4P7AA

Crystal structure of human mlh1
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
334
structure length
303
Chain Sequence
FVAGVIRRLDETVVNRIAAGEVIQRPANAIKEMIENCLDAKSTSIQVIVKEGGLKLIQIQDNGTGIRKEDLDIVCERFTTSKLGFRGEALASISHVAHVTITTKTADGKCAYRASYSDGKLKAPPKPCAGNQGTQITVEDLFYNIATRRKALKNPSEEYGKILEVVGRYSVHNAGISFSVKKQGETVADVRTLPNASTVDNIRSIFGNAVSRELIEIGCEDKTLAFKMNGYISNANYSVKKCIFLLFINHRLVESTSLRKAIETVYAAYLPKNTHPFLYLSLEISPESILERVQQHIESKLLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the human MLH1 N-terminus: implications for predisposition to Lynch syndrome.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
molecule keywords DNA mismatch repair protein Mlh1
total genus 88
structure length 303
sequence length 334
ec nomenclature
pdb deposition date 2014-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01119 DNA_mis_repair DNA mismatch repair protein, C-terminal domain
A PF13589 HATPase_c_3 Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4p7aA02
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 4p7aA01
2XX5A 1Z5CA 4XCJA 2XJXA 1OSFA 2CG9A 2Q8GA 2ZM6I 2BU8A 3OWBA 3B8HA 2YEDA 2UUBI 1AH6A 2V34A 5M4MA 4L91A 4H81A 4DV7I 3TZ2A 1YT1A 5FWKA 2VW5A 1IBKE 5LL6R 4YKXA 2WEQA 3K17A 4GKKE 4EGHA 2YKEA 4JG4A 4HZ5A 1J5EE 4O04A 3ZXOA 4DUHA 1XNRI 1A6FA 4DPXA 5LMNI 4DUYE 4DV4I 4DV0I 3J81Q 1HNWI 1Y8OA 2Q2EB 2XDKA 1UEKA 1Z0CA 2YEFA 3FT8A 4CWFA 4LFCI 4XIPA 4X62I 2VCJA 4B3RE 1R62A 3B25A 4PL9A 3WQ9A 2FYPA 3Q5JA 3TZ5A 1XNRE 2UWDA 4ED4A 3B26A 4FCQA 2HFSA 4XC0A 3A0XA 4U93A 2CCUA 3CWVA 4LF5I 4XKAA 4DV6E 1XMQI 2HKEA 4YKWA 2O1VA 3CGZA 1S14A 1ELOA 1S16A 2YJXA 5C93A 3RKZA 2YEIA 1HNWE 1HNXI 1NHIA 2BT0A 2UUAI 1YETA 3VHDA 4ASBA 4CWRA 1HR0E 2YKCA 1MU5A 4GKKI 1UYGA 2K5BA 1AH8A 3PEHA 2H55A 5FNFA 1FJGI 3OTOE 5IWAI 4B6CA 2E5LE 1H73A 1NHHA 2UXBE 1FNMA 2EXLA 3BMYA 4DR7I 4YY3E 4LF6I 1YSZA 1FWKA 2YE4A 3VADA 3JAMC 4BIZA 4BQJA 2XHXA 1EA6A 2WEPA 1US7A 2UU9E 2XDLA 4LFAI 4DR2E 3KE6A 3PYEA 1YS3A 2X36A 4H7QA 1GKXA 4EMDA 1UYKA 1Y8NA 2IOQA 4FN5A 2IWSA 3O0IA 4DUZE 2HCHA 3H4LA 1RR9A 2GFDA 3GIGB 4LP0A 1KIJA 4B3MI 1YC1A 4X65E 1BGQA 2WI2A 3FT5A 1ZXMA 4UTGA 2Q8HA 4DU8A 4FWGA 3NMQA 1I94I 3A0WA 5FLXQ 4FCPA 4LWGA 2XABA 4DR1E 5M4KA 4DV3E 5IDJA 4JAUA 3ZZ0A 4P52A 1HNZI 2YEGA 1QYEA 4DV7E 1XNQE 1I59A 1UY8A 1IBLI 2LJPA 1FJGE 3T10A 4HXZA 3O2FA 4O09A 3ZXQA 4EEHA 3T0HA 1UY7A 1Z0BA 1YT2A 2Q8IA 3Q5KA 3T0ZA 3B28A 4XDMA 2UXCE 4FMTA 1N0UA 2YK2A 3VHAA 4DV5I 2V2VA 2OI2A 4CE2A 1I5CA 3WU4A 4X62E 4LF7I 4HYMA 4DV1E 4DV2I 5CTWA 3TZ0A 4DR1I 1ZM2A 4E02A 1GJVA 1UYIA 2BU5A 5FNDA 4DV5E 5FNCA 3G7EA 3K98A 4USKA 4L8ZA 3INWA 2QG2A 2EFGA 4X66I 4K0KI 4DV1I 1Z0WA 1Z59A 4MOTA 4DV3I 3H80A 4FWHA 4AS9A 1N0VC 2ZITA 4NH7A 3U2DA 2FWZA 5J71A 1HR0I 1B3QA 2YECA 4KHPI 4EMVA 3PEJA 4PU9A 2BU7A 3EKOA 4DR7E 2HKJA 2ZKJA 1TILA 1U2OA 2BYIA 4XIRA 2BRCA 4E00A 3HULA 3ZZUA 4LFBE 2O1UA 4Z7YA 3RLPA 1TIDA 5D7DA 2YI7A 3G75A 4CWQA 2DEJA 3WU6A 4LWFA 3J80Q 1Z5BA 1U0ZA 4CE3A 4P7AA 4ZVIA 3HZ5A 4YKTA 1KTVA 1YESA 4WUCA 4B3ME 3G7BA 2BU2A 3D2RA 2YGEA 4B3TI 4DR4I 1I5AA 2R42A 4GQTA 2VQFI 1I94E 3MNRP 1WUUA 5LMNE 4XE2A 3J81C 4QPKA 4DV0E 2YE2A 1AM1A 1HNXE 3PYDA 4JASA 4LF9E 3FV5A 2PNRA 2ZDXA 1ID0A 4JYAE 1PKPA 3RLQA 2BYHA 2XD6A 4Z7CA 2WI6A 4EFTA 5FLXC 1IBLE 4JI3I 5CPHA 4I3HA 5M4HA 4JI6I 2YEAA 4JI7E 5IWAE 3A0ZA 3HYYA 2E5LI 1N34I 4O07A 5CF0A 2V2ZA 1U2RA 4JAVA 3U2KA 4BAEA 2UXCI 1N33E 1S4EA 4WUDA 1N32E 4DV6I 2BM0A 4L93A 1XMQE 2A2CA 2YEHA 4FWDA 4DV2E 1I5DA 1JM6A 2XJGA 2HK3A 4CE1A 4O05A 2WI1A 4BQGA 4GKJE 4LWEA 1UYHA 1Y4UA 1RREA 3K60A 4R3AA 1TH8A 4DUZI 1B63A 3GONA 5A2QQ 4LF9I 4HZ0A 2BM1A 1N33I 4W7TA 3SL2A 2WW4A 2XX2A 2YE9A 4EM7A 1IBKI 3QT5A 1KZNA 2XDSA 2X7IA 2UXBI 4MYUA 1FKAE 2YE8A 3F0NA 1ZM3A 2FWYA 3R4NA 3T1HE 3R4MA 4DU7A 2YGAA 4UROA 2IORA 1HNZE 2Q8FA 5GMDA 4UT4A 5M4NA 2BZ5A 3ZM7A 4DPTA 2YK9A 3EHGA 1TBWA 1KKHA 4MB9A 5LMUE 3WHAA 1ZWHA 3BM9A 2O1WA 3CRLA 5J6AA 4DR5I 3OW6A 1A4HA 3TZ4A 4U7OA 1XMOE 4GCZA 4HY1A 3LNUA 4MPCA 4CWOA 1BXDA 3A0YA 2FXSA 1K47A 4NXMI 4XCLA 3QTFA 4MP2A 4AWOA 5IT9Q 1MX0A 1Z5AA 1TC0A 2IWUA 4HACB 1AMWA 4PRXA 3T1YE 5CTUA 4EGKA 4LWHA 1XNQI 2YE5A 3OTOI 2JJCA 2HHHI 4XD8A 3K99A 4X66E 4K0KE 3K1JA 4ASFA 5IN9A 2DEIA 4GT8A 1NHJA 2BU6A 1PIEA 3M6AA 4GFNA 4DXLA 4NXNI 3V2UC 4BIUA 1NZ0A 4YKRA 4MP7A 4KQVA 2AJ4A 1QY8A 3A0TA 4L94A 4LF7E 3ZZTA 1YC3A 5M4PA 4GEEA 4MBCA 2GS8A 1ZXNA 4JI4E 1H7SA 4CWNA 4USMA 3R91A 3GIGA 4DR5E 4DR6I 3WU3A 4DPYA 4LWIA 4K4OA 5M4EA 4XKOA 4DZYA 4AQYI 4LF4I 2XCMA 4CWPA 3J7AM 4JI8I 4M1KA 1YERA 3Q1QA 3HEKA 2CZ9A 4GKJI 3ZKDA 4JI5I 2F4VE 1D6TA 3HZ1A 3QDDA 2YKIA 2QF6A 1Z0VA 3T1YI 4LF8E 2R3VA 2HG1A 5D7RA 4XKKA 3C11A 2IOPA 1TC6A 3J80C 2UUCI 1OJ4A 5GMEA 2JKIA 2V2QA 3U67A 1Y8PA 4P8OA 2YE6A 4JI1I 2YKJA 4U7NA 4JI5E 2F4VI 3T1HI 1UYMA 3R4OA 2AKPA 3D4JA 3EHHA 2J7KA 4HYPA 4YKQA 2YJWA 4YKUA 2E1RA 1YC4A 4CWSA 2A2DA 4JI8E 2YE7A 3T1KA 2HFUA 1KVKA 4JI0I 1FWLA 3INXA 2GQPA 4XITA 1FI4A 2UXDI 5D6QA 4DR6E 2QFOA 1I58A 5CTXA 4FW9A 3HYZA 2E0AA 3OMUA 4MPNA 2NPFA 1UYCA 1XMOI 4NH8A 1BYQA 3C0EA 4RPFA 3IEDA 4JI1E 2ZM6E 3WU5A 4E01A 4DPWA 2UUBE 2BREA 5BOCA 2UXDE 4L90A 5GGZA 2XK2A 2XX4A 4B3SI 2C2AA 5D7CA 3A0RA 4B7PA 3B78A 3QT7A 1UYDA 4OX9E 4KSGA 3TUHA 3PYGA 1H72C 2BTZA 2HK2A 5F3KA 4JI3E 1ZW9A 1BKNA 1IBMI 2XDUA 3DGEA 2HHHE 1VISA 2ESAA 5A2QC 1L0OA 4ASAA 3TTZA 4DUYI 4DV4E 2YEJA 2ZDYA 3EHFA 4ZKIA 4V26A 1N32I 4KFGA 4O0BA 3PYFA 1Z0GA 4KP4A 3CGYA 4WUBA 4B3RI 3R92A 2VQEE 5LMUI 4YHHI 5BR8I 4LF6E 4YY3I 1H74A 4PRVA 4JI2E 4FCRA 4LF5E 3B27A 3B82A 4OX9I 1ZM9A 2IWXA 4Q20A 4AQYE 5BODA 5CTYA 4LFAE 3GIFA 4LF4E 2YGFA 4DR2I 2XHTA 4MYTA 4ASGA 4NXME 2VQFE 3O6OA 4AWQA 1Y4SA 4AWPA 4I5SA 2WERA 5BR8E 3VHCA 4LPBA 3ZKBA 4JI2I 3CRKA 3T2SA 4JYAI 4H85A 1UYLA 2ZBKB 2UUCE 1MG7A 5IT9C 3J7AG 3QT8A 1YT0A 1DARA 2YI6A 4YKYA 1J5EI 1N34E 5L3JA 3V5RA 2XHRA 1UY9A 2BV3A 1THNA 2YKBA 5IDMA 2UU9I 2CCSA 1QZRA 4URMA 4LFCE 2YEEA 4MPEA 4BXIA 4EGIA 1N36I 2CH4A 1Z0EA 4X64E 4KHPE 4JI0E 3EKRA 5F5RA 2VF3A 2WI4A 2YI0A 4KTNA 4R3MA 4DR3E 2VCIA 4XTJA 2QG0A 4X65I 4GGLA 4LFBI 3B24A 2H8MA 2CGFA 1Z0TA 3K97A 1ZM4A 4JV5E 3LPSA 4HXWA 4NH9A 2YEBA 2XEXA 1UYFA 2YI5A 4URNA 1I5BA 2CCTA 4YKZA 4B3SE 4DR3I 4HY6A 4CWTA 4NXNE 3OWDA 4QPJA 1XHKA 4XIQA 2UUAE 4HACA 5D6PA 3LTOA 3JAMQ 1N36E 2BSMA 3QT6A 4X64I 4B3TE 1PVGA 4DR4E 2YE3A 1IBME 1AJ6A 4JI4I 1YSRA 4DPUA 3HHUA 4KSHA 2VWCA 3D36A 1EI1A 1H7UA 4JQLA 2V8PA 1UYEA 2XJJA 3Q5LA 4FPPA 4JI6E 3RLRA 4JV5I 4JI7I 3D0BA 4URLA 4X9LA 2VQEI 1UY6A 4YHHE 3EHJA 3OPDA 4LF8I 2WI3A 4R1FA 4EFUA 3JZ3A 4V25A 1GKZA 1B62A 2XDXA 3GIEA 2WI7A 2WI5A 3R4PA
chains in the Genus database with same CATH superfamily
2XX5A 1Z5CA 4XCJA 2XJXA 1OSFA 2CG9A 2Q8GA 2ZM6I 4BA2B 2BU8A 3B8HA 2YEDA 3OWBA 2UUBI 1AH6A 2V34A 3KRNA 5M4MA 4L91A 1E3PA 2C1GA 4H81A 4DV7I 3TZ2A 4OO1B 1YT1A 5FWKA 2VW5A 5ELWA 5LL6R 1IBKE 2WEQA 3K17A 4GKKE 4YKXA 2PO0A 2YKEA 4EGHA 4JG4A 4FW5A 4HZ5A 1J5EE 4O04A 3ZXOA 4DUHA 1XNRI 1A6FA 4DPXA 5LMNI 4DUYE 4DV4I 4FW4A 4DV0I 3J81Q 1HNWI 4ISAA 1Y8OA 2Q2EB 2XDKA 1UEKA 1Z0CA 2YEFA 3M7NG 3HKMA 3FT8A 4CWFA 4LFCI 4NBQA 4QNJA 4XIPA 1OYSA 4X62I 2VCJA 4B3RE 1R62A 3B25A 4PL9A 3WQ9A 3GLLA 4LCHA 2FYPA 3Q5JA 1YHCA 3TZ5A 5C0XB 1XNRE 2UWDA 4ED4A 3B26A 4FCQA 2HFSA 4XC0A 3A0XA 4U93A 2CCUA 3CWVA 4LF5I 4XKAA 4DV6E 1XMQI 2HKEA 4YKWA 2O1VA 5C0XE 3CGZA 1S14A 1ELOA 1S16A 2YJXA 4MDTA 5C93A 3M85G 3RKZA 2NN6E 2YEIA 4IS9A 1HNWE 1HNXI 1NHIA 2BT0A 4E72A 2UUAI 1YETA 3VHDA 4ASBA 4CWRA 1HR0E 2YKCA 1MU5A 4GKKI 1UYGA 2K5BA 1AH8A 3PEHA 2H55A 5FNFA 1FJGI 3OTOE 5IWAI 4B6CA 2E5LE 1H73A 2C37B 1NHHA 1UDSA 2UXBE 1FNMA 2EXLA 3BMYA 4DR7I 4YY3E 4LF6I 1YSZA 1FWKA 4FW6A 2YE4A 3JAMC 3VADA 2WNRA 4BIZA 4BQJA 2XHXA 1EA6A 2WEPA 1US7A 2UU9E 2AE8A 2XDLA 4LFAI 5DRPA 4DR2E 3KE6A 3PYEA 1YS3A 2X36A 4H7QA 2C39A 1GKXA 2IOQA 2CVEA 4EMDA 1UYKA 4FN5A 1Y8NA 2IWSA 3O0IA 4DUZE 2HCHA 5DROA 5EL9A 3H4LA 1RR9A 2GFDA 3GIGB 4MU0A 3HJCA 4LP0A 1KIJA 3P3CA 4B3MI 1YC1A 4X65E 1BGQA 2C38A 2O3ZA 2WI2A 3FT5A 1ZXMA 4UTGA 2Q8HA 4DU8A 4FWGA 3NMQA 1I94I 2JT2A 5FLXQ 3A0WA 4FCPA 2XABA 4DR1E 4LWGA 4DV3E 5IDJA 2NN6F 4JAUA 3ZZ0A 4P52A 1HNZI 2YEGA 1QYEA 4DV7E 1XNQE 1I59A 1UY8A 1IBLI 2LJPA 1FJGE 3T10A 4HXZA 3O2FA 4O09A 3ZXQA 4EEHA 3T0HA 1UDQA 1UY7A 1Z0BA 1YT2A 2Q8IA 3Q5KA 3T0ZA 3B28A 4XDMA 2UXCE 3P06A 2BA1G 4FMTA 1N0UA 4AIMA 3M85D 2YK2A 3VHAA 2F1DA 4DV5I 2V2VA 2OI2A 1IXMA 4CE2A 1I5CA 3WU4A 4X62E 4LF7I 4HYMA 4DV1E 4DV2I 4IZKA 3DD6A 5CTWA 3TZ0A 4DR1I 1ZM2A 4E02A 3L7ZA 1GJVA 1UYIA 3L7ZB 2BU5A 5FNDA 4LOMA 4DV5E 5FNCA 3G7EA 3K98A 4USKA 4L8ZA 1HK7A 2PO2B 2Z5CA 2EFGA 2QG2A 4X66I 4K0KI 3INWA 4DV1I 1Z0WA 1Z59A 3GCMA 4MOTA 3B4TA 4DV3I 3P3GA 3H80A 4FWHA 4AS9A 1N0VC 2HHIA 2ZITA 4NH7A 3U2DA 2FWZA 5J71A 1HR0I 1B3QA 2YECA 4KHPI 4EMVA 3CDIA 2FTKA 4PU9A 3PEJA 5JEAE 2BU7A 3EKOA 4DR7E 5JENA 4IFDB 2HKJA 2ZKJA 5C0XD 1TILA 1U2OA 2BYIA 4XIRA 2GQ0A 2BRCA 4E00A 3HULA 3Q6NA 2O1UA 3ZZUA 4LFBE 4Z7YA 3UHMA 3RLPA 2PO2A 2Z5CB 1TIDA 2YI7A 5D7DA 3G75A 4CWQA 2DEJA 3WU6A 4LWFA 3J80Q 1Z5BA 1U0ZA 4CE3A 4AM3A 3S5TA 4P7AA 4ZVIA 4IFDA 3HZ5A 4YKTA 5C0XF 1KTVA 1YESA 4WUCA 4B3ME 2PNMA 3G7BA 2BU2A 3D2RA 2YGEA 4B3TI 4DR4I 1I5AA 2R42A 4GQTA 2VQFI 1I94E 3MNRP 1WUUA 5LMNE 4XE2A 3J81C 4QPKA 4DV0E 2BA0D 2YE2A 1AM1A 2GO3A 1HNXE 3PYDA 2J65A 4JASA 4LF9E 3FV5A 2PNRA 4IFDE 2ZDXA 1ID0A 4JYAE 1PKPA 3RLQA 2BYHA 5JEAB 4Z7CA 2XD6A 2WI6A 4EFTA 5FLXC 1IBLE 4JI3I 5CPHA 4I3HA 5M4HA 4JI6I 4OO1F 2YEAA 4JI7E 5IWAE 3A0ZA 3HYYA 2E5LI 3PRYA 1N34I 4O07A 5CF0A 2V2ZA 1U2RA 4JAVA 3Q6MA 3U2KA 4BAEA 2UXCI 1N33E 1S4EA 4WUDA 4DV6I 1N32E 2BM0A 4L93A 2BA0G 1XMQE 4IZKB 4AIDA 2A2CA 2JE6B 5K36D 5JEAA 2YEHA 4FWDA 4DV2E 1I5DA 1JM6A 2XJGA 2HK3A 4CE1A 4O05A 2WI1A 4OO1E 4BQGA 4MQYA 4GKJE 1Y4UA 1UYHA 1RREA 3K60A 4LWEA 4R3AA 1TH8A 4DUZI 5K36E 1B63A 3GONA 5A2QQ 4LF9I 4HZ0A 2BM1A 1N33I 4W7TA 3SL2A 2Z5BA 4IFDF 2WW4A 5C0XA 5C0XC 3CYGA 2XX2A 2YE9A 4EM7A 4BA1A 1IBKI 3QT5A 4J3DA 1KZNA 2XDSA 2X7IA 2UXBI 4MYUA 1FKAE 2YE8A 3F0NA 1ZM3A 2FWYA 3R4NA 3T1HE 3R4MA 4DU7A 2YGAA 4UROA 2IORA 1HNZE 2Q8FA 2C37A 5GMDA 4UT4A 2JE6A 2BZ5A 5M4NA 3ZM7A 4DPTA 2YK9A 3EHGA 2C38B 3H1CA 2GO4A 1KKHA 1TBWA 4MB9A 5LMUE 3WHAA 1E3HA 1ZWHA 3BM9A 2O1WA 3CRLA 5J6AA 4DR5I 3OW6A 1A4HA 3TZ4A 4U7OA 2C39B 2JEBA 1XMOE 4HY1A 4GCZA 4MU4A 3LNUA 3U1KA 4MPCA 4CWOA 1BXDA 1OYPA 3A0YA 2JEAA 2FXSA 1K47A 5JEAF 4NXMI 3QTFA 4MP2A 4XCLA 4AWOA 5IT9Q 4U3DA 1MX0A 1Z5AA 1TC0A 2IWUA 4HACB 1AMWA 3P76A 4PRXA 3T1YE 5CTUA 4EGKA 4LCGA 4LWHA 5K36F 1XNQI 2YE5A 3GMEA 4N3OA 3OTOI 2JJCA 2HHHI 4XD8A 3K99A 5DNLA 4X66E 3K1JA 4K0KE 4ASFA 5IN9A 2DEIA 4GT8A 1NHJA 2BU6A 2IERA 2PNZB 1PIEA 3M6AA 4GFNA 4DXLA 4NXNI 3V2UC 4BIUA 1NZ0A 4YKRA 4MP7A 4KQVA 2AJ4A 1QY8A 3A0TA 4L94A 4LF7E 3ZZTA 1YC3A 5M4PA 4GEEA 4MBCA 2GS8A 1ZXNA 4JI4E 1H7SA 4CWNA 4USMA 3R91A 3GIGA 4DR5E 4DR6I 3WU3A 4DPYA 4LWIA 4K4OA 5M4EA 4XKOA 4DZYA 4AQYI 4LF4I 2XCMA 4CWPA 3J7AM 4JI8I 4M1KA 1YERA 3Q1QA 3HEKA 5DRQA 2CZ9A 2IESA 4GKJI 3ZKDA 4JI5I 2F4VE 1D6TA 3HZ1A 3QDDA 2YKIA 3PS1A 2QF6A 1Z0VA 3T1YI 1YH8A 2R3VA 4LF8E 2HG1A 5D7RA 2VESA 4FW7A 3C11A 4XKKA 2IOPA 1TC6A 3J80C 2UUCI 1OJ4A 5GMEA 2JKIA 2V2QA 2O1TA 1Y8PA 3U67A 4P8OA 2YE6A 4JI1I 4LCFA 2YKJA 4U7NA 1Y60A 4JI5E 2F4VI 5M4KA 4OZEA 3T1HI 2PO1B 1UYMA 2AKPA 3R4OA 2NN6B 3D4JA 5DRRA 2J7KA 3EHHA 4HYPA 4YKQA 2YJWA 4YKUA 2E1RA 4OO1D 1USVA 1YC4A 4CWSA 2A2DA 4JI8E 2YE7A 3T1KA 2HFUA 1KVKA 4JI0I 1FWLA 3INXA 3CDJA 2GQPA 4XITA 1FI4A 2UXDI 5D6QA 4DR6E 2QFOA 1I58A 1UDNA 5CTXA 4FW9A 3HYZA 2E0AA 3OMUA 4MPNA 2NPFA 1UYCA 1XMOI 4NH8A 5K36C 5EKWA 1BYQA 3C0EA 4RPFA 3IEDA 4JI1E 1P42A 2ZM6E 3WU5A 4E01A 4DPWA 2UUBE 2BREA 5BOCA 2UXDE 4L90A 4OO1C 5GGZA 2XK2A 2XX4A 4B3SI 2C2AA 5D7CA 3A0RA 4B7PA 3B78A 3QT7A 1UYDA 2BA1D 4OX9E 2PNLA 4KSGA 5DNXA 3PYGA 1H72C 3TUHA 2BTZA 1R6LA 2HK2A 4JI3E 5F3KA 1ZW9A 2BR2A 2Z5EA 1BKNA 1IBMI 2XDUA 3DGEA 2HHHE 1VISA 2ESAA 5A2QC 1L0OA 4ASAA 3TTZA 4DUYI 4DV4E 2YEJA 2ZDYA 3EHFA 4ZKIA 4V26A 1N32I 4KFGA 4O0BA 3PYFA 1Z0GA 4BA2A 4KP4A 1Y5YA 3CGYA 4WUBA 4B3RI 3R92A 2VQEE 5LMUI 2WNRB 4YHHI 5BR8I 4YY3I 1H74A 1R6MA 4PRVA 4JI2E 4LF6E 4FCRA 4LF5E 3B27A 2NN6A 3B82A 4OX9I 1ZM9A 2IWXA 5JEAD 4Q20A 4AQYE 2PO0B 3K85A 5CTYA 4LFAE 5BODA 3GIFA 4LF4E 2YGFA 4DR2I 2XHTA 4MYTA 4OO1A 4ASGA 4NXME 2VQFE 4IZJA 3O6OA 1Y4SA 4AWQA 4AWPA 1USUA 3LMMA 4I5SA 2C1IA 2WERA 2CGEA 5BR8E 3VHCA 4OKGA 4LPBA 3ZKBA 4JI2I 3CRKA 3T2SA 4JYAI 4H85A 1UYLA 4LPFA 4IZJD 2ZBKB 2UUCE 1MG7A 2NN6C 5IT9C 3J7AG 3QT8A 1YT0A 1DARA 2YI6A 2JEAB 4YKYA 3U1YA 1J5EI 1F51A 1N34E 2JEBB 5L3JA 3V5RA 2XHRA 1UY9A 2BV3A 5JEAC 1THNA 2YKBA 5IDMA 2UU9I 2CCSA 1QZRA 4IZJB 4URMA 4LFCE 2YEEA 4MPEA 4BXIA 4EGIA 1N36I 1XXEA 2CH4A 1Z0EA 4X64E 2BR2B 4KHPE 4JI0E 3EKRA 5F5RA 4IFDD 2VF3A 2WI4A 5K36B 2YI0A 4KTNA 1VI7A 4R3MA 4DR3E 2VCIA 4FW3A 4XTJA 2QG0A 2PNZA 4X65I 1OYRA 4GGLA 4LFBI 4GQUA 3B24A 2H8MA 2CGFA 1Z0TA 3K97A 1ZM4A 4JV5E 3LPSA 4HXWA 4BA1B 4NH9A 2YEBA 2XEXA 4MU3A 1UYFA 2YI5A 4URNA 3M7ND 2Z5BB 1I5BA 2CCTA 4B3SE 4DR3I 4HY6A 4YKZA 4NXNE 3OWDA 4QPJA 1XHKA 4CWTA 4XIQA 2UUAE 4HACA 5D6PA 1UDOA 3NZKA 3LTOA 2NN6D 3JAMQ 1N36E 2BSMA 4IFDC 3QT6A 4X64I 1PVGA 4B3TE 4DR4E 2YE3A 1IBME 1AJ6A 4JI4I 1YSRA 4DPUA 3HHUA 4KSHA 4U3BA 2VWCA 5K36A 4MU1A 2PO1A 1EI1A 3D36A 1H7UA 2WP8B 4JQLA 2V8PA 1RHYA 3PS2A 1UYEA 2XJJA 3Q5LA 4FPPA 4JI6E 3P3EA 3RLRA 2WP8A 4JV5I 4JI7I 3D0BA 4URLA 4X9LA 2VQEI 1UY6A 4YHHE 3EHJA 3OPDA 4LF8I 2WI3A 4R1FA 4EFUA 3JZ3A 4V25A 3PS3A 4QNKA 1B62A 1GKZA 2XDXA 3GIEA 2WI7A 2WI5A 1Y6ZA 3R4PA
chains in the Genus database with same CATH topology
2XX5A 1Z5CA 4XCJA 2XJXA 1OSFA 2CG9A 2Q8GA 2ZM6I 2BU8A 3OWBA 3B8HA 2YEDA 2UUBI 1AH6A 2V34A 5M4MA 4L91A 4H81A 4DV7I 3TZ2A 1YT1A 5FWKA 2VW5A 1IBKE 5LL6R 4YKXA 2WEQA 3K17A 4GKKE 4EGHA 2YKEA 4JG4A 4HZ5A 1J5EE 4O04A 3ZXOA 4DUHA 1XNRI 1A6FA 4DPXA 5LMNI 4DUYE 4DV4I 4DV0I 3J81Q 1HNWI 1Y8OA 2Q2EB 2XDKA 1UEKA 1Z0CA 2YEFA 3FT8A 4CWFA 4LFCI 4XIPA 4X62I 2VCJA 4B3RE 1R62A 3B25A 4PL9A 3WQ9A 2FYPA 3Q5JA 3TZ5A 1XNRE 2UWDA 4ED4A 3B26A 4FCQA 2HFSA 4XC0A 3A0XA 4U93A 2CCUA 3CWVA 4LF5I 4XKAA 4DV6E 1XMQI 2HKEA 4YKWA 2O1VA 3CGZA 1S14A 1ELOA 1S16A 2YJXA 5C93A 3RKZA 2YEIA 1HNWE 1HNXI 1NHIA 2BT0A 2UUAI 1YETA 3VHDA 4ASBA 4CWRA 1HR0E 2YKCA 1MU5A 4GKKI 1UYGA 2K5BA 1AH8A 3PEHA 2H55A 5FNFA 1FJGI 3OTOE 5IWAI 4B6CA 2E5LE 1H73A 1NHHA 2UXBE 1FNMA 2EXLA 3BMYA 4DR7I 4YY3E 4LF6I 1YSZA 1FWKA 2YE4A 3VADA 3JAMC 4BIZA 4BQJA 2XHXA 1EA6A 2WEPA 1US7A 2UU9E 2XDLA 4LFAI 4DR2E 3KE6A 3PYEA 1YS3A 2X36A 4H7QA 1GKXA 2IOQA 4EMDA 1UYKA 1Y8NA 4FN5A 2IWSA 3O0IA 4DUZE 2HCHA 3H4LA 1RR9A 2GFDA 3GIGB 4LP0A 3HJCA 1KIJA 4B3MI 1YC1A 4X65E 1BGQA 2WI2A 3FT5A 1ZXMA 4UTGA 2Q8HA 4DU8A 4FWGA 3NMQA 1I94I 3A0WA 5FLXQ 4FCPA 4LWGA 2XABA 4DR1E 5M4KA 4DV3E 5IDJA 4JAUA 3ZZ0A 4P52A 1HNZI 2YEGA 1QYEA 4DV7E 1XNQE 1I59A 1UY8A 1IBLI 2LJPA 1FJGE 3T10A 4HXZA 3O2FA 4O09A 3ZXQA 4EEHA 3T0HA 1UY7A 1Z0BA 1YT2A 2Q8IA 3Q5KA 3T0ZA 3B28A 4XDMA 2UXCE 3P06A 4FMTA 1N0UA 2YK2A 3VHAA 4DV5I 2V2VA 2OI2A 4CE2A 1I5CA 3WU4A 4X62E 4LF7I 4HYMA 4DV1E 4DV2I 4IZKA 5CTWA 3TZ0A 4DR1I 1ZM2A 4E02A 1GJVA 1UYIA 2BU5A 5FNDA 4DV5E 5FNCA 3G7EA 3K98A 4USKA 4L8ZA 1HK7A 2Z5CA 2QG2A 2EFGA 3INWA 4X66I 4K0KI 4DV1I 1Z0WA 1Z59A 4MOTA 4DV3I 3H80A 4FWHA 4AS9A 1N0VC 2ZITA 4NH7A 3U2DA 2FWZA 5J71A 1HR0I 1B3QA 2YECA 4KHPI 4EMVA 3PEJA 4PU9A 2BU7A 3EKOA 4DR7E 2HKJA 2ZKJA 1TILA 1U2OA 2BYIA 4XIRA 2GQ0A 2BRCA 4E00A 3HULA 3Q6NA 2O1UA 3ZZUA 4LFBE 4Z7YA 3RLPA 2Z5CB 1TIDA 5D7DA 2YI7A 3G75A 4CWQA 2DEJA 3WU6A 4LWFA 3J80Q 1Z5BA 1U0ZA 4CE3A 4P7AA 4ZVIA 3HZ5A 4YKTA 1KTVA 1YESA 4WUCA 4B3ME 2PNMA 3G7BA 2BU2A 3D2RA 2YGEA 4B3TI 4DR4I 1I5AA 2R42A 4GQTA 2VQFI 1I94E 3MNRP 1WUUA 5LMNE 4XE2A 3J81C 4QPKA 4DV0E 2YE2A 1AM1A 1HNXE 3PYDA 4JASA 4LF9E 3FV5A 2PNRA 2ZDXA 1ID0A 4JYAE 1PKPA 3RLQA 2BYHA 2XD6A 4Z7CA 2WI6A 4EFTA 5FLXC 1IBLE 4JI3I 5CPHA 4I3HA 5M4HA 4JI6I 2YEAA 4JI7E 5IWAE 3A0ZA 3HYYA 2E5LI 3PRYA 1N34I 4O07A 5CF0A 2V2ZA 1U2RA 4JAVA 3Q6MA 3U2KA 4BAEA 2UXCI 1N33E 1S4EA 4WUDA 4DV6I 1N32E 2BM0A 4L93A 1XMQE 4IZKB 2A2CA 2YEHA 4FWDA 4DV2E 1I5DA 1JM6A 2XJGA 2HK3A 4CE1A 4O05A 2WI1A 4BQGA 4GKJE 4LWEA 1Y4UA 1UYHA 1RREA 3K60A 4R3AA 1TH8A 4DUZI 1B63A 3GONA 5A2QQ 4LF9I 4HZ0A 2BM1A 1N33I 4W7TA 3SL2A 2Z5BA 2WW4A 2XX2A 2YE9A 4EM7A 1IBKI 3QT5A 1KZNA 2XDSA 2X7IA 2UXBI 4MYUA 1FKAE 2YE8A 3F0NA 1ZM3A 2FWYA 3R4NA 3T1HE 3R4MA 4DU7A 2YGAA 4UROA 2IORA 1HNZE 2Q8FA 5GMDA 4UT4A 5M4NA 2BZ5A 3ZM7A 4DPTA 2YK9A 3EHGA 1TBWA 1KKHA 4MB9A 5LMUE 3WHAA 1ZWHA 3BM9A 2O1WA 3CRLA 5J6AA 4DR5I 3OW6A 1A4HA 3TZ4A 4U7OA 1XMOE 4GCZA 4HY1A 3LNUA 4MPCA 4CWOA 1BXDA 3A0YA 2FXSA 1K47A 4NXMI 4XCLA 3QTFA 4MP2A 4AWOA 5IT9Q 1MX0A 1Z5AA 1TC0A 2IWUA 4HACB 1AMWA 4PRXA 3T1YE 5CTUA 4EGKA 4LWHA 1XNQI 2YE5A 4N3OA 3OTOI 2JJCA 2HHHI 4XD8A 3K99A 4X66E 4K0KE 3K1JA 4ASFA 5IN9A 2DEIA 4GT8A 1NHJA 2BU6A 1PIEA 3M6AA 4GFNA 4DXLA 4NXNI 3V2UC 4BIUA 1NZ0A 4YKRA 4MP7A 4KQVA 2AJ4A 1QY8A 3A0TA 4L94A 4LF7E 3ZZTA 1YC3A 5M4PA 4GEEA 4MBCA 2GS8A 1ZXNA 4JI4E 1H7SA 4CWNA 4USMA 3R91A 3GIGA 4DR5E 4DR6I 3WU3A 4DPYA 4LWIA 4K4OA 5M4EA 4XKOA 4DZYA 4AQYI 4LF4I 2XCMA 4CWPA 3J7AM 4JI8I 4M1KA 1YERA 3Q1QA 3HEKA 2CZ9A 4GKJI 3ZKDA 4JI5I 2F4VE 1D6TA 3HZ1A 3QDDA 2YKIA 2QF6A 1Z0VA 3T1YI 4LF8E 2R3VA 2HG1A 5D7RA 4XKKA 3C11A 2IOPA 1TC6A 3J80C 2UUCI 1OJ4A 5GMEA 2JKIA 2V2QA 2O1TA 1Y8PA 3U67A 4P8OA 2YE6A 4JI1I 2YKJA 4U7NA 4JI5E 2F4VI 3T1HI 1UYMA 3R4OA 2AKPA 3D4JA 3EHHA 2J7KA 4HYPA 4YKQA 2YJWA 4YKUA 2E1RA 1USVA 1YC4A 4CWSA 2A2DA 4JI8E 2YE7A 3T1KA 2HFUA 1KVKA 4JI0I 1FWLA 3INXA 2GQPA 4XITA 1FI4A 2UXDI 5D6QA 4DR6E 2QFOA 1I58A 5CTXA 4FW9A 3HYZA 2E0AA 3OMUA 4MPNA 2NPFA 1UYCA 1XMOI 4NH8A 1BYQA 3C0EA 4RPFA 3IEDA 4JI1E 2ZM6E 3WU5A 4E01A 4DPWA 2UUBE 2BREA 5BOCA 2UXDE 4L90A 5GGZA 2XK2A 2XX4A 4B3SI 2C2AA 5D7CA 3A0RA 4B7PA 3B78A 3QT7A 1UYDA 4OX9E 2PNLA 4KSGA 3TUHA 3PYGA 1H72C 2BTZA 2HK2A 5F3KA 4JI3E 1ZW9A 2Z5EA 1BKNA 1IBMI 2XDUA 3DGEA 2HHHE 1VISA 2ESAA 5A2QC 1L0OA 4ASAA 3TTZA 4DUYI 4DV4E 2YEJA 2ZDYA 3EHFA 4ZKIA 4V26A 1N32I 4KFGA 4O0BA 3PYFA 1Z0GA 4KP4A 3CGYA 4WUBA 4B3RI 3R92A 2VQEE 5LMUI 4YHHI 5BR8I 4YY3I 1H74A 4PRVA 4JI2E 4LF6E 4FCRA 4LF5E 3B27A 3B82A 4OX9I 1ZM9A 2IWXA 4Q20A 4AQYE 5BODA 3K85A 5CTYA 4LFAE 3GIFA 4LF4E 2YGFA 4DR2I 2XHTA 4MYTA 4ASGA 4NXME 2VQFE 4IZJA 3O6OA 1Y4SA 4AWQA 4AWPA 1USUA 4I5SA 2WERA 2CGEA 5BR8E 3VHCA 4LPBA 3ZKBA 4JI2I 3CRKA 3T2SA 4JYAI 4H85A 1UYLA 4IZJD 2UUCE 2ZBKB 1MG7A 5IT9C 3J7AG 3QT8A 1YT0A 1DARA 2YI6A 4YKYA 1J5EI 1N34E 5L3JA 3V5RA 2XHRA 1UY9A 2BV3A 1THNA 2YKBA 5IDMA 2UU9I 2CCSA 1QZRA 4IZJB 4URMA 4LFCE 2YEEA 4MPEA 4BXIA 4EGIA 1N36I 2CH4A 1Z0EA 4X64E 4KHPE 4JI0E 3EKRA 5F5RA 2VF3A 2WI4A 2YI0A 4KTNA 4R3MA 4DR3E 2VCIA 4XTJA 2QG0A 4X65I 4GGLA 4LFBI 3B24A 2H8MA 2CGFA 1Z0TA 3K97A 1ZM4A 4JV5E 3LPSA 4HXWA 4NH9A 2YEBA 2XEXA 1UYFA 2YI5A 4URNA 1I5BA 2Z5BB 2CCTA 4YKZA 4B3SE 4DR3I 4HY6A 4CWTA 4NXNE 3OWDA 4QPJA 1XHKA 4XIQA 2UUAE 4HACA 5D6PA 3LTOA 3JAMQ 1N36E 2BSMA 3QT6A 4X64I 4B3TE 1PVGA 4DR4E 2YE3A 1IBME 1AJ6A 4JI4I 1YSRA 4DPUA 3HHUA 4KSHA 2VWCA 3D36A 1EI1A 1H7UA 4JQLA 2V8PA 1UYEA 2XJJA 3Q5LA 4FPPA 4JI6E 3RLRA 4JV5I 4JI7I 3D0BA 4URLA 4X9LA 2VQEI 1UY6A 4YHHE 3EHJA 3OPDA 4LF8I 2WI3A 4R1FA 4EFUA 3JZ3A 4V25A 1GKZA 1B62A 2XDXA 3GIEA 2WI7A 2WI5A 1Y6ZA 3R4PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XX5 A;  1Z5C A;  4XCJ A;  2XJX A;  1OSF A;  2CG9 A;  2Q8G A;  2ZM6 I;  2BU8 A;  3OWB A;  3B8H A;  2YED A;  2UUB I;  1AH6 A;  2V34 A;  5M4M A;  4L91 A;  4H81 A;  4DV7 I;  3TZ2 A;  1YT1 A;  5FWK A;  2VW5 A;  1IBK E;  5LL6 R;  4YKX A;  2WEQ A;  3K17 A;  4GKK E;  4EGH A;  2YKE A;  4JG4 A;  4HZ5 A;  1J5E E;  4O04 A;  3ZXO A;  4DUH A;  1XNR I;  1A6F A;  4DPX A;  5LMN I;  4DUY E;  4DV4 I;  4DV0 I;  3J81 Q;  1HNW I;  1Y8O A;  2Q2E B;  2XDK A;  1UEK A;  1Z0C A;  2YEF A;  3FT8 A;  4CWF A;  4LFC I;  4XIP A;  4X62 I;  2VCJ A;  4B3R E;  1R62 A;  3B25 A;  4PL9 A;  3WQ9 A;  2FYP A;  3Q5J A;  3TZ5 A;  1XNR E;  2UWD A;  4ED4 A;  3B26 A;  4FCQ A;  2HFS A;  4XC0 A;  3A0X A;  4U93 A;  2CCU A;  3CWV A;  4LF5 I;  4XKA A;  4DV6 E;  1XMQ I;  2HKE A;  4YKW A;  2O1V A;  3CGZ A;  1S14 A;  1ELO A;  1S16 A;  2YJX A;  5C93 A;  3RKZ A;  2YEI A;  1HNW E;  1HNX I;  1NHI A;  2BT0 A;  2UUA I;  1YET A;  3VHD A;  4ASB A;  4CWR A;  1HR0 E;  2YKC A;  1MU5 A;  4GKK I;  1UYG A;  2K5B A;  1AH8 A;  3PEH A;  2H55 A;  5FNF A;  1FJG I;  3OTO E;  5IWA I;  4B6C A;  2E5L E;  1H73 A;  1NHH A;  2UXB E;  1FNM A;  2EXL A;  3BMY A;  4DR7 I;  4YY3 E;  4LF6 I;  1YSZ A;  1FWK A;  2YE4 A;  3VAD A;  3JAM C;  4BIZ A;  4BQJ A;  2XHX A;  1EA6 A;  2WEP A;  1US7 A;  2UU9 E;  2XDL A;  4LFA I;  4DR2 E;  3KE6 A;  3PYE A;  1YS3 A;  2X36 A;  4H7Q A;  1GKX A;  4EMD A;  1UYK A;  1Y8N A;  2IOQ A;  4FN5 A;  2IWS A;  3O0I A;  4DUZ E;  2HCH A;  3H4L A;  1RR9 A;  2GFD A;  3GIG B;  4LP0 A;  1KIJ A;  4B3M I;  1YC1 A;  4X65 E;  1BGQ A;  2WI2 A;  3FT5 A;  1ZXM A;  4UTG A;  2Q8H A;  4DU8 A;  4FWG A;  3NMQ A;  1I94 I;  3A0W A;  5FLX Q;  4FCP A;  4LWG A;  2XAB A;  4DR1 E;  5M4K A;  4DV3 E;  5IDJ A;  4JAU A;  3ZZ0 A;  4P52 A;  1HNZ I;  2YEG A;  1QYE A;  4DV7 E;  1XNQ E;  1I59 A;  1UY8 A;  1IBL I;  2LJP A;  1FJG E;  3T10 A;  4HXZ A;  3O2F A;  4O09 A;  3ZXQ A;  4EEH A;  3T0H A;  1UY7 A;  1Z0B A;  1YT2 A;  2Q8I A;  3Q5K A;  3T0Z A;  3B28 A;  4XDM A;  2UXC E;  4FMT A;  1N0U A;  2YK2 A;  3VHA A;  4DV5 I;  2V2V A;  2OI2 A;  4CE2 A;  1I5C A;  3WU4 A;  4X62 E;  4LF7 I;  4HYM A;  4DV1 E;  4DV2 I;  5CTW A;  3TZ0 A;  4DR1 I;  1ZM2 A;  4E02 A;  1GJV A;  1UYI A;  2BU5 A;  5FND A;  4DV5 E;  5FNC A;  3G7E A;  3K98 A;  4USK A;  4L8Z A;  3INW A;  2QG2 A;  2EFG A;  4X66 I;  4K0K I;  4DV1 I;  1Z0W A;  1Z59 A;  4MOT A;  4DV3 I;  3H80 A;  4FWH A;  4AS9 A;  1N0V C;  2ZIT A;  4NH7 A;  3U2D A;  2FWZ A;  5J71 A;  1HR0 I;  1B3Q A;  2YEC A;  4KHP I;  4EMV A;  3PEJ A;  4PU9 A;  2BU7 A;  3EKO A;  4DR7 E;  2HKJ A;  2ZKJ A;  1TIL A;  1U2O A;  2BYI A;  4XIR A;  2BRC A;  4E00 A;  3HUL A;  3ZZU A;  4LFB E;  2O1U A;  4Z7Y A;  3RLP A;  1TID A;  5D7D A;  2YI7 A;  3G75 A;  4CWQ A;  2DEJ A;  3WU6 A;  4LWF A;  3J80 Q;  1Z5B A;  1U0Z A;  4CE3 A;  4P7A A;  4ZVI A;  3HZ5 A;  4YKT A;  1KTV A;  1YES A;  4WUC A;  4B3M E;  3G7B A;  2BU2 A;  3D2R A;  2YGE A;  4B3T I;  4DR4 I;  1I5A A;  2R42 A;  4GQT A;  2VQF I;  1I94 E;  3MNR P;  1WUU A;  5LMN E;  4XE2 A;  3J81 C;  4QPK A;  4DV0 E;  2YE2 A;  1AM1 A;  1HNX E;  3PYD A;  4JAS A;  4LF9 E;  3FV5 A;  2PNR A;  2ZDX A;  1ID0 A;  4JYA E;  1PKP A;  3RLQ A;  2BYH A;  2XD6 A;  4Z7C A;  2WI6 A;  4EFT A;  5FLX C;  1IBL E;  4JI3 I;  5CPH A;  4I3H A;  5M4H A;  4JI6 I;  2YEA A;  4JI7 E;  5IWA E;  3A0Z A;  3HYY A;  2E5L I;  1N34 I;  4O07 A;  5CF0 A;  2V2Z A;  1U2R A;  4JAV A;  3U2K A;  4BAE A;  2UXC I;  1N33 E;  1S4E A;  4WUD A;  1N32 E;  4DV6 I;  2BM0 A;  4L93 A;  1XMQ E;  2A2C A;  2YEH A;  4FWD A;  4DV2 E;  1I5D A;  1JM6 A;  2XJG A;  2HK3 A;  4CE1 A;  4O05 A;  2WI1 A;  4BQG A;  4GKJ E;  4LWE A;  1UYH A;  1Y4U A;  1RRE A;  3K60 A;  4R3A A;  1TH8 A;  4DUZ I;  1B63 A;  3GON A;  5A2Q Q;  4LF9 I;  4HZ0 A;  2BM1 A;  1N33 I;  4W7T A;  3SL2 A;  2WW4 A;  2XX2 A;  2YE9 A;  4EM7 A;  1IBK I;  3QT5 A;  1KZN A;  2XDS A;  2X7I A;  2UXB I;  4MYU A;  1FKA E;  2YE8 A;  3F0N A;  1ZM3 A;  2FWY A;  3R4N A;  3T1H E;  3R4M A;  4DU7 A;  2YGA A;  4URO A;  2IOR A;  1HNZ E;  2Q8F A;  5GMD A;  4UT4 A;  5M4N A;  2BZ5 A;  3ZM7 A;  4DPT A;  2YK9 A;  3EHG A;  1TBW A;  1KKH A;  4MB9 A;  5LMU E;  3WHA A;  1ZWH A;  3BM9 A;  2O1W A;  3CRL A;  5J6A A;  4DR5 I;  3OW6 A;  1A4H A;  3TZ4 A;  4U7O A;  1XMO E;  4GCZ A;  4HY1 A;  3LNU A;  4MPC A;  4CWO A;  1BXD A;  3A0Y A;  2FXS A;  1K47 A;  4NXM I;  4XCL A;  3QTF A;  4MP2 A;  4AWO A;  5IT9 Q;  1MX0 A;  1Z5A A;  1TC0 A;  2IWU A;  4HAC B;  1AMW A;  4PRX A;  3T1Y E;  5CTU A;  4EGK A;  4LWH A;  1XNQ I;  2YE5 A;  3OTO I;  2JJC A;  2HHH I;  4XD8 A;  3K99 A;  4X66 E;  4K0K E;  3K1J A;  4ASF A;  5IN9 A;  2DEI A;  4GT8 A;  1NHJ A;  2BU6 A;  1PIE A;  3M6A A;  4GFN A;  4DXL A;  4NXN I;  3V2U C;  4BIU A;  1NZ0 A;  4YKR A;  4MP7 A;  4KQV A;  2AJ4 A;  1QY8 A;  3A0T A;  4L94 A;  4LF7 E;  3ZZT A;  1YC3 A;  5M4P A;  4GEE A;  4MBC A;  2GS8 A;  1ZXN A;  4JI4 E;  1H7S A;  4CWN A;  4USM A;  3R91 A;  3GIG A;  4DR5 E;  4DR6 I;  3WU3 A;  4DPY A;  4LWI A;  4K4O A;  5M4E A;  4XKO A;  4DZY A;  4AQY I;  4LF4 I;  2XCM A;  4CWP A;  3J7A M;  4JI8 I;  4M1K A;  1YER A;  3Q1Q A;  3HEK A;  2CZ9 A;  4GKJ I;  3ZKD A;  4JI5 I;  2F4V E;  1D6T A;  3HZ1 A;  3QDD A;  2YKI A;  2QF6 A;  1Z0V A;  3T1Y I;  4LF8 E;  2R3V A;  2HG1 A;  5D7R A;  4XKK A;  3C11 A;  2IOP A;  1TC6 A;  3J80 C;  2UUC I;  1OJ4 A;  5GME A;  2JKI A;  2V2Q A;  3U67 A;  1Y8P A;  4P8O A;  2YE6 A;  4JI1 I;  2YKJ A;  4U7N A;  4JI5 E;  2F4V I;  3T1H I;  1UYM A;  3R4O A;  2AKP A;  3D4J A;  3EHH A;  2J7K A;  4HYP A;  4YKQ A;  2YJW A;  4YKU A;  2E1R A;  1YC4 A;  4CWS A;  2A2D A;  4JI8 E;  2YE7 A;  3T1K A;  2HFU A;  1KVK A;  4JI0 I;  1FWL A;  3INX A;  2GQP A;  4XIT A;  1FI4 A;  2UXD I;  5D6Q A;  4DR6 E;  2QFO A;  1I58 A;  5CTX A;  4FW9 A;  3HYZ A;  2E0A A;  3OMU A;  4MPN A;  2NPF A;  1UYC A;  1XMO I;  4NH8 A;  1BYQ A;  3C0E A;  4RPF A;  3IED A;  4JI1 E;  2ZM6 E;  3WU5 A;  4E01 A;  4DPW A;  2UUB E;  2BRE A;  5BOC A;  2UXD E;  4L90 A;  5GGZ A;  2XK2 A;  2XX4 A;  4B3S I;  2C2A A;  5D7C A;  3A0R A;  4B7P A;  3B78 A;  3QT7 A;  1UYD A;  4OX9 E;  4KSG A;  3TUH A;  3PYG A;  1H72 C;  2BTZ A;  2HK2 A;  5F3K A;  4JI3 E;  1ZW9 A;  1BKN A;  1IBM I;  2XDU A;  3DGE A;  2HHH E;  1VIS A;  2ESA A;  5A2Q C;  1L0O A;  4ASA A;  3TTZ A;  4DUY I;  4DV4 E;  2YEJ A;  2ZDY A;  3EHF A;  4ZKI A;  4V26 A;  1N32 I;  4KFG A;  4O0B A;  3PYF A;  1Z0G A;  4KP4 A;  3CGY A;  4WUB A;  4B3R I;  3R92 A;  2VQE E;  5LMU I;  4YHH I;  5BR8 I;  4LF6 E;  4YY3 I;  1H74 A;  4PRV A;  4JI2 E;  4FCR A;  4LF5 E;  3B27 A;  3B82 A;  4OX9 I;  1ZM9 A;  2IWX A;  4Q20 A;  4AQY E;  5BOD A;  5CTY A;  4LFA E;  3GIF A;  4LF4 E;  2YGF A;  4DR2 I;  2XHT A;  4MYT A;  4ASG A;  4NXM E;  2VQF E;  3O6O A;  4AWQ A;  1Y4S A;  4AWP A;  4I5S A;  2WER A;  5BR8 E;  3VHC A;  4LPB A;  3ZKB A;  4JI2 I;  3CRK A;  3T2S A;  4JYA I;  4H85 A;  1UYL A;  2ZBK B;  2UUC E;  1MG7 A;  5IT9 C;  3J7A G;  3QT8 A;  1YT0 A;  1DAR A;  2YI6 A;  4YKY A;  1J5E I;  1N34 E;  5L3J A;  3V5R A;  2XHR A;  1UY9 A;  2BV3 A;  1THN A;  2YKB A;  5IDM A;  2UU9 I;  2CCS A;  1QZR A;  4URM A;  4LFC E;  2YEE A;  4MPE A;  4BXI A;  4EGI A;  1N36 I;  2CH4 A;  1Z0E A;  4X64 E;  4KHP E;  4JI0 E;  3EKR A;  5F5R A;  2VF3 A;  2WI4 A;  2YI0 A;  4KTN A;  4R3M A;  4DR3 E;  2VCI A;  4XTJ A;  2QG0 A;  4X65 I;  4GGL A;  4LFB I;  3B24 A;  2H8M A;  2CGF A;  1Z0T A;  3K97 A;  1ZM4 A;  4JV5 E;  3LPS A;  4HXW A;  4NH9 A;  2YEB A;  2XEX A;  1UYF A;  2YI5 A;  4URN A;  1I5B A;  2CCT A;  4YKZ A;  4B3S E;  4DR3 I;  4HY6 A;  4CWT A;  4NXN E;  3OWD A;  4QPJ A;  1XHK A;  4XIQ A;  2UUA E;  4HAC A;  5D6P A;  3LTO A;  3JAM Q;  1N36 E;  2BSM A;  3QT6 A;  4X64 I;  4B3T E;  1PVG A;  4DR4 E;  2YE3 A;  1IBM E;  1AJ6 A;  4JI4 I;  1YSR A;  4DPU A;  3HHU A;  4KSH A;  2VWC A;  3D36 A;  1EI1 A;  1H7U A;  4JQL A;  2V8P A;  1UYE A;  2XJJ A;  3Q5L A;  4FPP A;  4JI6 E;  3RLR A;  4JV5 I;  4JI7 I;  3D0B A;  4URL A;  4X9L A;  2VQE I;  1UY6 A;  4YHH E;  3EHJ A;  3OPD A;  4LF8 I;  2WI3 A;  4R1F A;  4EFU A;  3JZ3 A;  4V25 A;  1GKZ A;  1B62 A;  2XDX A;  3GIE A;  2WI7 A;  2WI5 A;  3R4P A; 
#chains in the Genus database with same CATH topology
 2XX5 A;  1Z5C A;  4XCJ A;  2XJX A;  1OSF A;  2CG9 A;  2Q8G A;  2ZM6 I;  4BA2 B;  2BU8 A;  3B8H A;  2YED A;  3OWB A;  2UUB I;  1AH6 A;  2V34 A;  3KRN A;  5M4M A;  4L91 A;  1E3P A;  2C1G A;  4H81 A;  4DV7 I;  3TZ2 A;  4OO1 B;  1YT1 A;  5FWK A;  2VW5 A;  5ELW A;  5LL6 R;  1IBK E;  2WEQ A;  3K17 A;  4GKK E;  4YKX A;  2PO0 A;  2YKE A;  4EGH A;  4JG4 A;  4FW5 A;  4HZ5 A;  1J5E E;  4O04 A;  3ZXO A;  4DUH A;  1XNR I;  1A6F A;  4DPX A;  5LMN I;  4DUY E;  4DV4 I;  4FW4 A;  4DV0 I;  3J81 Q;  1HNW I;  4ISA A;  1Y8O A;  2Q2E B;  2XDK A;  1UEK A;  1Z0C A;  2YEF A;  3M7N G;  3HKM A;  3FT8 A;  4CWF A;  4LFC I;  4NBQ A;  4QNJ A;  4XIP A;  1OYS A;  4X62 I;  2VCJ A;  4B3R E;  1R62 A;  3B25 A;  4PL9 A;  3WQ9 A;  3GLL A;  4LCH A;  2FYP A;  3Q5J A;  1YHC A;  3TZ5 A;  5C0X B;  1XNR E;  2UWD A;  4ED4 A;  3B26 A;  4FCQ A;  2HFS A;  4XC0 A;  3A0X A;  4U93 A;  2CCU A;  3CWV A;  4LF5 I;  4XKA A;  4DV6 E;  1XMQ I;  2HKE A;  4YKW A;  2O1V A;  5C0X E;  3CGZ A;  1S14 A;  1ELO A;  1S16 A;  2YJX A;  4MDT A;  5C93 A;  3M85 G;  3RKZ A;  2NN6 E;  2YEI A;  4IS9 A;  1HNW E;  1HNX I;  1NHI A;  2BT0 A;  4E72 A;  2UUA I;  1YET A;  3VHD A;  4ASB A;  4CWR A;  1HR0 E;  2YKC A;  1MU5 A;  4GKK I;  1UYG A;  2K5B A;  1AH8 A;  3PEH A;  2H55 A;  5FNF A;  1FJG I;  3OTO E;  5IWA I;  4B6C A;  2E5L E;  1H73 A;  2C37 B;  1NHH A;  1UDS A;  2UXB E;  1FNM A;  2EXL A;  3BMY A;  4DR7 I;  4YY3 E;  4LF6 I;  1YSZ A;  1FWK A;  4FW6 A;  2YE4 A;  3JAM C;  3VAD A;  2WNR A;  4BIZ A;  4BQJ A;  2XHX A;  1EA6 A;  2WEP A;  1US7 A;  2UU9 E;  2AE8 A;  2XDL A;  4LFA I;  5DRP A;  4DR2 E;  3KE6 A;  3PYE A;  1YS3 A;  2X36 A;  4H7Q A;  2C39 A;  1GKX A;  2IOQ A;  2CVE A;  4EMD A;  1UYK A;  4FN5 A;  1Y8N A;  2IWS A;  3O0I A;  4DUZ E;  2HCH A;  5DRO A;  5EL9 A;  3H4L A;  1RR9 A;  2GFD A;  3GIG B;  4MU0 A;  3HJC A;  4LP0 A;  1KIJ A;  3P3C A;  4B3M I;  1YC1 A;  4X65 E;  1BGQ A;  2C38 A;  2O3Z A;  2WI2 A;  3FT5 A;  1ZXM A;  4UTG A;  2Q8H A;  4DU8 A;  4FWG A;  3NMQ A;  1I94 I;  2JT2 A;  5FLX Q;  3A0W A;  4FCP A;  2XAB A;  4DR1 E;  4LWG A;  4DV3 E;  5IDJ A;  2NN6 F;  4JAU A;  3ZZ0 A;  4P52 A;  1HNZ I;  2YEG A;  1QYE A;  4DV7 E;  1XNQ E;  1I59 A;  1UY8 A;  1IBL I;  2LJP A;  1FJG E;  3T10 A;  4HXZ A;  3O2F A;  4O09 A;  3ZXQ A;  4EEH A;  3T0H A;  1UDQ A;  1UY7 A;  1Z0B A;  1YT2 A;  2Q8I A;  3Q5K A;  3T0Z A;  3B28 A;  4XDM A;  2UXC E;  3P06 A;  2BA1 G;  4FMT A;  1N0U A;  4AIM A;  3M85 D;  2YK2 A;  3VHA A;  2F1D A;  4DV5 I;  2V2V A;  2OI2 A;  1IXM A;  4CE2 A;  1I5C A;  3WU4 A;  4X62 E;  4LF7 I;  4HYM A;  4DV1 E;  4DV2 I;  4IZK A;  3DD6 A;  5CTW A;  3TZ0 A;  4DR1 I;  1ZM2 A;  4E02 A;  3L7Z A;  1GJV A;  1UYI A;  3L7Z B;  2BU5 A;  5FND A;  4LOM A;  4DV5 E;  5FNC A;  3G7E A;  3K98 A;  4USK A;  4L8Z A;  1HK7 A;  2PO2 B;  2Z5C A;  2EFG A;  2QG2 A;  4X66 I;  4K0K I;  3INW A;  4DV1 I;  1Z0W A;  1Z59 A;  3GCM A;  4MOT A;  3B4T A;  4DV3 I;  3P3G A;  3H80 A;  4FWH A;  4AS9 A;  1N0V C;  2HHI A;  2ZIT A;  4NH7 A;  3U2D A;  2FWZ A;  5J71 A;  1HR0 I;  1B3Q A;  2YEC A;  4KHP I;  4EMV A;  3CDI A;  2FTK A;  4PU9 A;  3PEJ A;  5JEA E;  2BU7 A;  3EKO A;  4DR7 E;  5JEN A;  4IFD B;  2HKJ A;  2ZKJ A;  5C0X D;  1TIL A;  1U2O A;  2BYI A;  4XIR A;  2GQ0 A;  2BRC A;  4E00 A;  3HUL A;  3Q6N A;  2O1U A;  3ZZU A;  4LFB E;  4Z7Y A;  3UHM A;  3RLP A;  2PO2 A;  2Z5C B;  1TID A;  2YI7 A;  5D7D A;  3G75 A;  4CWQ A;  2DEJ A;  3WU6 A;  4LWF A;  3J80 Q;  1Z5B A;  1U0Z A;  4CE3 A;  4AM3 A;  3S5T A;  4P7A A;  4ZVI A;  4IFD A;  3HZ5 A;  4YKT A;  5C0X F;  1KTV A;  1YES A;  4WUC A;  4B3M E;  2PNM A;  3G7B A;  2BU2 A;  3D2R A;  2YGE A;  4B3T I;  4DR4 I;  1I5A A;  2R42 A;  4GQT A;  2VQF I;  1I94 E;  3MNR P;  1WUU A;  5LMN E;  4XE2 A;  3J81 C;  4QPK A;  4DV0 E;  2BA0 D;  2YE2 A;  1AM1 A;  2GO3 A;  1HNX E;  3PYD A;  2J65 A;  4JAS A;  4LF9 E;  3FV5 A;  2PNR A;  4IFD E;  2ZDX A;  1ID0 A;  4JYA E;  1PKP A;  3RLQ A;  2BYH A;  5JEA B;  4Z7C A;  2XD6 A;  2WI6 A;  4EFT A;  5FLX C;  1IBL E;  4JI3 I;  5CPH A;  4I3H A;  5M4H A;  4JI6 I;  4OO1 F;  2YEA A;  4JI7 E;  5IWA E;  3A0Z A;  3HYY A;  2E5L I;  3PRY A;  1N34 I;  4O07 A;  5CF0 A;  2V2Z A;  1U2R A;  4JAV A;  3Q6M A;  3U2K A;  4BAE A;  2UXC I;  1N33 E;  1S4E A;  4WUD A;  4DV6 I;  1N32 E;  2BM0 A;  4L93 A;  2BA0 G;  1XMQ E;  4IZK B;  4AID A;  2A2C A;  2JE6 B;  5K36 D;  5JEA A;  2YEH A;  4FWD A;  4DV2 E;  1I5D A;  1JM6 A;  2XJG A;  2HK3 A;  4CE1 A;  4O05 A;  2WI1 A;  4OO1 E;  4BQG A;  4MQY A;  4GKJ E;  1Y4U A;  1UYH A;  1RRE A;  3K60 A;  4LWE A;  4R3A A;  1TH8 A;  4DUZ I;  5K36 E;  1B63 A;  3GON A;  5A2Q Q;  4LF9 I;  4HZ0 A;  2BM1 A;  1N33 I;  4W7T A;  3SL2 A;  2Z5B A;  4IFD F;  2WW4 A;  5C0X A;  5C0X C;  3CYG A;  2XX2 A;  2YE9 A;  4EM7 A;  4BA1 A;  1IBK I;  3QT5 A;  4J3D A;  1KZN A;  2XDS A;  2X7I A;  2UXB I;  4MYU A;  1FKA E;  2YE8 A;  3F0N A;  1ZM3 A;  2FWY A;  3R4N A;  3T1H E;  3R4M A;  4DU7 A;  2YGA A;  4URO A;  2IOR A;  1HNZ E;  2Q8F A;  2C37 A;  5GMD A;  4UT4 A;  2JE6 A;  2BZ5 A;  5M4N A;  3ZM7 A;  4DPT A;  2YK9 A;  3EHG A;  2C38 B;  3H1C A;  2GO4 A;  1KKH A;  1TBW A;  4MB9 A;  5LMU E;  3WHA A;  1E3H A;  1ZWH A;  3BM9 A;  2O1W A;  3CRL A;  5J6A A;  4DR5 I;  3OW6 A;  1A4H A;  3TZ4 A;  4U7O A;  2C39 B;  2JEB A;  1XMO E;  4HY1 A;  4GCZ A;  4MU4 A;  3LNU A;  3U1K A;  4MPC A;  4CWO A;  1BXD A;  1OYP A;  3A0Y A;  2JEA A;  2FXS A;  1K47 A;  5JEA F;  4NXM I;  3QTF A;  4MP2 A;  4XCL A;  4AWO A;  5IT9 Q;  4U3D A;  1MX0 A;  1Z5A A;  1TC0 A;  2IWU A;  4HAC B;  1AMW A;  3P76 A;  4PRX A;  3T1Y E;  5CTU A;  4EGK A;  4LCG A;  4LWH A;  5K36 F;  1XNQ I;  2YE5 A;  3GME A;  4N3O A;  3OTO I;  2JJC A;  2HHH I;  4XD8 A;  3K99 A;  5DNL A;  4X66 E;  3K1J A;  4K0K E;  4ASF A;  5IN9 A;  2DEI A;  4GT8 A;  1NHJ A;  2BU6 A;  2IER A;  2PNZ B;  1PIE A;  3M6A A;  4GFN A;  4DXL A;  4NXN I;  3V2U C;  4BIU A;  1NZ0 A;  4YKR A;  4MP7 A;  4KQV A;  2AJ4 A;  1QY8 A;  3A0T A;  4L94 A;  4LF7 E;  3ZZT A;  1YC3 A;  5M4P A;  4GEE A;  4MBC A;  2GS8 A;  1ZXN A;  4JI4 E;  1H7S A;  4CWN A;  4USM A;  3R91 A;  3GIG A;  4DR5 E;  4DR6 I;  3WU3 A;  4DPY A;  4LWI A;  4K4O A;  5M4E A;  4XKO A;  4DZY A;  4AQY I;  4LF4 I;  2XCM A;  4CWP A;  3J7A M;  4JI8 I;  4M1K A;  1YER A;  3Q1Q A;  3HEK A;  5DRQ A;  2CZ9 A;  2IES A;  4GKJ I;  3ZKD A;  4JI5 I;  2F4V E;  1D6T A;  3HZ1 A;  3QDD A;  2YKI A;  3PS1 A;  2QF6 A;  1Z0V A;  3T1Y I;  1YH8 A;  2R3V A;  4LF8 E;  2HG1 A;  5D7R A;  2VES A;  4FW7 A;  3C11 A;  4XKK A;  2IOP A;  1TC6 A;  3J80 C;  2UUC I;  1OJ4 A;  5GME A;  2JKI A;  2V2Q A;  2O1T A;  1Y8P A;  3U67 A;  4P8O A;  2YE6 A;  4JI1 I;  4LCF A;  2YKJ A;  4U7N A;  1Y60 A;  4JI5 E;  2F4V I;  5M4K A;  4OZE A;  3T1H I;  2PO1 B;  1UYM A;  2AKP A;  3R4O A;  2NN6 B;  3D4J A;  5DRR A;  2J7K A;  3EHH A;  4HYP A;  4YKQ A;  2YJW A;  4YKU A;  2E1R A;  4OO1 D;  1USV A;  1YC4 A;  4CWS A;  2A2D A;  4JI8 E;  2YE7 A;  3T1K A;  2HFU A;  1KVK A;  4JI0 I;  1FWL A;  3INX A;  3CDJ A;  2GQP A;  4XIT A;  1FI4 A;  2UXD I;  5D6Q A;  4DR6 E;  2QFO A;  1I58 A;  1UDN A;  5CTX A;  4FW9 A;  3HYZ A;  2E0A A;  3OMU A;  4MPN A;  2NPF A;  1UYC A;  1XMO I;  4NH8 A;  5K36 C;  5EKW A;  1BYQ A;  3C0E A;  4RPF A;  3IED A;  4JI1 E;  1P42 A;  2ZM6 E;  3WU5 A;  4E01 A;  4DPW A;  2UUB E;  2BRE A;  5BOC A;  2UXD E;  4L90 A;  4OO1 C;  5GGZ A;  2XK2 A;  2XX4 A;  4B3S I;  2C2A A;  5D7C A;  3A0R A;  4B7P A;  3B78 A;  3QT7 A;  1UYD A;  2BA1 D;  4OX9 E;  2PNL A;  4KSG A;  5DNX A;  3PYG A;  1H72 C;  3TUH A;  2BTZ A;  1R6L A;  2HK2 A;  4JI3 E;  5F3K A;  1ZW9 A;  2BR2 A;  2Z5E A;  1BKN A;  1IBM I;  2XDU A;  3DGE A;  2HHH E;  1VIS A;  2ESA A;  5A2Q C;  1L0O A;  4ASA A;  3TTZ A;  4DUY I;  4DV4 E;  2YEJ A;  2ZDY A;  3EHF A;  4ZKI A;  4V26 A;  1N32 I;  4KFG A;  4O0B A;  3PYF A;  1Z0G A;  4BA2 A;  4KP4 A;  1Y5Y A;  3CGY A;  4WUB A;  4B3R I;  3R92 A;  2VQE E;  5LMU I;  2WNR B;  4YHH I;  5BR8 I;  4YY3 I;  1H74 A;  1R6M A;  4PRV A;  4JI2 E;  4LF6 E;  4FCR A;  4LF5 E;  3B27 A;  2NN6 A;  3B82 A;  4OX9 I;  1ZM9 A;  2IWX A;  5JEA D;  4Q20 A;  4AQY E;  2PO0 B;  3K85 A;  5CTY A;  4LFA E;  5BOD A;  3GIF A;  4LF4 E;  2YGF A;  4DR2 I;  2XHT A;  4MYT A;  4OO1 A;  4ASG A;  4NXM E;  2VQF E;  4IZJ A;  3O6O A;  1Y4S A;  4AWQ A;  4AWP A;  1USU A;  3LMM A;  4I5S A;  2C1I A;  2WER A;  2CGE A;  5BR8 E;  3VHC A;  4OKG A;  4LPB A;  3ZKB A;  4JI2 I;  3CRK A;  3T2S A;  4JYA I;  4H85 A;  1UYL A;  4LPF A;  4IZJ D;  2ZBK B;  2UUC E;  1MG7 A;  2NN6 C;  5IT9 C;  3J7A G;  3QT8 A;  1YT0 A;  1DAR A;  2YI6 A;  2JEA B;  4YKY A;  3U1Y A;  1J5E I;  1F51 A;  1N34 E;  2JEB B;  5L3J A;  3V5R A;  2XHR A;  1UY9 A;  2BV3 A;  5JEA C;  1THN A;  2YKB A;  5IDM A;  2UU9 I;  2CCS A;  1QZR A;  4IZJ B;  4URM A;  4LFC E;  2YEE A;  4MPE A;  4BXI A;  4EGI A;  1N36 I;  1XXE A;  2CH4 A;  1Z0E A;  4X64 E;  2BR2 B;  4KHP E;  4JI0 E;  3EKR A;  5F5R A;  4IFD D;  2VF3 A;  2WI4 A;  5K36 B;  2YI0 A;  4KTN A;  1VI7 A;  4R3M A;  4DR3 E;  2VCI A;  4FW3 A;  4XTJ A;  2QG0 A;  2PNZ A;  4X65 I;  1OYR A;  4GGL A;  4LFB I;  4GQU A;  3B24 A;  2H8M A;  2CGF A;  1Z0T A;  3K97 A;  1ZM4 A;  4JV5 E;  3LPS A;  4HXW A;  4BA1 B;  4NH9 A;  2YEB A;  2XEX A;  4MU3 A;  1UYF A;  2YI5 A;  4URN A;  3M7N D;  2Z5B B;  1I5B A;  2CCT A;  4B3S E;  4DR3 I;  4HY6 A;  4YKZ A;  4NXN E;  3OWD A;  4QPJ A;  1XHK A;  4CWT A;  4XIQ A;  2UUA E;  4HAC A;  5D6P A;  1UDO A;  3NZK A;  3LTO A;  2NN6 D;  3JAM Q;  1N36 E;  2BSM A;  4IFD C;  3QT6 A;  4X64 I;  1PVG A;  4B3T E;  4DR4 E;  2YE3 A;  1IBM E;  1AJ6 A;  4JI4 I;  1YSR A;  4DPU A;  3HHU A;  4KSH A;  4U3B A;  2VWC A;  5K36 A;  4MU1 A;  2PO1 A;  1EI1 A;  3D36 A;  1H7U A;  2WP8 B;  4JQL A;  2V8P A;  1RHY A;  3PS2 A;  1UYE A;  2XJJ A;  3Q5L A;  4FPP A;  4JI6 E;  3P3E A;  3RLR A;  2WP8 A;  4JV5 I;  4JI7 I;  3D0B A;  4URL A;  4X9L A;  2VQE I;  1UY6 A;  4YHH E;  3EHJ A;  3OPD A;  4LF8 I;  2WI3 A;  4R1F A;  4EFU A;  3JZ3 A;  4V25 A;  3PS3 A;  4QNK A;  1B62 A;  1GKZ A;  2XDX A;  3GIE A;  2WI7 A;  2WI5 A;  1Y6Z A;  3R4P A; 
#chains in the Genus database with same CATH homology
 2XX5 A;  1Z5C A;  4XCJ A;  2XJX A;  1OSF A;  2CG9 A;  2Q8G A;  2ZM6 I;  2BU8 A;  3OWB A;  3B8H A;  2YED A;  2UUB I;  1AH6 A;  2V34 A;  5M4M A;  4L91 A;  4H81 A;  4DV7 I;  3TZ2 A;  1YT1 A;  5FWK A;  2VW5 A;  1IBK E;  5LL6 R;  4YKX A;  2WEQ A;  3K17 A;  4GKK E;  4EGH A;  2YKE A;  4JG4 A;  4HZ5 A;  1J5E E;  4O04 A;  3ZXO A;  4DUH A;  1XNR I;  1A6F A;  4DPX A;  5LMN I;  4DUY E;  4DV4 I;  4DV0 I;  3J81 Q;  1HNW I;  1Y8O A;  2Q2E B;  2XDK A;  1UEK A;  1Z0C A;  2YEF A;  3FT8 A;  4CWF A;  4LFC I;  4XIP A;  4X62 I;  2VCJ A;  4B3R E;  1R62 A;  3B25 A;  4PL9 A;  3WQ9 A;  2FYP A;  3Q5J A;  3TZ5 A;  1XNR E;  2UWD A;  4ED4 A;  3B26 A;  4FCQ A;  2HFS A;  4XC0 A;  3A0X A;  4U93 A;  2CCU A;  3CWV A;  4LF5 I;  4XKA A;  4DV6 E;  1XMQ I;  2HKE A;  4YKW A;  2O1V A;  3CGZ A;  1S14 A;  1ELO A;  1S16 A;  2YJX A;  5C93 A;  3RKZ A;  2YEI A;  1HNW E;  1HNX I;  1NHI A;  2BT0 A;  2UUA I;  1YET A;  3VHD A;  4ASB A;  4CWR A;  1HR0 E;  2YKC A;  1MU5 A;  4GKK I;  1UYG A;  2K5B A;  1AH8 A;  3PEH A;  2H55 A;  5FNF A;  1FJG I;  3OTO E;  5IWA I;  4B6C A;  2E5L E;  1H73 A;  1NHH A;  2UXB E;  1FNM A;  2EXL A;  3BMY A;  4DR7 I;  4YY3 E;  4LF6 I;  1YSZ A;  1FWK A;  2YE4 A;  3VAD A;  3JAM C;  4BIZ A;  4BQJ A;  2XHX A;  1EA6 A;  2WEP A;  1US7 A;  2UU9 E;  2XDL A;  4LFA I;  4DR2 E;  3KE6 A;  3PYE A;  1YS3 A;  2X36 A;  4H7Q A;  1GKX A;  2IOQ A;  4EMD A;  1UYK A;  1Y8N A;  4FN5 A;  2IWS A;  3O0I A;  4DUZ E;  2HCH A;  3H4L A;  1RR9 A;  2GFD A;  3GIG B;  4LP0 A;  3HJC A;  1KIJ A;  4B3M I;  1YC1 A;  4X65 E;  1BGQ A;  2WI2 A;  3FT5 A;  1ZXM A;  4UTG A;  2Q8H A;  4DU8 A;  4FWG A;  3NMQ A;  1I94 I;  3A0W A;  5FLX Q;  4FCP A;  4LWG A;  2XAB A;  4DR1 E;  5M4K A;  4DV3 E;  5IDJ A;  4JAU A;  3ZZ0 A;  4P52 A;  1HNZ I;  2YEG A;  1QYE A;  4DV7 E;  1XNQ E;  1I59 A;  1UY8 A;  1IBL I;  2LJP A;  1FJG E;  3T10 A;  4HXZ A;  3O2F A;  4O09 A;  3ZXQ A;  4EEH A;  3T0H A;  1UY7 A;  1Z0B A;  1YT2 A;  2Q8I A;  3Q5K A;  3T0Z A;  3B28 A;  4XDM A;  2UXC E;  3P06 A;  4FMT A;  1N0U A;  2YK2 A;  3VHA A;  4DV5 I;  2V2V A;  2OI2 A;  4CE2 A;  1I5C A;  3WU4 A;  4X62 E;  4LF7 I;  4HYM A;  4DV1 E;  4DV2 I;  4IZK A;  5CTW A;  3TZ0 A;  4DR1 I;  1ZM2 A;  4E02 A;  1GJV A;  1UYI A;  2BU5 A;  5FND A;  4DV5 E;  5FNC A;  3G7E A;  3K98 A;  4USK A;  4L8Z A;  1HK7 A;  2Z5C A;  2QG2 A;  2EFG A;  3INW A;  4X66 I;  4K0K I;  4DV1 I;  1Z0W A;  1Z59 A;  4MOT A;  4DV3 I;  3H80 A;  4FWH A;  4AS9 A;  1N0V C;  2ZIT A;  4NH7 A;  3U2D A;  2FWZ A;  5J71 A;  1HR0 I;  1B3Q A;  2YEC A;  4KHP I;  4EMV A;  3PEJ A;  4PU9 A;  2BU7 A;  3EKO A;  4DR7 E;  2HKJ A;  2ZKJ A;  1TIL A;  1U2O A;  2BYI A;  4XIR A;  2GQ0 A;  2BRC A;  4E00 A;  3HUL A;  3Q6N A;  2O1U A;  3ZZU A;  4LFB E;  4Z7Y A;  3RLP A;  2Z5C B;  1TID A;  5D7D A;  2YI7 A;  3G75 A;  4CWQ A;  2DEJ A;  3WU6 A;  4LWF A;  3J80 Q;  1Z5B A;  1U0Z A;  4CE3 A;  4P7A A;  4ZVI A;  3HZ5 A;  4YKT A;  1KTV A;  1YES A;  4WUC A;  4B3M E;  2PNM A;  3G7B A;  2BU2 A;  3D2R A;  2YGE A;  4B3T I;  4DR4 I;  1I5A A;  2R42 A;  4GQT A;  2VQF I;  1I94 E;  3MNR P;  1WUU A;  5LMN E;  4XE2 A;  3J81 C;  4QPK A;  4DV0 E;  2YE2 A;  1AM1 A;  1HNX E;  3PYD A;  4JAS A;  4LF9 E;  3FV5 A;  2PNR A;  2ZDX A;  1ID0 A;  4JYA E;  1PKP A;  3RLQ A;  2BYH A;  2XD6 A;  4Z7C A;  2WI6 A;  4EFT A;  5FLX C;  1IBL E;  4JI3 I;  5CPH A;  4I3H A;  5M4H A;  4JI6 I;  2YEA A;  4JI7 E;  5IWA E;  3A0Z A;  3HYY A;  2E5L I;  3PRY A;  1N34 I;  4O07 A;  5CF0 A;  2V2Z A;  1U2R A;  4JAV A;  3Q6M A;  3U2K A;  4BAE A;  2UXC I;  1N33 E;  1S4E A;  4WUD A;  4DV6 I;  1N32 E;  2BM0 A;  4L93 A;  1XMQ E;  4IZK B;  2A2C A;  2YEH A;  4FWD A;  4DV2 E;  1I5D A;  1JM6 A;  2XJG A;  2HK3 A;  4CE1 A;  4O05 A;  2WI1 A;  4BQG A;  4GKJ E;  4LWE A;  1Y4U A;  1UYH A;  1RRE A;  3K60 A;  4R3A A;  1TH8 A;  4DUZ I;  1B63 A;  3GON A;  5A2Q Q;  4LF9 I;  4HZ0 A;  2BM1 A;  1N33 I;  4W7T A;  3SL2 A;  2Z5B A;  2WW4 A;  2XX2 A;  2YE9 A;  4EM7 A;  1IBK I;  3QT5 A;  1KZN A;  2XDS A;  2X7I A;  2UXB I;  4MYU A;  1FKA E;  2YE8 A;  3F0N A;  1ZM3 A;  2FWY A;  3R4N A;  3T1H E;  3R4M A;  4DU7 A;  2YGA A;  4URO A;  2IOR A;  1HNZ E;  2Q8F A;  5GMD A;  4UT4 A;  5M4N A;  2BZ5 A;  3ZM7 A;  4DPT A;  2YK9 A;  3EHG A;  1TBW A;  1KKH A;  4MB9 A;  5LMU E;  3WHA A;  1ZWH A;  3BM9 A;  2O1W A;  3CRL A;  5J6A A;  4DR5 I;  3OW6 A;  1A4H A;  3TZ4 A;  4U7O A;  1XMO E;  4GCZ A;  4HY1 A;  3LNU A;  4MPC A;  4CWO A;  1BXD A;  3A0Y A;  2FXS A;  1K47 A;  4NXM I;  4XCL A;  3QTF A;  4MP2 A;  4AWO A;  5IT9 Q;  1MX0 A;  1Z5A A;  1TC0 A;  2IWU A;  4HAC B;  1AMW A;  4PRX A;  3T1Y E;  5CTU A;  4EGK A;  4LWH A;  1XNQ I;  2YE5 A;  4N3O A;  3OTO I;  2JJC A;  2HHH I;  4XD8 A;  3K99 A;  4X66 E;  4K0K E;  3K1J A;  4ASF A;  5IN9 A;  2DEI A;  4GT8 A;  1NHJ A;  2BU6 A;  1PIE A;  3M6A A;  4GFN A;  4DXL A;  4NXN I;  3V2U C;  4BIU A;  1NZ0 A;  4YKR A;  4MP7 A;  4KQV A;  2AJ4 A;  1QY8 A;  3A0T A;  4L94 A;  4LF7 E;  3ZZT A;  1YC3 A;  5M4P A;  4GEE A;  4MBC A;  2GS8 A;  1ZXN A;  4JI4 E;  1H7S A;  4CWN A;  4USM A;  3R91 A;  3GIG A;  4DR5 E;  4DR6 I;  3WU3 A;  4DPY A;  4LWI A;  4K4O A;  5M4E A;  4XKO A;  4DZY A;  4AQY I;  4LF4 I;  2XCM A;  4CWP A;  3J7A M;  4JI8 I;  4M1K A;  1YER A;  3Q1Q A;  3HEK A;  2CZ9 A;  4GKJ I;  3ZKD A;  4JI5 I;  2F4V E;  1D6T A;  3HZ1 A;  3QDD A;  2YKI A;  2QF6 A;  1Z0V A;  3T1Y I;  4LF8 E;  2R3V A;  2HG1 A;  5D7R A;  4XKK A;  3C11 A;  2IOP A;  1TC6 A;  3J80 C;  2UUC I;  1OJ4 A;  5GME A;  2JKI A;  2V2Q A;  2O1T A;  1Y8P A;  3U67 A;  4P8O A;  2YE6 A;  4JI1 I;  2YKJ A;  4U7N A;  4JI5 E;  2F4V I;  3T1H I;  1UYM A;  3R4O A;  2AKP A;  3D4J A;  3EHH A;  2J7K A;  4HYP A;  4YKQ A;  2YJW A;  4YKU A;  2E1R A;  1USV A;  1YC4 A;  4CWS A;  2A2D A;  4JI8 E;  2YE7 A;  3T1K A;  2HFU A;  1KVK A;  4JI0 I;  1FWL A;  3INX A;  2GQP A;  4XIT A;  1FI4 A;  2UXD I;  5D6Q A;  4DR6 E;  2QFO A;  1I58 A;  5CTX A;  4FW9 A;  3HYZ A;  2E0A A;  3OMU A;  4MPN A;  2NPF A;  1UYC A;  1XMO I;  4NH8 A;  1BYQ A;  3C0E A;  4RPF A;  3IED A;  4JI1 E;  2ZM6 E;  3WU5 A;  4E01 A;  4DPW A;  2UUB E;  2BRE A;  5BOC A;  2UXD E;  4L90 A;  5GGZ A;  2XK2 A;  2XX4 A;  4B3S I;  2C2A A;  5D7C A;  3A0R A;  4B7P A;  3B78 A;  3QT7 A;  1UYD A;  4OX9 E;  2PNL A;  4KSG A;  3TUH A;  3PYG A;  1H72 C;  2BTZ A;  2HK2 A;  5F3K A;  4JI3 E;  1ZW9 A;  2Z5E A;  1BKN A;  1IBM I;  2XDU A;  3DGE A;  2HHH E;  1VIS A;  2ESA A;  5A2Q C;  1L0O A;  4ASA A;  3TTZ A;  4DUY I;  4DV4 E;  2YEJ A;  2ZDY A;  3EHF A;  4ZKI A;  4V26 A;  1N32 I;  4KFG A;  4O0B A;  3PYF A;  1Z0G A;  4KP4 A;  3CGY A;  4WUB A;  4B3R I;  3R92 A;  2VQE E;  5LMU I;  4YHH I;  5BR8 I;  4YY3 I;  1H74 A;  4PRV A;  4JI2 E;  4LF6 E;  4FCR A;  4LF5 E;  3B27 A;  3B82 A;  4OX9 I;  1ZM9 A;  2IWX A;  4Q20 A;  4AQY E;  5BOD A;  3K85 A;  5CTY A;  4LFA E;  3GIF A;  4LF4 E;  2YGF A;  4DR2 I;  2XHT A;  4MYT A;  4ASG A;  4NXM E;  2VQF E;  4IZJ A;  3O6O A;  1Y4S A;  4AWQ A;  4AWP A;  1USU A;  4I5S A;  2WER A;  2CGE A;  5BR8 E;  3VHC A;  4LPB A;  3ZKB A;  4JI2 I;  3CRK A;  3T2S A;  4JYA I;  4H85 A;  1UYL A;  4IZJ D;  2UUC E;  2ZBK B;  1MG7 A;  5IT9 C;  3J7A G;  3QT8 A;  1YT0 A;  1DAR A;  2YI6 A;  4YKY A;  1J5E I;  1N34 E;  5L3J A;  3V5R A;  2XHR A;  1UY9 A;  2BV3 A;  1THN A;  2YKB A;  5IDM A;  2UU9 I;  2CCS A;  1QZR A;  4IZJ B;  4URM A;  4LFC E;  2YEE A;  4MPE A;  4BXI A;  4EGI A;  1N36 I;  2CH4 A;  1Z0E A;  4X64 E;  4KHP E;  4JI0 E;  3EKR A;  5F5R A;  2VF3 A;  2WI4 A;  2YI0 A;  4KTN A;  4R3M A;  4DR3 E;  2VCI A;  4XTJ A;  2QG0 A;  4X65 I;  4GGL A;  4LFB I;  3B24 A;  2H8M A;  2CGF A;  1Z0T A;  3K97 A;  1ZM4 A;  4JV5 E;  3LPS A;  4HXW A;  4NH9 A;  2YEB A;  2XEX A;  1UYF A;  2YI5 A;  4URN A;  1I5B A;  2Z5B B;  2CCT A;  4YKZ A;  4B3S E;  4DR3 I;  4HY6 A;  4CWT A;  4NXN E;  3OWD A;  4QPJ A;  1XHK A;  4XIQ A;  2UUA E;  4HAC A;  5D6P A;  3LTO A;  3JAM Q;  1N36 E;  2BSM A;  3QT6 A;  4X64 I;  4B3T E;  1PVG A;  4DR4 E;  2YE3 A;  1IBM E;  1AJ6 A;  4JI4 I;  1YSR A;  4DPU A;  3HHU A;  4KSH A;  2VWC A;  3D36 A;  1EI1 A;  1H7U A;  4JQL A;  2V8P A;  1UYE A;  2XJJ A;  3Q5L A;  4FPP A;  4JI6 E;  3RLR A;  4JV5 I;  4JI7 I;  3D0B A;  4URL A;  4X9L A;  2VQE I;  1UY6 A;  4YHH E;  3EHJ A;  3OPD A;  4LF8 I;  2WI3 A;  4R1F A;  4EFU A;  3JZ3 A;  4V25 A;  1GKZ A;  1B62 A;  2XDX A;  3GIE A;  2WI7 A;  2WI5 A;  1Y6Z A;  3R4P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...