4P7AA

Crystal structure of human mlh1
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
334
structure length
303
Chain Sequence
FVAGVIRRLDETVVNRIAAGEVIQRPANAIKEMIENCLDAKSTSIQVIVKEGGLKLIQIQDNGTGIRKEDLDIVCERFTTSKLGFRGEALASISHVAHVTITTKTADGKCAYRASYSDGKLKAPPKPCAGNQGTQITVEDLFYNIATRRKALKNPSEEYGKILEVVGRYSVHNAGISFSVKKQGETVADVRTLPNASTVDNIRSIFGNAVSRELIEIGCEDKTLAFKMNGYISNANYSVKKCIFLLFINHRLVESTSLRKAIETVYAAYLPKNTHPFLYLSLEISPESILERVQQHIESKLLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA mismatch repair protein Mlh1
publication title Structure of the human MLH1 N-terminus: implications for predisposition to Lynch syndrome.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 88
structure length 303
sequence length 334
ec nomenclature
pdb deposition date 2014-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01119 DNA_mis_repair DNA mismatch repair protein, C-terminal domain
A PF13589 HATPase_c_3 Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4p7aA02
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 4p7aA01
5CTXA 3K60A 2O1UA 1FI4A 1EI1A 3T1YE 4LPBA 1A6FA 4X66I 4YHHI 4JI3I 4XIPA 2WI4A 4FMTA 4XITA 3CGZA 4YKTA 4JI1I 1YT0A 3T2SA 3U67A 4FCPA 4X66E 4JI3E 4YHHE 1TIDA 4JI8I 3O6OA 3TUHA 4U7OA 4JI1E 3CRLA 4CWTA 3K99A 4DPYA 3TZ5A 3A0XA 5M4NA 5LL6R 4B3MI 5CTWA 1Y8PA 4DV0I 4JI8E 4JI2I 3TZ2A 1Z0GA 3WU3A 2JKIA 4USMA 3WU5A 1OSFA 1ZM3A 4B3ME 2BTZA 2XD6A 3KE6A 4NH7A 1ZWHA 5IN9A 3R91A 4DV0E 4JI2E 1YC3A 3D2RA 3OPDA 3K1JA 2BV3A 5CF0A 4MOTA 4EFTA 3WU4A 3ZM7A 4HXZA 3GIGA 3T0ZA 3JAMQ 2CH4A 4RPFA 1BKNA 1UYHA 5D7RA 4CE2A 3C0EA 3K17A 1HNXI 2YE7A 4DXLA 3TTZA 3OWBA 3HULA 3LNUA 4Q20A 1KZNA 2IWSA 1KTVA 2XDKA 2XEXA 2YK2A 5GMEA 2XK2A 1XHKA 1HNXE 1UY9A 4H81A 1MX0A 1J5EI 1IBMI 5CPHA 5CTYA 3Q5LA 5FWKA 3BM9A 5F5RA 4CWRA 1IBME 1J5EE 3A0RA 4EFUA 3V2UC 3B24A 4X65I 4DR4I 3B27A 5FNDA 2K5BA 4R3MA 1UYDA 1YESA 4MPEA 1ZW9A 2XABA 4JG4A 1H7SA 4EMVA 2YEFA 2WI3A 4P8OA 4X65E 4DR4E 1N0VC 4JYAI 4FPPA 1YSZA 2YE2A 1FWLA 4YKXA 3M6AA 1I5DA 5M4PA 3VHAA 2ZKJA 1I94I 4MPNA 4JYAE 4NXNI 4DPWA 2BU8A 4B3TI 2CGFA 2YE5A 2UUBI 2YK9A 4MYUA 1I94E 1MG7A 4MPCA 4B3SI 4NXNE 4EMDA 1GJVA 4FWHA 3T1KA 2OI2A 4B3TE 1Z5CA 2UUBE 5IDMA 1N0UA 2BM1A 4PU9A 4B3SE 4E01A 4ASAA 4K0KI 3QT6A 2YEHA 4DV1I 2ZDXA 1Y4SA 3J80Q 4LF6E 3HZ5A 4UT4A 4K0KE 2HK3A 2ESAA 2GS8A 4DV1E 2UXCI 3R4OA 1KVKA 4HYMA 3DGEA 4K4OA 1DARA 3INXA 4ZVIA 4FCRA 2UXCE 3C11A 3J7AG 1XNQI 5BOCA 1AM1A 2YEGA 2YE4A 4JI6I 2HKJA 1A4HA 4XIRA 2HG1A 3B25A 4YKWA 2IWXA 1XNQE 2XX2A 4JI6E 4DR5I 4BIZA 4LF7I 3VHCA 3RLQA 4NXMI 2YKEA 4LWEA 4DR5E 4DR6E 2Q2EB 1ZXNA 4LF7E 1Z0WA 2HCHA 3J81Q 2YJWA 4NXME 1AMWA 2YI5A 4R1FA 3U2KA 2HKEA 3LTOA 4XE2A 3EKOA 2WI7A 2ZM6I 1NHJA 4KHPE 1FKAE 1S4EA 4CE3A 1FJGI 2ZM6E 4E02A 4L93A 2WW4A 3JAMC 4DUZI 3ZZTA 2YEAA 5GGZA 4WUDA 4O05A 3QDDA 4ASFA 1KIJA 5D7DA 1FJGE 1HNZI 4DUZE 3WQ9A 2XDXA 1EA6A 1YERA 2YEDA 1HNZE 3PYGA 1FWKA 2BZ5A 2GFDA 3FT5A 3K98A 4DPXA 5F3KA 4L8ZA 3Q5JA 4QPKA 2YGFA 2V34A 5D6PA 2Q8IA 1UYEA 1UY6A 3FT8A 1B63A 1D6TA 2IOQA 2XX4A 2VQEI 2BU6A 3BMYA 4GGLA 4YKYA 3ZXOA 1GKXA 2A2DA 3VHDA 4AWPA 4LFBI 4URLA 4CWQA 1PKPA 2VQEE 4PL9A 5LMUI 1PVGA 2VWCA 5A2QQ 4LFBE 4EEHA 2Q8FA 2V2ZA 4YKQA 4XIQA 3GIGB 5LMUE 1PIEA 2R3VA 4MP7A 4R3AA 3H4LA 4X62I 4KSGA 1Z59A 4HZ0A 2WERA 1ELOA 2UXDI 2C2AA 3PEHA 3B28A 4X62E 1RR9A 3R92A 3A0ZA 3PYDA 2UXDE 4GT8A 3TZ4A 5M4HA 1OJ4A 2XJGA 2WEQA 3OMUA 2VCJA 4FCQA 2IWUA 3J80C 4KFGA 4P52A 4ZKIA 4L91A 1AJ6A 5D7CA 1Z0EA 2UXBI 4EGKA 4JAUA 1B3QA 4XDMA 1YETA 3OW6A 2WEPA 2V2VA 3K97A 2IORA 1UYIA 2YKIA 4GEEA 4GKJI 2UXBE 3D36A 3IEDA 3O2FA 2YKCA 3A0TA 1N32I 3ZXQA 1YT2A 2XHTA 4XKKA 4GKJE 3H80A 2YE9A 4H7QA 4JQLA 4LWFA 1ZM9A 5BODA 4JI5I 1N32E 1Y8OA 2O1VA 4KQVA 1UEKA 4B6CA 4MP2A 1Z0VA 3Q5KA 2XCMA 2H55A 2EXLA 4JI5E 4DV2E 1TH8A 3A0YA 4BQGA 5M4EA 4DU8A 4HZ5A 3ZZ0A 1AH8A 4YKRA 3GIFA 3J81C 2YKBA 3QT8A 2V2QA 4LF6I 1B62A 4JI7I 1TILA 2XJXA 1UYFA 2WI6A 2F4VI 3HYYA 1IBLE 1TC6A 1QZRA 4HYPA 2BM0A 4DV5I 2BYHA 4JI7E 4CWFA 4NH8A 4CWSA 3PYFA 3RLRA 2UUCI 4CWNA 2F4VE 1BYQA 2VCIA 2BSMA 3PEJA 2BT0A 3RLPA 3U2DA 4DV5E 4XD8A 4LF5I 2UUCE 5IT9Q 1UY8A 1S16A 1YS3A 4H85A 4DV6I 4UTGA 4ED4A 4U7NA 4LF5E 1N34I 1MU5A 4DR1E 4LF4I 1S14A 4P7AA 2ZBKB 1XMOI 4DV6E 4DR6I 4JASA 4M1KA 1WUUA 4YY3I 1N34E 3T1HE 4LF4E 1R62A 3ZKDA 1XMOE 4ASGA 4OX9I 3NMQA 1ZM4A 4PRXA 4YY3E 2HFUA 3T0HA 4HACA 3D4JA 4KHPI 2YKJA 4OX9E 4JI0I 5A2QC 4LWGA 1NHIA 2YE6A 4JAVA 1I5CA 2YJXA 3R4MA 4AWQA 4W7TA 2DEIA 4BQJA 4JI0E 2XDLA 2QF6A 3B26A 1I5BA 5FNFA 3OWDA 4V26A 2UU9I 4X9LA 4B7PA 1YC1A 3HHUA 2YI0A 5L3JA 2FWYA 4I3HA 4URNA 1US7A 3J7AM 4U93A 5D6QA 4O09A 2UU9E 1QY8A 2X7IA 1Z0TA 4HY6A 2DEJA 3B78A 4DV4I 4LF9I 2YE8A 4DV4E 4LF9E 4GKKI 4XC0A 1NHHA 4MYTA 2VF3A 2XX5A 3OTOI 4DUHA 4CWPA 2WI5A 1ID0A 2A2CA 4I5SA 4GKKE 5FNCA 3A0WA 3OTOE 4B3RI 1AH6A 4XCLA 5FLXQ 4DR7E 1YSRA 2YE3A 4DPUA 2YI6A 5J71A 3CGYA 2ZDYA 4XKAA 1HR0I 3F0NA 4B3RE 4LFAI 2VW5A 2YEJA 3O0IA 2VQFI 2LJPA 2AJ4A 2FYPA 3SL2A 2NPFA 2UWDA 4WUCA 1Y8NA 1HR0E 4DPTA 4FWGA 4LFAE 3QT7A 2VQFE 4LFCI 1XMQI 2UUAI 3V5RA 3R4PA 2CG9A 1TBWA 4JI4I 4L94A 4QPJA 4CE1A 1I59A 4LFCE 1XMQE 3Q1QA 2UUAE 3WHAA 1UYCA 3B82A 3QT5A 1VISA 4JI4E 2J7KA 1ZM2A 1QYEA 4KSHA 4AS9A 4GQTA 2O1WA 2ZITA 3EHGA 2XHRA 1U0ZA 1NZ0A 4E00A 4DV7I 2HFSA 1H73A 1JM6A 1GKZA 2E5LI 5IT9C 4Z7YA 4AQYI 4DV7E 4BAEA 1I5AA 4EGIA 3G75A 2E5LE 1H74A 2XDUA 4DV2I 4AQYE 2IOPA 2YGAA 4Z7CA 5BR8I 2PNRA 1UY7A 3GONA 3VADA 5GMDA 2BRCA 2Q8GA 5BR8E 4DR2I 1TC0A 2BREA 4URMA 4V25A 4DV3I 4NH9A 2HHHI 1N33I 3EHJA 3TZ0A 1Z5BA 2CCSA 2YGEA 4LWHA 1KKHA 4DR2E 1IBLI 4FW9A 2QFOA 2Q8HA 4DV3E 2HHHE 1N33E 5M4KA 2YEIA 4FN5A 4DUYI 2FXSA 4O07A 3WU6A 3EHHA 4XKOA 2R42A 1YT1A 4HY1A 4WUBA 2YEBA 4DUYE 1H7UA 4L90A 4MB9A 4MBCA 1UYKA 4LP0A 2BU5A 3CRKA 3EHFA 3GIEA 2XJJA 1IBKI 1UYLA 3LPSA 4DR1I 2XDSA 4BIUA 4YKZA 1RREA 5M4MA 1U2OA 1Z0CA 2H8MA 2E0AA 4DU7A 3HYZA 1IBKE 3T1HI 3B8HA 4O0BA 4UROA 4XTJA 3HZ1A 2YI7A 1ZXMA 2E1RA 2HK2A 4USKA 2EFGA 4GCZA 2X36A 4YKUA 4LWIA 4HACB 1N36I 3R4NA 4CWOA 2WI2A 5FLXC 2CCTA 2JJCA 1Z0BA 1H72C 3HEKA 5C93A 1N36E 1THNA 2CCUA 4BXIA 5CTUA 3D0BA 1FNMA 4DZYA 3INWA 2BU2A 5J6AA 1K47A 1U2RA 4X64I 2YEEA 2FWZA 3PYEA 4KTNA 3EKRA 4EGHA 3RKZA 2BU7A 1Y4UA 4X64E 4LF8I 1L0OA 2WI1A 2XHXA 3ZZUA 3FV5A 4FWDA 3JZ3A 3MNRP 1HNWI 1UYGA 1XNRI 2QG0A 2V8PA 2QG2A 4DR3I 4LF8E 3T10A 1HNWE 1XNRE 5IWAI 1I58A 4KP4A 1Z5AA 4AWOA 3ZKBA 2CZ9A 5IDJA 4DR3E 3CWVA 4PRVA 1UYMA 4HXWA 4JV5I 2AKPA 4XCJA 5LMNI 5IWAE 4GFNA 2YECA 1BGQA 2GQPA 4DR7I 1BXDA 4JV5E 3G7EA 3G7BA 5LMNE 4EM7A 4ASBA 2BYIA 3QTFA 3T1YI 4O04A 1YC4A
chains in the Genus database with same CATH superfamily
5CTXA 3K60A 2O1UA 1FI4A 1EI1A 3P3EA 3T1YE 4LPBA 1A6FA 4X66I 4YHHI 4JI3I 4XIPA 2WI4A 4FMTA 4XITA 3CGZA 4FW4A 4JI1I 4YKTA 1YT0A 3T2SA 3U67A 4FCPA 4X66E 4JI3E 4YHHE 1TIDA 4JI8I 4FW7A 3O6OA 3TUHA 4U7OA 4JI1E 3CRLA 4CWTA 3K99A 4DPYA 3TZ5A 3A0XA 5M4NA 5LL6R 4B3MI 5CTWA 1Y8PA 2CVEA 4DV0I 4JI8E 2NN6E 4JI2I 3TZ2A 1Z0GA 3WU3A 2JKIA 4USMA 2GO3A 3WU5A 1ZM3A 4B3ME 1OSFA 2BTZA 2XD6A 3KE6A 1ZWHA 4NH7A 3R91A 4DV0E 4JI2E 1YC3A 3D2RA 3OPDA 3K1JA 2BV3A 5CF0A 4MOTA 4EFTA 4FW3A 3WU4A 4LPFA 2J65A 3PS1A 3ZM7A 4HXZA 3GIGA 3T0ZA 4BA1A 4OO1F 3JAMQ 2CH4A 4RPFA 1BKNA 1UYHA 4ISAA 4BA2A 5D7RA 3C0EA 3K17A 4CE2A 1HNXI 3P06A 4DXLA 1E3HA 2C39A 2YE7A 3HULA 3LNUA 3OWBA 3M85G 1KZNA 1KTVA 2IWSA 2XDKA 2XEXA 2AE8A 2YK2A 3PS3A 5GMEA 2BA0G 4NBQA 1XHKA 1HNXE 1UY9A 1MX0A 1J5EI 1IBMI 2XK2A 4H81A 5FWKA 3Q5LA 4AIMA 2WP8A 4FW5A 5CTYA 3BM9A 3L7ZB 5C0XE 2WNRB 5F5RA 4CWRA 4MU1A 4MU4A 1J5EE 1IBME 3A0RA 4EFUA 3V2UC 3B24A 4X65I 4DR4I 3B27A 4OZEA 5FNDA 2K5BA 4R3MA 1UYDA 1YESA 4MPEA 1ZW9A 2XABA 4JG4A 1H7SA 2GQ0A 2C37A 2YEFA 4EMVA 2WI3A 4P8OA 4X65E 4DR4E 3CDIA 1N0VC 4JYAI 4FPPA 1Y6ZA 2PO2A 5DRRA 5EL9A 1YSZA 1FWLA 2YE2A 4U3BA 3M6AA 1I5DA 4YKXA 5M4PA 3VHAA 1UDQA 2ZKJA 1I94I 4MPNA 4JYAE 5C0XA 4NXNI 4DPWA 2BU8A 2PO1B 4B3TI 2CGFA 2YE5A 2UUBI 2YK9A 4MYUA 1I94E 1MG7A 4MPCA 4B3SI 1P42A 4EMDA 4NXNE 1GJVA 3DD6A 4FWHA 3T1KA 2OI2A 4B3TE 1Z5CA 2UUBE 2BR2A 5IDMA 1N0UA 2BM1A 4PU9A 2PO0B 4B3SE 3HJCA 2C38B 5DNXA 4E01A 4ASAA 4K0KI 3QT6A 2YEHA 4DV1I 2ZDXA 1Y4SA 3J80Q 4LF6E 3HZ5A 4UT4A 4OO1C 4K0KE 2HK3A 4OO1D 2ESAA 2GS8A 4DV1E 2UXCI 3R4OA 1KVKA 4HYMA 3DGEA 4K4OA 1DARA 3CDJA 3INXA 4ZVIA 2Z5CA 4FCRA 2UXCE 3C11A 3J7AG 1XNQI 5BOCA 1AM1A 2YEGA 2YE4A 4JI6I 2HKJA 1A4HA 4XIRA 2HG1A 3B25A 5CPHA 4YKWA 2IWXA 1XNQE 2XX2A 4JI6E 4DR5I 1R6LA 4BIZA 4LF7I 3VHCA 3RLQA 4NXMI 2YKEA 2FTKA 4LWEA 4DR5E 4DR6E 2Q2EB 1ZXNA 4LF7E 1Z0WA 2HCHA 3J81Q 2YJWA 4NXME 1AMWA 2YI5A 4R1FA 3U2KA 2HKEA 4LCHA 3LTOA 4XE2A 3EKOA 2WI7A 4IFDA 3M85D 2ZM6I 1NHJA 5C0XF 4KHPE 1IXMA 2BA0D 2C1GA 1FKAE 3M7ND 1S4EA 3UHMA 1FJGI 4CE3A 2ZM6E 4E02A 4L93A 2WW4A 3JAMC 4DUZI 3ZZTA 2YEAA 5GGZA 2Z5EA 4GQUA 4WUDA 4O05A 3QDDA 4ASFA 1KIJA 5D7DA 1FJGE 1HNZI 4DUZE 3WQ9A 5ELWA 2XDXA 1EA6A 1YERA 3CYGA 2YEDA 1HNZE 1Y60A 3PYGA 1FWKA 2BZ5A 1Y5YA 2GFDA 3FT5A 3K98A 4DPXA 5F3KA 2C1IA 4L8ZA 3Q5JA 4QPKA 2YGFA 2V34A 5D6PA 2Q8IA 1UYEA 1UY6A 3FT8A 2JE6A 1B63A 1D6TA 2IOQA 2XX4A 2VQEI 2BU6A 3BMYA 4GGLA 4YKYA 3ZXOA 1GKXA 2A2DA 1VI7A 3VHDA 4AWPA 2PNLA 4URLA 4LFBI 4CWQA 1PKPA 2VQEE 4PL9A 5LMUI 1PVGA 2VWCA 5A2QQ 4LFBE 4EEHA 2Q8FA 2V2ZA 4YKQA 4XIQA 3GIGB 5LMUE 1PIEA 2R3VA 4BA1B 4MP7A 5JENA 4R3AA 3H4LA 4X62I 4KSGA 1Z59A 4HZ0A 2WERA 1ELOA 2UXDI 4LCFA 2JT2A 2C2AA 4BA2B 3B28A 3PEHA 2NN6A 4X62E 1RR9A 2C39B 3R92A 3A0ZA 3PYDA 2UXDE 4GT8A 3TZ4A 5M4HA 1OJ4A 1OYSA 1XXEA 2XJGA 4IFDF 2WEQA 3OMUA 4MDTA 2VCJA 4FCQA 5C0XD 2IWUA 2WP8B 3J80C 4KFGA 4P52A 4ZKIA 1UDNA 4L91A 1AJ6A 5JEAE 5D7CA 1Z0EA 2UXBI 4EGKA 4JAUA 1RHYA 1B3QA 1YETA 4XDMA 3OW6A 2WEPA 2V2VA 3K97A 2JEAA 2IORA 1UYIA 2C37B 2YKIA 4OKGA 4GEEA 4GKJI 3PS2A 2UXBE 3D36A 3IEDA 3O2FA 2YKCA 3A0TA 4FW6A 1N32I 2PO2B 1YT2A 3ZXQA 2XHTA 4XKKA 4GKJE 3H80A 2YE9A 4H7QA 4JQLA 4LWFA 1ZM9A 5BODA 3GMEA 5C0XB 4JI5I 1N32E 1Y8OA 2O1VA 4KQVA 1UEKA 4LOMA 3HKMA 5JEAA 4MP2A 4B6CA 1Z0VA 3Q5KA 2XCMA 2H55A 2EXLA 4JI5E 4DV2E 1TH8A 3A0YA 4BQGA 5M4EA 4DU8A 4HZ5A 3ZZ0A 1AH8A 2BR2B 4YKRA 3GIFA 3GCMA 3J81C 3QT8A 2YKBA 2V2QA 2Z5BA 4LF6I 1B62A 4JI7I 1TILA 2XJXA 4IZJA 1UYFA 1OYRA 2WI6A 2F4VI 3HYYA 1IBLE 5K36E 1TC6A 1QZRA 3P76A 2HHIA 4HYPA 2BM0A 4DV5I 2BYHA 4JI7E 4CWFA 4NH8A 4CWSA 4IZKA 2NN6F 2PNZA 3PYFA 2UUCI 2F4VE 2Z5CB 1BYQA 2BSMA 2VCIA 2BT0A 3PEJA 3RLPA 3U2DA 4E72A 4DV5E 4XD8A 4IFDC 3U1YA 4LF5I 2UUCE 4IFDD 5IT9Q 1UY8A 3H1CA 1S16A 1YS3A 4H85A 4DV6I 4UTGA 4ED4A 4U7NA 4LF5E 1N34I 5K36A 1MU5A 4DR1E 4LF4I 1S14A 4P7AA 2ZBKB 1XMOI 4DV6E 4DR6I 4JASA 4M1KA 1WUUA 4YY3I 2BA1G 2PNMA 1N34E 3T1HE 4LF4E 1R62A 3ZKDA 1XMOE 4ASGA 4OX9I 1YHCA 3NMQA 1ZM4A 4PRXA 4YY3E 2HFUA 3T0HA 4HACA 3D4JA 4KHPI 4OO1E 2YKJA 4IFDB 4OX9E 4JI0I 5A2QC 4LWGA 1NHIA 2YE6A 4JAVA 5JEAF 1I5CA 2YJXA 3R4MA 4AWQA 4W7TA 2DEIA 4BQJA 4JI0E 2XDLA 2QF6A 3B26A 3PRYA 1I5BA 5FNFA 3OWDA 4N3OA 4V26A 2UU9I 4X9LA 4B7PA 3Q6MA 1YC1A 3HHUA 2YI0A 5L3JA 2FWYA 4I3HA 3GLLA 1US7A 3J7AM 4U93A 5D6QA 4URNA 4O09A 2UU9E 1R6MA 1QY8A 4OO1A 2X7IA 1Z0TA 4HY6A 2DEJA 3B78A 4DV4I 4LF9I 3TTZA 4AIDA 1OYPA 2YE8A 2NN6C 4DV4E 2JE6B 4LF9E 4GKKI 1NHHA 3P3CA 2NN6D 4MYTA 2VF3A 4XC0A 2XX5A 3OTOI 5IN9A 4DUHA 4CWPA 2WI5A 1ID0A 2A2CA 4I5SA 4GKKE 4MU0A 5FNCA 3A0WA 3OTOE 4B3RI 1AH6A 2JEBA 4XCLA 5FLXQ 4DR7E 1YSRA 2YE3A 4DPUA 2YI6A 5J71A 5DNLA 3CGYA 2ZDYA 4XKAA 1HR0I 4Q20A 3F0NA 5K36F 4B3RE 4LFAI 2VW5A 2YEJA 3O0IA 2VQFI 2LJPA 2AJ4A 2FYPA 3SL2A 2NPFA 2UWDA 4WUCA 1Y8NA 1HR0E 2VESA 4DPTA 4FWGA 4LFAE 3QT7A 2VQFE 2NN6B 4LFCI 1XMQI 2UUAI 3V5RA 3R4PA 2CG9A 1TBWA 4JI4I 4L94A 4QPJA 4CE1A 1I59A 4LFCE 1XMQE 3Q1QA 2UUAE 3WHAA 2CGEA 5JEAC 3B82A 3QT5A 5C0XC 1F51A 1UYCA 5JEAD 1VISA 4JI4E 2J7KA 1ZM2A 1USUA 1QYEA 4KSHA 4AS9A 4GQTA 2O1WA 2ZITA 3EHGA 2XHRA 1U0ZA 2JEAB 3MNRP 1NZ0A 2O3ZA 3U1KA 4E00A 3B4TA 4DV7I 2BA1D 4QNKA 2HFSA 1H73A 1UDSA 1JM6A 2E5LI 1GKZA 4IZJD 5IT9C 4Z7YA 3LMMA 4AQYI 4DV7E 4BAEA 1I5AA 4EGIA 3G75A 2E5LE 1H74A 2IERA 5JEAB 2XDUA 4DV2I 4AQYE 4AM3A 2IOPA 2YGAA 3M7NG 4Z7CA 5BR8I 2PNRA 1UY7A 4QNJA 3GONA 3VADA 5GMDA 2BRCA 2Q8GA 5BR8E 4DR2I 1TC0A 2BREA 2Z5BB 3L7ZA 4URMA 2WNRA 4V25A 4DV3I 4NH9A 2HHHI 1N33I 3EHJA 3TZ0A 1Z5BA 5K36C 2CCSA 2YGEA 1KKHA 4LWHA 5K36D 4IZJB 4DR2E 1IBLI 4FW9A 5DROA 2QFOA 2Q8HA 4DV3E 3RLRA 5DRQA 2HHHE 1HK7A 1N33E 5M4KA 2YEIA 4FN5A 2O1TA 4DUYI 2FXSA 4O07A 4IZKB 3WU6A 3EHHA 2PNZB 4XKOA 2R42A 1YT1A 3P3GA 4HY1A 1E3PA 4WUBA 2YEBA 4DUYE 1H7UA 4L90A 4MB9A 4LCGA 4MBCA 1UYKA 2PO1A 4LP0A 2BU5A 1UDOA 4IS9A 3CRKA 3EHFA 3GIEA 2XJJA 1IBKI 1UYLA 3LPSA 4DR1I 2XDSA 4BIUA 4YKZA 1RREA 4MQYA 5K36B 1U2OA 1Z0CA 5M4MA 2H8MA 2E0AA 4DU7A 2PO0A 1IBKE 3T1HI 3B8HA 3HYZA 4O0BA 4UROA 2C38A 3NZKA 4XTJA 3HZ1A 2YI7A 1ZXMA 2GO4A 3S5TA 2E1RA 2HK2A 4USKA 2EFGA 4GCZA 2X36A 4YKUA 4LWIA 4HACB 1N36I 3R4NA 4CWOA 2WI2A 5FLXC 2CCTA 2JJCA 3Q6NA 1Z0BA 1H72C 3HEKA 5C93A 1N36E 1THNA 2CCUA 4BXIA 5CTUA 3D0BA 1FNMA 4DZYA 3INWA 2BU2A 5J6AA 1K47A 4U3DA 1U2RA 4X64I 4IFDE 2YEEA 4MU3A 2FWZA 3PYEA 5EKWA 4KTNA 3EKRA 4EGHA 3RKZA 2BU7A 1Y4UA 2F1DA 4X64E 4LF8I 1L0OA 2WI1A 4OO1B 3ZZUA 2XHXA 4FWDA 2IESA 3FV5A 3JZ3A 1HNWI 1UYGA 1XNRI 2QG0A 1YH8A 2V8PA 2QG2A 4DR3I 4LF8E 3T10A 1HNWE 4J3DA 1XNRE 5IWAI 1I58A 1USVA 1Z5AA 4KP4A 3ZKBA 2CZ9A 4AWOA 5IDJA 4DR3E 3CWVA 4PRVA 1UYMA 4HXWA 4JV5I 2AKPA 4XCJA 5LMNI 5IWAE 4GFNA 2YECA 1BGQA 4CWNA 2GQPA 4DR7I 3K85A 1BXDA 2JEBB 4JV5E 3G7EA 3G7BA 5LMNE 4EM7A 5DRPA 4ASBA 2BYIA 3QTFA 3T1YI 4O04A 3KRNA 1YC4A
chains in the Genus database with same CATH topology
5CTXA 3K60A 2O1UA 1FI4A 1EI1A 3T1YE 4LPBA 1A6FA 4X66I 4YHHI 4JI3I 4XIPA 2WI4A 4FMTA 4XITA 3CGZA 4YKTA 4JI1I 1YT0A 3T2SA 3U67A 4FCPA 4X66E 4JI3E 4YHHE 1TIDA 4JI8I 3O6OA 3TUHA 4U7OA 4JI1E 3CRLA 4CWTA 3K99A 4DPYA 3TZ5A 3A0XA 5M4NA 5LL6R 4B3MI 5CTWA 1Y8PA 4DV0I 4JI8E 4JI2I 3TZ2A 1Z0GA 3WU3A 2JKIA 4USMA 3WU5A 1OSFA 1ZM3A 4B3ME 2BTZA 2XD6A 3KE6A 4NH7A 1ZWHA 5IN9A 3R91A 4DV0E 4JI2E 1YC3A 3D2RA 3OPDA 3K1JA 2BV3A 5CF0A 4MOTA 4EFTA 3WU4A 3ZM7A 4HXZA 3GIGA 3T0ZA 3JAMQ 2CH4A 4RPFA 1BKNA 1UYHA 5D7RA 4CE2A 3C0EA 3K17A 1HNXI 3P06A 4DXLA 2YE7A 3OWBA 3TTZA 3HULA 3LNUA 4Q20A 1KZNA 2IWSA 1KTVA 2XDKA 2XEXA 2YK2A 5GMEA 2XK2A 1XHKA 1HNXE 1UY9A 4H81A 1MX0A 1J5EI 1IBMI 5CPHA 5CTYA 5FWKA 3Q5LA 3BM9A 5F5RA 4CWRA 1IBME 1J5EE 3A0RA 4EFUA 3V2UC 3B24A 4X65I 4DR4I 3B27A 5FNDA 2K5BA 4R3MA 1UYDA 1YESA 4MPEA 1ZW9A 2XABA 4JG4A 1H7SA 2GQ0A 4EMVA 2YEFA 2WI3A 4P8OA 4X65E 4DR4E 1N0VC 4JYAI 4FPPA 1Y6ZA 1YSZA 2YE2A 1FWLA 4YKXA 3M6AA 1I5DA 5M4PA 3VHAA 2ZKJA 1I94I 4MPNA 4JYAE 4NXNI 4DPWA 2BU8A 4B3TI 2CGFA 2YE5A 2UUBI 2YK9A 4MYUA 1I94E 1MG7A 4MPCA 4B3SI 4NXNE 4EMDA 1GJVA 4FWHA 3T1KA 2OI2A 4B3TE 1Z5CA 2UUBE 5IDMA 1N0UA 2BM1A 4PU9A 4B3SE 3HJCA 4E01A 4ASAA 4K0KI 3QT6A 2YEHA 4DV1I 2ZDXA 1Y4SA 3J80Q 4LF6E 3HZ5A 4UT4A 4K0KE 2HK3A 2ESAA 2GS8A 4DV1E 2UXCI 3R4OA 1KVKA 4HYMA 3DGEA 4K4OA 1DARA 3INXA 4ZVIA 2Z5CA 4FCRA 2UXCE 3C11A 3J7AG 1XNQI 5BOCA 1AM1A 2YEGA 2YE4A 4JI6I 2HKJA 1A4HA 4XIRA 2HG1A 3B25A 4YKWA 2IWXA 1XNQE 2XX2A 4JI6E 4DR5I 4BIZA 4LF7I 3VHCA 3RLQA 4NXMI 2YKEA 4LWEA 4DR5E 4DR6E 2Q2EB 1ZXNA 4LF7E 1Z0WA 2HCHA 3J81Q 2YJWA 4NXME 1AMWA 2YI5A 4R1FA 3U2KA 2HKEA 3LTOA 4XE2A 3EKOA 2WI7A 2ZM6I 1NHJA 4KHPE 1FKAE 1S4EA 4CE3A 1FJGI 2ZM6E 4E02A 4L93A 2WW4A 3JAMC 4DUZI 3ZZTA 2YEAA 5GGZA 2Z5EA 4WUDA 4O05A 3QDDA 4ASFA 1KIJA 5D7DA 1FJGE 1HNZI 4DUZE 3WQ9A 2XDXA 1EA6A 1YERA 2YEDA 1HNZE 3PYGA 1FWKA 2BZ5A 2GFDA 3FT5A 3K98A 4DPXA 5F3KA 4L8ZA 3Q5JA 4QPKA 2YGFA 2V34A 5D6PA 2Q8IA 1UYEA 1UY6A 3FT8A 1B63A 1D6TA 2IOQA 2XX4A 2VQEI 2BU6A 3BMYA 4GGLA 4YKYA 3ZXOA 1GKXA 2A2DA 3VHDA 4AWPA 2PNLA 4URLA 4LFBI 4CWQA 1PKPA 2VQEE 4PL9A 5LMUI 1PVGA 2VWCA 5A2QQ 4LFBE 4EEHA 2Q8FA 2V2ZA 4YKQA 4XIQA 3GIGB 5LMUE 1PIEA 2R3VA 4MP7A 4R3AA 3H4LA 4X62I 4KSGA 1Z59A 4HZ0A 2WERA 1ELOA 2UXDI 2C2AA 3PEHA 3B28A 4X62E 1RR9A 3R92A 3A0ZA 3PYDA 2UXDE 4GT8A 3TZ4A 5M4HA 1OJ4A 2XJGA 2WEQA 3OMUA 2VCJA 4FCQA 2IWUA 3J80C 4KFGA 4P52A 4ZKIA 4L91A 1AJ6A 5D7CA 1Z0EA 2UXBI 4EGKA 4JAUA 1B3QA 4XDMA 1YETA 3OW6A 2WEPA 2V2VA 3K97A 2IORA 1UYIA 2YKIA 4GEEA 4GKJI 2UXBE 3D36A 3IEDA 3O2FA 2YKCA 3A0TA 1N32I 3ZXQA 1YT2A 2XHTA 4XKKA 4GKJE 3H80A 2YE9A 4H7QA 4JQLA 4LWFA 1ZM9A 5BODA 4JI5I 1N32E 1Y8OA 2O1VA 4KQVA 1UEKA 4B6CA 4MP2A 1Z0VA 3Q5KA 2XCMA 2H55A 2EXLA 4JI5E 4DV2E 1TH8A 3A0YA 4BQGA 5M4EA 4DU8A 4HZ5A 3ZZ0A 1AH8A 4YKRA 3GIFA 3J81C 2YKBA 3QT8A 2V2QA 2Z5BA 4LF6I 1B62A 4JI7I 1TILA 2XJXA 4IZJA 1UYFA 2WI6A 2F4VI 3HYYA 1IBLE 1TC6A 1QZRA 4HYPA 2BM0A 4DV5I 2BYHA 4JI7E 4CWFA 4NH8A 4CWSA 4IZKA 3PYFA 3RLRA 2UUCI 4CWNA 2F4VE 2Z5CB 1BYQA 2BSMA 2VCIA 2BT0A 3PEJA 3RLPA 3U2DA 4DV5E 4XD8A 4LF5I 2UUCE 5IT9Q 1UY8A 1S16A 1YS3A 4H85A 4DV6I 4UTGA 4ED4A 4U7NA 4LF5E 1N34I 1MU5A 4DR1E 4LF4I 1S14A 4P7AA 2ZBKB 1XMOI 4DV6E 4DR6I 4JASA 4M1KA 1WUUA 4YY3I 2PNMA 1N34E 3T1HE 4LF4E 1R62A 3ZKDA 1XMOE 4ASGA 4OX9I 3NMQA 1ZM4A 4PRXA 4YY3E 2HFUA 3T0HA 4HACA 3D4JA 4KHPI 2YKJA 4OX9E 4JI0I 5A2QC 4LWGA 1NHIA 2YE6A 4JAVA 1I5CA 2YJXA 3R4MA 4AWQA 4W7TA 2DEIA 4BQJA 4JI0E 2XDLA 2QF6A 3B26A 3PRYA 1I5BA 5FNFA 3OWDA 4N3OA 4V26A 2UU9I 4X9LA 4B7PA 3Q6MA 1YC1A 3HHUA 2YI0A 5L3JA 2FWYA 4I3HA 4URNA 1US7A 3J7AM 4U93A 5D6QA 4O09A 2UU9E 1QY8A 2X7IA 1Z0TA 4HY6A 2DEJA 3B78A 4DV4I 4LF9I 2YE8A 4DV4E 4LF9E 4GKKI 4XC0A 1NHHA 4MYTA 2VF3A 2XX5A 3OTOI 4DUHA 4CWPA 2WI5A 1ID0A 2A2CA 4I5SA 4GKKE 5FNCA 3A0WA 3OTOE 4B3RI 1AH6A 4XCLA 5FLXQ 4DR7E 1YSRA 2YE3A 4DPUA 2YI6A 5J71A 3CGYA 2ZDYA 4XKAA 1HR0I 3F0NA 4B3RE 4LFAI 2VW5A 2YEJA 3O0IA 2VQFI 2LJPA 2AJ4A 2FYPA 3SL2A 2NPFA 2UWDA 4WUCA 1Y8NA 1HR0E 4DPTA 4FWGA 4LFAE 3QT7A 2VQFE 4LFCI 1XMQI 2UUAI 3V5RA 3R4PA 2CG9A 1TBWA 4JI4I 4L94A 4QPJA 4CE1A 1I59A 4LFCE 1XMQE 3Q1QA 2UUAE 3WHAA 2CGEA 1UYCA 3B82A 3QT5A 1VISA 4JI4E 2J7KA 1ZM2A 1USUA 1QYEA 4KSHA 4AS9A 4GQTA 2O1WA 2ZITA 3EHGA 2XHRA 1U0ZA 1NZ0A 4E00A 4DV7I 2HFSA 1H73A 1JM6A 1GKZA 2E5LI 4IZJD 5IT9C 4Z7YA 4AQYI 4DV7E 4BAEA 1I5AA 4EGIA 3G75A 2E5LE 1H74A 2XDUA 4DV2I 4AQYE 2IOPA 2YGAA 4Z7CA 5BR8I 2PNRA 1UY7A 3GONA 3VADA 5GMDA 2BRCA 2Q8GA 5BR8E 4DR2I 1TC0A 2BREA 2Z5BB 4URMA 4V25A 4DV3I 4NH9A 2HHHI 1N33I 3EHJA 3TZ0A 1Z5BA 2CCSA 2YGEA 4LWHA 1KKHA 4IZJB 4DR2E 1IBLI 4FW9A 2QFOA 2Q8HA 4DV3E 2HHHE 1HK7A 1N33E 5M4KA 2YEIA 4FN5A 2O1TA 4DUYI 2FXSA 4O07A 4IZKB 3WU6A 3EHHA 4XKOA 2R42A 1YT1A 4HY1A 4WUBA 2YEBA 4DUYE 1H7UA 4L90A 4MB9A 4MBCA 1UYKA 4LP0A 2BU5A 3CRKA 3EHFA 3GIEA 2XJJA 1IBKI 1UYLA 3LPSA 4DR1I 2XDSA 4BIUA 4YKZA 1RREA 5M4MA 1U2OA 1Z0CA 2H8MA 2E0AA 4DU7A 3HYZA 1IBKE 3T1HI 3B8HA 4O0BA 4UROA 4XTJA 3HZ1A 2YI7A 1ZXMA 2E1RA 2HK2A 4USKA 2EFGA 4GCZA 2X36A 4YKUA 4LWIA 4HACB 1N36I 3R4NA 4CWOA 2WI2A 5FLXC 2CCTA 2JJCA 3Q6NA 1Z0BA 1H72C 3HEKA 5C93A 1N36E 1THNA 2CCUA 4BXIA 5CTUA 3D0BA 1FNMA 4DZYA 3INWA 2BU2A 5J6AA 1K47A 1U2RA 4X64I 2YEEA 2FWZA 3PYEA 4KTNA 3EKRA 4EGHA 3RKZA 2BU7A 1Y4UA 4X64E 4LF8I 1L0OA 2WI1A 2XHXA 3ZZUA 3FV5A 4FWDA 3JZ3A 3MNRP 1HNWI 1UYGA 1XNRI 2QG0A 2V8PA 2QG2A 4DR3I 4LF8E 3T10A 1HNWE 1XNRE 5IWAI 1I58A 1USVA 1Z5AA 4KP4A 3ZKBA 2CZ9A 4AWOA 5IDJA 4DR3E 3CWVA 4PRVA 1UYMA 4HXWA 4JV5I 2AKPA 4XCJA 5LMNI 5IWAE 4GFNA 2YECA 1BGQA 2GQPA 4DR7I 3K85A 1BXDA 4JV5E 3G7EA 3G7BA 5LMNE 4EM7A 4ASBA 2BYIA 3QTFA 3T1YI 4O04A 1YC4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CTX A;  3K60 A;  2O1U A;  1FI4 A;  1EI1 A;  3T1Y E;  4LPB A;  1A6F A;  4X66 I;  4YHH I;  4JI3 I;  4XIP A;  2WI4 A;  4FMT A;  4XIT A;  3CGZ A;  4YKT A;  4JI1 I;  1YT0 A;  3T2S A;  3U67 A;  4FCP A;  4X66 E;  4JI3 E;  4YHH E;  1TID A;  4JI8 I;  3O6O A;  3TUH A;  4U7O A;  4JI1 E;  3CRL A;  4CWT A;  3K99 A;  4DPY A;  3TZ5 A;  3A0X A;  5M4N A;  5LL6 R;  4B3M I;  5CTW A;  1Y8P A;  4DV0 I;  4JI8 E;  4JI2 I;  3TZ2 A;  1Z0G A;  3WU3 A;  2JKI A;  4USM A;  3WU5 A;  1OSF A;  1ZM3 A;  4B3M E;  2BTZ A;  2XD6 A;  3KE6 A;  4NH7 A;  1ZWH A;  5IN9 A;  3R91 A;  4DV0 E;  4JI2 E;  1YC3 A;  3D2R A;  3OPD A;  3K1J A;  2BV3 A;  5CF0 A;  4MOT A;  4EFT A;  3WU4 A;  3ZM7 A;  4HXZ A;  3GIG A;  3T0Z A;  3JAM Q;  2CH4 A;  4RPF A;  1BKN A;  1UYH A;  5D7R A;  4CE2 A;  3C0E A;  3K17 A;  1HNX I;  2YE7 A;  4DXL A;  3TTZ A;  3OWB A;  3HUL A;  3LNU A;  4Q20 A;  1KZN A;  2IWS A;  1KTV A;  2XDK A;  2XEX A;  2YK2 A;  5GME A;  2XK2 A;  1XHK A;  1HNX E;  1UY9 A;  4H81 A;  1MX0 A;  1J5E I;  1IBM I;  5CPH A;  5CTY A;  3Q5L A;  5FWK A;  3BM9 A;  5F5R A;  4CWR A;  1IBM E;  1J5E E;  3A0R A;  4EFU A;  3V2U C;  3B24 A;  4X65 I;  4DR4 I;  3B27 A;  5FND A;  2K5B A;  4R3M A;  1UYD A;  1YES A;  4MPE A;  1ZW9 A;  2XAB A;  4JG4 A;  1H7S A;  4EMV A;  2YEF A;  2WI3 A;  4P8O A;  4X65 E;  4DR4 E;  1N0V C;  4JYA I;  4FPP A;  1YSZ A;  2YE2 A;  1FWL A;  4YKX A;  3M6A A;  1I5D A;  5M4P A;  3VHA A;  2ZKJ A;  1I94 I;  4MPN A;  4JYA E;  4NXN I;  4DPW A;  2BU8 A;  4B3T I;  2CGF A;  2YE5 A;  2UUB I;  2YK9 A;  4MYU A;  1I94 E;  1MG7 A;  4MPC A;  4B3S I;  4NXN E;  4EMD A;  1GJV A;  4FWH A;  3T1K A;  2OI2 A;  4B3T E;  1Z5C A;  2UUB E;  5IDM A;  1N0U A;  2BM1 A;  4PU9 A;  4B3S E;  4E01 A;  4ASA A;  4K0K I;  3QT6 A;  2YEH A;  4DV1 I;  2ZDX A;  1Y4S A;  3J80 Q;  4LF6 E;  3HZ5 A;  4UT4 A;  4K0K E;  2HK3 A;  2ESA A;  2GS8 A;  4DV1 E;  2UXC I;  3R4O A;  1KVK A;  4HYM A;  3DGE A;  4K4O A;  1DAR A;  3INX A;  4ZVI A;  4FCR A;  2UXC E;  3C11 A;  3J7A G;  1XNQ I;  5BOC A;  1AM1 A;  2YEG A;  2YE4 A;  4JI6 I;  2HKJ A;  1A4H A;  4XIR A;  2HG1 A;  3B25 A;  4YKW A;  2IWX A;  1XNQ E;  2XX2 A;  4JI6 E;  4DR5 I;  4BIZ A;  4LF7 I;  3VHC A;  3RLQ A;  4NXM I;  2YKE A;  4LWE A;  4DR5 E;  4DR6 E;  2Q2E B;  1ZXN A;  4LF7 E;  1Z0W A;  2HCH A;  3J81 Q;  2YJW A;  4NXM E;  1AMW A;  2YI5 A;  4R1F A;  3U2K A;  2HKE A;  3LTO A;  4XE2 A;  3EKO A;  2WI7 A;  2ZM6 I;  1NHJ A;  4KHP E;  1FKA E;  1S4E A;  4CE3 A;  1FJG I;  2ZM6 E;  4E02 A;  4L93 A;  2WW4 A;  3JAM C;  4DUZ I;  3ZZT A;  2YEA A;  5GGZ A;  4WUD A;  4O05 A;  3QDD A;  4ASF A;  1KIJ A;  5D7D A;  1FJG E;  1HNZ I;  4DUZ E;  3WQ9 A;  2XDX A;  1EA6 A;  1YER A;  2YED A;  1HNZ E;  3PYG A;  1FWK A;  2BZ5 A;  2GFD A;  3FT5 A;  3K98 A;  4DPX A;  5F3K A;  4L8Z A;  3Q5J A;  4QPK A;  2YGF A;  2V34 A;  5D6P A;  2Q8I A;  1UYE A;  1UY6 A;  3FT8 A;  1B63 A;  1D6T A;  2IOQ A;  2XX4 A;  2VQE I;  2BU6 A;  3BMY A;  4GGL A;  4YKY A;  3ZXO A;  1GKX A;  2A2D A;  3VHD A;  4AWP A;  4LFB I;  4URL A;  4CWQ A;  1PKP A;  2VQE E;  4PL9 A;  5LMU I;  1PVG A;  2VWC A;  5A2Q Q;  4LFB E;  4EEH A;  2Q8F A;  2V2Z A;  4YKQ A;  4XIQ A;  3GIG B;  5LMU E;  1PIE A;  2R3V A;  4MP7 A;  4R3A A;  3H4L A;  4X62 I;  4KSG A;  1Z59 A;  4HZ0 A;  2WER A;  1ELO A;  2UXD I;  2C2A A;  3PEH A;  3B28 A;  4X62 E;  1RR9 A;  3R92 A;  3A0Z A;  3PYD A;  2UXD E;  4GT8 A;  3TZ4 A;  5M4H A;  1OJ4 A;  2XJG A;  2WEQ A;  3OMU A;  2VCJ A;  4FCQ A;  2IWU A;  3J80 C;  4KFG A;  4P52 A;  4ZKI A;  4L91 A;  1AJ6 A;  5D7C A;  1Z0E A;  2UXB I;  4EGK A;  4JAU A;  1B3Q A;  4XDM A;  1YET A;  3OW6 A;  2WEP A;  2V2V A;  3K97 A;  2IOR A;  1UYI A;  2YKI A;  4GEE A;  4GKJ I;  2UXB E;  3D36 A;  3IED A;  3O2F A;  2YKC A;  3A0T A;  1N32 I;  3ZXQ A;  1YT2 A;  2XHT A;  4XKK A;  4GKJ E;  3H80 A;  2YE9 A;  4H7Q A;  4JQL A;  4LWF A;  1ZM9 A;  5BOD A;  4JI5 I;  1N32 E;  1Y8O A;  2O1V A;  4KQV A;  1UEK A;  4B6C A;  4MP2 A;  1Z0V A;  3Q5K A;  2XCM A;  2H55 A;  2EXL A;  4JI5 E;  4DV2 E;  1TH8 A;  3A0Y A;  4BQG A;  5M4E A;  4DU8 A;  4HZ5 A;  3ZZ0 A;  1AH8 A;  4YKR A;  3GIF A;  3J81 C;  2YKB A;  3QT8 A;  2V2Q A;  4LF6 I;  1B62 A;  4JI7 I;  1TIL A;  2XJX A;  1UYF A;  2WI6 A;  2F4V I;  3HYY A;  1IBL E;  1TC6 A;  1QZR A;  4HYP A;  2BM0 A;  4DV5 I;  2BYH A;  4JI7 E;  4CWF A;  4NH8 A;  4CWS A;  3PYF A;  3RLR A;  2UUC I;  4CWN A;  2F4V E;  1BYQ A;  2VCI A;  2BSM A;  3PEJ A;  2BT0 A;  3RLP A;  3U2D A;  4DV5 E;  4XD8 A;  4LF5 I;  2UUC E;  5IT9 Q;  1UY8 A;  1S16 A;  1YS3 A;  4H85 A;  4DV6 I;  4UTG A;  4ED4 A;  4U7N A;  4LF5 E;  1N34 I;  1MU5 A;  4DR1 E;  4LF4 I;  1S14 A;  4P7A A;  2ZBK B;  1XMO I;  4DV6 E;  4DR6 I;  4JAS A;  4M1K A;  1WUU A;  4YY3 I;  1N34 E;  3T1H E;  4LF4 E;  1R62 A;  3ZKD A;  1XMO E;  4ASG A;  4OX9 I;  3NMQ A;  1ZM4 A;  4PRX A;  4YY3 E;  2HFU A;  3T0H A;  4HAC A;  3D4J A;  4KHP I;  2YKJ A;  4OX9 E;  4JI0 I;  5A2Q C;  4LWG A;  1NHI A;  2YE6 A;  4JAV A;  1I5C A;  2YJX A;  3R4M A;  4AWQ A;  4W7T A;  2DEI A;  4BQJ A;  4JI0 E;  2XDL A;  2QF6 A;  3B26 A;  1I5B A;  5FNF A;  3OWD A;  4V26 A;  2UU9 I;  4X9L A;  4B7P A;  1YC1 A;  3HHU A;  2YI0 A;  5L3J A;  2FWY A;  4I3H A;  4URN A;  1US7 A;  3J7A M;  4U93 A;  5D6Q A;  4O09 A;  2UU9 E;  1QY8 A;  2X7I A;  1Z0T A;  4HY6 A;  2DEJ A;  3B78 A;  4DV4 I;  4LF9 I;  2YE8 A;  4DV4 E;  4LF9 E;  4GKK I;  4XC0 A;  1NHH A;  4MYT A;  2VF3 A;  2XX5 A;  3OTO I;  4DUH A;  4CWP A;  2WI5 A;  1ID0 A;  2A2C A;  4I5S A;  4GKK E;  5FNC A;  3A0W A;  3OTO E;  4B3R I;  1AH6 A;  4XCL A;  5FLX Q;  4DR7 E;  1YSR A;  2YE3 A;  4DPU A;  2YI6 A;  5J71 A;  3CGY A;  2ZDY A;  4XKA A;  1HR0 I;  3F0N A;  4B3R E;  4LFA I;  2VW5 A;  2YEJ A;  3O0I A;  2VQF I;  2LJP A;  2AJ4 A;  2FYP A;  3SL2 A;  2NPF A;  2UWD A;  4WUC A;  1Y8N A;  1HR0 E;  4DPT A;  4FWG A;  4LFA E;  3QT7 A;  2VQF E;  4LFC I;  1XMQ I;  2UUA I;  3V5R A;  3R4P A;  2CG9 A;  1TBW A;  4JI4 I;  4L94 A;  4QPJ A;  4CE1 A;  1I59 A;  4LFC E;  1XMQ E;  3Q1Q A;  2UUA E;  3WHA A;  1UYC A;  3B82 A;  3QT5 A;  1VIS A;  4JI4 E;  2J7K A;  1ZM2 A;  1QYE A;  4KSH A;  4AS9 A;  4GQT A;  2O1W A;  2ZIT A;  3EHG A;  2XHR A;  1U0Z A;  1NZ0 A;  4E00 A;  4DV7 I;  2HFS A;  1H73 A;  1JM6 A;  1GKZ A;  2E5L I;  5IT9 C;  4Z7Y A;  4AQY I;  4DV7 E;  4BAE A;  1I5A A;  4EGI A;  3G75 A;  2E5L E;  1H74 A;  2XDU A;  4DV2 I;  4AQY E;  2IOP A;  2YGA A;  4Z7C A;  5BR8 I;  2PNR A;  1UY7 A;  3GON A;  3VAD A;  5GMD A;  2BRC A;  2Q8G A;  5BR8 E;  4DR2 I;  1TC0 A;  2BRE A;  4URM A;  4V25 A;  4DV3 I;  4NH9 A;  2HHH I;  1N33 I;  3EHJ A;  3TZ0 A;  1Z5B A;  2CCS A;  2YGE A;  4LWH A;  1KKH A;  4DR2 E;  1IBL I;  4FW9 A;  2QFO A;  2Q8H A;  4DV3 E;  2HHH E;  1N33 E;  5M4K A;  2YEI A;  4FN5 A;  4DUY I;  2FXS A;  4O07 A;  3WU6 A;  3EHH A;  4XKO A;  2R42 A;  1YT1 A;  4HY1 A;  4WUB A;  2YEB A;  4DUY E;  1H7U A;  4L90 A;  4MB9 A;  4MBC A;  1UYK A;  4LP0 A;  2BU5 A;  3CRK A;  3EHF A;  3GIE A;  2XJJ A;  1IBK I;  1UYL A;  3LPS A;  4DR1 I;  2XDS A;  4BIU A;  4YKZ A;  1RRE A;  5M4M A;  1U2O A;  1Z0C A;  2H8M A;  2E0A A;  4DU7 A;  3HYZ A;  1IBK E;  3T1H I;  3B8H A;  4O0B A;  4URO A;  4XTJ A;  3HZ1 A;  2YI7 A;  1ZXM A;  2E1R A;  2HK2 A;  4USK A;  2EFG A;  4GCZ A;  2X36 A;  4YKU A;  4LWI A;  4HAC B;  1N36 I;  3R4N A;  4CWO A;  2WI2 A;  5FLX C;  2CCT A;  2JJC A;  1Z0B A;  1H72 C;  3HEK A;  5C93 A;  1N36 E;  1THN A;  2CCU A;  4BXI A;  5CTU A;  3D0B A;  1FNM A;  4DZY A;  3INW A;  2BU2 A;  5J6A A;  1K47 A;  1U2R A;  4X64 I;  2YEE A;  2FWZ A;  3PYE A;  4KTN A;  3EKR A;  4EGH A;  3RKZ A;  2BU7 A;  1Y4U A;  4X64 E;  4LF8 I;  1L0O A;  2WI1 A;  2XHX A;  3ZZU A;  3FV5 A;  4FWD A;  3JZ3 A;  3MNR P;  1HNW I;  1UYG A;  1XNR I;  2QG0 A;  2V8P A;  2QG2 A;  4DR3 I;  4LF8 E;  3T10 A;  1HNW E;  1XNR E;  5IWA I;  1I58 A;  4KP4 A;  1Z5A A;  4AWO A;  3ZKB A;  2CZ9 A;  5IDJ A;  4DR3 E;  3CWV A;  4PRV A;  1UYM A;  4HXW A;  4JV5 I;  2AKP A;  4XCJ A;  5LMN I;  5IWA E;  4GFN A;  2YEC A;  1BGQ A;  2GQP A;  4DR7 I;  1BXD A;  4JV5 E;  3G7E A;  3G7B A;  5LMN E;  4EM7 A;  4ASB A;  2BYI A;  3QTF A;  3T1Y I;  4O04 A;  1YC4 A; 
#chains in the Genus database with same CATH topology
 5CTX A;  3K60 A;  2O1U A;  1FI4 A;  1EI1 A;  3P3E A;  3T1Y E;  4LPB A;  1A6F A;  4X66 I;  4YHH I;  4JI3 I;  4XIP A;  2WI4 A;  4FMT A;  4XIT A;  3CGZ A;  4FW4 A;  4JI1 I;  4YKT A;  1YT0 A;  3T2S A;  3U67 A;  4FCP A;  4X66 E;  4JI3 E;  4YHH E;  1TID A;  4JI8 I;  4FW7 A;  3O6O A;  3TUH A;  4U7O A;  4JI1 E;  3CRL A;  4CWT A;  3K99 A;  4DPY A;  3TZ5 A;  3A0X A;  5M4N A;  5LL6 R;  4B3M I;  5CTW A;  1Y8P A;  2CVE A;  4DV0 I;  4JI8 E;  2NN6 E;  4JI2 I;  3TZ2 A;  1Z0G A;  3WU3 A;  2JKI A;  4USM A;  2GO3 A;  3WU5 A;  1ZM3 A;  4B3M E;  1OSF A;  2BTZ A;  2XD6 A;  3KE6 A;  1ZWH A;  4NH7 A;  3R91 A;  4DV0 E;  4JI2 E;  1YC3 A;  3D2R A;  3OPD A;  3K1J A;  2BV3 A;  5CF0 A;  4MOT A;  4EFT A;  4FW3 A;  3WU4 A;  4LPF A;  2J65 A;  3PS1 A;  3ZM7 A;  4HXZ A;  3GIG A;  3T0Z A;  4BA1 A;  4OO1 F;  3JAM Q;  2CH4 A;  4RPF A;  1BKN A;  1UYH A;  4ISA A;  4BA2 A;  5D7R A;  3C0E A;  3K17 A;  4CE2 A;  1HNX I;  3P06 A;  4DXL A;  1E3H A;  2C39 A;  2YE7 A;  3HUL A;  3LNU A;  3OWB A;  3M85 G;  1KZN A;  1KTV A;  2IWS A;  2XDK A;  2XEX A;  2AE8 A;  2YK2 A;  3PS3 A;  5GME A;  2BA0 G;  4NBQ A;  1XHK A;  1HNX E;  1UY9 A;  1MX0 A;  1J5E I;  1IBM I;  2XK2 A;  4H81 A;  5FWK A;  3Q5L A;  4AIM A;  2WP8 A;  4FW5 A;  5CTY A;  3BM9 A;  3L7Z B;  5C0X E;  2WNR B;  5F5R A;  4CWR A;  4MU1 A;  4MU4 A;  1J5E E;  1IBM E;  3A0R A;  4EFU A;  3V2U C;  3B24 A;  4X65 I;  4DR4 I;  3B27 A;  4OZE A;  5FND A;  2K5B A;  4R3M A;  1UYD A;  1YES A;  4MPE A;  1ZW9 A;  2XAB A;  4JG4 A;  1H7S A;  2GQ0 A;  2C37 A;  2YEF A;  4EMV A;  2WI3 A;  4P8O A;  4X65 E;  4DR4 E;  3CDI A;  1N0V C;  4JYA I;  4FPP A;  1Y6Z A;  2PO2 A;  5DRR A;  5EL9 A;  1YSZ A;  1FWL A;  2YE2 A;  4U3B A;  3M6A A;  1I5D A;  4YKX A;  5M4P A;  3VHA A;  1UDQ A;  2ZKJ A;  1I94 I;  4MPN A;  4JYA E;  5C0X A;  4NXN I;  4DPW A;  2BU8 A;  2PO1 B;  4B3T I;  2CGF A;  2YE5 A;  2UUB I;  2YK9 A;  4MYU A;  1I94 E;  1MG7 A;  4MPC A;  4B3S I;  1P42 A;  4EMD A;  4NXN E;  1GJV A;  3DD6 A;  4FWH A;  3T1K A;  2OI2 A;  4B3T E;  1Z5C A;  2UUB E;  2BR2 A;  5IDM A;  1N0U A;  2BM1 A;  4PU9 A;  2PO0 B;  4B3S E;  3HJC A;  2C38 B;  5DNX A;  4E01 A;  4ASA A;  4K0K I;  3QT6 A;  2YEH A;  4DV1 I;  2ZDX A;  1Y4S A;  3J80 Q;  4LF6 E;  3HZ5 A;  4UT4 A;  4OO1 C;  4K0K E;  2HK3 A;  4OO1 D;  2ESA A;  2GS8 A;  4DV1 E;  2UXC I;  3R4O A;  1KVK A;  4HYM A;  3DGE A;  4K4O A;  1DAR A;  3CDJ A;  3INX A;  4ZVI A;  2Z5C A;  4FCR A;  2UXC E;  3C11 A;  3J7A G;  1XNQ I;  5BOC A;  1AM1 A;  2YEG A;  2YE4 A;  4JI6 I;  2HKJ A;  1A4H A;  4XIR A;  2HG1 A;  3B25 A;  5CPH A;  4YKW A;  2IWX A;  1XNQ E;  2XX2 A;  4JI6 E;  4DR5 I;  1R6L A;  4BIZ A;  4LF7 I;  3VHC A;  3RLQ A;  4NXM I;  2YKE A;  2FTK A;  4LWE A;  4DR5 E;  4DR6 E;  2Q2E B;  1ZXN A;  4LF7 E;  1Z0W A;  2HCH A;  3J81 Q;  2YJW A;  4NXM E;  1AMW A;  2YI5 A;  4R1F A;  3U2K A;  2HKE A;  4LCH A;  3LTO A;  4XE2 A;  3EKO A;  2WI7 A;  4IFD A;  3M85 D;  2ZM6 I;  1NHJ A;  5C0X F;  4KHP E;  1IXM A;  2BA0 D;  2C1G A;  1FKA E;  3M7N D;  1S4E A;  3UHM A;  1FJG I;  4CE3 A;  2ZM6 E;  4E02 A;  4L93 A;  2WW4 A;  3JAM C;  4DUZ I;  3ZZT A;  2YEA A;  5GGZ A;  2Z5E A;  4GQU A;  4WUD A;  4O05 A;  3QDD A;  4ASF A;  1KIJ A;  5D7D A;  1FJG E;  1HNZ I;  4DUZ E;  3WQ9 A;  5ELW A;  2XDX A;  1EA6 A;  1YER A;  3CYG A;  2YED A;  1HNZ E;  1Y60 A;  3PYG A;  1FWK A;  2BZ5 A;  1Y5Y A;  2GFD A;  3FT5 A;  3K98 A;  4DPX A;  5F3K A;  2C1I A;  4L8Z A;  3Q5J A;  4QPK A;  2YGF A;  2V34 A;  5D6P A;  2Q8I A;  1UYE A;  1UY6 A;  3FT8 A;  2JE6 A;  1B63 A;  1D6T A;  2IOQ A;  2XX4 A;  2VQE I;  2BU6 A;  3BMY A;  4GGL A;  4YKY A;  3ZXO A;  1GKX A;  2A2D A;  1VI7 A;  3VHD A;  4AWP A;  2PNL A;  4URL A;  4LFB I;  4CWQ A;  1PKP A;  2VQE E;  4PL9 A;  5LMU I;  1PVG A;  2VWC A;  5A2Q Q;  4LFB E;  4EEH A;  2Q8F A;  2V2Z A;  4YKQ A;  4XIQ A;  3GIG B;  5LMU E;  1PIE A;  2R3V A;  4BA1 B;  4MP7 A;  5JEN A;  4R3A A;  3H4L A;  4X62 I;  4KSG A;  1Z59 A;  4HZ0 A;  2WER A;  1ELO A;  2UXD I;  4LCF A;  2JT2 A;  2C2A A;  4BA2 B;  3B28 A;  3PEH A;  2NN6 A;  4X62 E;  1RR9 A;  2C39 B;  3R92 A;  3A0Z A;  3PYD A;  2UXD E;  4GT8 A;  3TZ4 A;  5M4H A;  1OJ4 A;  1OYS A;  1XXE A;  2XJG A;  4IFD F;  2WEQ A;  3OMU A;  4MDT A;  2VCJ A;  4FCQ A;  5C0X D;  2IWU A;  2WP8 B;  3J80 C;  4KFG A;  4P52 A;  4ZKI A;  1UDN A;  4L91 A;  1AJ6 A;  5JEA E;  5D7C A;  1Z0E A;  2UXB I;  4EGK A;  4JAU A;  1RHY A;  1B3Q A;  1YET A;  4XDM A;  3OW6 A;  2WEP A;  2V2V A;  3K97 A;  2JEA A;  2IOR A;  1UYI A;  2C37 B;  2YKI A;  4OKG A;  4GEE A;  4GKJ I;  3PS2 A;  2UXB E;  3D36 A;  3IED A;  3O2F A;  2YKC A;  3A0T A;  4FW6 A;  1N32 I;  2PO2 B;  1YT2 A;  3ZXQ A;  2XHT A;  4XKK A;  4GKJ E;  3H80 A;  2YE9 A;  4H7Q A;  4JQL A;  4LWF A;  1ZM9 A;  5BOD A;  3GME A;  5C0X B;  4JI5 I;  1N32 E;  1Y8O A;  2O1V A;  4KQV A;  1UEK A;  4LOM A;  3HKM A;  5JEA A;  4MP2 A;  4B6C A;  1Z0V A;  3Q5K A;  2XCM A;  2H55 A;  2EXL A;  4JI5 E;  4DV2 E;  1TH8 A;  3A0Y A;  4BQG A;  5M4E A;  4DU8 A;  4HZ5 A;  3ZZ0 A;  1AH8 A;  2BR2 B;  4YKR A;  3GIF A;  3GCM A;  3J81 C;  3QT8 A;  2YKB A;  2V2Q A;  2Z5B A;  4LF6 I;  1B62 A;  4JI7 I;  1TIL A;  2XJX A;  4IZJ A;  1UYF A;  1OYR A;  2WI6 A;  2F4V I;  3HYY A;  1IBL E;  5K36 E;  1TC6 A;  1QZR A;  3P76 A;  2HHI A;  4HYP A;  2BM0 A;  4DV5 I;  2BYH A;  4JI7 E;  4CWF A;  4NH8 A;  4CWS A;  4IZK A;  2NN6 F;  2PNZ A;  3PYF A;  2UUC I;  2F4V E;  2Z5C B;  1BYQ A;  2BSM A;  2VCI A;  2BT0 A;  3PEJ A;  3RLP A;  3U2D A;  4E72 A;  4DV5 E;  4XD8 A;  4IFD C;  3U1Y A;  4LF5 I;  2UUC E;  4IFD D;  5IT9 Q;  1UY8 A;  3H1C A;  1S16 A;  1YS3 A;  4H85 A;  4DV6 I;  4UTG A;  4ED4 A;  4U7N A;  4LF5 E;  1N34 I;  5K36 A;  1MU5 A;  4DR1 E;  4LF4 I;  1S14 A;  4P7A A;  2ZBK B;  1XMO I;  4DV6 E;  4DR6 I;  4JAS A;  4M1K A;  1WUU A;  4YY3 I;  2BA1 G;  2PNM A;  1N34 E;  3T1H E;  4LF4 E;  1R62 A;  3ZKD A;  1XMO E;  4ASG A;  4OX9 I;  1YHC A;  3NMQ A;  1ZM4 A;  4PRX A;  4YY3 E;  2HFU A;  3T0H A;  4HAC A;  3D4J A;  4KHP I;  4OO1 E;  2YKJ A;  4IFD B;  4OX9 E;  4JI0 I;  5A2Q C;  4LWG A;  1NHI A;  2YE6 A;  4JAV A;  5JEA F;  1I5C A;  2YJX A;  3R4M A;  4AWQ A;  4W7T A;  2DEI A;  4BQJ A;  4JI0 E;  2XDL A;  2QF6 A;  3B26 A;  3PRY A;  1I5B A;  5FNF A;  3OWD A;  4N3O A;  4V26 A;  2UU9 I;  4X9L A;  4B7P A;  3Q6M A;  1YC1 A;  3HHU A;  2YI0 A;  5L3J A;  2FWY A;  4I3H A;  3GLL A;  1US7 A;  3J7A M;  4U93 A;  5D6Q A;  4URN A;  4O09 A;  2UU9 E;  1R6M A;  1QY8 A;  4OO1 A;  2X7I A;  1Z0T A;  4HY6 A;  2DEJ A;  3B78 A;  4DV4 I;  4LF9 I;  3TTZ A;  4AID A;  1OYP A;  2YE8 A;  2NN6 C;  4DV4 E;  2JE6 B;  4LF9 E;  4GKK I;  1NHH A;  3P3C A;  2NN6 D;  4MYT A;  2VF3 A;  4XC0 A;  2XX5 A;  3OTO I;  5IN9 A;  4DUH A;  4CWP A;  2WI5 A;  1ID0 A;  2A2C A;  4I5S A;  4GKK E;  4MU0 A;  5FNC A;  3A0W A;  3OTO E;  4B3R I;  1AH6 A;  2JEB A;  4XCL A;  5FLX Q;  4DR7 E;  1YSR A;  2YE3 A;  4DPU A;  2YI6 A;  5J71 A;  5DNL A;  3CGY A;  2ZDY A;  4XKA A;  1HR0 I;  4Q20 A;  3F0N A;  5K36 F;  4B3R E;  4LFA I;  2VW5 A;  2YEJ A;  3O0I A;  2VQF I;  2LJP A;  2AJ4 A;  2FYP A;  3SL2 A;  2NPF A;  2UWD A;  4WUC A;  1Y8N A;  1HR0 E;  2VES A;  4DPT A;  4FWG A;  4LFA E;  3QT7 A;  2VQF E;  2NN6 B;  4LFC I;  1XMQ I;  2UUA I;  3V5R A;  3R4P A;  2CG9 A;  1TBW A;  4JI4 I;  4L94 A;  4QPJ A;  4CE1 A;  1I59 A;  4LFC E;  1XMQ E;  3Q1Q A;  2UUA E;  3WHA A;  2CGE A;  5JEA C;  3B82 A;  3QT5 A;  5C0X C;  1F51 A;  1UYC A;  5JEA D;  1VIS A;  4JI4 E;  2J7K A;  1ZM2 A;  1USU A;  1QYE A;  4KSH A;  4AS9 A;  4GQT A;  2O1W A;  2ZIT A;  3EHG A;  2XHR A;  1U0Z A;  2JEA B;  3MNR P;  1NZ0 A;  2O3Z A;  3U1K A;  4E00 A;  3B4T A;  4DV7 I;  2BA1 D;  4QNK A;  2HFS A;  1H73 A;  1UDS A;  1JM6 A;  2E5L I;  1GKZ A;  4IZJ D;  5IT9 C;  4Z7Y A;  3LMM A;  4AQY I;  4DV7 E;  4BAE A;  1I5A A;  4EGI A;  3G75 A;  2E5L E;  1H74 A;  2IER A;  5JEA B;  2XDU A;  4DV2 I;  4AQY E;  4AM3 A;  2IOP A;  2YGA A;  3M7N G;  4Z7C A;  5BR8 I;  2PNR A;  1UY7 A;  4QNJ A;  3GON A;  3VAD A;  5GMD A;  2BRC A;  2Q8G A;  5BR8 E;  4DR2 I;  1TC0 A;  2BRE A;  2Z5B B;  3L7Z A;  4URM A;  2WNR A;  4V25 A;  4DV3 I;  4NH9 A;  2HHH I;  1N33 I;  3EHJ A;  3TZ0 A;  1Z5B A;  5K36 C;  2CCS A;  2YGE A;  1KKH A;  4LWH A;  5K36 D;  4IZJ B;  4DR2 E;  1IBL I;  4FW9 A;  5DRO A;  2QFO A;  2Q8H A;  4DV3 E;  3RLR A;  5DRQ A;  2HHH E;  1HK7 A;  1N33 E;  5M4K A;  2YEI A;  4FN5 A;  2O1T A;  4DUY I;  2FXS A;  4O07 A;  4IZK B;  3WU6 A;  3EHH A;  2PNZ B;  4XKO A;  2R42 A;  1YT1 A;  3P3G A;  4HY1 A;  1E3P A;  4WUB A;  2YEB A;  4DUY E;  1H7U A;  4L90 A;  4MB9 A;  4LCG A;  4MBC A;  1UYK A;  2PO1 A;  4LP0 A;  2BU5 A;  1UDO A;  4IS9 A;  3CRK A;  3EHF A;  3GIE A;  2XJJ A;  1IBK I;  1UYL A;  3LPS A;  4DR1 I;  2XDS A;  4BIU A;  4YKZ A;  1RRE A;  4MQY A;  5K36 B;  1U2O A;  1Z0C A;  5M4M A;  2H8M A;  2E0A A;  4DU7 A;  2PO0 A;  1IBK E;  3T1H I;  3B8H A;  3HYZ A;  4O0B A;  4URO A;  2C38 A;  3NZK A;  4XTJ A;  3HZ1 A;  2YI7 A;  1ZXM A;  2GO4 A;  3S5T A;  2E1R A;  2HK2 A;  4USK A;  2EFG A;  4GCZ A;  2X36 A;  4YKU A;  4LWI A;  4HAC B;  1N36 I;  3R4N A;  4CWO A;  2WI2 A;  5FLX C;  2CCT A;  2JJC A;  3Q6N A;  1Z0B A;  1H72 C;  3HEK A;  5C93 A;  1N36 E;  1THN A;  2CCU A;  4BXI A;  5CTU A;  3D0B A;  1FNM A;  4DZY A;  3INW A;  2BU2 A;  5J6A A;  1K47 A;  4U3D A;  1U2R A;  4X64 I;  4IFD E;  2YEE A;  4MU3 A;  2FWZ A;  3PYE A;  5EKW A;  4KTN A;  3EKR A;  4EGH A;  3RKZ A;  2BU7 A;  1Y4U A;  2F1D A;  4X64 E;  4LF8 I;  1L0O A;  2WI1 A;  4OO1 B;  3ZZU A;  2XHX A;  4FWD A;  2IES A;  3FV5 A;  3JZ3 A;  1HNW I;  1UYG A;  1XNR I;  2QG0 A;  1YH8 A;  2V8P A;  2QG2 A;  4DR3 I;  4LF8 E;  3T10 A;  1HNW E;  4J3D A;  1XNR E;  5IWA I;  1I58 A;  1USV A;  1Z5A A;  4KP4 A;  3ZKB A;  2CZ9 A;  4AWO A;  5IDJ A;  4DR3 E;  3CWV A;  4PRV A;  1UYM A;  4HXW A;  4JV5 I;  2AKP A;  4XCJ A;  5LMN I;  5IWA E;  4GFN A;  2YEC A;  1BGQ A;  4CWN A;  2GQP A;  4DR7 I;  3K85 A;  1BXD A;  2JEB B;  4JV5 E;  3G7E A;  3G7B A;  5LMN E;  4EM7 A;  5DRP A;  4ASB A;  2BYI A;  3QTF A;  3T1Y I;  4O04 A;  3KRN A;  1YC4 A; 
#chains in the Genus database with same CATH homology
 5CTX A;  3K60 A;  2O1U A;  1FI4 A;  1EI1 A;  3T1Y E;  4LPB A;  1A6F A;  4X66 I;  4YHH I;  4JI3 I;  4XIP A;  2WI4 A;  4FMT A;  4XIT A;  3CGZ A;  4YKT A;  4JI1 I;  1YT0 A;  3T2S A;  3U67 A;  4FCP A;  4X66 E;  4JI3 E;  4YHH E;  1TID A;  4JI8 I;  3O6O A;  3TUH A;  4U7O A;  4JI1 E;  3CRL A;  4CWT A;  3K99 A;  4DPY A;  3TZ5 A;  3A0X A;  5M4N A;  5LL6 R;  4B3M I;  5CTW A;  1Y8P A;  4DV0 I;  4JI8 E;  4JI2 I;  3TZ2 A;  1Z0G A;  3WU3 A;  2JKI A;  4USM A;  3WU5 A;  1OSF A;  1ZM3 A;  4B3M E;  2BTZ A;  2XD6 A;  3KE6 A;  4NH7 A;  1ZWH A;  5IN9 A;  3R91 A;  4DV0 E;  4JI2 E;  1YC3 A;  3D2R A;  3OPD A;  3K1J A;  2BV3 A;  5CF0 A;  4MOT A;  4EFT A;  3WU4 A;  3ZM7 A;  4HXZ A;  3GIG A;  3T0Z A;  3JAM Q;  2CH4 A;  4RPF A;  1BKN A;  1UYH A;  5D7R A;  4CE2 A;  3C0E A;  3K17 A;  1HNX I;  3P06 A;  4DXL A;  2YE7 A;  3OWB A;  3TTZ A;  3HUL A;  3LNU A;  4Q20 A;  1KZN A;  2IWS A;  1KTV A;  2XDK A;  2XEX A;  2YK2 A;  5GME A;  2XK2 A;  1XHK A;  1HNX E;  1UY9 A;  4H81 A;  1MX0 A;  1J5E I;  1IBM I;  5CPH A;  5CTY A;  5FWK A;  3Q5L A;  3BM9 A;  5F5R A;  4CWR A;  1IBM E;  1J5E E;  3A0R A;  4EFU A;  3V2U C;  3B24 A;  4X65 I;  4DR4 I;  3B27 A;  5FND A;  2K5B A;  4R3M A;  1UYD A;  1YES A;  4MPE A;  1ZW9 A;  2XAB A;  4JG4 A;  1H7S A;  2GQ0 A;  4EMV A;  2YEF A;  2WI3 A;  4P8O A;  4X65 E;  4DR4 E;  1N0V C;  4JYA I;  4FPP A;  1Y6Z A;  1YSZ A;  2YE2 A;  1FWL A;  4YKX A;  3M6A A;  1I5D A;  5M4P A;  3VHA A;  2ZKJ A;  1I94 I;  4MPN A;  4JYA E;  4NXN I;  4DPW A;  2BU8 A;  4B3T I;  2CGF A;  2YE5 A;  2UUB I;  2YK9 A;  4MYU A;  1I94 E;  1MG7 A;  4MPC A;  4B3S I;  4NXN E;  4EMD A;  1GJV A;  4FWH A;  3T1K A;  2OI2 A;  4B3T E;  1Z5C A;  2UUB E;  5IDM A;  1N0U A;  2BM1 A;  4PU9 A;  4B3S E;  3HJC A;  4E01 A;  4ASA A;  4K0K I;  3QT6 A;  2YEH A;  4DV1 I;  2ZDX A;  1Y4S A;  3J80 Q;  4LF6 E;  3HZ5 A;  4UT4 A;  4K0K E;  2HK3 A;  2ESA A;  2GS8 A;  4DV1 E;  2UXC I;  3R4O A;  1KVK A;  4HYM A;  3DGE A;  4K4O A;  1DAR A;  3INX A;  4ZVI A;  2Z5C A;  4FCR A;  2UXC E;  3C11 A;  3J7A G;  1XNQ I;  5BOC A;  1AM1 A;  2YEG A;  2YE4 A;  4JI6 I;  2HKJ A;  1A4H A;  4XIR A;  2HG1 A;  3B25 A;  4YKW A;  2IWX A;  1XNQ E;  2XX2 A;  4JI6 E;  4DR5 I;  4BIZ A;  4LF7 I;  3VHC A;  3RLQ A;  4NXM I;  2YKE A;  4LWE A;  4DR5 E;  4DR6 E;  2Q2E B;  1ZXN A;  4LF7 E;  1Z0W A;  2HCH A;  3J81 Q;  2YJW A;  4NXM E;  1AMW A;  2YI5 A;  4R1F A;  3U2K A;  2HKE A;  3LTO A;  4XE2 A;  3EKO A;  2WI7 A;  2ZM6 I;  1NHJ A;  4KHP E;  1FKA E;  1S4E A;  4CE3 A;  1FJG I;  2ZM6 E;  4E02 A;  4L93 A;  2WW4 A;  3JAM C;  4DUZ I;  3ZZT A;  2YEA A;  5GGZ A;  2Z5E A;  4WUD A;  4O05 A;  3QDD A;  4ASF A;  1KIJ A;  5D7D A;  1FJG E;  1HNZ I;  4DUZ E;  3WQ9 A;  2XDX A;  1EA6 A;  1YER A;  2YED A;  1HNZ E;  3PYG A;  1FWK A;  2BZ5 A;  2GFD A;  3FT5 A;  3K98 A;  4DPX A;  5F3K A;  4L8Z A;  3Q5J A;  4QPK A;  2YGF A;  2V34 A;  5D6P A;  2Q8I A;  1UYE A;  1UY6 A;  3FT8 A;  1B63 A;  1D6T A;  2IOQ A;  2XX4 A;  2VQE I;  2BU6 A;  3BMY A;  4GGL A;  4YKY A;  3ZXO A;  1GKX A;  2A2D A;  3VHD A;  4AWP A;  2PNL A;  4URL A;  4LFB I;  4CWQ A;  1PKP A;  2VQE E;  4PL9 A;  5LMU I;  1PVG A;  2VWC A;  5A2Q Q;  4LFB E;  4EEH A;  2Q8F A;  2V2Z A;  4YKQ A;  4XIQ A;  3GIG B;  5LMU E;  1PIE A;  2R3V A;  4MP7 A;  4R3A A;  3H4L A;  4X62 I;  4KSG A;  1Z59 A;  4HZ0 A;  2WER A;  1ELO A;  2UXD I;  2C2A A;  3PEH A;  3B28 A;  4X62 E;  1RR9 A;  3R92 A;  3A0Z A;  3PYD A;  2UXD E;  4GT8 A;  3TZ4 A;  5M4H A;  1OJ4 A;  2XJG A;  2WEQ A;  3OMU A;  2VCJ A;  4FCQ A;  2IWU A;  3J80 C;  4KFG A;  4P52 A;  4ZKI A;  4L91 A;  1AJ6 A;  5D7C A;  1Z0E A;  2UXB I;  4EGK A;  4JAU A;  1B3Q A;  4XDM A;  1YET A;  3OW6 A;  2WEP A;  2V2V A;  3K97 A;  2IOR A;  1UYI A;  2YKI A;  4GEE A;  4GKJ I;  2UXB E;  3D36 A;  3IED A;  3O2F A;  2YKC A;  3A0T A;  1N32 I;  3ZXQ A;  1YT2 A;  2XHT A;  4XKK A;  4GKJ E;  3H80 A;  2YE9 A;  4H7Q A;  4JQL A;  4LWF A;  1ZM9 A;  5BOD A;  4JI5 I;  1N32 E;  1Y8O A;  2O1V A;  4KQV A;  1UEK A;  4B6C A;  4MP2 A;  1Z0V A;  3Q5K A;  2XCM A;  2H55 A;  2EXL A;  4JI5 E;  4DV2 E;  1TH8 A;  3A0Y A;  4BQG A;  5M4E A;  4DU8 A;  4HZ5 A;  3ZZ0 A;  1AH8 A;  4YKR A;  3GIF A;  3J81 C;  2YKB A;  3QT8 A;  2V2Q A;  2Z5B A;  4LF6 I;  1B62 A;  4JI7 I;  1TIL A;  2XJX A;  4IZJ A;  1UYF A;  2WI6 A;  2F4V I;  3HYY A;  1IBL E;  1TC6 A;  1QZR A;  4HYP A;  2BM0 A;  4DV5 I;  2BYH A;  4JI7 E;  4CWF A;  4NH8 A;  4CWS A;  4IZK A;  3PYF A;  3RLR A;  2UUC I;  4CWN A;  2F4V E;  2Z5C B;  1BYQ A;  2BSM A;  2VCI A;  2BT0 A;  3PEJ A;  3RLP A;  3U2D A;  4DV5 E;  4XD8 A;  4LF5 I;  2UUC E;  5IT9 Q;  1UY8 A;  1S16 A;  1YS3 A;  4H85 A;  4DV6 I;  4UTG A;  4ED4 A;  4U7N A;  4LF5 E;  1N34 I;  1MU5 A;  4DR1 E;  4LF4 I;  1S14 A;  4P7A A;  2ZBK B;  1XMO I;  4DV6 E;  4DR6 I;  4JAS A;  4M1K A;  1WUU A;  4YY3 I;  2PNM A;  1N34 E;  3T1H E;  4LF4 E;  1R62 A;  3ZKD A;  1XMO E;  4ASG A;  4OX9 I;  3NMQ A;  1ZM4 A;  4PRX A;  4YY3 E;  2HFU A;  3T0H A;  4HAC A;  3D4J A;  4KHP I;  2YKJ A;  4OX9 E;  4JI0 I;  5A2Q C;  4LWG A;  1NHI A;  2YE6 A;  4JAV A;  1I5C A;  2YJX A;  3R4M A;  4AWQ A;  4W7T A;  2DEI A;  4BQJ A;  4JI0 E;  2XDL A;  2QF6 A;  3B26 A;  3PRY A;  1I5B A;  5FNF A;  3OWD A;  4N3O A;  4V26 A;  2UU9 I;  4X9L A;  4B7P A;  3Q6M A;  1YC1 A;  3HHU A;  2YI0 A;  5L3J A;  2FWY A;  4I3H A;  4URN A;  1US7 A;  3J7A M;  4U93 A;  5D6Q A;  4O09 A;  2UU9 E;  1QY8 A;  2X7I A;  1Z0T A;  4HY6 A;  2DEJ A;  3B78 A;  4DV4 I;  4LF9 I;  2YE8 A;  4DV4 E;  4LF9 E;  4GKK I;  4XC0 A;  1NHH A;  4MYT A;  2VF3 A;  2XX5 A;  3OTO I;  4DUH A;  4CWP A;  2WI5 A;  1ID0 A;  2A2C A;  4I5S A;  4GKK E;  5FNC A;  3A0W A;  3OTO E;  4B3R I;  1AH6 A;  4XCL A;  5FLX Q;  4DR7 E;  1YSR A;  2YE3 A;  4DPU A;  2YI6 A;  5J71 A;  3CGY A;  2ZDY A;  4XKA A;  1HR0 I;  3F0N A;  4B3R E;  4LFA I;  2VW5 A;  2YEJ A;  3O0I A;  2VQF I;  2LJP A;  2AJ4 A;  2FYP A;  3SL2 A;  2NPF A;  2UWD A;  4WUC A;  1Y8N A;  1HR0 E;  4DPT A;  4FWG A;  4LFA E;  3QT7 A;  2VQF E;  4LFC I;  1XMQ I;  2UUA I;  3V5R A;  3R4P A;  2CG9 A;  1TBW A;  4JI4 I;  4L94 A;  4QPJ A;  4CE1 A;  1I59 A;  4LFC E;  1XMQ E;  3Q1Q A;  2UUA E;  3WHA A;  2CGE A;  1UYC A;  3B82 A;  3QT5 A;  1VIS A;  4JI4 E;  2J7K A;  1ZM2 A;  1USU A;  1QYE A;  4KSH A;  4AS9 A;  4GQT A;  2O1W A;  2ZIT A;  3EHG A;  2XHR A;  1U0Z A;  1NZ0 A;  4E00 A;  4DV7 I;  2HFS A;  1H73 A;  1JM6 A;  1GKZ A;  2E5L I;  4IZJ D;  5IT9 C;  4Z7Y A;  4AQY I;  4DV7 E;  4BAE A;  1I5A A;  4EGI A;  3G75 A;  2E5L E;  1H74 A;  2XDU A;  4DV2 I;  4AQY E;  2IOP A;  2YGA A;  4Z7C A;  5BR8 I;  2PNR A;  1UY7 A;  3GON A;  3VAD A;  5GMD A;  2BRC A;  2Q8G A;  5BR8 E;  4DR2 I;  1TC0 A;  2BRE A;  2Z5B B;  4URM A;  4V25 A;  4DV3 I;  4NH9 A;  2HHH I;  1N33 I;  3EHJ A;  3TZ0 A;  1Z5B A;  2CCS A;  2YGE A;  4LWH A;  1KKH A;  4IZJ B;  4DR2 E;  1IBL I;  4FW9 A;  2QFO A;  2Q8H A;  4DV3 E;  2HHH E;  1HK7 A;  1N33 E;  5M4K A;  2YEI A;  4FN5 A;  2O1T A;  4DUY I;  2FXS A;  4O07 A;  4IZK B;  3WU6 A;  3EHH A;  4XKO A;  2R42 A;  1YT1 A;  4HY1 A;  4WUB A;  2YEB A;  4DUY E;  1H7U A;  4L90 A;  4MB9 A;  4MBC A;  1UYK A;  4LP0 A;  2BU5 A;  3CRK A;  3EHF A;  3GIE A;  2XJJ A;  1IBK I;  1UYL A;  3LPS A;  4DR1 I;  2XDS A;  4BIU A;  4YKZ A;  1RRE A;  5M4M A;  1U2O A;  1Z0C A;  2H8M A;  2E0A A;  4DU7 A;  3HYZ A;  1IBK E;  3T1H I;  3B8H A;  4O0B A;  4URO A;  4XTJ A;  3HZ1 A;  2YI7 A;  1ZXM A;  2E1R A;  2HK2 A;  4USK A;  2EFG A;  4GCZ A;  2X36 A;  4YKU A;  4LWI A;  4HAC B;  1N36 I;  3R4N A;  4CWO A;  2WI2 A;  5FLX C;  2CCT A;  2JJC A;  3Q6N A;  1Z0B A;  1H72 C;  3HEK A;  5C93 A;  1N36 E;  1THN A;  2CCU A;  4BXI A;  5CTU A;  3D0B A;  1FNM A;  4DZY A;  3INW A;  2BU2 A;  5J6A A;  1K47 A;  1U2R A;  4X64 I;  2YEE A;  2FWZ A;  3PYE A;  4KTN A;  3EKR A;  4EGH A;  3RKZ A;  2BU7 A;  1Y4U A;  4X64 E;  4LF8 I;  1L0O A;  2WI1 A;  2XHX A;  3ZZU A;  3FV5 A;  4FWD A;  3JZ3 A;  3MNR P;  1HNW I;  1UYG A;  1XNR I;  2QG0 A;  2V8P A;  2QG2 A;  4DR3 I;  4LF8 E;  3T10 A;  1HNW E;  1XNR E;  5IWA I;  1I58 A;  1USV A;  1Z5A A;  4KP4 A;  3ZKB A;  2CZ9 A;  4AWO A;  5IDJ A;  4DR3 E;  3CWV A;  4PRV A;  1UYM A;  4HXW A;  4JV5 I;  2AKP A;  4XCJ A;  5LMN I;  5IWA E;  4GFN A;  2YEC A;  1BGQ A;  2GQP A;  4DR7 I;  3K85 A;  1BXD A;  4JV5 E;  3G7E A;  3G7B A;  5LMN E;  4EM7 A;  4ASB A;  2BYI A;  3QTF A;  3T1Y I;  4O04 A;  1YC4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...