90A 4ASFA 2YGFA 4EEHA 3EHFA 2YEFA 1MU5A 1H7SA 2WI1A 2FWYA 5L3JA 3HZ5A 3QDDA 1YS3A 3NMQA 4R1FA 3TUHA 4BXIA 3RLRA 2CCTA 5D7CA 4NH8A 4YKQA 2FYPA 4U7NA 3ZKDA 3HYZA 1I59A 1EI1A 4YKXA 2IOPA 3Q5KA 3RLQA 2BRCA 4CWPA 2XABA 3SL2A 5CPHA 4I3HA 3QTFA 3RLPA 2YGAA 1MX0A 3VHCA 3CWVA 4LWIA 1S14A 2YEIA 4CWRA 2XX2A 3CRKA 2YEDA 4JAVA 5M4PA 4LWEA 3EHGA 4HXWA 4EGIA 2WEQA 4PRXA 2WI4A 2VWCA 4QPKA 2JJCA 4R3MA 4URMA 2GQPA 1YERA 3K98A 2YE7A 5M4EA 2O1UA 3HZ1A 1B63A 4DUHA 3PEJA 4EM7A 1UYKA 3FT5A 3INWA 4MP7A 1ZWHA 5IDJA 2YJXA 3TZ2A 3T1KA 4V25A 3VHDA 3PEHA 4B6CA 4X9LA 2YE5A 4XKAA 2H55A 1NHHA 2Q8IA 4JASA 1YC4A 4FPPA 5IN9A 2C2AA 4Q20A 3OMUA 4HYPA 2Q8FA 4URLA 4P7AA 2FXSA 2XHRA 4XITA 1YESA 2WI7A 5CTYA 1UYFA 2YJWA 4XKOA 3A0ZA 1Y4SA 2BU8A 2VCIA 3TZ0A 2Q8HA 1TBWA 3C11A 3R91A 3A0TA 1TIDA 4GT8A 3LNUA 4FCPA 2O1VA 4HYMA 2ZDYA 1YT0A 2CCUA 2YEBA 4LWFA 3HEKA 4HXZA 4YKRA 1L0OA 3U2DA 3R4PA 1UYDA 1KZNA 2XDKA 4B7PA 3IEDA 3B26A 4YKTA 1AH6A 2BU7A 5D7DA 1B62A 2ZKJA 2YEJA 4O04A 2YECA 2YGEA 1I5CA 1THNA 3U67A 2WI2A 4O05A 2YKIA 4LPBA 1YC3A 3RKZA 3VHAA 2YKEA 4DZYA 2BU2A 1B3QA 2WI6A 4H7QA 4MPEA 2HCHA 4E01A 2YI0A 4QPJA 2XJJA 2E0AA 4HZ0A 1NHIA 4R3AA 1UYLA 2YKJA 2CCSA 2YKCA 5D6QA 5M4KA 4L94A 3ZXOA 4GCZA 5FNCA 4H81A 4L91A 4K4OA 4E00A 2BYHA 4MPCA 3O6OA 4CWFA 3GIGA 1BKNA 1YSZA 1UY6A 2H8MA 2YEAA 4MOTA 1YETA 4EFTA 1BGQA 4CWNA 3H80A 4CWSA 2YEEA 3H4LA 4EMVA 1Z59A 4XIQA 3T0ZA 3D2RA 4XCLA 1H7UA 3MNRP 4CWTA 5FNFA 2BYIA 3TZ5A 2XDXA 3K99A 1A4HA 2XX4A 2YE4A 4HZ5A 5F5RA 5FNDA 3R92A 4EGHA 4KFGA 3B27A 4EFUA 2VCJA 2XDLA 3O0IA 3Q5JA 1I5BA 4PU9A 5C93A 1UYGA 2XHTA 5CF0A 3EHJA 2YK9A 1GJVA 5J6AA 1GKXA 4ASGA 1TILA 1UY9A 1Y8OA 4GGLA 4WUCA 5M4HA 4YKYA 4EGKA 2CH4A 3INXA 1QY8A 3T2SA 1PVGA 2GFDA 1ID0A 2FWZA 4ZVIA 3HYYA 1JM6A 3B25A 3CGYA 1Z5AA 5J71A 2YEGA 1ZXNA 4ZKIA 4GQTA 4W7TA 1U0ZA 3A0YA 2YEHA 2HKJA 4CE1A 2IWXA 4FCQA 4BIZA 1YSRA 5M4MA 4UROA 4MBCA 5BOCA 3VADA 3T10A 4LWGA 4JQLA 1QZRA 4KQVA 3GIEA 1R62A 3FT8A 4PL9A 4XIPA 1UYHA 1ZW9A 4XDMA 2PNRA 2YK2A 2YKBA 1I5AA 2YE3A 3GIFA 4O0BA 4I5SA 2XDUA 2XJGA 2QG2A 1BXDA 2IWSA 1NHJA 3DGEA 3D36A 4E02A 1EA6A 2IWUA 4O09A 4AWQA 2IORA 3C0EA 2BT0A 3A0WA 4GFNA 4JAUA 4L8ZA 1I5DA 1AM1A 3BMYA 5CTWA 2XD6A 1GKZA 3OPDA 4URNA 4AS9A 3O2FA 3G7EA 2ZBKB 3ZM7A 4YKWA 5M4NA 4XIRA 3BM9A 5FWKA 3D0BA 3TTZA 1UY8A 4PRVA 4XC0A 5CTXA 1TC6A 4CWOA 2XK2A 2YE6A 3LPSA 2QF6A 1YT2A 1KIJA 1Y8PA 2WI5A 4YKZA 3A0RA 1I58A 3B28A 4FCRA 1UY7A 2BREA 2YI5A 3EHHA 1AJ6A 3G75A 2WI3A 4MPNA 3WHAA 2BU5A 5F3KA 3EKRA 1Z5BA 4XD8A 4ASAA 2XX5A 4L93A 5IDMA 4MB9A 4O07A 2YE9A 3OWBA 1ZXMA 4HY6A 1AMWA 1BYQA 1TC0A 2Q8GA 2XCMA 1Y4UA 2K5BA 3HHUA 1QYEA 3FV5A 3G7BA 4CE3A 3T0HA 2CG9A 4GEEA 4KP4A 3K97A 4V26A 3B24A 3ZKBA 2JKIA 3CGZA 3JZ3A 2BZ5A 1YT1A 2QG0A 4LWHA 5BODA 2YI7A 2XJXA 3R4OA 5D6PA 4XTJA 3K60A 4KTNA 5CTUA 4AWOA 4H85A 2QFOA 3KE6A 3R4NA 2BU6A 2ESAA 4CE2A 2UWDA
chains in the Genus database with same CATH superfamily
3LMMA 1YC1A 2VW5A 3OW6A 5D7RA 1S16A 4AWPA 3ZXQA 3A0XA 3GIGB 2O1WA 3Q5LA 4WUBA 2XHXA 1UYEA 2WEPA 4P8OA 2YE8A 4KSHA 3WQ9A 4XE2A 3U2KA 3OWDA 1AH8A 4U7OA 4LP0A 4ASBA 2BTZA 1U2OA 4BQJA 1US7A 4WUDA 4KSGA 1Z5CA 4NH7A 2Q2EB 1UYIA 4XCJA 4FMTA 4BQGA 4NH9A 2BSMA 1UYCA 2WERA 4CWQA 2ZDXA 2YI6A 1Y8NA 5GGZA 3TZ4A 4HY1A 4XKKA 3R4MA 4YKUA 1TH8A 1OSFA 3EKOA 4BAEA 2CGFA 2EXLA 2YE2A 2HG1A 4MP2A 3CRLA 2AKPA 4BIUA 1UYMA 2XDSA 4U93A 2IOQA 4L90A 4ASFA 2YGFA 4EEHA 3EHFA 2YEFA 1MU5A 1H7SA 2WI1A 2FWYA 5L3JA 3HZ5A 3QDDA 1YS3A 3NMQA 4R1FA 3TUHA 4BXIA 3RLRA 2CCTA 5D7CA 4NH8A 4YKQA 2FYPA 4U7NA 3ZKDA 3HYZA 1I59A 1EI1A 4YKXA 2IOPA 3Q5KA 3RLQA 2BRCA 4CWPA 2XABA 3SL2A 5CPHA 4I3HA 3QTFA 3RLPA 2YGAA 1MX0A 3VHCA 3CWVA 4LWIA 1S14A 2YEIA 4CWRA 1IXMA 2XX2A 3CRKA 2YEDA 4JAVA 5M4PA 4LWEA 3EHGA 4HXWA 4EGIA 2WEQA 4PRXA 2WI4A 3S5TA 2VWCA 4QPKA 3CYGA 2JJCA 4R3MA 4URMA 2GQPA 1YERA 3K98A 2YE7A 5M4EA 2O1UA 3HZ1A 1B63A 4DUHA 3PEJA 4EM7A 1UYKA 3FT5A 3INWA 4MP7A 1ZWHA 5IDJA 2YJXA 3TZ2A 3T1KA 4V25A 3VHDA 3PEHA 4B6CA 4X9LA 2FTKA 2YE5A 4XKAA 2H55A 1NHHA 2Q8IA 4JASA 1YC4A 4FPPA 5IN9A 2C2AA 4Q20A 3OMUA 4HYPA 2Q8FA 4URLA 4P7AA 2FXSA 2XHRA 4XITA 1YESA 2WI7A 5CTYA 1UYFA 2YJWA 4XKOA 3A0ZA 1Y4SA 2BU8A 2VCIA 3TZ0A 2Q8HA 1TBWA 3C11A 3R91A 3A0TA 1TIDA 4GT8A 3LNUA 4FCPA 2O1VA 4HYMA 2ZDYA 1YT0A 2CCUA 2YEBA 4LWFA 3HEKA 4HXZA 4YKRA 1L0OA 3U2DA 3R4PA 1UYDA 1KZNA 2XDKA 4B7PA 3IEDA 3B26A 4YKTA 1AH6A 2BU7A 5D7DA 1B62A 2ZKJA 2YEJA 4O04A 2YECA 2YGEA 1I5CA 1THNA 3U67A 2WI2A 4O05A 2YKIA 4LPBA 1YC3A 3RKZA 3VHAA 2YKEA 4DZYA 2BU2A 1B3QA 2WI6A 4H7QA 4MPEA 2HCHA 4E01A 2YI0A 4QPJA 2XJJA 2E0AA 4HZ0A 1NHIA 4R3AA 1UYLA 2YKJA 2CCSA 2YKCA 5D6QA 5M4KA 4L94A 3ZXOA 4GCZA 5FNCA 4H81A 4E72A 4L91A 4K4OA 4E00A 2BYHA 4MPCA 3O6OA 4CWFA 3GIGA 1BKNA 1YSZA 1UY6A 2H8MA 2YEAA 4MOTA 1YETA 4EFTA 1BGQA 4CWNA 3H80A 4CWSA 2YEEA 3H4LA 4EMVA 1Z59A 4XIQA 3T0ZA 3D2RA 4XCLA 1H7UA 3MNRP 4CWTA 5FNFA 2BYIA 3TZ5A 2XDXA 3K99A 5JENA 1A4HA 2XX4A 2YE4A 4HZ5A 5F5RA 5FNDA 3R92A 4EGHA 4KFGA 3B27A 4EFUA 2VCJA 2XDLA 3O0IA 3Q5JA 1I5BA 4PU9A 5C93A 1UYGA 2XHTA 5CF0A 3EHJA 2YK9A 1GJVA 5J6AA 1GKXA 4ASGA 1TILA 1UY9A 1Y8OA 2HHIA 4GGLA 4WUCA 5M4HA 4YKYA 4EGKA 2CH4A 3INXA 1QY8A 3T2SA 1PVGA 2GFDA 1ID0A 2FWZA 4ZVIA 3HYYA 1JM6A 3B25A 3CGYA 1Z5AA 5J71A 2YEGA 1ZXNA 4ZKIA 4GQTA 4W7TA 2C1IA 1U0ZA 3A0YA 2YEHA 2HKJA 4CE1A 2IWXA 4FCQA 4BIZA 1YSRA 5M4MA 4UROA 4MBCA 5BOCA 3VADA 3T10A 4LWGA 4JQLA 1QZRA 4KQVA 3GIEA 1R62A 3FT8A 4PL9A 4XIPA 1UYHA 1ZW9A 4XDMA 2PNRA 2YK2A 2YKBA 1I5AA 2YE3A 3GIFA 4O0BA 4I5SA 2XDUA 2XJGA 2QG2A 1BXDA 2IWSA 1NHJA 3DGEA 3D36A 4E02A 1EA6A 2IWUA 4O09A 4AWQA 2IORA 3C0EA 2BT0A 3A0WA 4GFNA 4JAUA 4L8ZA 1I5DA 1AM1A 3BMYA 5CTWA 2XD6A 1GKZA 3OPDA 4URNA 4AS9A 3O2FA 1F51A 3G7EA 2ZBKB 3ZM7A 4YKWA 5M4NA 4XIRA 3BM9A 5FWKA 3D0BA 3TTZA 1UY8A 4PRVA 4XC0A 5CTXA 1TC6A 4CWOA 2XK2A 2YE6A 3LPSA 2QF6A 1YT2A 1KIJA 1Y8PA 2WI5A 4YKZA 3A0RA 1I58A 3B28A 4FCRA 1UY7A 2BREA 2C1GA 2YI5A 3EHHA 1AJ6A 3G75A 2WI3A 4MPNA 3WHAA 2BU5A 5F3KA 3EKRA 1Z5BA 4XD8A 4ASAA 2XX5A 4L93A 5IDMA 4MB9A 4O07A 2YE9A 3OWBA 1ZXMA 4HY6A 1AMWA 1BYQA 1TC0A 2Q8GA 2XCMA 1Y4UA 2K5BA 3HHUA 1QYEA 3FV5A 3G7BA 4CE3A 3T0HA 2CG9A 4GEEA 4KP4A 3K97A 4V26A 3B24A 3ZKBA 2JKIA 3CGZA 3JZ3A 2BZ5A 1YT1A 2QG0A 4LWHA 5BODA 2YI7A 2XJXA 3R4OA 5D6PA 4XTJA 3K60A 4KTNA 5CTUA 4AWOA 4H85A 2QFOA 3KE6A 3R4NA 2BU6A 2ESAA 4CE2A 2UWDA
chains in the Genus database with same CATH topology
1YC1A 2VW5A 3OW6A 5D7RA 1S16A 4AWPA 3ZXQA 3A0XA 3GIGB 2O1WA 3Q5LA 4WUBA 2XHXA 1UYEA 2WEPA 4P8OA 2YE8A 4KSHA 3WQ9A 4XE2A 3U2KA 3OWDA 1AH8A 4U7OA 4LP0A 4ASBA 2BTZA 1U2OA 4BQJA 1US7A 4WUDA 4KSGA 1Z5CA 4NH7A 2Q2EB 1UYIA 4XCJA 4FMTA 4BQGA 4NH9A 2BSMA 1UYCA 2WERA 4CWQA 2ZDXA 2YI6A 1Y8NA 5GGZA 3TZ4A 4HY1A 4XKKA 3R4MA 4YKUA 1TH8A 1OSFA 3EKOA 4BAEA 2CGFA 2EXLA 2YE2A 2HG1A 4MP2A 3CRLA 2AKPA 4BIUA 1UYMA 2XDSA 4U93A 2IOQA 4L90A 4ASFA 2YGFA 4EEHA 3EHFA 2YEFA 1MU5A 1H7SA 2WI1A 2FWYA 5L3JA 3HZ5A 3QDDA 1YS3A 3NMQA 4R1FA 3TUHA 4BXIA 3RLRA 2CCTA 5D7CA 4NH8A 4YKQA 2FYPA 4U7NA 3ZKDA 3HYZA 1I59A 1EI1A 4YKXA 2IOPA 3Q5KA 3RLQA 2BRCA 4CWPA 2XABA 3SL2A 5CPHA 4I3HA 3QTFA 3RLPA 2YGAA 1MX0A 3VHCA 3CWVA 4LWIA 1S14A 2YEIA 4CWRA 2XX2A 3CRKA 2YEDA 4JAVA 5M4PA 4LWEA 3EHGA 4HXWA 4EGIA 2WEQA 4PRXA 2WI4A 2VWCA 4QPKA 2JJCA 4R3MA 4URMA 2GQPA 1YERA 3K98A 2YE7A 5M4EA 2O1UA 3HZ1A 1B63A 4DUHA 3PEJA 4EM7A 1UYKA 3FT5A 3INWA 4MP7A 1ZWHA 5IDJA 2YJXA 3TZ2A 3T1KA 4V25A 3VHDA 3PEHA 4B6CA 4X9LA 2YE5A 4XKAA 2H55A 1NHHA 2Q8IA 4JASA 1YC4A 4FPPA 5IN9A 2C2AA 4Q20A 3OMUA 4HYPA 2Q8FA 4URLA 4P7AA 2FXSA 2XHRA 4XITA 1YESA 2WI7A 5CTYA 1UYFA 2YJWA 4XKOA 3A0ZA 1Y4SA 2BU8A 2VCIA 3TZ0A 2Q8HA 1TBWA 3C11A 3R91A 3A0TA 1TIDA 4GT8A 3LNUA 4FCPA 2O1VA 4HYMA 2ZDYA 1YT0A 2CCUA 2YEBA 4LWFA 3HEKA 4HXZA 4YKRA 1L0OA 3U2DA 3R4PA 1UYDA 1KZNA 2XDKA 4B7PA 3IEDA 3B26A 4YKTA 1AH6A 2BU7A 5D7DA 1B62A 2ZKJA 2YEJA 4O04A 2YECA 2YGEA 1I5CA 1THNA 3U67A 2WI2A 4O05A 2YKIA 4LPBA 1YC3A 3RKZA 3VHAA 2YKEA 4DZYA 2BU2A 1B3QA 2WI6A 4H7QA 4MPEA 2HCHA 4E01A 2YI0A 4QPJA 2XJJA 2E0AA 4HZ0A 1NHIA 4R3AA 1UYLA 2YKJA 2CCSA 2YKCA 5D6QA 5M4KA 4L94A 3ZXOA 4GCZA 5FNCA 4H81A 4L91A 4K4OA 4E00A 2BYHA 4MPCA 3O6OA 4CWFA 3GIGA 1BKNA 1YSZA 1UY6A 2H8MA 2YEAA 4MOTA 1YETA 4EFTA 1BGQA 4CWNA 3H80A 4CWSA 2YEEA 3H4LA 4EMVA 1Z59A 4XIQA 3T0ZA 3D2RA 4XCLA 1H7UA 3MNRP 4CWTA 5FNFA 2BYIA 3TZ5A 2XDXA 3K99A 1A4HA 2XX4A 2YE4A 4HZ5A 5F5RA 5FNDA 3R92A 4EGHA 4KFGA 3B27A 4EFUA 2VCJA 2XDLA 3O0IA 3Q5JA 1I5BA 4PU9A 5C93A 1UYGA 2XHTA 5CF0A 3EHJA 2YK9A 1GJVA 5J6AA 1GKXA 4ASGA 1TILA 1UY9A 1Y8OA 4GGLA 4WUCA 5M4HA 4YKYA 4EGKA 2CH4A 3INXA 1QY8A 3T2SA 1PVGA 2GFDA 1ID0A 2FWZA 4ZVIA 3HYYA 1JM6A 3B25A 3CGYA 1Z5AA 5J71A 2YEGA 1ZXNA 4ZKIA 4GQTA 4W7TA 1U0ZA 3A0YA 2YEHA 2HKJA 4CE1A 2IWXA 4FCQA 4BIZA 1YSRA 5M4MA 4UROA 4MBCA 5BOCA 3VADA 3T10A 4LWGA 4JQLA 1QZRA 4KQVA 3GIEA 1R62A 3FT8A 4PL9A 4XIPA 1UYHA 1ZW9A 4XDMA 2PNRA 2YK2A 2YKBA 1I5AA 2YE3A 3GIFA 4O0BA 4I5SA 2XDUA 2XJGA 2QG2A 1BXDA 2IWSA 1NHJA 3DGEA 3D36A 4E02A 1EA6A 2IWUA 4O09A 4AWQA 2IORA 3C0EA 2BT0A 3A0WA 4GFNA 4JAUA 4L8ZA 1I5DA 1AM1A 3BMYA 5CTWA 2XD6A 1GKZA 3OPDA 4URNA 4AS9A 3O2FA 3G7EA 2ZBKB 3ZM7A 4YKWA 5M4NA 4XIRA 3BM9A 5FWKA 3D0BA 3TTZA 1UY8A 4PRVA 4XC0A 5CTXA 1TC6A 4CWOA 2XK2A 2YE6A 3LPSA 2QF6A 1YT2A 1KIJA 1Y8PA 2WI5A 4YKZA 3A0RA 1I58A 3B28A 4FCRA 1UY7A 2BREA 2YI5A 3EHHA 1AJ6A 3G75A 2WI3A 4MPNA 3WHAA 2BU5A 5F3KA 3EKRA 1Z5BA 4XD8A 4ASAA 2XX5A 4L93A 5IDMA 4MB9A 4O07A 2YE9A 3OWBA 1ZXMA 4HY6A 1AMWA 1BYQA 1TC0A 2Q8GA 2XCMA 1Y4UA 2K5BA 3HHUA 1QYEA 3FV5A 3G7BA 4CE3A 3T0HA 2CG9A 4GEEA 4KP4A 3K97A 4V26A 3B24A 3ZKBA 2JKIA 3CGZA 3JZ3A 2BZ5A 1YT1A 2QG0A 4LWHA 5BODA 2YI7A 2XJXA 3R4OA 5D6PA 4XTJA 3K60A 4KTNA 5CTUA 4AWOA 4H85A 2QFOA 3KE6A 3R4NA 2BU6A 2ESAA 4CE2A 2UWDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YC1 A;  2VW5 A;  3OW6 A;  5D7R A;  1S16 A;  4AWP A;  3ZXQ A;  3A0X A;  3GIG B;  2O1W A;  3Q5L A;  4WUB A;  2XHX A;  1UYE A;  2WEP A;  4P8O A;  2YE8 A;  4KSH A;  3WQ9 A;  4XE2 A;  3U2K A;  3OWD A;  1AH8 A;  4U7O A;  4LP0 A;  4ASB A;  2BTZ A;  1U2O A;  4BQJ A;  1US7 A;  4WUD A;  4KSG A;  1Z5C A;  4NH7 A;  2Q2E B;  1UYI A;  4XCJ A;  4FMT A;  4BQG A;  4NH9 A;  2BSM A;  1UYC A;  2WER A;  4CWQ A;  2ZDX A;  2YI6 A;  1Y8N A;  5GGZ A;  3TZ4 A;  4HY1 A;  4XKK A;  3R4M A;  4YKU A;  1TH8 A;  1OSF A;  3EKO A;  4BAE A;  2CGF A;  2EXL A;  2YE2 A;  2HG1 A;  4MP2 A;  3CRL A;  2AKP A;  4BIU A;  1UYM A;  2XDS A;  4U93 A;  2IOQ A;  4L90 A;  4ASF A;  2YGF A;  4EEH A;  3EHF A;  2YEF A;  1MU5 A;  1H7S A;  2WI1 A;  2FWY A;  5L3J A;  3HZ5 A;  3QDD A;  1YS3 A;  3NMQ A;  4R1F A;  3TUH A;  4BXI A;  3RLR A;  2CCT A;  5D7C A;  4NH8 A;  4YKQ A;  2FYP A;  4U7N A;  3ZKD A;  3HYZ A;  1I59 A;  1EI1 A;  4YKX A;  2IOP A;  3Q5K A;  3RLQ A;  2BRC A;  4CWP A;  2XAB A;  3SL2 A;  5CPH A;  4I3H A;  3QTF A;  3RLP A;  2YGA A;  1MX0 A;  3VHC A;  3CWV A;  4LWI A;  1S14 A;  2YEI A;  4CWR A;  2XX2 A;  3CRK A;  2YED A;  4JAV A;  5M4P A;  4LWE A;  3EHG A;  4HXW A;  4EGI A;  2WEQ A;  4PRX A;  2WI4 A;  2VWC A;  4QPK A;  2JJC A;  4R3M A;  4URM A;  2GQP A;  1YER A;  3K98 A;  2YE7 A;  5M4E A;  2O1U A;  3HZ1 A;  1B63 A;  4DUH A;  3PEJ A;  4EM7 A;  1UYK A;  3FT5 A;  3INW A;  4MP7 A;  1ZWH A;  5IDJ A;  2YJX A;  3TZ2 A;  3T1K A;  4V25 A;  3VHD A;  3PEH A;  4B6C A;  4X9L A;  2YE5 A;  4XKA A;  2H55 A;  1NHH A;  2Q8I A;  4JAS A;  1YC4 A;  4FPP A;  5IN9 A;  2C2A A;  4Q20 A;  3OMU A;  4HYP A;  2Q8F A;  4URL A;  4P7A A;  2FXS A;  2XHR A;  4XIT A;  1YES A;  2WI7 A;  5CTY A;  1UYF A;  2YJW A;  4XKO A;  3A0Z A;  1Y4S A;  2BU8 A;  2VCI A;  3TZ0 A;  2Q8H A;  1TBW A;  3C11 A;  3R91 A;  3A0T A;  1TID A;  4GT8 A;  3LNU A;  4FCP A;  2O1V A;  4HYM A;  2ZDY A;  1YT0 A;  2CCU A;  2YEB A;  4LWF A;  3HEK A;  4HXZ A;  4YKR A;  1L0O A;  3U2D A;  3R4P A;  1UYD A;  1KZN A;  2XDK A;  4B7P A;  3IED A;  3B26 A;  4YKT A;  1AH6 A;  2BU7 A;  5D7D A;  1B62 A;  2ZKJ A;  2YEJ A;  4O04 A;  2YEC A;  2YGE A;  1I5C A;  1THN A;  3U67 A;  2WI2 A;  4O05 A;  2YKI A;  4LPB A;  1YC3 A;  3RKZ A;  3VHA A;  2YKE A;  4DZY A;  2BU2 A;  1B3Q A;  2WI6 A;  4H7Q A;  4MPE A;  2HCH A;  4E01 A;  2YI0 A;  4QPJ A;  2XJJ A;  2E0A A;  4HZ0 A;  1NHI A;  4R3A A;  1UYL A;  2YKJ A;  2CCS A;  2YKC A;  5D6Q A;  5M4K A;  4L94 A;  3ZXO A;  4GCZ A;  5FNC A;  4H81 A;  4L91 A;  4K4O A;  4E00 A;  2BYH A;  4MPC A;  3O6O A;  4CWF A;  3GIG A;  1BKN A;  1YSZ A;  1UY6 A;  2H8M A;  2YEA A;  4MOT A;  1YET A;  4EFT A;  1BGQ A;  4CWN A;  3H80 A;  4CWS A;  2YEE A;  3H4L A;  4EMV A;  1Z59 A;  4XIQ A;  3T0Z A;  3D2R A;  4XCL A;  1H7U A;  3MNR P;  4CWT A;  5FNF A;  2BYI A;  3TZ5 A;  2XDX A;  3K99 A;  1A4H A;  2XX4 A;  2YE4 A;  4HZ5 A;  5F5R A;  5FND A;  3R92 A;  4EGH A;  4KFG A;  3B27 A;  4EFU A;  2VCJ A;  2XDL A;  3O0I A;  3Q5J A;  1I5B A;  4PU9 A;  5C93 A;  1UYG A;  2XHT A;  5CF0 A;  3EHJ A;  2YK9 A;  1GJV A;  5J6A A;  1GKX A;  4ASG A;  1TIL A;  1UY9 A;  1Y8O A;  4GGL A;  4WUC A;  5M4H A;  4YKY A;  4EGK A;  2CH4 A;  3INX A;  1QY8 A;  3T2S A;  1PVG A;  2GFD A;  1ID0 A;  2FWZ A;  4ZVI A;  3HYY A;  1JM6 A;  3B25 A;  3CGY A;  1Z5A A;  5J71 A;  2YEG A;  1ZXN A;  4ZKI A;  4GQT A;  4W7T A;  1U0Z A;  3A0Y A;  2YEH A;  2HKJ A;  4CE1 A;  2IWX A;  4FCQ A;  4BIZ A;  1YSR A;  5M4M A;  4URO A;  4MBC A;  5BOC A;  3VAD A;  3T10 A;  4LWG A;  4JQL A;  1QZR A;  4KQV A;  3GIE A;  1R62 A;  3FT8 A;  4PL9 A;  4XIP A;  1UYH A;  1ZW9 A;  4XDM A;  2PNR A;  2YK2 A;  2YKB A;  1I5A A;  2YE3 A;  3GIF A;  4O0B A;  4I5S A;  2XDU A;  2XJG A;  2QG2 A;  1BXD A;  2IWS A;  1NHJ A;  3DGE A;  3D36 A;  4E02 A;  1EA6 A;  2IWU A;  4O09 A;  4AWQ A;  2IOR A;  3C0E A;  2BT0 A;  3A0W A;  4GFN A;  4JAU A;  4L8Z A;  1I5D A;  1AM1 A;  3BMY A;  5CTW A;  2XD6 A;  1GKZ A;  3OPD A;  4URN A;  4AS9 A;  3O2F A;  3G7E A;  2ZBK B;  3ZM7 A;  4YKW A;  5M4N A;  4XIR A;  3BM9 A;  5FWK A;  3D0B A;  3TTZ A;  1UY8 A;  4PRV A;  4XC0 A;  5CTX A;  1TC6 A;  4CWO A;  2XK2 A;  2YE6 A;  3LPS A;  2QF6 A;  1YT2 A;  1KIJ A;  1Y8P A;  2WI5 A;  4YKZ A;  3A0R A;  1I58 A;  3B28 A;  4FCR A;  1UY7 A;  2BRE A;  2YI5 A;  3EHH A;  1AJ6 A;  3G75 A;  2WI3 A;  4MPN A;  3WHA A;  2BU5 A;  5F3K A;  3EKR A;  1Z5B A;  4XD8 A;  4ASA A;  2XX5 A;  4L93 A;  5IDM A;  4MB9 A;  4O07 A;  2YE9 A;  3OWB A;  1ZXM A;  4HY6 A;  1AMW A;  1BYQ A;  1TC0 A;  2Q8G A;  2XCM A;  1Y4U A;  2K5B A;  3HHU A;  1QYE A;  3FV5 A;  3G7B A;  4CE3 A;  3T0H A;  2CG9 A;  4GEE A;  4KP4 A;  3K97 A;  4V26 A;  3B24 A;  3ZKB A;  2JKI A;  3CGZ A;  3JZ3 A;  2BZ5 A;  1YT1 A;  2QG0 A;  4LWH A;  5BOD A;  2YI7 A;  2XJX A;  3R4O A;  5D6P A;  4XTJ A;  3K60 A;  4KTN A;  5CTU A;  4AWO A;  4H85 A;  2QFO A;  3KE6 A;  3R4N A;  2BU6 A;  2ESA A;  4CE2 A;  2UWD A; 
#chains in the Genus database with same CATH topology
 3LMM A;  1YC1 A;  2VW5 A;  3OW6 A;  5D7R A;  1S16 A;  4AWP A;  3ZXQ A;  3A0X A;  3GIG B;  2O1W A;  3Q5L A;  4WUB A;  2XHX A;  1UYE A;  2WEP A;  4P8O A;  2YE8 A;  4KSH A;  3WQ9 A;  4XE2 A;  3U2K A;  3OWD A;  1AH8 A;  4U7O A;  4LP0 A;  4ASB A;  2BTZ A;  1U2O A;  4BQJ A;  1US7 A;  4WUD A;  4KSG A;  1Z5C A;  4NH7 A;  2Q2E B;  1UYI A;  4XCJ A;  4FMT A;  4BQG A;  4NH9 A;  2BSM A;  1UYC A;  2WER A;  4CWQ A;  2ZDX A;  2YI6 A;  1Y8N A;  5GGZ A;  3TZ4 A;  4HY1 A;  4XKK A;  3R4M A;  4YKU A;  1TH8 A;  1OSF A;  3EKO A;  4BAE A;  2CGF A;  2EXL A;  2YE2 A;  2HG1 A;  4MP2 A;  3CRL A;  2AKP A;  4BIU A;  1UYM A;  2XDS A;  4U93 A;  2IOQ A;  4L90 A;  4ASF A;  2YGF A;  4EEH A;  3EHF A;  2YEF A;  1MU5 A;  1H7S A;  2WI1 A;  2FWY A;  5L3J A;  3HZ5 A;  3QDD A;  1YS3 A;  3NMQ A;  4R1F A;  3TUH A;  4BXI A;  3RLR A;  2CCT A;  5D7C A;  4NH8 A;  4YKQ A;  2FYP A;  4U7N A;  3ZKD A;  3HYZ A;  1I59 A;  1EI1 A;  4YKX A;  2IOP A;  3Q5K A;  3RLQ A;  2BRC A;  4CWP A;  2XAB A;  3SL2 A;  5CPH A;  4I3H A;  3QTF A;  3RLP A;  2YGA A;  1MX0 A;  3VHC A;  3CWV A;  4LWI A;  1S14 A;  2YEI A;  4CWR A;  1IXM A;  2XX2 A;  3CRK A;  2YED A;  4JAV A;  5M4P A;  4LWE A;  3EHG A;  4HXW A;  4EGI A;  2WEQ A;  4PRX A;  2WI4 A;  3S5T A;  2VWC A;  4QPK A;  3CYG A;  2JJC A;  4R3M A;  4URM A;  2GQP A;  1YER A;  3K98 A;  2YE7 A;  5M4E A;  2O1U A;  3HZ1 A;  1B63 A;  4DUH A;  3PEJ A;  4EM7 A;  1UYK A;  3FT5 A;  3INW A;  4MP7 A;  1ZWH A;  5IDJ A;  2YJX A;  3TZ2 A;  3T1K A;  4V25 A;  3VHD A;  3PEH A;  4B6C A;  4X9L A;  2FTK A;  2YE5 A;  4XKA A;  2H55 A;  1NHH A;  2Q8I A;  4JAS A;  1YC4 A;  4FPP A;  5IN9 A;  2C2A A;  4Q20 A;  3OMU A;  4HYP A;  2Q8F A;  4URL A;  4P7A A;  2FXS A;  2XHR A;  4XIT A;  1YES A;  2WI7 A;  5CTY A;  1UYF A;  2YJW A;  4XKO A;  3A0Z A;  1Y4S A;  2BU8 A;  2VCI A;  3TZ0 A;  2Q8H A;  1TBW A;  3C11 A;  3R91 A;  3A0T A;  1TID A;  4GT8 A;  3LNU A;  4FCP A;  2O1V A;  4HYM A;  2ZDY A;  1YT0 A;  2CCU A;  2YEB A;  4LWF A;  3HEK A;  4HXZ A;  4YKR A;  1L0O A;  3U2D A;  3R4P A;  1UYD A;  1KZN A;  2XDK A;  4B7P A;  3IED A;  3B26 A;  4YKT A;  1AH6 A;  2BU7 A;  5D7D A;  1B62 A;  2ZKJ A;  2YEJ A;  4O04 A;  2YEC A;  2YGE A;  1I5C A;  1THN A;  3U67 A;  2WI2 A;  4O05 A;  2YKI A;  4LPB A;  1YC3 A;  3RKZ A;  3VHA A;  2YKE A;  4DZY A;  2BU2 A;  1B3Q A;  2WI6 A;  4H7Q A;  4MPE A;  2HCH A;  4E01 A;  2YI0 A;  4QPJ A;  2XJJ A;  2E0A A;  4HZ0 A;  1NHI A;  4R3A A;  1UYL A;  2YKJ A;  2CCS A;  2YKC A;  5D6Q A;  5M4K A;  4L94 A;  3ZXO A;  4GCZ A;  5FNC A;  4H81 A;  4E72 A;  4L91 A;  4K4O A;  4E00 A;  2BYH A;  4MPC A;  3O6O A;  4CWF A;  3GIG A;  1BKN A;  1YSZ A;  1UY6 A;  2H8M A;  2YEA A;  4MOT A;  1YET A;  4EFT A;  1BGQ A;  4CWN A;  3H80 A;  4CWS A;  2YEE A;  3H4L A;  4EMV A;  1Z59 A;  4XIQ A;  3T0Z A;  3D2R A;  4XCL A;  1H7U A;  3MNR P;  4CWT A;  5FNF A;  2BYI A;  3TZ5 A;  2XDX A;  3K99 A;  5JEN A;  1A4H A;  2XX4 A;  2YE4 A;  4HZ5 A;  5F5R A;  5FND A;  3R92 A;  4EGH A;  4KFG A;  3B27 A;  4EFU A;  2VCJ A;  2XDL A;  3O0I A;  3Q5J A;  1I5B A;  4PU9 A;  5C93 A;  1UYG A;  2XHT A;  5CF0 A;  3EHJ A;  2YK9 A;  1GJV A;  5J6A A;  1GKX A;  4ASG A;  1TIL A;  1UY9 A;  1Y8O A;  2HHI A;  4GGL A;  4WUC A;  5M4H A;  4YKY A;  4EGK A;  2CH4 A;  3INX A;  1QY8 A;  3T2S A;  1PVG A;  2GFD A;  1ID0 A;  2FWZ A;  4ZVI A;  3HYY A;  1JM6 A;  3B25 A;  3CGY A;  1Z5A A;  5J71 A;  2YEG A;  1ZXN A;  4ZKI A;  4GQT A;  4W7T A;  2C1I A;  1U0Z A;  3A0Y A;  2YEH A;  2HKJ A;  4CE1 A;  2IWX A;  4FCQ A;  4BIZ A;  1YSR A;  5M4M A;  4URO A;  4MBC A;  5BOC A;  3VAD A;  3T10 A;  4LWG A;  4JQL A;  1QZR A;  4KQV A;  3GIE A;  1R62 A;  3FT8 A;  4PL9 A;  4XIP A;  1UYH A;  1ZW9 A;  4XDM A;  2PNR A;  2YK2 A;  2YKB A;  1I5A A;  2YE3 A;  3GIF A;  4O0B A;  4I5S A;  2XDU A;  2XJG A;  2QG2 A;  1BXD A;  2IWS A;  1NHJ A;  3DGE A;  3D36 A;  4E02 A;  1EA6 A;  2IWU A;  4O09 A;  4AWQ A;  2IOR A;  3C0E A;  2BT0 A;  3A0W A;  4GFN A;  4JAU A;  4L8Z A;  1I5D A;  1AM1 A;  3BMY A;  5CTW A;  2XD6 A;  1GKZ A;  3OPD A;  4URN A;  4AS9 A;  3O2F A;  1F51 A;  3G7E A;  2ZBK B;  3ZM7 A;  4YKW A;  5M4N A;  4XIR A;  3BM9 A;  5FWK A;  3D0B A;  3TTZ A;  1UY8 A;  4PRV A;  4XC0 A;  5CTX A;  1TC6 A;  4CWO A;  2XK2 A;  2YE6 A;  3LPS A;  2QF6 A;  1YT2 A;  1KIJ A;  1Y8P A;  2WI5 A;  4YKZ A;  3A0R A;  1I58 A;  3B28 A;  4FCR A;  1UY7 A;  2BRE A;  2C1G A;  2YI5 A;  3EHH A;  1AJ6 A;  3G75 A;  2WI3 A;  4MPN A;  3WHA A;  2BU5 A;  5F3K A;  3EKR A;  1Z5B A;  4XD8 A;  4ASA A;  2XX5 A;  4L93 A;  5IDM A;  4MB9 A;  4O07 A;  2YE9 A;  3OWB A;  1ZXM A;  4HY6 A;  1AMW A;  1BYQ A;  1TC0 A;  2Q8G A;  2XCM A;  1Y4U A;  2K5B A;  3HHU A;  1QYE A;  3FV5 A;  3G7B A;  4CE3 A;  3T0H A;  2CG9 A;  4GEE A;  4KP4 A;  3K97 A;  4V26 A;  3B24 A;  3ZKB A;  2JKI A;  3CGZ A;  3JZ3 A;  2BZ5 A;  1YT1 A;  2QG0 A;  4LWH A;  5BOD A;  2YI7 A;  2XJX A;  3R4O A;  5D6P A;  4XTJ A;  3K60 A;  4KTN A;  5CTU A;  4AWO A;  4H85 A;  2QFO A;  3KE6 A;  3R4N A;  2BU6 A;  2ESA A;  4CE2 A;  2UWD A; 
#chains in the Genus database with same CATH homology
 1YC1 A;  2VW5 A;  3OW6 A;  5D7R A;  1S16 A;  4AWP A;  3ZXQ A;  3A0X A;  3GIG B;  2O1W A;  3Q5L A;  4WUB A;  2XHX A;  1UYE A;  2WEP A;  4P8O A;  2YE8 A;  4KSH A;  3WQ9 A;  4XE2 A;  3U2K A;  3OWD A;  1AH8 A;  4U7O A;  4LP0 A;  4ASB A;  2BTZ A;  1U2O A;  4BQJ A;  1US7 A;  4WUD A;  4KSG A;  1Z5C A;  4NH7 A;  2Q2E B;  1UYI A;  4XCJ A;  4FMT A;  4BQG A;  4NH9 A;  2BSM A;  1UYC A;  2WER A;  4CWQ A;  2ZDX A;  2YI6 A;  1Y8N A;  5GGZ A;  3TZ4 A;  4HY1 A;  4XKK A;  3R4M A;  4YKU A;  1TH8 A;  1OSF A;  3EKO A;  4BAE A;  2CGF A;  2EXL A;  2YE2 A;  2HG1 A;  4MP2 A;  3CRL A;  2AKP A;  4BIU A;  1UYM A;  2XDS A;  4U93 A;  2IOQ A;  4L90 A;  4ASF A;  2YGF A;  4EEH A;  3EHF A;  2YEF A;  1MU5 A;  1H7S A;  2WI1 A;  2FWY A;  5L3J A;  3HZ5 A;  3QDD A;  1YS3 A;  3NMQ A;  4R1F A;  3TUH A;  4BXI A;  3RLR A;  2CCT A;  5D7C A;  4NH8 A;  4YKQ A;  2FYP A;  4U7N A;  3ZKD A;  3HYZ A;  1I59 A;  1EI1 A;  4YKX A;  2IOP A;  3Q5K A;  3RLQ A;  2BRC A;  4CWP A;  2XAB A;  3SL2 A;  5CPH A;  4I3H A;  3QTF A;  3RLP A;  2YGA A;  1MX0 A;  3VHC A;  3CWV A;  4LWI A;  1S14 A;  2YEI A;  4CWR A;  2XX2 A;  3CRK A;  2YED A;  4JAV A;  5M4P A;  4LWE A;  3EHG A;  4HXW A;  4EGI A;  2WEQ A;  4PRX A;  2WI4 A;  2VWC A;  4QPK A;  2JJC A;  4R3M A;  4URM A;  2GQP A;  1YER A;  3K98 A;  2YE7 A;  5M4E A;  2O1U A;  3HZ1 A;  1B63 A;  4DUH A;  3PEJ A;  4EM7 A;  1UYK A;  3FT5 A;  3INW A;  4MP7 A;  1ZWH A;  5IDJ A;  2YJX A;  3TZ2 A;  3T1K A;  4V25 A;  3VHD A;  3PEH A;  4B6C A;  4X9L A;  2YE5 A;  4XKA A;  2H55 A;  1NHH A;  2Q8I A;  4JAS A;  1YC4 A;  4FPP A;  5IN9 A;  2C2A A;  4Q20 A;  3OMU A;  4HYP A;  2Q8F A;  4URL A;  4P7A A;  2FXS A;  2XHR A;  4XIT A;  1YES A;  2WI7 A;  5CTY A;  1UYF A;  2YJW A;  4XKO A;  3A0Z A;  1Y4S A;  2BU8 A;  2VCI A;  3TZ0 A;  2Q8H A;  1TBW A;  3C11 A;  3R91 A;  3A0T A;  1TID A;  4GT8 A;  3LNU A;  4FCP A;  2O1V A;  4HYM A;  2ZDY A;  1YT0 A;  2CCU A;  2YEB A;  4LWF A;  3HEK A;  4HXZ A;  4YKR A;  1L0O A;  3U2D A;  3R4P A;  1UYD A;  1KZN A;  2XDK A;  4B7P A;  3IED A;  3B26 A;  4YKT A;  1AH6 A;  2BU7 A;  5D7D A;  1B62 A;  2ZKJ A;  2YEJ A;  4O04 A;  2YEC A;  2YGE A;  1I5C A;  1THN A;  3U67 A;  2WI2 A;  4O05 A;  2YKI A;  4LPB A;  1YC3 A;  3RKZ A;  3VHA A;  2YKE A;  4DZY A;  2BU2 A;  1B3Q A;  2WI6 A;  4H7Q A;  4MPE A;  2HCH A;  4E01 A;  2YI0 A;  4QPJ A;  2XJJ A;  2E0A A;  4HZ0 A;  1NHI A;  4R3A A;  1UYL A;  2YKJ A;  2CCS A;  2YKC A;  5D6Q A;  5M4K A;  4L94 A;  3ZXO A;  4GCZ A;  5FNC A;  4H81 A;  4L91 A;  4K4O A;  4E00 A;  2BYH A;  4MPC A;  3O6O A;  4CWF A;  3GIG A;  1BKN A;  1YSZ A;  1UY6 A;  2H8M A;  2YEA A;  4MOT A;  1YET A;  4EFT A;  1BGQ A;  4CWN A;  3H80 A;  4CWS A;  2YEE A;  3H4L A;  4EMV A;  1Z59 A;  4XIQ A;  3T0Z A;  3D2R A;  4XCL A;  1H7U A;  3MNR P;  4CWT A;  5FNF A;  2BYI A;  3TZ5 A;  2XDX A;  3K99 A;  1A4H A;  2XX4 A;  2YE4 A;  4HZ5 A;  5F5R A;  5FND A;  3R92 A;  4EGH A;  4KFG A;  3B27 A;  4EFU A;  2VCJ A;  2XDL A;  3O0I A;  3Q5J A;  1I5B A;  4PU9 A;  5C93 A;  1UYG A;  2XHT A;  5CF0 A;  3EHJ A;  2YK9 A;  1GJV A;  5J6A A;  1GKX A;  4ASG A;  1TIL A;  1UY9 A;  1Y8O A;  4GGL A;  4WUC A;  5M4H A;  4YKY A;  4EGK A;  2CH4 A;  3INX A;  1QY8 A;  3T2S A;  1PVG A;  2GFD A;  1ID0 A;  2FWZ A;  4ZVI A;  3HYY A;  1JM6 A;  3B25 A;  3CGY A;  1Z5A A;  5J71 A;  2YEG A;  1ZXN A;  4ZKI A;  4GQT A;  4W7T A;  1U0Z A;  3A0Y A;  2YEH A;  2HKJ A;  4CE1 A;  2IWX A;  4FCQ A;  4BIZ A;  1YSR A;  5M4M A;  4URO A;  4MBC A;  5BOC A;  3VAD A;  3T10 A;  4LWG A;  4JQL A;  1QZR A;  4KQV A;  3GIE A;  1R62 A;  3FT8 A;  4PL9 A;  4XIP A;  1UYH A;  1ZW9 A;  4XDM A;  2PNR A;  2YK2 A;  2YKB A;  1I5A A;  2YE3 A;  3GIF A;  4O0B A;  4I5S A;  2XDU A;  2XJG A;  2QG2 A;  1BXD A;  2IWS A;  1NHJ A;  3DGE A;  3D36 A;  4E02 A;  1EA6 A;  2IWU A;  4O09 A;  4AWQ A;  2IOR A;  3C0E A;  2BT0 A;  3A0W A;  4GFN A;  4JAU A;  4L8Z A;  1I5D A;  1AM1 A;  3BMY A;  5CTW A;  2XD6 A;  1GKZ A;  3OPD A;  4URN A;  4AS9 A;  3O2F A;  3G7E A;  2ZBK B;  3ZM7 A;  4YKW A;  5M4N A;  4XIR A;  3BM9 A;  5FWK A;  3D0B A;  3TTZ A;  1UY8 A;  4PRV A;  4XC0 A;  5CTX A;  1TC6 A;  4CWO A;  2XK2 A;  2YE6 A;  3LPS A;  2QF6 A;  1YT2 A;  1KIJ A;  1Y8P A;  2WI5 A;  4YKZ A;  3A0R A;  1I58 A;  3B28 A;  4FCR A;  1UY7 A;  2BRE A;  2YI5 A;  3EHH A;  1AJ6 A;  3G75 A;  2WI3 A;  4MPN A;  3WHA A;  2BU5 A;  5F3K A;  3EKR A;  1Z5B A;  4XD8 A;  4ASA A;  2XX5 A;  4L93 A;  5IDM A;  4MB9 A;  4O07 A;  2YE9 A;  3OWB A;  1ZXM A;  4HY6 A;  1AMW A;  1BYQ A;  1TC0 A;  2Q8G A;  2XCM A;  1Y4U A;  2K5B A;  3HHU A;  1QYE A;  3FV5 A;  3G7B A;  4CE3 A;  3T0H A;  2CG9 A;  4GEE A;  4KP4 A;  3K97 A;  4V26 A;  3B24 A;  3ZKB A;  2JKI A;  3CGZ A;  3JZ3 A;  2BZ5 A;  1YT1 A;  2QG0 A;  4LWH A;  5BOD A;  2YI7 A;  2XJX A;  3R4O A;  5D6P A;  4XTJ A;  3K60 A;  4KTN A;  5CTU A;  4AWO A;  4H85 A;  2QFO A;  3KE6 A;  3R4N A;  2BU6 A;  2ESA A;  4CE2 A;  2UWD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...