4P7AA

Crystal structure of human mlh1
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
334
structure length
303
Chain Sequence
FVAGVIRRLDETVVNRIAAGEVIQRPANAIKEMIENCLDAKSTSIQVIVKEGGLKLIQIQDNGTGIRKEDLDIVCERFTTSKLGFRGEALASISHVAHVTITTKTADGKCAYRASYSDGKLKAPPKPCAGNQGTQITVEDLFYNIATRRKALKNPSEEYGKILEVVGRYSVHNAGISFSVKKQGETVADVRTLPNASTVDNIRSIFGNAVSRELIEIGCEDKTLAFKMNGYISNANYSVKKCIFLLFINHRLVESTSLRKAIETVYAAYLPKNTHPFLYLSLEISPESILERVQQHIESKLLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords DNA mismatch repair protein Mlh1
publication title Structure of the human MLH1 N-terminus: implications for predisposition to Lynch syndrome.
pubmed doi rcsb
source organism Homo sapiens
total genus 88
structure length 303
sequence length 334
ec nomenclature
pdb deposition date 2014-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01119 DNA_mis_repair DNA mismatch repair protein, C-terminal domain
A PF13589 HATPase_c_3 Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4p7aA02
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 4p7aA01
2X7IA 4XKAA 3J80C 1BYQA 4HY6A 2VWCA 4AQYE 4MOTA 2EFGA 4DV5E 1Z0CA 1D6TA 1YERA 4O04A 4L91A 2BSMA 3EKOA 2IOPA 4DR4I 3FT8A 3D2RA 3WU4A 1IBKI 3INWA 4JI8I 3A0YA 3QT6A 3A0WA 1IBME 2YECA 1AJ6A 2HG1A 1FKAE 1EA6A 3T1KA 3SL2A 2UXDE 1AMWA 4AWOA 4LF9E 4NXNE 5GMEA 2ESAA 2CCTA 4MB9A 3WU6A 1UYDA 2YJXA 4JYAI 2UXBE 3OTOE 4BAEA 2EXLA 3T1HE 4EMVA 2QG2A 4HZ5A 5LMUE 2YE8A 3RLPA 2VQEE 5D6QA 4XDMA 4XTJA 2YE6A 2XJGA 3HZ1A 4USKA 4JI3I 2LJPA 4DPUA 3J7AM 4YKQA 3ZZ0A 4U93A 1U0ZA 4JI1E 4M1KA 5M4MA 4XIRA 1N32I 1H7SA 3KE6A 4HY1A 4DPXA 4LF7I 4B3TE 1YSZA 1JM6A 5BR8I 2E5LI 4XE2A 1UY8A 4X62I 4MPNA 1XNRE 1UY7A 2R3VA 1FJGE 2YEIA 4LP0A 4YKXA 4JV5I 1N0UA 4KFGA 4R3AA 4XIQA 4X65I 5FLXQ 4DV0E 2VCJA 4GT8A 4MYTA 2YKCA 1XHKA 5M4EA 1Z0VA 2V2ZA 2BM1A 2FYPA 2Q8FA 4GKKE 1ZXMA 2O1UA 3D36A 3C11A 1B62A 4LF6E 4DV4E 1I5AA 2XJJA 4O0BA 4XIPA 1N0VC 4O05A 4LWFA 4P7AA 1GKXA 1ID0A 1GJVA 1YT2A 3OPDA 4NH8A 4YKUA 1YC3A 4O07A 2IWSA 4B3RI 2HCHA 3B25A 4OX9E 3J81C 2CCUA 1WUUA 1A4HA 4RPFA 4DUYI 4EM7A 4DR7I 3HZ5A 1N33I 1YC4A 2OI2A 2XDLA 4URMA 2BRCA 2XABA 3Q5KA 2XX2A 1YSRA 3O2FA 1H74A 4X64E 4LF8I 1ZWHA 4CWSA 4WUDA 1XNQI 4DPYA 3T1YI 5IT9Q 4BIUA 2HK3A 2CG9A 3ZXQA 4JI7E 4JG4A 2K5BA 1J5EI 4YKTA 1YS3A 4KSHA 4DV3E 4X9LA 1AM1A 4LWGA 3V2UC 1AH6A 3O0IA 2X36A 3K60A 3VADA 4MP2A 2BV3A 4HYMA 4LFAI 1UYCA 2UWDA 3QT7A 4WUBA 2JKIA 5BODA 4DV1I 4GEEA 1ZM2A 4DR6I 4FCQA 2FXSA 1NHHA 1HNZE 2UU9I 3QT5A 4DU7A 2XHXA 3TZ2A 4CWQA 4FWHA 3A0RA 2HHHE 2FWYA 2PNRA 5IWAE 4V25A 4X66E 3RLRA 1DARA 4UROA 2VW5A 4XKOA 3TTZA 4KTNA 3BMYA 2BU7A 2UUCE 5M4HA 5C93A 1Z59A 3HHUA 2BU5A 1I59A 4GFNA 3PEJA 3EHJA 5FNDA 2YE7A 3VHDA 4LFCI 3U67A 4JQLA 1Y8OA 3B28A 4MYUA 3J7AG 2ZM6E 1KKHA 3GIFA 1KIJA 4ASFA 4UT4A 3K97A 3WQ9A 4URLA 2Q8IA 2VQFI 2HFSA 4KHPE 4FMTA 2CZ9A 4DUZI 1Z5CA 1HNWE 3WU3A 3GIGB 5CPHA 5BOCA 3T2SA 3NMQA 1YC1A 2YKBA 2YKJA 3BM9A 3K99A 3HEKA 4V26A 3TZ5A 3ZXOA 4GCZA 2BU6A 3ZZUA 3B24A 4XKKA 2YI7A 4U7NA 2XD6A 2YE2A 2HK2A 4LF4I 3H80A 3WHAA 4DR5E 1FNMA 3TZ4A 2YEHA 4ZKIA 4AWQA 4PL9A 4DZYA 4JI5I 2CCSA 1TIDA 4FW9A 4L94A 4B6CA 4DV5I 1UYKA 2XDXA 4MPCA 4JI4E 2QG0A 4I3HA 4QPJA 1N36E 5L3JA 2YJWA 1N34E 1Z0BA 4EFTA 4DV6E 4AWPA 3OWBA 2WEQA 4XC0A 1IBMI 2J7KA 2QFOA 1Z0EA 3A0XA 4GKJE 1TBWA 2UXDI 2V2VA 4NXNI 1HNXE 2UUAE 4LF9I 4HXWA 3HULA 3ZM7A 1Y4SA 4EGKA 2A2CA 2HKEA 4DR1E 1IBLE 2BM0A 4I5SA 2NPFA 4URNA 2UXBI 3OTOI 4ZVIA 2IOQA 5CTUA 2AJ4A 3OW6A 1UY6A 1BGQA 1U2OA 4DUHA 4PRVA 3VHAA 5LMUI 4LFBE 2XJXA 2VQEI 1ZXNA 1H72C 4BIZA 5FLXC 4DXLA 1RREA 2XDSA 2FWZA 1L0OA 4H81A 1ELOA 2CGFA 3ZZTA 2YEAA 5FWKA 3CWVA 3PYFA 3O6OA 4XCLA 4B3ME 3M6AA 4JI1I 4LWHA 1KVKA 1RR9A 2BU8A 2IORA 1QYEA 4FN5A 2YI6A 4JAVA 1UYLA 4JI6E 2YGEA 4JASA 4XCJA 3HYYA 3CRKA 3R91A 3D4JA 3T10A 1ZW9A 3EHGA 5A2QC 4HACB 2YE5A 5IDMA 4B3TI 3ZKDA 4L8ZA 1GKZA 3F0NA 5D7DA 2XEXA 2YEGA 3OMUA 1FJGI 3EHFA 4CE3A 1S4EA 2WI2A 2BT0A 4DR2E 1UYEA 2XCMA 4YKWA 4DV0I 3R4OA 3GIEA 2IWUA 2HKJA 5IT9C 1HR0E 1NHJA 5F5RA 4DV7E 3FV5A 5GGZA 1UYMA 4NXME 1K47A 1MG7A 5LMNE 4CE1A 4GKKI 4LF5E 2YK2A 1Z0WA 4YHHE 1Z0GA 4K0KE 4LF6I 2V8PA 2YE4A 1XMOE 2BYHA 3TUHA 1PVGA 4AS9A 3MNRP 1R62A 4KP4A 1Z0TA 1UYIA 2GQPA 4EGHA 1UY9A 5FNFA 4YKYA 4OX9I 1OJ4A 3LTOA 3LNUA 2YGFA 3IEDA 1FWLA 4PU9A 4LWIA 1UYGA 4EFUA 4QPKA 3JAMQ 4X64I 3Q5JA 3CGZA 2ZDXA 2VCIA 4JI7I 5J71A 2WI3A 2F4VE 2JJCA 4DV3I 4FCRA 2YI5A 2YEDA 4DR3E 1MX0A 4YY3E 4B3SE 3R4MA 4BQGA 1KTVA 4GGLA 1BKNA 3R4NA 4U7OA 2A2DA 2IWXA 3B78A 2YEJA 4JI0E 5F3KA 2BTZA 2BU2A 2HHHI 4DV2E 4JI2E 2AKPA 2QF6A 1H7UA 4YKZA 1Y8NA 5IWAI 5CTYA 2UXCE 4X66I 3HYZA 4Z7CA 2UUCI 3PYDA 3Q5LA 1I94E 2UUBE 3GIGA 4L93A 4P52A 1XMQE 2XX4A 5FNCA 4CE2A 2YKIA 2YI0A 4CWRA 2ZM6I 3K98A 1TC0A 4HZ0A 3U2KA 1YT1A 1B63A 3WU5A 3T0ZA 4DR4E 3H4LA 1IBKE 4JI8E 2HFUA 4DPTA 4KHPI 1HNWI 1THNA 3G7BA 3QT8A 4AQYI 3Q1QA 1I58A 4ASGA 4ED4A 2XHTA 4JYAE 4ASBA 5IN9A 2V34A 4EEHA 1UYFA 3A0ZA 2Q8HA 4DR5I 2ZBKB 2YEBA 3QDDA 3C0EA 4XITA 4NH9A 5M4NA 1YESA 5LL6R 3J80Q 4NH7A 5D7CA 3VHCA 1S14A 4MP7A 2BYIA 3T1HI 1I5CA 2ZKJA 4JI3E 4JI4I 1MU5A 1N36I 2XDUA 2E1RA 2YEEA 4H85A 1N34I 4DV6I 1TC6A 1QY8A 5IDJA 4CWPA 3K1JA 1TH8A 2XHRA 4GKJI 3CGYA 1N32E 1VISA 4ASAA 3TZ0A 2UUAI 1HNXI 2YGAA 2YKEA 2WEPA 4CWFA 4LF7E 4DR1I 1IBLI 5J6AA 5BR8E 2E5LE 1US7A 4X62E 2Q2EB 1Z5AA 3PEHA 3B8HA 2H55A 4LFBI 1AH8A 4JV5E 5CF0A 1S16A 1FI4A 4X65E 1PIEA 2C2AA 4HACA 2WI6A 1TILA 3JZ3A 3QTFA 1UEKA 2WI4A 1PKPA 2V2QA 1XNRI 1H73A 1B3QA 3B27A 1I5BA 3RLQA 1QZRA 1Y8PA 4FWGA 2R42A 4Z7YA 2CH4A 1ZM9A 2YE3A 3CRLA 4B3MI 1Z5BA 4WUCA 3PYGA 1YT0A 3OWDA 4JI6I 4KSGA 1A6FA 3B26A 3INXA 2YE9A 3V5RA 4GQTA 4K4OA 4P8OA 4CWTA 4CWNA 5D7RA 1Y4UA 2DEJA 4B3RE 4MPEA 5CTWA 3DGEA 4DUYE 4DR7E 4DU8A 4DV4I 3G75A 1N33E 4LWEA 3EKRA 3GONA 3EHHA 4DR2I 4LF8E 5M4KA 1FWKA 1XNQE 3T1YE 3JAMC 4HYPA 1ZM3A 2ZITA 1I5DA 3D0BA 5A2QQ 2YEFA 1BXDA 1HR0I 1J5EE 2XDKA 2Q8GA 4DV7I 1OSFA 4NXMI 2XK2A 5LMNI 3R4PA 4BQJA 4LF5I 5CTXA 4YHHI 4LFAE 4K0KI 4E00A 4B7PA 2VF3A 3LPSA 4DV1E 1XMOI 3ZKBA 4DR6E 3RKZA 4YKRA 2UU9E 5GMDA 2WI5A 2O1WA 4EGIA 3J81Q 4CWOA 2YK9A 3B82A 4FPPA 2BREA 2DEIA 4FCPA 1NHIA 4E02A 2WERA 4XD8A 2GFDA 1HNZI 4R3MA 1NZ0A 3U2DA 4LFCE 2F4VI 2WI7A 4MBCA 2H8MA 4R1FA 4BXIA 4UTGA 4DR3I 3A0TA 4YY3I 4B3SI 3T0HA 2GS8A 2VQFE 2E0AA 3FT5A 4L90A 5D6PA 2WI1A 3PYEA 4H7QA 4DUZE 1YETA 1U2RA 2WW4A 4O09A 4KQVA 1KZNA 4JI0I 2ZDYA 1ZM4A 2O1VA 4DPWA 4DV2I 4JI2I 4Q20A 1EI1A 4JAUA 4FWDA 5M4PA 2UXCI 4PRXA 4EMDA 4LF4E 1UYHA 4LPBA 2XX5A 3R92A 4HXZA 1I94I 2UUBI 4USMA 2BZ5A 3G7EA 3K17A 4JI5E 4W7TA 4E01A 1XMQI
chains in the Genus database with same CATH superfamily
2X7IA 4XKAA 3J80C 1BYQA 4HY6A 2VWCA 4AQYE 4MOTA 2EFGA 4DV5E 1Z0CA 1D6TA 1YERA 4O04A 4L91A 2BSMA 4IFDF 2IOPA 4DR4I 3EKOA 3FT8A 3D2RA 3WU4A 1IBKI 3INWA 4JI8I 3A0YA 3QT6A 3A0WA 1IBME 2BA1G 5JEAF 2YECA 5JEAA 5EKWA 1AJ6A 2HG1A 4LOMA 1FKAE 1EA6A 2C1IA 3SL2A 2UXDE 1AMWA 3T1KA 4AWOA 4LF9E 4NXNE 3CYGA 2VESA 5GMEA 2ESAA 2CCTA 4MB9A 3WU6A 1UYDA 1IXMA 2YJXA 4JYAI 5DNXA 2JEBB 3OTOE 2UXBE 4BAEA 3CDJA 2EXLA 3T1HE 4EMVA 2QG2A 4HZ5A 4MU3A 5LMUE 2YE8A 2CVEA 2NN6C 3RLPA 2VQEE 5D6QA 2PO2B 4XDMA 4XTJA 2YE6A 2C37A 4AIMA 3Q6MA 4USKA 2XJGA 3HZ1A 4JI3I 4U3DA 2LJPA 4DPUA 3J7AM 4YKQA 3ZZ0A 4U93A 1U0ZA 5C0XF 5C0XA 4JI1E 2JEAB 4M1KA 5M4MA 2BA1D 4XIRA 1N32I 3PS3A 5K36D 1H7SA 3KE6A 4HY1A 2O1TA 4LCFA 4DPXA 4LF7I 2J65A 4B3TE 4MU1A 1YSZA 1F51A 2C39A 1JM6A 5BR8I 2E5LI 4XE2A 1UY8A 4FW6A 4X62I 4MPNA 1XNRE 1UY7A 2R3VA 1FJGE 2YEIA 4LP0A 4YKXA 3P3CA 4JV5I 1N0UA 4KFGA 4R3AA 4XIQA 4X65I 5FLXQ 4DV0E 2VCJA 4GT8A 4MYTA 2YKCA 1XHKA 5M4EA 1Z0VA 2V2ZA 4OO1A 2BM1A 2FYPA 2Q8FA 1YH8A 4GKKE 1ZXMA 2O1UA 3GMEA 3D36A 2Z5CA 4MQYA 1B62A 4LF6E 4DV4E 1I5AA 4LCGA 2XJJA 3C11A 1N0VC 2WP8B 4O0BA 4O05A 4LWFA 4P7AA 1GKXA 1ID0A 1GJVA 1YT2A 3OPDA 4NH8A 4YKUA 1YC3A 4O07A 2IWSA 5JEAC 4B3RI 2HCHA 3B25A 4OX9E 3J81C 2PO1A 2CCUA 1WUUA 1Y60A 1A4HA 4RPFA 4DUYI 2PNZA 4EM7A 4DR7I 4QNJA 3HZ5A 1N33I 4BA2B 2OI2A 1YC4A 2XDLA 4URMA 2BRCA 2XABA 3Q5KA 2XX2A 1YSRA 2CGEA 3O2FA 1H74A 4X64E 4LF8I 1ZWHA 4CWSA 4WUDA 1XNQI 4DPYA 3T1YI 5IT9Q 4BIUA 2CG9A 2HK3A 3ZXQA 4JI7E 4JG4A 2K5BA 1J5EI 4YKTA 2C38A 1YS3A 4KSHA 4DV3E 4X9LA 1AM1A 4LWGA 3V2UC 1AH6A 3O0IA 2X36A 2WNRA 1E3HA 3K60A 3VADA 4MP2A 2BV3A 2NN6D 4HYMA 4LFAI 1UYCA 3QT7A 4WUBA 2JKIA 5DRPA 2UWDA 5K36E 1HK7A 5BODA 4DV1I 4AM3A 4GEEA 1ZM2A 4DR6I 4FCQA 2FXSA 1NHHA 5C0XC 1HNZE 3QT5A 4DU7A 2UU9I 2XHXA 3TZ2A 1UDNA 2JE6B 4FWHA 3A0RA 2HHHE 4CWQA 2FWYA 2PNRA 5IWAE 4V25A 4X66E 3RLRA 4U3BA 1DARA 4UROA 2VW5A 4XKOA 3TTZA 4KTNA 3BMYA 2BU7A 2IESA 1BXDA 2UUCE 5M4HA 5C93A 1Z59A 3M7NG 2BU5A 2PO0A 1I59A 3HHUA 4GFNA 3PEJA 3EHJA 5FNDA 2YE7A 3VHDA 4LFCI 4IZKB 4JQLA 1Y8OA 3U67A 2C1GA 3B28A 4MYUA 3J7AG 2ZM6E 1KKHA 3GIFA 1KIJA 4ASFA 4UT4A 3K97A 3WQ9A 2BR2B 1E3PA 4URLA 2Q8IA 2VQFI 1XXEA 2HFSA 4OO1C 4KHPE 4FMTA 1UDSA 2CZ9A 4DUZI 1Z5CA 1HNWE 3WU3A 3GIGB 5CPHA 5BOCA 3T2SA 4AIDA 3NMQA 1YC1A 2YKBA 2YKJA 3BM9A 3K99A 3HEKA 4V26A 3TZ5A 3ZXOA 4GCZA 2BU6A 3ZZUA 3B24A 4XKKA 2YI7A 4U7NA 2XD6A 2YE2A 2HK2A 4LF4I 3H80A 3WHAA 4DR5E 1FNMA 3P3EA 2YEHA 3TZ4A 3K85A 4ZKIA 4IFDD 4AWQA 4PL9A 3M7ND 4DZYA 4JI5I 2CCSA 1TIDA 4FW9A 5JEAD 4L94A 4B6CA 3P3GA 1OYSA 2JEBA 4DV5I 1UYKA 2XDXA 4MPCA 4JI4E 2QG0A 4I3HA 2NN6E 1N36E 4QPJA 5L3JA 2YJWA 1N34E 1Z0BA 4EFTA 4DV6E 4AWPA 3OWBA 2WEQA 4XC0A 4IFDB 1IBMI 2J7KA 2QFOA 1Z0EA 3A0XA 4GKJE 2PO2A 1TBWA 2UXDI 2V2VA 4NXNI 1HNXE 4FW7A 2UUAE 4LF9I 3HULA 4IZJD 4HXWA 1Y4SA 3ZM7A 4EGKA 2A2CA 2HKEA 4DR1E 1IBLE 2BM0A 4I5SA 2NPFA 4URNA 2UXBI 3OTOI 2IOQA 4ZVIA 5CTUA 2AJ4A 3OW6A 1UY6A 1BGQA 1U2OA 4DUHA 4PRVA 3VHAA 5LMUI 4LFBE 2XJXA 2VQEI 1Y6ZA 1H72C 1ZXNA 5DROA 5C0XD 4BIZA 5JENA 5FLXC 4IZJB 4DXLA 1RREA 2XDSA 2FWZA 1L0OA 4H81A 1ELOA 4LCHA 2CGFA 2GO4A 3ZZTA 2YEAA 5FWKA 3KRNA 3CWVA 3PYFA 3O6OA 4XCLA 4B3ME 3M6AA 4JI1I 4LWHA 1KVKA 1RR9A 2BU8A 5K36B 1QYEA 4FN5A 2IORA 2YI6A 1UYLA 4JI6E 2YGEA 4JAVA 4JASA 3HYYA 3CRKA 2HHIA 4XCJA 3D4JA 3R91A 3T10A 1ZW9A 3EHGA 3Q6NA 5A2QC 4HACB 4OO1F 2GO3A 3S5TA 2YE5A 5IDMA 4B3TI 3ZKDA 4L8ZA 1GKZA 3F0NA 5D7DA 2XEXA 2YEGA 4IFDE 1FJGI 1YHCA 3OMUA 3EHFA 4CE3A 1S4EA 2WI2A 2WP8A 2BT0A 5JEAE 4DR2E 1UYEA 2XCMA 4YKWA 4DV0I 3R4OA 3GIEA 2IWUA 5EL9A 2HKJA 4J3DA 5IT9C 1HR0E 2AE8A 1NHJA 5F5RA 1R6LA 4DV7E 3FV5A 5GGZA 1UYMA 4NXME 1K47A 1MG7A 5LMNE 4CE1A 4GKKI 4LF5E 4BA2A 1Z0WA 2YK2A 4YHHE 1Z0GA 4K0KE 4LF6I 2V8PA 2YE4A 1XMOE 5DNLA 2BYHA 1PVGA 4AS9A 3TUHA 3MNRP 4BA1B 1R62A 4KP4A 1Z0TA 1UYIA 1USUA 2GQPA 4EGHA 1UY9A 5FNFA 4YKYA 4OX9I 1OJ4A 3LTOA 3LNUA 2YGFA 3IEDA 3PS1A 4OKGA 1UDQA 1FWLA 4PU9A 4LWIA 5C0XE 1UYGA 2PNLA 4EFUA 4QPKA 3JAMQ 4X64I 2IERA 3Q5JA 3CGZA 4NBQA 2ZDXA 2VCIA 4JI7I 5J71A 2WI3A 2JE6A 2F4VE 2JJCA 4DV3I 3CDIA 4FCRA 2YI5A 2YEDA 2NN6B 4DR3E 1MX0A 4YY3E 4B3SE 3R4MA 4BQGA 1KTVA 4GGLA 1BKNA 3R4NA 4U7OA 2A2DA 1P42A 2IWXA 3B78A 2YEJA 3PS2A 5DRQA 4JI0E 4IZKA 5F3KA 2BTZA 2BU2A 4GQUA 2HHHI 4DV2E 4JI2E 2AKPA 2QF6A 1H7UA 4YKZA 1Y8NA 5IWAI 5CTYA 2UXCE 4X66I 3HYZA 2Z5BB 4Z7CA 2UUCI 3PYDA 3Q5LA 1I94E 2UUBE 3GIGA 2BA0G 4FW3A 4L93A 4P52A 1XMQE 2XX4A 3L7ZB 5FNCA 4CE2A 2YKIA 2YI0A 4CWRA 3U1YA 2ZM6I 4XIPA 3K98A 1TC0A 4HZ0A 3U2KA 1YT1A 1B63A 3WU5A 3T0ZA 4DR4E 3H4LA 4QNKA 1IBKE 4JI8E 2HFUA 4DPTA 4KHPI 1HNWI 3H1CA 1THNA 4N3OA 3G7BA 3QT8A 4AQYI 3Q1QA 1I58A 4FW5A 1UDOA 2FTKA 4ASGA 4ED4A 2XHTA 4JYAE 4ASBA 5IN9A 2V34A 4EEHA 1UYFA 3A0ZA 2Q8HA 4DR5I 4IFDA 2ZBKB 2YEBA 3QDDA 3M85G 3C0EA 5JEAB 4NH9A 4IS9A 2BA0D 3P06A 1YESA 4XITA 5M4NA 5LL6R 3J80Q 4NH7A 5D7CA 3VHCA 1S14A 4MP7A 2PNMA 2BYIA 3T1HI 1I5CA 3HKMA 2ZKJA 4JI3E 4JI4I 1MU5A 1N36I 2JEAA 2E1RA 2XDUA 2YEEA 4H85A 1N34I 4DV6I 1TC6A 1QY8A 5IDJA 4CWPA 3K1JA 1TH8A 2XHRA 4GKJI 3CGYA 1N32E 1VISA 4ASAA 4IZJA 2UUAI 1HNXI 3TZ0A 2YGAA 2YKEA 2WEPA 4CWFA 4LF7E 4DR1I 2C37B 1IBLI 5J6AA 5BR8E 3GLLA 2E5LE 1US7A 4X62E 2Q2EB 1Z5AA 3PEHA 2GQ0A 3B8HA 5K36F 4LFBI 5K36A 5C0XB 5ELWA 1AH8A 4MDTA 2H55A 4JV5E 3M85D 1S16A 3B4TA 1FI4A 4X65E 5CF0A 1PIEA 2C2AA 4HACA 2WI6A 3U1KA 3DD6A 1TILA 3JZ3A 3QTFA 1UEKA 2WI4A 1PKPA 2C39B 2V2QA 1H73A 1XNRI 4OO1D 1B3QA 1I5BA 3B27A 1QZRA 3RLQA 1Y8PA 4FWGA 2R42A 4Z7YA 2CH4A 1ZM9A 2YE3A 1OYRA 4B3MI 1Z5BA 3CRLA 4WUCA 3PYGA 4MU0A 1YT0A 3OWDA 4JI6I 4KSGA 1A6FA 3B26A 3INXA 2YE9A 4MU4A 3V5RA 4GQTA 4K4OA 4P8OA 4CWTA 4CWNA 5D7RA 1Y4UA 2DEJA 2Z5EA 4B3RE 4MPEA 5CTWA 3DGEA 4OO1B 1RHYA 4DUYE 4DR7E 4DU8A 4DV4I 3G75A 1N33E 4LWEA 1OYPA 2Z5CB 3EKRA 3GONA 3EHHA 4DR2I 1USVA 2O3ZA 4LF8E 5M4KA 1FWKA 4BA1A 1XNQE 3T1YE 3JAMC 4HYPA 1ZM3A 2ZITA 5DRRA 4IFDC 5A2QQ 1I5DA 2YEFA 3D0BA 1HR0I 1J5EE 2XDKA 2Q8GA 4DV7I 1OSFA 2PO1B 4NXMI 2XK2A 5LMNI 3R4PA 2PNZB 4LF5I 5CTXA 4BQJA 4YHHI 4LFAE 4K0KI 4E00A 4B7PA 2VF3A 3P76A 3LPSA 4DV1E 1XMOI 3ZKBA 4DR6E 2JT2A 3RKZA 4YKRA 2UU9E 3HJCA 5GMDA 2WI5A 4E72A 2O1WA 4EGIA 3J81Q 2C38B 4LPFA 4CWOA 2NN6F 2NN6A 2YK9A 3B82A 4FPPA 2WNRB 2BREA 2DEIA 4FCPA 1NHIA 4ISAA 3NZKA 4E02A 2WERA 4XD8A 2GFDA 1HNZI 4R3MA 1NZ0A 3U2DA 4LFCE 5K36C 1VI7A 2F4VI 3PRYA 2WI7A 4OO1E 4OZEA 4MBCA 2H8MA 4R1FA 3LMMA 4BXIA 2BR2A 4UTGA 4DR3I 2Z5BA 3A0TA 4YY3I 4B3SI 3UHMA 3T0HA 2GS8A 2VQFE 2E0AA 3FT5A 4L90A 5D6PA 2WI1A 3PYEA 4H7QA 4DUZE 1YETA 2PO0B 1U2RA 2WW4A 4O09A 4KQVA 1Y5YA 3GCMA 4JI0I 3L7ZA 1KZNA 2ZDYA 1ZM4A 2O1VA 4FW4A 4DPWA 4DV2I 4JI2I 4Q20A 1EI1A 4JAUA 4FWDA 5M4PA 2UXCI 4PRXA 4EMDA 4LF4E 1UYHA 4LPBA 2XX5A 1R6MA 2F1DA 3R92A 4HXZA 1I94I 2UUBI 4USMA 2BZ5A 3G7EA 3K17A 4JI5E 4W7TA 4E01A 1XMQI
chains in the Genus database with same CATH topology
2X7IA 4XKAA 3J80C 1BYQA 4HY6A 2VWCA 4AQYE 4MOTA 2EFGA 4DV5E 1Z0CA 1D6TA 1YERA 4O04A 4L91A 2BSMA 3EKOA 2IOPA 4DR4I 3FT8A 3D2RA 3WU4A 1IBKI 3INWA 4JI8I 3A0YA 3QT6A 3A0WA 1IBME 2YECA 1AJ6A 2HG1A 1FKAE 1EA6A 3T1KA 3SL2A 2UXDE 1AMWA 4AWOA 4LF9E 4NXNE 5GMEA 2ESAA 2CCTA 4MB9A 3WU6A 1UYDA 2YJXA 4JYAI 2UXBE 3OTOE 4BAEA 2EXLA 3T1HE 4EMVA 2QG2A 4HZ5A 5LMUE 2YE8A 3RLPA 2VQEE 5D6QA 4XDMA 4XTJA 2YE6A 2XJGA 3HZ1A 3Q6MA 4USKA 4JI3I 2LJPA 4DPUA 3J7AM 4YKQA 3ZZ0A 4U93A 1U0ZA 4JI1E 4M1KA 5M4MA 4XIRA 1N32I 1H7SA 3KE6A 4HY1A 2O1TA 4DPXA 4LF7I 4B3TE 1YSZA 1JM6A 5BR8I 2E5LI 4XE2A 1UY8A 4X62I 4MPNA 1XNRE 1UY7A 2R3VA 1FJGE 2YEIA 4LP0A 4YKXA 4JV5I 1N0UA 4KFGA 4R3AA 4XIQA 4X65I 5FLXQ 4DV0E 2VCJA 4GT8A 4MYTA 2YKCA 1XHKA 5M4EA 1Z0VA 2V2ZA 2BM1A 2FYPA 2Q8FA 4GKKE 1ZXMA 2O1UA 3D36A 2Z5CA 3C11A 1B62A 4LF6E 4DV4E 1I5AA 2XJJA 4O0BA 4XIPA 1N0VC 4O05A 4LWFA 4P7AA 1GKXA 1ID0A 1GJVA 1YT2A 3OPDA 4NH8A 4YKUA 1YC3A 4O07A 2IWSA 4B3RI 2HCHA 3B25A 4OX9E 3J81C 2CCUA 1WUUA 1A4HA 4RPFA 4DUYI 4EM7A 4DR7I 3HZ5A 1N33I 1YC4A 2OI2A 2XDLA 4URMA 2BRCA 2XABA 3Q5KA 2XX2A 1YSRA 2CGEA 3O2FA 1H74A 4X64E 4LF8I 1ZWHA 4CWSA 4WUDA 1XNQI 3T1YI 4DPYA 5IT9Q 4BIUA 2CG9A 2HK3A 3ZXQA 4JI7E 4JG4A 2K5BA 1J5EI 4YKTA 1YS3A 4KSHA 4DV3E 4X9LA 1AM1A 4LWGA 3V2UC 1AH6A 3O0IA 2X36A 3K60A 3VADA 4MP2A 2BV3A 4HYMA 4LFAI 1UYCA 2UWDA 3QT7A 4WUBA 2JKIA 5BODA 1HK7A 4DV1I 4GEEA 1ZM2A 4DR6I 4FCQA 2FXSA 1NHHA 1HNZE 2UU9I 3QT5A 4DU7A 2XHXA 3TZ2A 4CWQA 4FWHA 3A0RA 2HHHE 2FWYA 2PNRA 5IWAE 4V25A 4X66E 3RLRA 1DARA 4UROA 2VW5A 4XKOA 3TTZA 4KTNA 3BMYA 2BU7A 2UUCE 5M4HA 5C93A 1Z59A 3HHUA 2BU5A 1I59A 4GFNA 3PEJA 3EHJA 5FNDA 2YE7A 3VHDA 4LFCI 4IZKB 4JQLA 1Y8OA 3U67A 3B28A 4MYUA 3J7AG 2ZM6E 1KKHA 3GIFA 1KIJA 4ASFA 4UT4A 3K97A 3WQ9A 4URLA 2Q8IA 2VQFI 2HFSA 4KHPE 4FMTA 2CZ9A 4DUZI 1Z5CA 1HNWE 3WU3A 3GIGB 5CPHA 5BOCA 3T2SA 3NMQA 1YC1A 2YKBA 2YKJA 3BM9A 3K99A 3HEKA 4V26A 3TZ5A 3ZXOA 4GCZA 2BU6A 3ZZUA 3B24A 4XKKA 2YI7A 4U7NA 2XD6A 2YE2A 2HK2A 4LF4I 3H80A 3WHAA 4DR5E 1FNMA 3TZ4A 2YEHA 4ZKIA 3K85A 4AWQA 4PL9A 4DZYA 4JI5I 2CCSA 1TIDA 4FW9A 4L94A 4B6CA 4DV5I 1UYKA 2XDXA 4MPCA 4JI4E 2QG0A 4I3HA 4QPJA 1N36E 5L3JA 2YJWA 1N34E 1Z0BA 4EFTA 4DV6E 4AWPA 3OWBA 2WEQA 4XC0A 1IBMI 2J7KA 2QFOA 1Z0EA 3A0XA 4GKJE 1TBWA 2UXDI 2V2VA 4NXNI 1HNXE 2UUAE 4LF9I 4HXWA 3HULA 4IZJD 1Y4SA 3ZM7A 4EGKA 2A2CA 2HKEA 4DR1E 1IBLE 2BM0A 4I5SA 2NPFA 4URNA 2UXBI 3OTOI 2IOQA 4ZVIA 5CTUA 2AJ4A 3OW6A 1UY6A 1BGQA 1U2OA 4DUHA 4PRVA 3VHAA 5LMUI 4LFBE 2XJXA 2VQEI 1Y6ZA 1H72C 1ZXNA 4BIZA 5FLXC 4IZJB 4DXLA 1RREA 2XDSA 2FWZA 1L0OA 4H81A 1ELOA 2CGFA 3ZZTA 2YEAA 5FWKA 3CWVA 3PYFA 3O6OA 4XCLA 4B3ME 3M6AA 4JI1I 4LWHA 1KVKA 1RR9A 2BU8A 2IORA 1QYEA 4FN5A 2YI6A 4JAVA 1UYLA 4JI6E 2YGEA 4JASA 4XCJA 3HYYA 3CRKA 3R91A 3D4JA 3T10A 1ZW9A 3EHGA 3Q6NA 5A2QC 4HACB 2YE5A 5IDMA 4B3TI 3ZKDA 4L8ZA 1GKZA 3F0NA 5D7DA 2XEXA 2YEGA 3OMUA 1FJGI 3EHFA 4CE3A 1S4EA 2WI2A 2BT0A 4DR2E 1UYEA 2XCMA 4YKWA 4DV0I 3R4OA 3GIEA 2IWUA 2HKJA 5IT9C 1HR0E 1NHJA 5F5RA 4DV7E 3FV5A 5GGZA 1UYMA 4NXME 1K47A 1MG7A 5LMNE 4CE1A 4GKKI 4LF5E 2YK2A 1Z0WA 4YHHE 1Z0GA 4K0KE 4LF6I 2V8PA 2YE4A 1XMOE 2BYHA 3TUHA 1PVGA 4AS9A 3MNRP 1R62A 4KP4A 1Z0TA 1UYIA 1USUA 2GQPA 4EGHA 1UY9A 5FNFA 4YKYA 4OX9I 1OJ4A 3LTOA 3LNUA 2YGFA 3IEDA 1FWLA 4PU9A 4LWIA 1UYGA 2PNLA 4EFUA 4QPKA 3JAMQ 4X64I 3Q5JA 3CGZA 2ZDXA 2VCIA 4JI7I 5J71A 2WI3A 2F4VE 2JJCA 4DV3I 4FCRA 2YI5A 2YEDA 4DR3E 1MX0A 4YY3E 4B3SE 3R4MA 4BQGA 1KTVA 4GGLA 1BKNA 3R4NA 4U7OA 2A2DA 2IWXA 3B78A 2YEJA 4JI0E 4IZKA 5F3KA 2BTZA 2BU2A 2HHHI 4DV2E 4JI2E 2AKPA 2QF6A 1H7UA 4YKZA 1Y8NA 5IWAI 5CTYA 2UXCE 4X66I 3HYZA 2Z5BB 4Z7CA 2UUCI 3PYDA 3Q5LA 1I94E 2UUBE 3GIGA 4L93A 4P52A 1XMQE 2XX4A 5FNCA 4CE2A 2YKIA 2YI0A 4CWRA 2ZM6I 3K98A 1TC0A 4HZ0A 3U2KA 1YT1A 1B63A 3WU5A 3T0ZA 4DR4E 3H4LA 1IBKE 4JI8E 2HFUA 4DPTA 4KHPI 1HNWI 1THNA 4N3OA 3G7BA 3QT8A 4AQYI 3Q1QA 1I58A 4ASGA 4ED4A 2XHTA 4JYAE 4ASBA 5IN9A 2V34A 4EEHA 1UYFA 3A0ZA 2Q8HA 4DR5I 2ZBKB 2YEBA 3QDDA 3C0EA 4XITA 4NH9A 3P06A 1YESA 5M4NA 5LL6R 3J80Q 4NH7A 5D7CA 3VHCA 1S14A 4MP7A 2PNMA 2BYIA 3T1HI 1I5CA 2ZKJA 4JI3E 4JI4I 1MU5A 1N36I 2XDUA 2E1RA 2YEEA 4H85A 1N34I 4DV6I 1TC6A 1QY8A 5IDJA 4CWPA 3K1JA 1TH8A 2XHRA 4GKJI 3CGYA 1N32E 1VISA 4ASAA 4IZJA 2UUAI 1HNXI 3TZ0A 2YGAA 2YKEA 2WEPA 4CWFA 4LF7E 4DR1I 1IBLI 5J6AA 5BR8E 2E5LE 1US7A 4X62E 2Q2EB 1Z5AA 3PEHA 2GQ0A 3B8HA 2H55A 4LFBI 1AH8A 4JV5E 5CF0A 1S16A 1FI4A 4X65E 1PIEA 2C2AA 4HACA 2WI6A 1TILA 3JZ3A 3QTFA 1UEKA 2WI4A 1PKPA 2V2QA 1XNRI 1H73A 1B3QA 3B27A 1I5BA 3RLQA 1QZRA 1Y8PA 4FWGA 2R42A 4Z7YA 2CH4A 1ZM9A 2YE3A 3CRLA 4B3MI 1Z5BA 4WUCA 3PYGA 1YT0A 3OWDA 4JI6I 4KSGA 1A6FA 3B26A 3INXA 2YE9A 3V5RA 4GQTA 4K4OA 4P8OA 4CWTA 4CWNA 5D7RA 1Y4UA 2DEJA 2Z5EA 4B3RE 4MPEA 5CTWA 3DGEA 4DUYE 4DR7E 4DU8A 4DV4I 3G75A 1N33E 4LWEA 2Z5CB 3EKRA 3GONA 3EHHA 4DR2I 1USVA 4LF8E 5M4KA 1FWKA 1XNQE 3T1YE 3JAMC 4HYPA 1ZM3A 2ZITA 1I5DA 3D0BA 5A2QQ 2YEFA 1BXDA 1HR0I 1J5EE 2XDKA 2Q8GA 4DV7I 1OSFA 4NXMI 2XK2A 5LMNI 3R4PA 4BQJA 4LF5I 5CTXA 4YHHI 4LFAE 4K0KI 4E00A 4B7PA 2VF3A 3LPSA 4DV1E 1XMOI 3ZKBA 4DR6E 3RKZA 4YKRA 2UU9E 3HJCA 5GMDA 2WI5A 2O1WA 4EGIA 3J81Q 4CWOA 2YK9A 3B82A 4FPPA 2BREA 2DEIA 4FCPA 1NHIA 4E02A 2WERA 4XD8A 2GFDA 1HNZI 4R3MA 1NZ0A 3U2DA 4LFCE 2F4VI 3PRYA 2WI7A 4MBCA 2H8MA 4R1FA 4BXIA 4UTGA 4DR3I 2Z5BA 3A0TA 4YY3I 4B3SI 3T0HA 2GS8A 2VQFE 2E0AA 3FT5A 4L90A 5D6PA 2WI1A 3PYEA 4H7QA 4DUZE 1YETA 1U2RA 2WW4A 4O09A 4KQVA 1KZNA 4JI0I 2ZDYA 1ZM4A 2O1VA 4DPWA 4DV2I 4JI2I 4Q20A 1EI1A 4JAUA 4FWDA 5M4PA 2UXCI 4PRXA 4EMDA 4LF4E 1UYHA 4LPBA 2XX5A 3R92A 4HXZA 1I94I 2UUBI 4USMA 2BZ5A 3G7EA 3K17A 4JI5E 4W7TA 4E01A 1XMQI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X7I A;  4XKA A;  3J80 C;  1BYQ A;  4HY6 A;  2VWC A;  4AQY E;  4MOT A;  2EFG A;  4DV5 E;  1Z0C A;  1D6T A;  1YER A;  4O04 A;  4L91 A;  2BSM A;  3EKO A;  2IOP A;  4DR4 I;  3FT8 A;  3D2R A;  3WU4 A;  1IBK I;  3INW A;  4JI8 I;  3A0Y A;  3QT6 A;  3A0W A;  1IBM E;  2YEC A;  1AJ6 A;  2HG1 A;  1FKA E;  1EA6 A;  3T1K A;  3SL2 A;  2UXD E;  1AMW A;  4AWO A;  4LF9 E;  4NXN E;  5GME A;  2ESA A;  2CCT A;  4MB9 A;  3WU6 A;  1UYD A;  2YJX A;  4JYA I;  2UXB E;  3OTO E;  4BAE A;  2EXL A;  3T1H E;  4EMV A;  2QG2 A;  4HZ5 A;  5LMU E;  2YE8 A;  3RLP A;  2VQE E;  5D6Q A;  4XDM A;  4XTJ A;  2YE6 A;  2XJG A;  3HZ1 A;  4USK A;  4JI3 I;  2LJP A;  4DPU A;  3J7A M;  4YKQ A;  3ZZ0 A;  4U93 A;  1U0Z A;  4JI1 E;  4M1K A;  5M4M A;  4XIR A;  1N32 I;  1H7S A;  3KE6 A;  4HY1 A;  4DPX A;  4LF7 I;  4B3T E;  1YSZ A;  1JM6 A;  5BR8 I;  2E5L I;  4XE2 A;  1UY8 A;  4X62 I;  4MPN A;  1XNR E;  1UY7 A;  2R3V A;  1FJG E;  2YEI A;  4LP0 A;  4YKX A;  4JV5 I;  1N0U A;  4KFG A;  4R3A A;  4XIQ A;  4X65 I;  5FLX Q;  4DV0 E;  2VCJ A;  4GT8 A;  4MYT A;  2YKC A;  1XHK A;  5M4E A;  1Z0V A;  2V2Z A;  2BM1 A;  2FYP A;  2Q8F A;  4GKK E;  1ZXM A;  2O1U A;  3D36 A;  3C11 A;  1B62 A;  4LF6 E;  4DV4 E;  1I5A A;  2XJJ A;  4O0B A;  4XIP A;  1N0V C;  4O05 A;  4LWF A;  4P7A A;  1GKX A;  1ID0 A;  1GJV A;  1YT2 A;  3OPD A;  4NH8 A;  4YKU A;  1YC3 A;  4O07 A;  2IWS A;  4B3R I;  2HCH A;  3B25 A;  4OX9 E;  3J81 C;  2CCU A;  1WUU A;  1A4H A;  4RPF A;  4DUY I;  4EM7 A;  4DR7 I;  3HZ5 A;  1N33 I;  1YC4 A;  2OI2 A;  2XDL A;  4URM A;  2BRC A;  2XAB A;  3Q5K A;  2XX2 A;  1YSR A;  3O2F A;  1H74 A;  4X64 E;  4LF8 I;  1ZWH A;  4CWS A;  4WUD A;  1XNQ I;  4DPY A;  3T1Y I;  5IT9 Q;  4BIU A;  2HK3 A;  2CG9 A;  3ZXQ A;  4JI7 E;  4JG4 A;  2K5B A;  1J5E I;  4YKT A;  1YS3 A;  4KSH A;  4DV3 E;  4X9L A;  1AM1 A;  4LWG A;  3V2U C;  1AH6 A;  3O0I A;  2X36 A;  3K60 A;  3VAD A;  4MP2 A;  2BV3 A;  4HYM A;  4LFA I;  1UYC A;  2UWD A;  3QT7 A;  4WUB A;  2JKI A;  5BOD A;  4DV1 I;  4GEE A;  1ZM2 A;  4DR6 I;  4FCQ A;  2FXS A;  1NHH A;  1HNZ E;  2UU9 I;  3QT5 A;  4DU7 A;  2XHX A;  3TZ2 A;  4CWQ A;  4FWH A;  3A0R A;  2HHH E;  2FWY A;  2PNR A;  5IWA E;  4V25 A;  4X66 E;  3RLR A;  1DAR A;  4URO A;  2VW5 A;  4XKO A;  3TTZ A;  4KTN A;  3BMY A;  2BU7 A;  2UUC E;  5M4H A;  5C93 A;  1Z59 A;  3HHU A;  2BU5 A;  1I59 A;  4GFN A;  3PEJ A;  3EHJ A;  5FND A;  2YE7 A;  3VHD A;  4LFC I;  3U67 A;  4JQL A;  1Y8O A;  3B28 A;  4MYU A;  3J7A G;  2ZM6 E;  1KKH A;  3GIF A;  1KIJ A;  4ASF A;  4UT4 A;  3K97 A;  3WQ9 A;  4URL A;  2Q8I A;  2VQF I;  2HFS A;  4KHP E;  4FMT A;  2CZ9 A;  4DUZ I;  1Z5C A;  1HNW E;  3WU3 A;  3GIG B;  5CPH A;  5BOC A;  3T2S A;  3NMQ A;  1YC1 A;  2YKB A;  2YKJ A;  3BM9 A;  3K99 A;  3HEK A;  4V26 A;  3TZ5 A;  3ZXO A;  4GCZ A;  2BU6 A;  3ZZU A;  3B24 A;  4XKK A;  2YI7 A;  4U7N A;  2XD6 A;  2YE2 A;  2HK2 A;  4LF4 I;  3H80 A;  3WHA A;  4DR5 E;  1FNM A;  3TZ4 A;  2YEH A;  4ZKI A;  4AWQ A;  4PL9 A;  4DZY A;  4JI5 I;  2CCS A;  1TID A;  4FW9 A;  4L94 A;  4B6C A;  4DV5 I;  1UYK A;  2XDX A;  4MPC A;  4JI4 E;  2QG0 A;  4I3H A;  4QPJ A;  1N36 E;  5L3J A;  2YJW A;  1N34 E;  1Z0B A;  4EFT A;  4DV6 E;  4AWP A;  3OWB A;  2WEQ A;  4XC0 A;  1IBM I;  2J7K A;  2QFO A;  1Z0E A;  3A0X A;  4GKJ E;  1TBW A;  2UXD I;  2V2V A;  4NXN I;  1HNX E;  2UUA E;  4LF9 I;  4HXW A;  3HUL A;  3ZM7 A;  1Y4S A;  4EGK A;  2A2C A;  2HKE A;  4DR1 E;  1IBL E;  2BM0 A;  4I5S A;  2NPF A;  4URN A;  2UXB I;  3OTO I;  4ZVI A;  2IOQ A;  5CTU A;  2AJ4 A;  3OW6 A;  1UY6 A;  1BGQ A;  1U2O A;  4DUH A;  4PRV A;  3VHA A;  5LMU I;  4LFB E;  2XJX A;  2VQE I;  1ZXN A;  1H72 C;  4BIZ A;  5FLX C;  4DXL A;  1RRE A;  2XDS A;  2FWZ A;  1L0O A;  4H81 A;  1ELO A;  2CGF A;  3ZZT A;  2YEA A;  5FWK A;  3CWV A;  3PYF A;  3O6O A;  4XCL A;  4B3M E;  3M6A A;  4JI1 I;  4LWH A;  1KVK A;  1RR9 A;  2BU8 A;  2IOR A;  1QYE A;  4FN5 A;  2YI6 A;  4JAV A;  1UYL A;  4JI6 E;  2YGE A;  4JAS A;  4XCJ A;  3HYY A;  3CRK A;  3R91 A;  3D4J A;  3T10 A;  1ZW9 A;  3EHG A;  5A2Q C;  4HAC B;  2YE5 A;  5IDM A;  4B3T I;  3ZKD A;  4L8Z A;  1GKZ A;  3F0N A;  5D7D A;  2XEX A;  2YEG A;  3OMU A;  1FJG I;  3EHF A;  4CE3 A;  1S4E A;  2WI2 A;  2BT0 A;  4DR2 E;  1UYE A;  2XCM A;  4YKW A;  4DV0 I;  3R4O A;  3GIE A;  2IWU A;  2HKJ A;  5IT9 C;  1HR0 E;  1NHJ A;  5F5R A;  4DV7 E;  3FV5 A;  5GGZ A;  1UYM A;  4NXM E;  1K47 A;  1MG7 A;  5LMN E;  4CE1 A;  4GKK I;  4LF5 E;  2YK2 A;  1Z0W A;  4YHH E;  1Z0G A;  4K0K E;  4LF6 I;  2V8P A;  2YE4 A;  1XMO E;  2BYH A;  3TUH A;  1PVG A;  4AS9 A;  3MNR P;  1R62 A;  4KP4 A;  1Z0T A;  1UYI A;  2GQP A;  4EGH A;  1UY9 A;  5FNF A;  4YKY A;  4OX9 I;  1OJ4 A;  3LTO A;  3LNU A;  2YGF A;  3IED A;  1FWL A;  4PU9 A;  4LWI A;  1UYG A;  4EFU A;  4QPK A;  3JAM Q;  4X64 I;  3Q5J A;  3CGZ A;  2ZDX A;  2VCI A;  4JI7 I;  5J71 A;  2WI3 A;  2F4V E;  2JJC A;  4DV3 I;  4FCR A;  2YI5 A;  2YED A;  4DR3 E;  1MX0 A;  4YY3 E;  4B3S E;  3R4M A;  4BQG A;  1KTV A;  4GGL A;  1BKN A;  3R4N A;  4U7O A;  2A2D A;  2IWX A;  3B78 A;  2YEJ A;  4JI0 E;  5F3K A;  2BTZ A;  2BU2 A;  2HHH I;  4DV2 E;  4JI2 E;  2AKP A;  2QF6 A;  1H7U A;  4YKZ A;  1Y8N A;  5IWA I;  5CTY A;  2UXC E;  4X66 I;  3HYZ A;  4Z7C A;  2UUC I;  3PYD A;  3Q5L A;  1I94 E;  2UUB E;  3GIG A;  4L93 A;  4P52 A;  1XMQ E;  2XX4 A;  5FNC A;  4CE2 A;  2YKI A;  2YI0 A;  4CWR A;  2ZM6 I;  3K98 A;  1TC0 A;  4HZ0 A;  3U2K A;  1YT1 A;  1B63 A;  3WU5 A;  3T0Z A;  4DR4 E;  3H4L A;  1IBK E;  4JI8 E;  2HFU A;  4DPT A;  4KHP I;  1HNW I;  1THN A;  3G7B A;  3QT8 A;  4AQY I;  3Q1Q A;  1I58 A;  4ASG A;  4ED4 A;  2XHT A;  4JYA E;  4ASB A;  5IN9 A;  2V34 A;  4EEH A;  1UYF A;  3A0Z A;  2Q8H A;  4DR5 I;  2ZBK B;  2YEB A;  3QDD A;  3C0E A;  4XIT A;  4NH9 A;  5M4N A;  1YES A;  5LL6 R;  3J80 Q;  4NH7 A;  5D7C A;  3VHC A;  1S14 A;  4MP7 A;  2BYI A;  3T1H I;  1I5C A;  2ZKJ A;  4JI3 E;  4JI4 I;  1MU5 A;  1N36 I;  2XDU A;  2E1R A;  2YEE A;  4H85 A;  1N34 I;  4DV6 I;  1TC6 A;  1QY8 A;  5IDJ A;  4CWP A;  3K1J A;  1TH8 A;  2XHR A;  4GKJ I;  3CGY A;  1N32 E;  1VIS A;  4ASA A;  3TZ0 A;  2UUA I;  1HNX I;  2YGA A;  2YKE A;  2WEP A;  4CWF A;  4LF7 E;  4DR1 I;  1IBL I;  5J6A A;  5BR8 E;  2E5L E;  1US7 A;  4X62 E;  2Q2E B;  1Z5A A;  3PEH A;  3B8H A;  2H55 A;  4LFB I;  1AH8 A;  4JV5 E;  5CF0 A;  1S16 A;  1FI4 A;  4X65 E;  1PIE A;  2C2A A;  4HAC A;  2WI6 A;  1TIL A;  3JZ3 A;  3QTF A;  1UEK A;  2WI4 A;  1PKP A;  2V2Q A;  1XNR I;  1H73 A;  1B3Q A;  3B27 A;  1I5B A;  3RLQ A;  1QZR A;  1Y8P A;  4FWG A;  2R42 A;  4Z7Y A;  2CH4 A;  1ZM9 A;  2YE3 A;  3CRL A;  4B3M I;  1Z5B A;  4WUC A;  3PYG A;  1YT0 A;  3OWD A;  4JI6 I;  4KSG A;  1A6F A;  3B26 A;  3INX A;  2YE9 A;  3V5R A;  4GQT A;  4K4O A;  4P8O A;  4CWT A;  4CWN A;  5D7R A;  1Y4U A;  2DEJ A;  4B3R E;  4MPE A;  5CTW A;  3DGE A;  4DUY E;  4DR7 E;  4DU8 A;  4DV4 I;  3G75 A;  1N33 E;  4LWE A;  3EKR A;  3GON A;  3EHH A;  4DR2 I;  4LF8 E;  5M4K A;  1FWK A;  1XNQ E;  3T1Y E;  3JAM C;  4HYP A;  1ZM3 A;  2ZIT A;  1I5D A;  3D0B A;  5A2Q Q;  2YEF A;  1BXD A;  1HR0 I;  1J5E E;  2XDK A;  2Q8G A;  4DV7 I;  1OSF A;  4NXM I;  2XK2 A;  5LMN I;  3R4P A;  4BQJ A;  4LF5 I;  5CTX A;  4YHH I;  4LFA E;  4K0K I;  4E00 A;  4B7P A;  2VF3 A;  3LPS A;  4DV1 E;  1XMO I;  3ZKB A;  4DR6 E;  3RKZ A;  4YKR A;  2UU9 E;  5GMD A;  2WI5 A;  2O1W A;  4EGI A;  3J81 Q;  4CWO A;  2YK9 A;  3B82 A;  4FPP A;  2BRE A;  2DEI A;  4FCP A;  1NHI A;  4E02 A;  2WER A;  4XD8 A;  2GFD A;  1HNZ I;  4R3M A;  1NZ0 A;  3U2D A;  4LFC E;  2F4V I;  2WI7 A;  4MBC A;  2H8M A;  4R1F A;  4BXI A;  4UTG A;  4DR3 I;  3A0T A;  4YY3 I;  4B3S I;  3T0H A;  2GS8 A;  2VQF E;  2E0A A;  3FT5 A;  4L90 A;  5D6P A;  2WI1 A;  3PYE A;  4H7Q A;  4DUZ E;  1YET A;  1U2R A;  2WW4 A;  4O09 A;  4KQV A;  1KZN A;  4JI0 I;  2ZDY A;  1ZM4 A;  2O1V A;  4DPW A;  4DV2 I;  4JI2 I;  4Q20 A;  1EI1 A;  4JAU A;  4FWD A;  5M4P A;  2UXC I;  4PRX A;  4EMD A;  4LF4 E;  1UYH A;  4LPB A;  2XX5 A;  3R92 A;  4HXZ A;  1I94 I;  2UUB I;  4USM A;  2BZ5 A;  3G7E A;  3K17 A;  4JI5 E;  4W7T A;  4E01 A;  1XMQ I; 
#chains in the Genus database with same CATH topology
 2X7I A;  4XKA A;  3J80 C;  1BYQ A;  4HY6 A;  2VWC A;  4AQY E;  4MOT A;  2EFG A;  4DV5 E;  1Z0C A;  1D6T A;  1YER A;  4O04 A;  4L91 A;  2BSM A;  4IFD F;  2IOP A;  4DR4 I;  3EKO A;  3FT8 A;  3D2R A;  3WU4 A;  1IBK I;  3INW A;  4JI8 I;  3A0Y A;  3QT6 A;  3A0W A;  1IBM E;  2BA1 G;  5JEA F;  2YEC A;  5JEA A;  5EKW A;  1AJ6 A;  2HG1 A;  4LOM A;  1FKA E;  1EA6 A;  2C1I A;  3SL2 A;  2UXD E;  1AMW A;  3T1K A;  4AWO A;  4LF9 E;  4NXN E;  3CYG A;  2VES A;  5GME A;  2ESA A;  2CCT A;  4MB9 A;  3WU6 A;  1UYD A;  1IXM A;  2YJX A;  4JYA I;  5DNX A;  2JEB B;  3OTO E;  2UXB E;  4BAE A;  3CDJ A;  2EXL A;  3T1H E;  4EMV A;  2QG2 A;  4HZ5 A;  4MU3 A;  5LMU E;  2YE8 A;  2CVE A;  2NN6 C;  3RLP A;  2VQE E;  5D6Q A;  2PO2 B;  4XDM A;  4XTJ A;  2YE6 A;  2C37 A;  4AIM A;  3Q6M A;  4USK A;  2XJG A;  3HZ1 A;  4JI3 I;  4U3D A;  2LJP A;  4DPU A;  3J7A M;  4YKQ A;  3ZZ0 A;  4U93 A;  1U0Z A;  5C0X F;  5C0X A;  4JI1 E;  2JEA B;  4M1K A;  5M4M A;  2BA1 D;  4XIR A;  1N32 I;  3PS3 A;  5K36 D;  1H7S A;  3KE6 A;  4HY1 A;  2O1T A;  4LCF A;  4DPX A;  4LF7 I;  2J65 A;  4B3T E;  4MU1 A;  1YSZ A;  1F51 A;  2C39 A;  1JM6 A;  5BR8 I;  2E5L I;  4XE2 A;  1UY8 A;  4FW6 A;  4X62 I;  4MPN A;  1XNR E;  1UY7 A;  2R3V A;  1FJG E;  2YEI A;  4LP0 A;  4YKX A;  3P3C A;  4JV5 I;  1N0U A;  4KFG A;  4R3A A;  4XIQ A;  4X65 I;  5FLX Q;  4DV0 E;  2VCJ A;  4GT8 A;  4MYT A;  2YKC A;  1XHK A;  5M4E A;  1Z0V A;  2V2Z A;  4OO1 A;  2BM1 A;  2FYP A;  2Q8F A;  1YH8 A;  4GKK E;  1ZXM A;  2O1U A;  3GME A;  3D36 A;  2Z5C A;  4MQY A;  1B62 A;  4LF6 E;  4DV4 E;  1I5A A;  4LCG A;  2XJJ A;  3C11 A;  1N0V C;  2WP8 B;  4O0B A;  4O05 A;  4LWF A;  4P7A A;  1GKX A;  1ID0 A;  1GJV A;  1YT2 A;  3OPD A;  4NH8 A;  4YKU A;  1YC3 A;  4O07 A;  2IWS A;  5JEA C;  4B3R I;  2HCH A;  3B25 A;  4OX9 E;  3J81 C;  2PO1 A;  2CCU A;  1WUU A;  1Y60 A;  1A4H A;  4RPF A;  4DUY I;  2PNZ A;  4EM7 A;  4DR7 I;  4QNJ A;  3HZ5 A;  1N33 I;  4BA2 B;  2OI2 A;  1YC4 A;  2XDL A;  4URM A;  2BRC A;  2XAB A;  3Q5K A;  2XX2 A;  1YSR A;  2CGE A;  3O2F A;  1H74 A;  4X64 E;  4LF8 I;  1ZWH A;  4CWS A;  4WUD A;  1XNQ I;  4DPY A;  3T1Y I;  5IT9 Q;  4BIU A;  2CG9 A;  2HK3 A;  3ZXQ A;  4JI7 E;  4JG4 A;  2K5B A;  1J5E I;  4YKT A;  2C38 A;  1YS3 A;  4KSH A;  4DV3 E;  4X9L A;  1AM1 A;  4LWG A;  3V2U C;  1AH6 A;  3O0I A;  2X36 A;  2WNR A;  1E3H A;  3K60 A;  3VAD A;  4MP2 A;  2BV3 A;  2NN6 D;  4HYM A;  4LFA I;  1UYC A;  3QT7 A;  4WUB A;  2JKI A;  5DRP A;  2UWD A;  5K36 E;  1HK7 A;  5BOD A;  4DV1 I;  4AM3 A;  4GEE A;  1ZM2 A;  4DR6 I;  4FCQ A;  2FXS A;  1NHH A;  5C0X C;  1HNZ E;  3QT5 A;  4DU7 A;  2UU9 I;  2XHX A;  3TZ2 A;  1UDN A;  2JE6 B;  4FWH A;  3A0R A;  2HHH E;  4CWQ A;  2FWY A;  2PNR A;  5IWA E;  4V25 A;  4X66 E;  3RLR A;  4U3B A;  1DAR A;  4URO A;  2VW5 A;  4XKO A;  3TTZ A;  4KTN A;  3BMY A;  2BU7 A;  2IES A;  1BXD A;  2UUC E;  5M4H A;  5C93 A;  1Z59 A;  3M7N G;  2BU5 A;  2PO0 A;  1I59 A;  3HHU A;  4GFN A;  3PEJ A;  3EHJ A;  5FND A;  2YE7 A;  3VHD A;  4LFC I;  4IZK B;  4JQL A;  1Y8O A;  3U67 A;  2C1G A;  3B28 A;  4MYU A;  3J7A G;  2ZM6 E;  1KKH A;  3GIF A;  1KIJ A;  4ASF A;  4UT4 A;  3K97 A;  3WQ9 A;  2BR2 B;  1E3P A;  4URL A;  2Q8I A;  2VQF I;  1XXE A;  2HFS A;  4OO1 C;  4KHP E;  4FMT A;  1UDS A;  2CZ9 A;  4DUZ I;  1Z5C A;  1HNW E;  3WU3 A;  3GIG B;  5CPH A;  5BOC A;  3T2S A;  4AID A;  3NMQ A;  1YC1 A;  2YKB A;  2YKJ A;  3BM9 A;  3K99 A;  3HEK A;  4V26 A;  3TZ5 A;  3ZXO A;  4GCZ A;  2BU6 A;  3ZZU A;  3B24 A;  4XKK A;  2YI7 A;  4U7N A;  2XD6 A;  2YE2 A;  2HK2 A;  4LF4 I;  3H80 A;  3WHA A;  4DR5 E;  1FNM A;  3P3E A;  2YEH A;  3TZ4 A;  3K85 A;  4ZKI A;  4IFD D;  4AWQ A;  4PL9 A;  3M7N D;  4DZY A;  4JI5 I;  2CCS A;  1TID A;  4FW9 A;  5JEA D;  4L94 A;  4B6C A;  3P3G A;  1OYS A;  2JEB A;  4DV5 I;  1UYK A;  2XDX A;  4MPC A;  4JI4 E;  2QG0 A;  4I3H A;  2NN6 E;  1N36 E;  4QPJ A;  5L3J A;  2YJW A;  1N34 E;  1Z0B A;  4EFT A;  4DV6 E;  4AWP A;  3OWB A;  2WEQ A;  4XC0 A;  4IFD B;  1IBM I;  2J7K A;  2QFO A;  1Z0E A;  3A0X A;  4GKJ E;  2PO2 A;  1TBW A;  2UXD I;  2V2V A;  4NXN I;  1HNX E;  4FW7 A;  2UUA E;  4LF9 I;  3HUL A;  4IZJ D;  4HXW A;  1Y4S A;  3ZM7 A;  4EGK A;  2A2C A;  2HKE A;  4DR1 E;  1IBL E;  2BM0 A;  4I5S A;  2NPF A;  4URN A;  2UXB I;  3OTO I;  2IOQ A;  4ZVI A;  5CTU A;  2AJ4 A;  3OW6 A;  1UY6 A;  1BGQ A;  1U2O A;  4DUH A;  4PRV A;  3VHA A;  5LMU I;  4LFB E;  2XJX A;  2VQE I;  1Y6Z A;  1H72 C;  1ZXN A;  5DRO A;  5C0X D;  4BIZ A;  5JEN A;  5FLX C;  4IZJ B;  4DXL A;  1RRE A;  2XDS A;  2FWZ A;  1L0O A;  4H81 A;  1ELO A;  4LCH A;  2CGF A;  2GO4 A;  3ZZT A;  2YEA A;  5FWK A;  3KRN A;  3CWV A;  3PYF A;  3O6O A;  4XCL A;  4B3M E;  3M6A A;  4JI1 I;  4LWH A;  1KVK A;  1RR9 A;  2BU8 A;  5K36 B;  1QYE A;  4FN5 A;  2IOR A;  2YI6 A;  1UYL A;  4JI6 E;  2YGE A;  4JAV A;  4JAS A;  3HYY A;  3CRK A;  2HHI A;  4XCJ A;  3D4J A;  3R91 A;  3T10 A;  1ZW9 A;  3EHG A;  3Q6N A;  5A2Q C;  4HAC B;  4OO1 F;  2GO3 A;  3S5T A;  2YE5 A;  5IDM A;  4B3T I;  3ZKD A;  4L8Z A;  1GKZ A;  3F0N A;  5D7D A;  2XEX A;  2YEG A;  4IFD E;  1FJG I;  1YHC A;  3OMU A;  3EHF A;  4CE3 A;  1S4E A;  2WI2 A;  2WP8 A;  2BT0 A;  5JEA E;  4DR2 E;  1UYE A;  2XCM A;  4YKW A;  4DV0 I;  3R4O A;  3GIE A;  2IWU A;  5EL9 A;  2HKJ A;  4J3D A;  5IT9 C;  1HR0 E;  2AE8 A;  1NHJ A;  5F5R A;  1R6L A;  4DV7 E;  3FV5 A;  5GGZ A;  1UYM A;  4NXM E;  1K47 A;  1MG7 A;  5LMN E;  4CE1 A;  4GKK I;  4LF5 E;  4BA2 A;  1Z0W A;  2YK2 A;  4YHH E;  1Z0G A;  4K0K E;  4LF6 I;  2V8P A;  2YE4 A;  1XMO E;  5DNL A;  2BYH A;  1PVG A;  4AS9 A;  3TUH A;  3MNR P;  4BA1 B;  1R62 A;  4KP4 A;  1Z0T A;  1UYI A;  1USU A;  2GQP A;  4EGH A;  1UY9 A;  5FNF A;  4YKY A;  4OX9 I;  1OJ4 A;  3LTO A;  3LNU A;  2YGF A;  3IED A;  3PS1 A;  4OKG A;  1UDQ A;  1FWL A;  4PU9 A;  4LWI A;  5C0X E;  1UYG A;  2PNL A;  4EFU A;  4QPK A;  3JAM Q;  4X64 I;  2IER A;  3Q5J A;  3CGZ A;  4NBQ A;  2ZDX A;  2VCI A;  4JI7 I;  5J71 A;  2WI3 A;  2JE6 A;  2F4V E;  2JJC A;  4DV3 I;  3CDI A;  4FCR A;  2YI5 A;  2YED A;  2NN6 B;  4DR3 E;  1MX0 A;  4YY3 E;  4B3S E;  3R4M A;  4BQG A;  1KTV A;  4GGL A;  1BKN A;  3R4N A;  4U7O A;  2A2D A;  1P42 A;  2IWX A;  3B78 A;  2YEJ A;  3PS2 A;  5DRQ A;  4JI0 E;  4IZK A;  5F3K A;  2BTZ A;  2BU2 A;  4GQU A;  2HHH I;  4DV2 E;  4JI2 E;  2AKP A;  2QF6 A;  1H7U A;  4YKZ A;  1Y8N A;  5IWA I;  5CTY A;  2UXC E;  4X66 I;  3HYZ A;  2Z5B B;  4Z7C A;  2UUC I;  3PYD A;  3Q5L A;  1I94 E;  2UUB E;  3GIG A;  2BA0 G;  4FW3 A;  4L93 A;  4P52 A;  1XMQ E;  2XX4 A;  3L7Z B;  5FNC A;  4CE2 A;  2YKI A;  2YI0 A;  4CWR A;  3U1Y A;  2ZM6 I;  4XIP A;  3K98 A;  1TC0 A;  4HZ0 A;  3U2K A;  1YT1 A;  1B63 A;  3WU5 A;  3T0Z A;  4DR4 E;  3H4L A;  4QNK A;  1IBK E;  4JI8 E;  2HFU A;  4DPT A;  4KHP I;  1HNW I;  3H1C A;  1THN A;  4N3O A;  3G7B A;  3QT8 A;  4AQY I;  3Q1Q A;  1I58 A;  4FW5 A;  1UDO A;  2FTK A;  4ASG A;  4ED4 A;  2XHT A;  4JYA E;  4ASB A;  5IN9 A;  2V34 A;  4EEH A;  1UYF A;  3A0Z A;  2Q8H A;  4DR5 I;  4IFD A;  2ZBK B;  2YEB A;  3QDD A;  3M85 G;  3C0E A;  5JEA B;  4NH9 A;  4IS9 A;  2BA0 D;  3P06 A;  1YES A;  4XIT A;  5M4N A;  5LL6 R;  3J80 Q;  4NH7 A;  5D7C A;  3VHC A;  1S14 A;  4MP7 A;  2PNM A;  2BYI A;  3T1H I;  1I5C A;  3HKM A;  2ZKJ A;  4JI3 E;  4JI4 I;  1MU5 A;  1N36 I;  2JEA A;  2E1R A;  2XDU A;  2YEE A;  4H85 A;  1N34 I;  4DV6 I;  1TC6 A;  1QY8 A;  5IDJ A;  4CWP A;  3K1J A;  1TH8 A;  2XHR A;  4GKJ I;  3CGY A;  1N32 E;  1VIS A;  4ASA A;  4IZJ A;  2UUA I;  1HNX I;  3TZ0 A;  2YGA A;  2YKE A;  2WEP A;  4CWF A;  4LF7 E;  4DR1 I;  2C37 B;  1IBL I;  5J6A A;  5BR8 E;  3GLL A;  2E5L E;  1US7 A;  4X62 E;  2Q2E B;  1Z5A A;  3PEH A;  2GQ0 A;  3B8H A;  5K36 F;  4LFB I;  5K36 A;  5C0X B;  5ELW A;  1AH8 A;  4MDT A;  2H55 A;  4JV5 E;  3M85 D;  1S16 A;  3B4T A;  1FI4 A;  4X65 E;  5CF0 A;  1PIE A;  2C2A A;  4HAC A;  2WI6 A;  3U1K A;  3DD6 A;  1TIL A;  3JZ3 A;  3QTF A;  1UEK A;  2WI4 A;  1PKP A;  2C39 B;  2V2Q A;  1H73 A;  1XNR I;  4OO1 D;  1B3Q A;  1I5B A;  3B27 A;  1QZR A;  3RLQ A;  1Y8P A;  4FWG A;  2R42 A;  4Z7Y A;  2CH4 A;  1ZM9 A;  2YE3 A;  1OYR A;  4B3M I;  1Z5B A;  3CRL A;  4WUC A;  3PYG A;  4MU0 A;  1YT0 A;  3OWD A;  4JI6 I;  4KSG A;  1A6F A;  3B26 A;  3INX A;  2YE9 A;  4MU4 A;  3V5R A;  4GQT A;  4K4O A;  4P8O A;  4CWT A;  4CWN A;  5D7R A;  1Y4U A;  2DEJ A;  2Z5E A;  4B3R E;  4MPE A;  5CTW A;  3DGE A;  4OO1 B;  1RHY A;  4DUY E;  4DR7 E;  4DU8 A;  4DV4 I;  3G75 A;  1N33 E;  4LWE A;  1OYP A;  2Z5C B;  3EKR A;  3GON A;  3EHH A;  4DR2 I;  1USV A;  2O3Z A;  4LF8 E;  5M4K A;  1FWK A;  4BA1 A;  1XNQ E;  3T1Y E;  3JAM C;  4HYP A;  1ZM3 A;  2ZIT A;  5DRR A;  4IFD C;  5A2Q Q;  1I5D A;  2YEF A;  3D0B A;  1HR0 I;  1J5E E;  2XDK A;  2Q8G A;  4DV7 I;  1OSF A;  2PO1 B;  4NXM I;  2XK2 A;  5LMN I;  3R4P A;  2PNZ B;  4LF5 I;  5CTX A;  4BQJ A;  4YHH I;  4LFA E;  4K0K I;  4E00 A;  4B7P A;  2VF3 A;  3P76 A;  3LPS A;  4DV1 E;  1XMO I;  3ZKB A;  4DR6 E;  2JT2 A;  3RKZ A;  4YKR A;  2UU9 E;  3HJC A;  5GMD A;  2WI5 A;  4E72 A;  2O1W A;  4EGI A;  3J81 Q;  2C38 B;  4LPF A;  4CWO A;  2NN6 F;  2NN6 A;  2YK9 A;  3B82 A;  4FPP A;  2WNR B;  2BRE A;  2DEI A;  4FCP A;  1NHI A;  4ISA A;  3NZK A;  4E02 A;  2WER A;  4XD8 A;  2GFD A;  1HNZ I;  4R3M A;  1NZ0 A;  3U2D A;  4LFC E;  5K36 C;  1VI7 A;  2F4V I;  3PRY A;  2WI7 A;  4OO1 E;  4OZE A;  4MBC A;  2H8M A;  4R1F A;  3LMM A;  4BXI A;  2BR2 A;  4UTG A;  4DR3 I;  2Z5B A;  3A0T A;  4YY3 I;  4B3S I;  3UHM A;  3T0H A;  2GS8 A;  2VQF E;  2E0A A;  3FT5 A;  4L90 A;  5D6P A;  2WI1 A;  3PYE A;  4H7Q A;  4DUZ E;  1YET A;  2PO0 B;  1U2R A;  2WW4 A;  4O09 A;  4KQV A;  1Y5Y A;  3GCM A;  4JI0 I;  3L7Z A;  1KZN A;  2ZDY A;  1ZM4 A;  2O1V A;  4FW4 A;  4DPW A;  4DV2 I;  4JI2 I;  4Q20 A;  1EI1 A;  4JAU A;  4FWD A;  5M4P A;  2UXC I;  4PRX A;  4EMD A;  4LF4 E;  1UYH A;  4LPB A;  2XX5 A;  1R6M A;  2F1D A;  3R92 A;  4HXZ A;  1I94 I;  2UUB I;  4USM A;  2BZ5 A;  3G7E A;  3K17 A;  4JI5 E;  4W7T A;  4E01 A;  1XMQ I; 
#chains in the Genus database with same CATH homology
 2X7I A;  4XKA A;  3J80 C;  1BYQ A;  4HY6 A;  2VWC A;  4AQY E;  4MOT A;  2EFG A;  4DV5 E;  1Z0C A;  1D6T A;  1YER A;  4O04 A;  4L91 A;  2BSM A;  3EKO A;  2IOP A;  4DR4 I;  3FT8 A;  3D2R A;  3WU4 A;  1IBK I;  3INW A;  4JI8 I;  3A0Y A;  3QT6 A;  3A0W A;  1IBM E;  2YEC A;  1AJ6 A;  2HG1 A;  1FKA E;  1EA6 A;  3T1K A;  3SL2 A;  2UXD E;  1AMW A;  4AWO A;  4LF9 E;  4NXN E;  5GME A;  2ESA A;  2CCT A;  4MB9 A;  3WU6 A;  1UYD A;  2YJX A;  4JYA I;  2UXB E;  3OTO E;  4BAE A;  2EXL A;  3T1H E;  4EMV A;  2QG2 A;  4HZ5 A;  5LMU E;  2YE8 A;  3RLP A;  2VQE E;  5D6Q A;  4XDM A;  4XTJ A;  2YE6 A;  2XJG A;  3HZ1 A;  3Q6M A;  4USK A;  4JI3 I;  2LJP A;  4DPU A;  3J7A M;  4YKQ A;  3ZZ0 A;  4U93 A;  1U0Z A;  4JI1 E;  4M1K A;  5M4M A;  4XIR A;  1N32 I;  1H7S A;  3KE6 A;  4HY1 A;  2O1T A;  4DPX A;  4LF7 I;  4B3T E;  1YSZ A;  1JM6 A;  5BR8 I;  2E5L I;  4XE2 A;  1UY8 A;  4X62 I;  4MPN A;  1XNR E;  1UY7 A;  2R3V A;  1FJG E;  2YEI A;  4LP0 A;  4YKX A;  4JV5 I;  1N0U A;  4KFG A;  4R3A A;  4XIQ A;  4X65 I;  5FLX Q;  4DV0 E;  2VCJ A;  4GT8 A;  4MYT A;  2YKC A;  1XHK A;  5M4E A;  1Z0V A;  2V2Z A;  2BM1 A;  2FYP A;  2Q8F A;  4GKK E;  1ZXM A;  2O1U A;  3D36 A;  2Z5C A;  3C11 A;  1B62 A;  4LF6 E;  4DV4 E;  1I5A A;  2XJJ A;  4O0B A;  4XIP A;  1N0V C;  4O05 A;  4LWF A;  4P7A A;  1GKX A;  1ID0 A;  1GJV A;  1YT2 A;  3OPD A;  4NH8 A;  4YKU A;  1YC3 A;  4O07 A;  2IWS A;  4B3R I;  2HCH A;  3B25 A;  4OX9 E;  3J81 C;  2CCU A;  1WUU A;  1A4H A;  4RPF A;  4DUY I;  4EM7 A;  4DR7 I;  3HZ5 A;  1N33 I;  1YC4 A;  2OI2 A;  2XDL A;  4URM A;  2BRC A;  2XAB A;  3Q5K A;  2XX2 A;  1YSR A;  2CGE A;  3O2F A;  1H74 A;  4X64 E;  4LF8 I;  1ZWH A;  4CWS A;  4WUD A;  1XNQ I;  3T1Y I;  4DPY A;  5IT9 Q;  4BIU A;  2CG9 A;  2HK3 A;  3ZXQ A;  4JI7 E;  4JG4 A;  2K5B A;  1J5E I;  4YKT A;  1YS3 A;  4KSH A;  4DV3 E;  4X9L A;  1AM1 A;  4LWG A;  3V2U C;  1AH6 A;  3O0I A;  2X36 A;  3K60 A;  3VAD A;  4MP2 A;  2BV3 A;  4HYM A;  4LFA I;  1UYC A;  2UWD A;  3QT7 A;  4WUB A;  2JKI A;  5BOD A;  1HK7 A;  4DV1 I;  4GEE A;  1ZM2 A;  4DR6 I;  4FCQ A;  2FXS A;  1NHH A;  1HNZ E;  2UU9 I;  3QT5 A;  4DU7 A;  2XHX A;  3TZ2 A;  4CWQ A;  4FWH A;  3A0R A;  2HHH E;  2FWY A;  2PNR A;  5IWA E;  4V25 A;  4X66 E;  3RLR A;  1DAR A;  4URO A;  2VW5 A;  4XKO A;  3TTZ A;  4KTN A;  3BMY A;  2BU7 A;  2UUC E;  5M4H A;  5C93 A;  1Z59 A;  3HHU A;  2BU5 A;  1I59 A;  4GFN A;  3PEJ A;  3EHJ A;  5FND A;  2YE7 A;  3VHD A;  4LFC I;  4IZK B;  4JQL A;  1Y8O A;  3U67 A;  3B28 A;  4MYU A;  3J7A G;  2ZM6 E;  1KKH A;  3GIF A;  1KIJ A;  4ASF A;  4UT4 A;  3K97 A;  3WQ9 A;  4URL A;  2Q8I A;  2VQF I;  2HFS A;  4KHP E;  4FMT A;  2CZ9 A;  4DUZ I;  1Z5C A;  1HNW E;  3WU3 A;  3GIG B;  5CPH A;  5BOC A;  3T2S A;  3NMQ A;  1YC1 A;  2YKB A;  2YKJ A;  3BM9 A;  3K99 A;  3HEK A;  4V26 A;  3TZ5 A;  3ZXO A;  4GCZ A;  2BU6 A;  3ZZU A;  3B24 A;  4XKK A;  2YI7 A;  4U7N A;  2XD6 A;  2YE2 A;  2HK2 A;  4LF4 I;  3H80 A;  3WHA A;  4DR5 E;  1FNM A;  3TZ4 A;  2YEH A;  4ZKI A;  3K85 A;  4AWQ A;  4PL9 A;  4DZY A;  4JI5 I;  2CCS A;  1TID A;  4FW9 A;  4L94 A;  4B6C A;  4DV5 I;  1UYK A;  2XDX A;  4MPC A;  4JI4 E;  2QG0 A;  4I3H A;  4QPJ A;  1N36 E;  5L3J A;  2YJW A;  1N34 E;  1Z0B A;  4EFT A;  4DV6 E;  4AWP A;  3OWB A;  2WEQ A;  4XC0 A;  1IBM I;  2J7K A;  2QFO A;  1Z0E A;  3A0X A;  4GKJ E;  1TBW A;  2UXD I;  2V2V A;  4NXN I;  1HNX E;  2UUA E;  4LF9 I;  4HXW A;  3HUL A;  4IZJ D;  1Y4S A;  3ZM7 A;  4EGK A;  2A2C A;  2HKE A;  4DR1 E;  1IBL E;  2BM0 A;  4I5S A;  2NPF A;  4URN A;  2UXB I;  3OTO I;  2IOQ A;  4ZVI A;  5CTU A;  2AJ4 A;  3OW6 A;  1UY6 A;  1BGQ A;  1U2O A;  4DUH A;  4PRV A;  3VHA A;  5LMU I;  4LFB E;  2XJX A;  2VQE I;  1Y6Z A;  1H72 C;  1ZXN A;  4BIZ A;  5FLX C;  4IZJ B;  4DXL A;  1RRE A;  2XDS A;  2FWZ A;  1L0O A;  4H81 A;  1ELO A;  2CGF A;  3ZZT A;  2YEA A;  5FWK A;  3CWV A;  3PYF A;  3O6O A;  4XCL A;  4B3M E;  3M6A A;  4JI1 I;  4LWH A;  1KVK A;  1RR9 A;  2BU8 A;  2IOR A;  1QYE A;  4FN5 A;  2YI6 A;  4JAV A;  1UYL A;  4JI6 E;  2YGE A;  4JAS A;  4XCJ A;  3HYY A;  3CRK A;  3R91 A;  3D4J A;  3T10 A;  1ZW9 A;  3EHG A;  3Q6N A;  5A2Q C;  4HAC B;  2YE5 A;  5IDM A;  4B3T I;  3ZKD A;  4L8Z A;  1GKZ A;  3F0N A;  5D7D A;  2XEX A;  2YEG A;  3OMU A;  1FJG I;  3EHF A;  4CE3 A;  1S4E A;  2WI2 A;  2BT0 A;  4DR2 E;  1UYE A;  2XCM A;  4YKW A;  4DV0 I;  3R4O A;  3GIE A;  2IWU A;  2HKJ A;  5IT9 C;  1HR0 E;  1NHJ A;  5F5R A;  4DV7 E;  3FV5 A;  5GGZ A;  1UYM A;  4NXM E;  1K47 A;  1MG7 A;  5LMN E;  4CE1 A;  4GKK I;  4LF5 E;  2YK2 A;  1Z0W A;  4YHH E;  1Z0G A;  4K0K E;  4LF6 I;  2V8P A;  2YE4 A;  1XMO E;  2BYH A;  3TUH A;  1PVG A;  4AS9 A;  3MNR P;  1R62 A;  4KP4 A;  1Z0T A;  1UYI A;  1USU A;  2GQP A;  4EGH A;  1UY9 A;  5FNF A;  4YKY A;  4OX9 I;  1OJ4 A;  3LTO A;  3LNU A;  2YGF A;  3IED A;  1FWL A;  4PU9 A;  4LWI A;  1UYG A;  2PNL A;  4EFU A;  4QPK A;  3JAM Q;  4X64 I;  3Q5J A;  3CGZ A;  2ZDX A;  2VCI A;  4JI7 I;  5J71 A;  2WI3 A;  2F4V E;  2JJC A;  4DV3 I;  4FCR A;  2YI5 A;  2YED A;  4DR3 E;  1MX0 A;  4YY3 E;  4B3S E;  3R4M A;  4BQG A;  1KTV A;  4GGL A;  1BKN A;  3R4N A;  4U7O A;  2A2D A;  2IWX A;  3B78 A;  2YEJ A;  4JI0 E;  4IZK A;  5F3K A;  2BTZ A;  2BU2 A;  2HHH I;  4DV2 E;  4JI2 E;  2AKP A;  2QF6 A;  1H7U A;  4YKZ A;  1Y8N A;  5IWA I;  5CTY A;  2UXC E;  4X66 I;  3HYZ A;  2Z5B B;  4Z7C A;  2UUC I;  3PYD A;  3Q5L A;  1I94 E;  2UUB E;  3GIG A;  4L93 A;  4P52 A;  1XMQ E;  2XX4 A;  5FNC A;  4CE2 A;  2YKI A;  2YI0 A;  4CWR A;  2ZM6 I;  3K98 A;  1TC0 A;  4HZ0 A;  3U2K A;  1YT1 A;  1B63 A;  3WU5 A;  3T0Z A;  4DR4 E;  3H4L A;  1IBK E;  4JI8 E;  2HFU A;  4DPT A;  4KHP I;  1HNW I;  1THN A;  4N3O A;  3G7B A;  3QT8 A;  4AQY I;  3Q1Q A;  1I58 A;  4ASG A;  4ED4 A;  2XHT A;  4JYA E;  4ASB A;  5IN9 A;  2V34 A;  4EEH A;  1UYF A;  3A0Z A;  2Q8H A;  4DR5 I;  2ZBK B;  2YEB A;  3QDD A;  3C0E A;  4XIT A;  4NH9 A;  3P06 A;  1YES A;  5M4N A;  5LL6 R;  3J80 Q;  4NH7 A;  5D7C A;  3VHC A;  1S14 A;  4MP7 A;  2PNM A;  2BYI A;  3T1H I;  1I5C A;  2ZKJ A;  4JI3 E;  4JI4 I;  1MU5 A;  1N36 I;  2XDU A;  2E1R A;  2YEE A;  4H85 A;  1N34 I;  4DV6 I;  1TC6 A;  1QY8 A;  5IDJ A;  4CWP A;  3K1J A;  1TH8 A;  2XHR A;  4GKJ I;  3CGY A;  1N32 E;  1VIS A;  4ASA A;  4IZJ A;  2UUA I;  1HNX I;  3TZ0 A;  2YGA A;  2YKE A;  2WEP A;  4CWF A;  4LF7 E;  4DR1 I;  1IBL I;  5J6A A;  5BR8 E;  2E5L E;  1US7 A;  4X62 E;  2Q2E B;  1Z5A A;  3PEH A;  2GQ0 A;  3B8H A;  2H55 A;  4LFB I;  1AH8 A;  4JV5 E;  5CF0 A;  1S16 A;  1FI4 A;  4X65 E;  1PIE A;  2C2A A;  4HAC A;  2WI6 A;  1TIL A;  3JZ3 A;  3QTF A;  1UEK A;  2WI4 A;  1PKP A;  2V2Q A;  1XNR I;  1H73 A;  1B3Q A;  3B27 A;  1I5B A;  3RLQ A;  1QZR A;  1Y8P A;  4FWG A;  2R42 A;  4Z7Y A;  2CH4 A;  1ZM9 A;  2YE3 A;  3CRL A;  4B3M I;  1Z5B A;  4WUC A;  3PYG A;  1YT0 A;  3OWD A;  4JI6 I;  4KSG A;  1A6F A;  3B26 A;  3INX A;  2YE9 A;  3V5R A;  4GQT A;  4K4O A;  4P8O A;  4CWT A;  4CWN A;  5D7R A;  1Y4U A;  2DEJ A;  2Z5E A;  4B3R E;  4MPE A;  5CTW A;  3DGE A;  4DUY E;  4DR7 E;  4DU8 A;  4DV4 I;  3G75 A;  1N33 E;  4LWE A;  2Z5C B;  3EKR A;  3GON A;  3EHH A;  4DR2 I;  1USV A;  4LF8 E;  5M4K A;  1FWK A;  1XNQ E;  3T1Y E;  3JAM C;  4HYP A;  1ZM3 A;  2ZIT A;  1I5D A;  3D0B A;  5A2Q Q;  2YEF A;  1BXD A;  1HR0 I;  1J5E E;  2XDK A;  2Q8G A;  4DV7 I;  1OSF A;  4NXM I;  2XK2 A;  5LMN I;  3R4P A;  4BQJ A;  4LF5 I;  5CTX A;  4YHH I;  4LFA E;  4K0K I;  4E00 A;  4B7P A;  2VF3 A;  3LPS A;  4DV1 E;  1XMO I;  3ZKB A;  4DR6 E;  3RKZ A;  4YKR A;  2UU9 E;  3HJC A;  5GMD A;  2WI5 A;  2O1W A;  4EGI A;  3J81 Q;  4CWO A;  2YK9 A;  3B82 A;  4FPP A;  2BRE A;  2DEI A;  4FCP A;  1NHI A;  4E02 A;  2WER A;  4XD8 A;  2GFD A;  1HNZ I;  4R3M A;  1NZ0 A;  3U2D A;  4LFC E;  2F4V I;  3PRY A;  2WI7 A;  4MBC A;  2H8M A;  4R1F A;  4BXI A;  4UTG A;  4DR3 I;  2Z5B A;  3A0T A;  4YY3 I;  4B3S I;  3T0H A;  2GS8 A;  2VQF E;  2E0A A;  3FT5 A;  4L90 A;  5D6P A;  2WI1 A;  3PYE A;  4H7Q A;  4DUZ E;  1YET A;  1U2R A;  2WW4 A;  4O09 A;  4KQV A;  1KZN A;  4JI0 I;  2ZDY A;  1ZM4 A;  2O1V A;  4DPW A;  4DV2 I;  4JI2 I;  4Q20 A;  1EI1 A;  4JAU A;  4FWD A;  5M4P A;  2UXC I;  4PRX A;  4EMD A;  4LF4 E;  1UYH A;  4LPB A;  2XX5 A;  3R92 A;  4HXZ A;  1I94 I;  2UUB I;  4USM A;  2BZ5 A;  3G7E A;  3K17 A;  4JI5 E;  4W7T A;  4E01 A;  1XMQ I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...