4P7AA

Crystal structure of human mlh1
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
334
structure length
303
Chain Sequence
FVAGVIRRLDETVVNRIAAGEVIQRPANAIKEMIENCLDAKSTSIQVIVKEGGLKLIQIQDNGTGIRKEDLDIVCERFTTSKLGFRGEALASISHVAHVTITTKTADGKCAYRASYSDGKLKAPPKPCAGNQGTQITVEDLFYNIATRRKALKNPSEEYGKILEVVGRYSVHNAGISFSVKKQGETVADVRTLPNASTVDNIRSIFGNAVSRELIEIGCEDKTLAFKMNGYISNANYSVKKCIFLLFINHRLVESTSLRKAIETVYAAYLPKNTHPFLYLSLEISPESILERVQQHIESKLLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA mismatch repair protein Mlh1
publication title Structure of the human MLH1 N-terminus: implications for predisposition to Lynch syndrome.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 88
structure length 303
sequence length 334
ec nomenclature
pdb deposition date 2014-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01119 DNA_mis_repair DNA mismatch repair protein, C-terminal domain
A PF13589 HATPase_c_3 Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4p7aA02
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 4p7aA01
1N33E 3SL2A 3J81C 1HR0E 5D6PA 4MYUA 1US7A 2PNRA 2YE8A 2YECA 4DPYA 4JAVA 1HNWE 1Y4SA 2XX5A 3J80Q 2UXCI 2E5LE 4DV5E 4DV0E 1UEKA 3FT8A 4HY1A 1YT1A 1I5CA 1UYLA 1IBKE 3VHCA 3G75A 1FJGE 1HNXE 1I5AA 4CWRA 1QYEA 3R92A 4LFCI 2HK2A 4DU8A 1ZM2A 2BU6A 4LF6E 2HFUA 2YGAA 4XKAA 2HFSA 2UU9E 2BU2A 4DV1I 4KTNA 2UWDA 3D2RA 4CWTA 3HHUA 3U2DA 3CWVA 3GONA 2GQPA 2WI6A 4CWFA 5J6AA 3TZ2A 4X66I 4PU9A 1YC4A 3EHJA 4NXME 3HZ1A 4QPKA 2BYHA 4LWHA 2WI4A 3J7AG 2HHHI 1Z0EA 2WI1A 4U7OA 4XIQA 4R1FA 2CG9A 4HXZA 4JI0I 3Q1QA 1YSZA 2YGEA 5D6QA 4EGKA 4CWPA 3K99A 4ASBA 4USKA 1XMOE 1UY6A 2YE6A 4OX9E 3D36A 1Z0GA 2CZ9A 4JYAI 3K98A 2V34A 3D4JA 5BR8I 1S4EA 3Q5JA 2YEGA 4XIPA 2XDXA 2BZ5A 2FXSA 1HNZE 5GMEA 3T1KA 2QFOA 2ZDXA 2VWCA 4JI1E 4JI6E 4H7QA 5FNFA 2BYIA 4GKKI 4URMA 3TUHA 4HYMA 4DR5I 3KE6A 3B78A 4X65E 1Y8NA 3T1HI 3F0NA 4LF5I 4LF9E 5D7DA 3EHHA 4BAEA 2A2CA 1TILA 2IWXA 2DEIA 4EGHA 1YS3A 4XCLA 5LMNE 2C2AA 4Q20A 4BQGA 2QG0A 2XDUA 4K4OA 4M1KA 4EFUA 3JAMC 4KP4A 2ZDYA 3A0ZA 4UT4A 1N32E 4E02A 5CTWA 4JI7E 4RPFA 4AS9A 4I5SA 1AH8A 1N34E 3R4MA 4UTGA 4WUCA 4LFAI 3R4NA 2YEDA 4YKYA 4DV3E 1UYGA 4NH7A 1B63A 3EKRA 1MG7A 1I5DA 4JI2I 2DEJA 4B3SE 3QT7A 2E5LI 2K5BA 4DV5I 4DV0I 2IORA 4BXIA 3DGEA 2XD6A 4LF8E 3NMQA 4KFGA 1IBKI 1I58A 2FYPA 2YKBA 5M4NA 4HACB 5LL6R 1HNXI 4ZKIA 2UUCE 1Y4UA 3A0RA 4YKZA 1A6FA 4EEHA 1ZW9A 2X7IA 2AJ4A 4LF6I 4HYPA 4LWGA 1PVGA 3QT6A 4L90A 2UU9I 4H81A 4JI3E 3RKZA 2O1WA 1FWLA 1GKXA 2IOPA 1Z5CA 1FWKA 2R3VA 4MB9A 4NH9A 4JV5I 1TC0A 4DV4E 1H74A 3PEJA 2O1UA 5J71A 3OWDA 2HKJA 1IBLE 4LWFA 4DV6E 4NXMI 3J7AM 4K0KE 2OI2A 2FWZA 3T2SA 1J5EI 2Q8GA 5LMUI 1BKNA 2YKJA 4XTJA 4YHHE 4X9LA 2VW5A 5CTYA 5A2QC 2XK2A 3HEKA 1ZM3A 4JI8E 3PYDA 2UUBE 2XJJA 2UXBI 4YY3I 5D7RA 2XDLA 4KQVA 2YKCA 5GGZA 4LWIA 1XNRE 3T0HA 4CWNA 3BMYA 3PEHA 4HY6A 2VQFE 3HYYA 4JI1I 3GIEA 4JI4I 4JI6I 4JAUA 4JQLA 2YE2A 4FW9A 1XMQE 2GFDA 3Q5LA 4DR6E 4WUDA 2YI7A 5IN9A 3LTOA 3GIFA 4L93A 4R3AA 2NPFA 4AWOA 1ZM9A 4DV2E 2VQEE 2YE7A 4URNA 2BU7A 4MPNA 4KSHA 4XC0A 5LMNI 4FPPA 2ZKJA 2JKIA 1UYDA 2QG2A 4HXWA 1KKHA 2WW4A 1RR9A 4YKTA 2XEXA 4P52A 5F5RA 4DR2E 2VCJA 4DUZE 3B28A 3CRKA 1N32I 1H72C 3CGYA 4JI7I 2FWYA 2YEBA 4XDMA 3T0ZA 3QDDA 5F3KA 4H85A 4LPBA 3OTOE 4BIUA 1PIEA 1IBME 1EA6A 3JZ3A 1U0ZA 3GIGA 4YKQA 2CCUA 2YE5A 1VISA 3ZZUA 4DV3I 4LF7I 2YK2A 2YJWA 3B8HA 4LP0A 5FNDA 4B3ME 4EMDA 3C0EA 1YT0A 5IT9C 4B3SI 1XNQE 5FLXC 4DR3I 4CE1A 4DXLA 3PYFA 3ZKDA 2LJPA 4L8ZA 2ESAA 2UUAI 4U7NA 5CTUA 4FWHA 2XJXA 3H80A 2VCIA 4GKJE 4DPUA 4O04A 4DR7E 1H7UA 2YKIA 3V2UC 1N36E 3EHGA 2YEEA 3FT5A 4O0BA 1D6TA 5IDJA 4MBCA 1KTVA 3M6AA 4KHPE 3B25A 4NH8A 3ZM7A 1XHKA 4B7PA 5M4MA 2V2ZA 2E1RA 4JI3I 4DR4I 3J81Q 3FV5A 4CWOA 4JI5E 1NHIA 1BGQA 2YEIA 4DV4I 3PYGA 4FWGA 1KVKA 4E01A 4GGLA 1IBLI 1YETA 4I3HA 1UYEA 4L91A 1Z0VA 3B24A 1YC1A 2X36A 4B3TI 4WUBA 1I94I 4K0KI 4L94A 4NXNI 1N33I 3B26A 1HR0I 3IEDA 3WU5A 2XHXA 2WERA 4GT8A 5FWKA 3TTZA 2ZBKB 2XX4A 4LWEA 1HNWI 4LFCE 2QF6A 2UUBI 4JI8I 3QTFA 4EMVA 3J80C 2YGFA 4CE3A 4LFBE 4DR1E 1ZWHA 2YE9A 1B62A 1OJ4A 3OMUA 1FKAE 1FNMA 2VQFI 2YK9A 4KSGA 5IWAE 2XCMA 5M4HA 1ZXMA 1I5BA 2HK3A 2XHTA 1FJGI 1Z0CA 2VF3A 4AWQA 1H73A 4PRXA 3VADA 4DV2I 4E00A 3WQ9A 4Z7CA 2H8MA 1Z59A 1AM1A 1MX0A 4FMTA 5M4EA 1Y8OA 1K47A 4XE2A 2YI5A 2E0AA 1QZRA 2H55A 2HKEA 3QT5A 4O05A 4GQTA 4DR2I 4DUZI 4EM7A 2XHRA 2BU8A 3V5RA 2YE4A 4XCJA 3ZKBA 2WI3A 4PL9A 4X62E 1IBMI 4DUHA 4FCRA 4ED4A 3HYZA 2Q8HA 1FI4A 3H4LA 2BREA 4ASGA 3QT8A 1Z0BA 5L3JA 4B3MI 4GCZA 1XNQI 3R4OA 1XMOI 4OX9I 4XD8A 5M4PA 3G7BA 2XX2A 3OWBA 3VHDA 3MNRP 3K97A 4GKJI 2AKPA 1HNZI 1TC6A 2R42A 2BU5A 1WUUA 2JJCA 2O1VA 4O07A 3OW6A 1JM6A 1R62A 3WU4A 5GMDA 3JAMQ 3B27A 4QPJA 4KHPI 3T10A 4X65I 3U67A 4XIRA 4LF9I 5D7CA 2ZITA 3OPDA 4W7TA 4X64E 1YERA 1U2OA 4MPCA 4ASAA 4LFAE 4JI5I 1U2RA 2WI2A 4U93A 4AWPA 2V2QA 2F4VE 1YSRA 2YEFA 3O2FA 1YT2A 3O0IA 3K17A 4JI2E 3HZ5A 1UY9A 4V25A 4URLA 1I59A 2Q8IA 1S16A 3T1YE 1ZXNA 4LF4E 1EI1A 4XKKA 3D0BA 5C93A 2YKEA 2EXLA 1N34I 2V8PA 4B3RE 3Q5KA 3A0XA 3TZ5A 1RREA 4XKOA 1AMWA 1BYQA 1A4HA 1UYIA 4MOTA 3ZZTA 3ZXOA 3RLQA 2YEHA 3U2KA 1UYHA 2UXDE 4DPTA 4LFBI 4DR1I 1Z0WA 1NZ0A 1ELOA 3K1JA 3ZZ0A 2IWSA 2BM0A 3A0WA 4EGIA 3VHAA 2Q8FA 3EKOA 2J7KA 4LF8I 5IWAI 4BIZA 4YKUA 4YKXA 4MP7A 4JV5E 3WU6A 1UYCA 4DUYE 4AQYE 2WI7A 1AH6A 4DPWA 1KZNA 2UUCI 2XDKA 2XJGA 2Q2EB 1THNA 3LPSA 3A0YA 4DV7E 4HACA 4DZYA 3R91A 1J5EE 1TIDA 2ZM6E 2YI0A 5LMUE 1Z0TA 3G7EA 2YI6A 2YE3A 3INXA 3HULA 5A2QQ 3ZXQA 3RLPA 2UXBE 1NHHA 4YY3E 4X62I 2CCSA 2BV3A 5CTXA 2UXCE 4DV6I 2BT0A 2WEPA 1BXDA 1TBWA 4PRVA 1Y8PA 4JI4E 3K60A 1GKZA 4YHHI 4JG4A 4B6CA 2XABA 4MP2A 1Z5AA 4MPEA 4FCPA 4O09A 4EFTA 4R3MA 1YC3A 2BSMA 4XITA 1L0OA 1XNRI 4CE2A 4DU7A 2YJXA 4DV1E 4CWQA 4FN5A 5BODA 4MYTA 3WU3A 1MU5A 3GIGB 3TZ0A 1XMQI 3CRLA 4DR6I 4GEEA 5FNCA 3EHFA 1GJVA 2BM1A 2IOQA 2XDSA 2VQEI 4X64I 4YKWA 1KIJA 4FCQA 4X66E 3B82A 3BM9A 2F4VI 1N0VC 4HZ0A 3PYEA 4P7AA 4LF7E 4V26A 3A0TA 4FWDA 2HHHE 1YESA 1UYKA 2YEJA 4JI0E 4P8OA 3TZ4A 4DR3E 1ZM4A 5IT9Q 1UYFA 2A2DA 1UY7A 2V2VA 3T1YI 5FLXQ 1N0UA 2WI5A 2UUAE 2BTZA 4LF4I 3OTOI 4DPXA 5CPHA 4JYAE 2EFGA 5BR8E 4YKRA 4B3RI 4USMA 4UROA 1B3QA 3INWA 3LNUA 1OSFA 4CWSA 3CGZA 2HCHA 1H7SA 2UXDI 3WHAA 2CGFA 4GKKE 1UY8A 1PKPA 4GFNA 4HZ5A 3RLRA 4DR5E 5CF0A 4ZVIA 4ASFA 1TH8A 1DARA 1NHJA 3T1HE 4LF5E 4DR4E 4BQJA 5M4KA 1QY8A 2BRCA 2CCTA 4DUYI 1AJ6A 4AQYI 2HG1A 4DR7I 5IDMA 2CH4A 3R4PA 1Z5BA 1UYMA 5BOCA 1ID0A 2IWUA 3C11A 4JASA 1N36I 3O6OA 2GS8A 4DV7I 4Z7YA 4B3TE 1S14A 2WEQA 1I94E 2YEAA 4NXNE 2ZM6I
chains in the Genus database with same CATH superfamily
4OO1F 1N33E 3SL2A 4N3OA 3J81C 1YHCA 1HR0E 5D6PA 4MYUA 5JEAE 2Z5BA 4AIMA 1US7A 2C37B 4NBQA 4LCHA 1UDSA 2PNRA 2YE8A 3CYGA 2YECA 4DPYA 4JAVA 1HNWE 5C0XE 1Y4SA 2XX5A 3J80Q 2UXCI 2E5LE 4DV5E 4DV0E 1UEKA 3FT8A 4HY1A 1YT1A 1I5CA 1UYLA 1IBKE 3VHCA 2NN6D 1FJGE 4LCFA 1HNXE 1I5AA 3G75A 4CWRA 1QYEA 4U3BA 2C38A 3R92A 4LFCI 3M85G 2HK2A 4DU8A 1ZM2A 2BU6A 4LF6E 2HFUA 2YGAA 4XKAA 2HFSA 2JT2A 2PNLA 1Y60A 2Z5CA 2UU9E 2BU2A 4DV1I 4IFDC 4KTNA 3PS1A 1P42A 2UWDA 3D2RA 3U1KA 4CWTA 3HHUA 3U2DA 2PO0A 3CWVA 3GONA 2GQPA 2WI6A 4CWFA 5J6AA 3TZ2A 2WNRB 4X66I 4PU9A 5ELWA 5DROA 5C0XF 2NN6C 4NXME 1YC4A 2BYHA 3EHJA 3HZ1A 4LWHA 2WI4A 3S5TA 3J7AG 2HHHI 1Z0EA 2WI1A 4U7OA 4XIQA 4R1FA 4BA2A 2CG9A 4HXZA 4JI0I 3Q1QA 1YSZA 2YGEA 5D6QA 4EGKA 4CWPA 3K99A 4ASBA 4USKA 1XMOE 1UY6A 2YE6A 4OX9E 5JEAD 3D36A 1Z0GA 2CZ9A 4JYAI 3K98A 2V34A 3D4JA 5BR8I 1S4EA 1UDQA 2YEGA 3Q5JA 2XDXA 2BZ5A 4XIPA 5IDJA 2FXSA 1VI7A 1HNZE 5GMEA 3T1KA 5C0XD 2QFOA 2ZDXA 5K36D 4JI1E 2VWCA 4JI6E 4H7QA 2NN6B 5FNFA 2BYIA 4GKKI 4URMA 3TUHA 4HYMA 4DR5I 3KE6A 3B78A 5EL9A 4X65E 3T1HI 3F0NA 4LF5I 4LF9E 2BA0D 1Y8NA 3EHHA 5D7DA 4BAEA 2A2CA 1TILA 2IWXA 2DEIA 4EGHA 1YS3A 2JEAB 4XCLA 5LMNE 2C2AA 4Q20A 4BQGA 5EKWA 5JEAC 2QG0A 2XDUA 4K4OA 4M1KA 4EFUA 3JAMC 4FW6A 2ZDYA 4KP4A 3A0ZA 4UT4A 1N32E 4E02A 5CTWA 4JI7E 3CDJA 5C0XC 3CDIA 4RPFA 5K36C 2JEBB 4AS9A 1E3PA 3P76A 4I5SA 1AH8A 1N34E 3R4MA 4UTGA 4WUCA 4MU3A 4LFAI 3U1YA 3R4NA 2YEDA 4YKYA 4MU1A 4DV3E 1UYGA 4NH7A 1B63A 3EKRA 1MG7A 3GMEA 1I5DA 4JI2I 3P3EA 2DEJA 4B3SE 3QT7A 4J3DA 2E5LI 5JEAB 4MQYA 4DV5I 2K5BA 2O1TA 4DV0I 2NN6E 2IORA 4BXIA 3DGEA 1IXMA 2XD6A 4LF8E 3NMQA 4KFGA 1IBKI 1I58A 2FYPA 2YKBA 5M4NA 4HACB 5K36B 5LL6R 1HNXI 3UHMA 4ZKIA 4FW7A 2UUCE 1Y4UA 3A0RA 4YKZA 1A6FA 4LOMA 4EEHA 1ZW9A 2X7IA 2AJ4A 4LF6I 4HYPA 4LWGA 4IS9A 1PVGA 3QT6A 2WP8B 4L90A 2UU9I 2PNZA 3Q6NA 4H81A 4JI3E 3H1CA 3RKZA 2O1WA 1FWLA 2IOPA 2VESA 1GKXA 1Z5CA 1FWKA 2R3VA 4MB9A 4NH9A 4JV5I 1TC0A 4FW4A 4DV4E 1H74A 3PEJA 2O1UA 5J71A 3OWDA 2HKJA 1IBLE 3PS2A 4LWFA 2J65A 4DV6E 4NXMI 3J7AM 4K0KE 2OI2A 2FWZA 3T2SA 1J5EI 2Q8GA 5LMUI 1BKNA 2YKJA 4XTJA 4YHHE 4IZJD 4X9LA 2NN6F 4ISAA 2VW5A 5CTYA 5A2QC 2XK2A 3HEKA 1ZM3A 4JI8E 3PYDA 2UUBE 5K36E 2UXBI 2XJJA 4YY3I 5D7RA 2XDLA 4KQVA 2YKCA 5GGZA 4LWIA 1XNRE 4IFDA 3T0HA 4CWNA 3BMYA 3PEHA 4HY6A 2VQFE 3HYYA 4JI1I 3GIEA 4JI4I 4JI6I 2BA1G 1OYSA 2YE2A 4JAUA 4JQLA 4FW9A 1XMQE 2GFDA 3Q5LA 4DR6E 4WUDA 2YI7A 5IN9A 3LTOA 3GIFA 4L93A 3NZKA 4OO1A 4R3AA 2NPFA 4AWOA 1ZM9A 4DV2E 2VQEE 2YE7A 4URNA 2BU7A 4OKGA 4QNJA 4MPNA 4KSHA 4XC0A 4BA1B 4AIDA 5LMNI 2ZKJA 4FPPA 2JKIA 1UYDA 2QG2A 4HXWA 1KKHA 1YH8A 5JENA 2WW4A 1RR9A 4YKTA 2XEXA 4P52A 5F5RA 4DR2E 2VCJA 4DUZE 3B28A 3CRKA 3L7ZB 1H72C 1N32I 4JI7I 5JEAF 2FWYA 2YEBA 3CGYA 4XDMA 3QDDA 5F3KA 3T0ZA 4H85A 4LPBA 3OTOE 4BIUA 1E3HA 3PRYA 1PIEA 1IBME 1EA6A 3JZ3A 1U0ZA 3GIGA 4YKQA 2CCUA 2YE5A 1VISA 3ZZUA 5K36F 4DV3I 4LF7I 4IZJB 2YJWA 3B8HA 2YK2A 2BR2B 2GQ0A 3DD6A 4EMDA 4B3ME 4LP0A 5FNDA 4FW3A 3C0EA 1YT0A 5IT9C 1UDOA 2PO2A 4B3SI 1XNQE 4LPFA 5FLXC 4DR3I 4DXLA 4CE1A 3PYFA 2BA0G 3ZKDA 2LJPA 4L8ZA 2ESAA 2UUAI 4U7NA 4IZKA 5CTUA 1R6MA 4FWHA 2XJXA 3HJCA 2PO1B 2VCIA 3H80A 4GKJE 4DPUA 4O04A 4DR7E 1H7UA 2YKIA 3V2UC 2Z5BB 1N36E 3EHGA 2YEEA 3FT5A 2IESA 5C0XA 1D6TA 4O0BA 2C39A 2C1GA 1KTVA 3M6AA 4KHPE 3B25A 4MBCA 3ZM7A 1XHKA 4NH8A 4B7PA 2V2ZA 2E1RA 4JI3I 4DR4I 5M4MA 3J81Q 4OZEA 3FV5A 2IERA 4CWOA 4E72A 4JI5E 1NHIA 1BGQA 2YEIA 4DV4I 3PYGA 4FWGA 1KVKA 4E01A 4GGLA 1IBLI 1YETA 2O3ZA 4I3HA 1UYEA 2JE6A 1Z0VA 3B24A 4L91A 1YC1A 2X36A 4B3TI 4WUBA 1I94I 4K0KI 2C38B 4L94A 4NXNI 1N33I 2GO4A 3B26A 1HR0I 3IEDA 3WU5A 2XHXA 2WERA 4GT8A 2Z5CB 5FWKA 3TTZA 2F1DA 2ZBKB 3P3GA 2XX4A 4LWEA 1HNWI 4LFCE 2QF6A 2UUBI 4JI8I 3QTFA 4MDTA 4EMVA 3J80C 2YGFA 4CE3A 4LFBE 4DR1E 2C37A 1ZWHA 2YE9A 1B62A 4U3DA 3M7NG 1OJ4A 3OMUA 1OYRA 1FNMA 2PO0B 2VQFI 1FKAE 2YK9A 3GCMA 4KSGA 5IWAE 2XCMA 5M4HA 1ZXMA 1I5BA 2HK3A 2XHTA 1FJGI 1Z0CA 2VF3A 4AWQA 1H73A 4PRXA 3VADA 4DV2I 4BA2B 4E00A 1Y5YA 3WQ9A 4Z7CA 2H8MA 1RHYA 1Z59A 1MX0A 1AM1A 4FMTA 5M4EA 1Y8OA 1K47A 4XE2A 2YI5A 5DRPA 3B4TA 2E0AA 1QZRA 4OO1E 2H55A 2HKEA 3QT5A 4O05A 4GQTA 4DR2I 2PNMA 4DUZI 2XHRA 4EM7A 2BU8A 3V5RA 2YE4A 4XCJA 3ZKBA 2WI3A 4PL9A 4X62E 1IBMI 4DUHA 4FCRA 4ED4A 3HYZA 2Q8HA 1FI4A 3H4LA 2BREA 4ASGA 3QT8A 1Z0BA 2GO3A 5L3JA 4B3MI 4GCZA 2WNRA 5DRQA 1XNQI 3R4OA 1XMOI 3LMMA 4OX9I 4XD8A 5M4PA 3G7BA 2XX2A 3OWBA 4QPKA 3VHDA 3MNRP 3K97A 4GKJI 2AKPA 1HNZI 1TC6A 2R42A 2BU5A 1WUUA 2O1VA 2JJCA 4O07A 3OW6A 1JM6A 1R62A 3WU4A 4LCGA 5GMDA 3JAMQ 3B27A 4KHPI 4QPJA 3T10A 4X65I 3P3CA 3U67A 4XIRA 4LF9I 5D7CA 2ZITA 3OPDA 4W7TA 4X64E 1YERA 1U2OA 2NN6A 3P06A 4MPCA 4ASAA 4LFAE 4JI5I 1U2RA 2WI2A 4U93A 4AWPA 2V2QA 2F4VE 1YSRA 2YEFA 4IFDD 1Y6ZA 4MU0A 3O2FA 1YT2A 3O0IA 1R6LA 3K17A 4JI2E 3HZ5A 1UDNA 1UY9A 4V25A 4URLA 1I59A 2Q8IA 2JEAA 1S16A 3T1YE 1ZXNA 4LF4E 1EI1A 4XKKA 4OO1D 3D0BA 5C93A 2YKEA 2EXLA 1N34I 2V8PA 4B3RE 3Q5KA 3A0XA 3TZ5A 1RREA 4XKOA 2PNZB 1AMWA 1BYQA 1A4HA 1UYIA 4MOTA 3ZZTA 3ZXOA 1XXEA 3RLQA 2YEHA 3U2KA 1UYHA 2UXDE 2JEBA 4DPTA 4LFBI 4DR1I 1Z0WA 1NZ0A 1ELOA 3K1JA 2AE8A 3ZZ0A 2IWSA 1HK7A 2BM0A 3A0WA 4EGIA 4QNKA 3VHAA 2Q8FA 3EKOA 2J7KA 4LF8I 2BA1D 5IWAI 4BIZA 4YKUA 4FW5A 4MP7A 4YKXA 4JV5E 3WU6A 1UYCA 4DUYE 4AQYE 5JEAA 2WI7A 1AH6A 4DPWA 1KZNA 2UUCI 2XDKA 2XJGA 2Q2EB 4OO1C 1THNA 3LPSA 3M85D 4DV7E 3A0YA 4HACA 4DZYA 5K36A 1J5EE 3GLLA 2ZM6E 1TIDA 2YI0A 5LMUE 3R91A 1Z0TA 3G7EA 2YI6A 2YE3A 5DNXA 4IFDB 3INXA 2CGEA 2WP8A 3HULA 5A2QQ 3ZXQA 3RLPA 2UXBE 1NHHA 4YY3E 4X62I 2CCSA 2BV3A 5CTXA 2UXCE 4DV6I 2BT0A 1USUA 4OO1B 2WEPA 1BXDA 1TBWA 4PRVA 1Y8PA 4JI4E 1OYPA 3K60A 1GKZA 5DRRA 4YHHI 4JG4A 4B6CA 2XABA 2Z5EA 4MP2A 1Z5AA 4MPEA 4FCPA 4O09A 4EFTA 4R3MA 1YC3A 2BSMA 4XITA 1L0OA 3K85A 1XNRI 2CVEA 4CE2A 1USVA 4DU7A 2YJXA 3KRNA 4DV1E 4CWQA 4FN5A 5BODA 4MYTA 3WU3A 1MU5A 3GIGB 3TZ0A 1XMQI 3CRLA 4DR6I 4GEEA 5FNCA 3PS3A 3EHFA 1GJVA 2BM1A 2IOQA 4IFDE 2XDSA 2VQEI 4X64I 2PO2B 1KIJA 4FCQA 4X66E 4YKWA 3B82A 3BM9A 2F4VI 1N0VC 4HZ0A 3PYEA 4P7AA 4LF7E 4V26A 3A0TA 4FWDA 2HHHE 1YESA 1UYKA 2HHIA 4IZKB 2YEJA 4JI0E 1F51A 4P8OA 3TZ4A 4DR3E 1ZM4A 5IT9Q 1UYFA 2A2DA 1UY7A 2V2VA 3T1YI 4BA1A 1N0UA 5FLXQ 2WI5A 2UUAE 2BTZA 4LF4I 3OTOI 4DPXA 5CPHA 4JYAE 2EFGA 5BR8E 5C0XB 4B3RI 4YKRA 2C39B 4USMA 4UROA 1B3QA 2C1IA 3L7ZA 3INWA 3LNUA 1OSFA 4CWSA 3CGZA 2HCHA 1H7SA 2UXDI 3WHAA 2CGFA 4GKKE 1UY8A 1PKPA 4GFNA 4HZ5A 3RLRA 4DR5E 5CF0A 4ZVIA 4ASFA 4MU4A 3M7ND 1TH8A 1DARA 1NHJA 3T1HE 4LF5E 4DR4E 4BQJA 5M4KA 4IZJA 2BR2A 2JE6B 1QY8A 2BRCA 2CCTA 4GQUA 4AM3A 4IFDF 4DUYI 1AJ6A 4AQYI 2HG1A 4DR7I 5IDMA 5DNLA 2CH4A 1Z5BA 1UYMA 3R4PA 5BOCA 1ID0A 2IWUA 2FTKA 3C11A 4JASA 1N36I 3O6OA 2GS8A 4DV7I 3HKMA 4Z7YA 3Q6MA 4B3TE 2PO1A 1I94E 1S14A 2WEQA 2YEAA 4NXNE 2ZM6I
chains in the Genus database with same CATH topology
1N33E 3SL2A 4N3OA 3J81C 1HR0E 5D6PA 4MYUA 2Z5BA 1US7A 2PNRA 2YE8A 2YECA 4DPYA 4JAVA 1HNWE 1Y4SA 2XX5A 3J80Q 2UXCI 2E5LE 4DV5E 4DV0E 1UEKA 3FT8A 4HY1A 1YT1A 1I5CA 1UYLA 1IBKE 3VHCA 3G75A 1FJGE 1HNXE 1I5AA 4CWRA 1QYEA 3R92A 4LFCI 2HK2A 4DU8A 1ZM2A 2BU6A 4LF6E 2HFUA 2YGAA 4XKAA 2HFSA 2PNLA 2Z5CA 2UU9E 2BU2A 4DV1I 4KTNA 2UWDA 3D2RA 4CWTA 3HHUA 3U2DA 3CWVA 3GONA 2GQPA 2WI6A 4CWFA 5J6AA 3TZ2A 4X66I 4PU9A 1YC4A 3EHJA 4NXME 3HZ1A 4QPKA 2BYHA 4LWHA 2WI4A 3J7AG 2HHHI 1Z0EA 2WI1A 4U7OA 4XIQA 4R1FA 2CG9A 4HXZA 4JI0I 3Q1QA 1YSZA 2YGEA 5D6QA 4EGKA 4CWPA 3K99A 4ASBA 4USKA 1XMOE 1UY6A 2YE6A 4OX9E 3D36A 1Z0GA 2CZ9A 4JYAI 3K98A 2V34A 3D4JA 5BR8I 1S4EA 3Q5JA 2YEGA 4XIPA 2XDXA 2BZ5A 2FXSA 1HNZE 5GMEA 3T1KA 2QFOA 2ZDXA 2VWCA 4JI1E 4JI6E 4H7QA 5FNFA 2BYIA 4GKKI 4URMA 3TUHA 4HYMA 4DR5I 3KE6A 3B78A 4X65E 1Y8NA 3T1HI 3F0NA 4LF5I 4LF9E 5D7DA 3EHHA 4BAEA 2A2CA 1TILA 2IWXA 2DEIA 4EGHA 1YS3A 4XCLA 5LMNE 2C2AA 4Q20A 4BQGA 2QG0A 2XDUA 4K4OA 4M1KA 4EFUA 3JAMC 4KP4A 2ZDYA 3A0ZA 4UT4A 1N32E 4E02A 5CTWA 4JI7E 4RPFA 4AS9A 4I5SA 1AH8A 1N34E 3R4MA 4UTGA 4WUCA 4LFAI 3R4NA 2YEDA 4YKYA 4DV3E 1UYGA 4NH7A 1B63A 3EKRA 1MG7A 1I5DA 4JI2I 2DEJA 4B3SE 3QT7A 2E5LI 2K5BA 4DV5I 2O1TA 4DV0I 2IORA 4BXIA 3DGEA 2XD6A 4LF8E 3NMQA 4KFGA 1IBKI 1I58A 2FYPA 2YKBA 5M4NA 4HACB 5LL6R 1HNXI 4ZKIA 2UUCE 1Y4UA 3A0RA 4YKZA 1A6FA 4EEHA 1ZW9A 2X7IA 2AJ4A 4LF6I 4HYPA 4LWGA 1PVGA 3QT6A 4L90A 2UU9I 3Q6NA 4H81A 4JI3E 3RKZA 2O1WA 1FWLA 2IOPA 1GKXA 1Z5CA 1FWKA 2R3VA 4MB9A 4NH9A 4JV5I 1TC0A 4DV4E 1H74A 3PEJA 2O1UA 5J71A 3OWDA 2HKJA 1IBLE 4LWFA 4DV6E 4NXMI 3J7AM 4K0KE 2OI2A 2FWZA 3T2SA 1J5EI 2Q8GA 5LMUI 1BKNA 2YKJA 4XTJA 4YHHE 4IZJD 4X9LA 2VW5A 5CTYA 5A2QC 2XK2A 3HEKA 1ZM3A 4JI8E 3PYDA 2UUBE 2XJJA 2UXBI 4YY3I 5D7RA 2XDLA 4KQVA 2YKCA 5GGZA 4LWIA 1XNRE 3T0HA 4CWNA 3BMYA 3PEHA 4HY6A 2VQFE 3HYYA 4JI1I 3GIEA 4JI4I 4JI6I 4JAUA 4JQLA 2YE2A 4FW9A 1XMQE 2GFDA 3Q5LA 4DR6E 4WUDA 2YI7A 5IN9A 3LTOA 3GIFA 4L93A 4R3AA 2NPFA 4AWOA 1ZM9A 4DV2E 2VQEE 2YE7A 4URNA 2BU7A 4MPNA 4KSHA 4XC0A 5LMNI 4FPPA 2ZKJA 2JKIA 1UYDA 2QG2A 4HXWA 1KKHA 2WW4A 1RR9A 4YKTA 2XEXA 4P52A 5F5RA 4DR2E 2VCJA 4DUZE 3B28A 3CRKA 1N32I 1H72C 3CGYA 4JI7I 2FWYA 2YEBA 4XDMA 3T0ZA 3QDDA 5F3KA 4H85A 4LPBA 3OTOE 4BIUA 3PRYA 1PIEA 1IBME 1EA6A 3JZ3A 1U0ZA 3GIGA 4YKQA 2CCUA 2YE5A 1VISA 3ZZUA 4DV3I 4LF7I 4IZJB 2YJWA 3B8HA 2YK2A 4LP0A 2GQ0A 4B3ME 4EMDA 5FNDA 3C0EA 1YT0A 5IT9C 4B3SI 1XNQE 5FLXC 4DR3I 4CE1A 4DXLA 3PYFA 3ZKDA 2LJPA 4L8ZA 2ESAA 2UUAI 4U7NA 4IZKA 5CTUA 4FWHA 2XJXA 3HJCA 3H80A 2VCIA 4GKJE 4DPUA 4O04A 4DR7E 1H7UA 2YKIA 3V2UC 2Z5BB 1N36E 3EHGA 2YEEA 3FT5A 4O0BA 1D6TA 5IDJA 4MBCA 1KTVA 3M6AA 4KHPE 3B25A 4NH8A 3ZM7A 1XHKA 4B7PA 5M4MA 2V2ZA 2E1RA 4JI3I 4DR4I 3J81Q 3FV5A 4CWOA 4JI5E 1NHIA 1BGQA 2YEIA 4DV4I 3PYGA 4FWGA 1KVKA 4E01A 4GGLA 1IBLI 1YETA 4I3HA 1UYEA 4L91A 1Z0VA 3B24A 1YC1A 2X36A 4B3TI 4WUBA 1I94I 4K0KI 4L94A 4NXNI 1N33I 3B26A 1HR0I 3IEDA 3WU5A 2XHXA 2WERA 4GT8A 2Z5CB 5FWKA 3TTZA 2ZBKB 2XX4A 4LWEA 1HNWI 4LFCE 2QF6A 2UUBI 4JI8I 3QTFA 4EMVA 3J80C 2YGFA 4CE3A 4LFBE 4DR1E 1ZWHA 2YE9A 1B62A 1OJ4A 3OMUA 1FKAE 1FNMA 2VQFI 2YK9A 4KSGA 5IWAE 2XCMA 5M4HA 1ZXMA 1I5BA 2HK3A 2XHTA 1FJGI 1Z0CA 2VF3A 4AWQA 1H73A 4PRXA 3VADA 4DV2I 4E00A 3WQ9A 4Z7CA 2H8MA 1Z59A 1AM1A 1MX0A 4FMTA 5M4EA 1Y8OA 1K47A 4XE2A 2YI5A 2E0AA 1QZRA 2H55A 2HKEA 3QT5A 4O05A 4GQTA 4DR2I 2PNMA 4DUZI 2XHRA 4EM7A 2BU8A 3V5RA 2YE4A 4XCJA 3ZKBA 2WI3A 4PL9A 4X62E 1IBMI 4DUHA 4FCRA 4ED4A 3HYZA 2Q8HA 1FI4A 3H4LA 2BREA 4ASGA 3QT8A 1Z0BA 5L3JA 4B3MI 4GCZA 1XNQI 3R4OA 1XMOI 4OX9I 4XD8A 5M4PA 3G7BA 2XX2A 3OWBA 3VHDA 3MNRP 3K97A 4GKJI 2AKPA 1HNZI 1TC6A 2R42A 2BU5A 1WUUA 2O1VA 2JJCA 4O07A 3OW6A 1JM6A 1R62A 3WU4A 5GMDA 3JAMQ 3B27A 4QPJA 4KHPI 3T10A 4X65I 3U67A 4XIRA 4LF9I 5D7CA 2ZITA 3OPDA 4W7TA 4X64E 1YERA 1U2OA 3P06A 4MPCA 4ASAA 4LFAE 4JI5I 1U2RA 2WI2A 4U93A 4AWPA 2V2QA 2F4VE 1YSRA 2YEFA 1Y6ZA 3O2FA 1YT2A 3O0IA 3K17A 4JI2E 3HZ5A 1UY9A 4V25A 4URLA 1I59A 2Q8IA 1S16A 3T1YE 1ZXNA 4LF4E 1EI1A 4XKKA 3D0BA 5C93A 2YKEA 2EXLA 1N34I 2V8PA 4B3RE 3Q5KA 3A0XA 3TZ5A 1RREA 4XKOA 1AMWA 1BYQA 1A4HA 1UYIA 4MOTA 3ZZTA 3ZXOA 3RLQA 2YEHA 3U2KA 1UYHA 2UXDE 4DPTA 4LFBI 4DR1I 1Z0WA 1NZ0A 1ELOA 3K1JA 3ZZ0A 2IWSA 1HK7A 2BM0A 3A0WA 4EGIA 3VHAA 2Q8FA 3EKOA 2J7KA 4LF8I 5IWAI 4BIZA 4YKUA 4YKXA 4MP7A 4JV5E 3WU6A 1UYCA 4DUYE 4AQYE 2WI7A 1AH6A 4DPWA 1KZNA 2UUCI 2XDKA 2XJGA 2Q2EB 1THNA 3LPSA 3A0YA 4DV7E 4HACA 4DZYA 3R91A 1J5EE 1TIDA 2ZM6E 2YI0A 5LMUE 1Z0TA 3G7EA 2YI6A 2YE3A 3INXA 2CGEA 3HULA 5A2QQ 3ZXQA 3RLPA 2UXBE 1NHHA 4YY3E 4X62I 2CCSA 2BV3A 5CTXA 2UXCE 4DV6I 2BT0A 1USUA 2WEPA 1BXDA 1TBWA 4PRVA 1Y8PA 4JI4E 3K60A 1GKZA 4YHHI 4JG4A 4B6CA 2XABA 2Z5EA 4MP2A 1Z5AA 4MPEA 4FCPA 4O09A 4EFTA 4R3MA 1YC3A 2BSMA 4XITA 1L0OA 3K85A 1XNRI 4CE2A 1USVA 4DU7A 2YJXA 4DV1E 4CWQA 4FN5A 5BODA 4MYTA 3WU3A 1MU5A 3GIGB 3TZ0A 1XMQI 3CRLA 4DR6I 4GEEA 5FNCA 3EHFA 1GJVA 2BM1A 2IOQA 2XDSA 2VQEI 4X64I 4YKWA 1KIJA 4FCQA 4X66E 3B82A 3BM9A 2F4VI 1N0VC 4HZ0A 3PYEA 4P7AA 4LF7E 4V26A 3A0TA 4FWDA 2HHHE 1YESA 1UYKA 4IZKB 2YEJA 4JI0E 4P8OA 3TZ4A 4DR3E 1ZM4A 5IT9Q 1UYFA 2A2DA 1UY7A 2V2VA 3T1YI 5FLXQ 1N0UA 2WI5A 2UUAE 2BTZA 4LF4I 3OTOI 4DPXA 5CPHA 4JYAE 2EFGA 5BR8E 4YKRA 4B3RI 4USMA 4UROA 1B3QA 3INWA 3LNUA 1OSFA 4CWSA 3CGZA 2HCHA 1H7SA 2UXDI 3WHAA 2CGFA 4GKKE 1UY8A 1PKPA 4GFNA 4HZ5A 3RLRA 4DR5E 5CF0A 4ZVIA 4ASFA 1TH8A 1DARA 1NHJA 3T1HE 4LF5E 4DR4E 4BQJA 5M4KA 4IZJA 1QY8A 2BRCA 2CCTA 4DUYI 1AJ6A 4AQYI 2HG1A 4DR7I 5IDMA 2CH4A 3R4PA 1Z5BA 1UYMA 5BOCA 1ID0A 2IWUA 3C11A 4JASA 1N36I 3O6OA 2GS8A 4DV7I 4Z7YA 3Q6MA 4B3TE 1S14A 1I94E 2WEQA 2YEAA 4NXNE 2ZM6I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N33 E;  3SL2 A;  3J81 C;  1HR0 E;  5D6P A;  4MYU A;  1US7 A;  2PNR A;  2YE8 A;  2YEC A;  4DPY A;  4JAV A;  1HNW E;  1Y4S A;  2XX5 A;  3J80 Q;  2UXC I;  2E5L E;  4DV5 E;  4DV0 E;  1UEK A;  3FT8 A;  4HY1 A;  1YT1 A;  1I5C A;  1UYL A;  1IBK E;  3VHC A;  3G75 A;  1FJG E;  1HNX E;  1I5A A;  4CWR A;  1QYE A;  3R92 A;  4LFC I;  2HK2 A;  4DU8 A;  1ZM2 A;  2BU6 A;  4LF6 E;  2HFU A;  2YGA A;  4XKA A;  2HFS A;  2UU9 E;  2BU2 A;  4DV1 I;  4KTN A;  2UWD A;  3D2R A;  4CWT A;  3HHU A;  3U2D A;  3CWV A;  3GON A;  2GQP A;  2WI6 A;  4CWF A;  5J6A A;  3TZ2 A;  4X66 I;  4PU9 A;  1YC4 A;  3EHJ A;  4NXM E;  3HZ1 A;  4QPK A;  2BYH A;  4LWH A;  2WI4 A;  3J7A G;  2HHH I;  1Z0E A;  2WI1 A;  4U7O A;  4XIQ A;  4R1F A;  2CG9 A;  4HXZ A;  4JI0 I;  3Q1Q A;  1YSZ A;  2YGE A;  5D6Q A;  4EGK A;  4CWP A;  3K99 A;  4ASB A;  4USK A;  1XMO E;  1UY6 A;  2YE6 A;  4OX9 E;  3D36 A;  1Z0G A;  2CZ9 A;  4JYA I;  3K98 A;  2V34 A;  3D4J A;  5BR8 I;  1S4E A;  3Q5J A;  2YEG A;  4XIP A;  2XDX A;  2BZ5 A;  2FXS A;  1HNZ E;  5GME A;  3T1K A;  2QFO A;  2ZDX A;  2VWC A;  4JI1 E;  4JI6 E;  4H7Q A;  5FNF A;  2BYI A;  4GKK I;  4URM A;  3TUH A;  4HYM A;  4DR5 I;  3KE6 A;  3B78 A;  4X65 E;  1Y8N A;  3T1H I;  3F0N A;  4LF5 I;  4LF9 E;  5D7D A;  3EHH A;  4BAE A;  2A2C A;  1TIL A;  2IWX A;  2DEI A;  4EGH A;  1YS3 A;  4XCL A;  5LMN E;  2C2A A;  4Q20 A;  4BQG A;  2QG0 A;  2XDU A;  4K4O A;  4M1K A;  4EFU A;  3JAM C;  4KP4 A;  2ZDY A;  3A0Z A;  4UT4 A;  1N32 E;  4E02 A;  5CTW A;  4JI7 E;  4RPF A;  4AS9 A;  4I5S A;  1AH8 A;  1N34 E;  3R4M A;  4UTG A;  4WUC A;  4LFA I;  3R4N A;  2YED A;  4YKY A;  4DV3 E;  1UYG A;  4NH7 A;  1B63 A;  3EKR A;  1MG7 A;  1I5D A;  4JI2 I;  2DEJ A;  4B3S E;  3QT7 A;  2E5L I;  2K5B A;  4DV5 I;  4DV0 I;  2IOR A;  4BXI A;  3DGE A;  2XD6 A;  4LF8 E;  3NMQ A;  4KFG A;  1IBK I;  1I58 A;  2FYP A;  2YKB A;  5M4N A;  4HAC B;  5LL6 R;  1HNX I;  4ZKI A;  2UUC E;  1Y4U A;  3A0R A;  4YKZ A;  1A6F A;  4EEH A;  1ZW9 A;  2X7I A;  2AJ4 A;  4LF6 I;  4HYP A;  4LWG A;  1PVG A;  3QT6 A;  4L90 A;  2UU9 I;  4H81 A;  4JI3 E;  3RKZ A;  2O1W A;  1FWL A;  1GKX A;  2IOP A;  1Z5C A;  1FWK A;  2R3V A;  4MB9 A;  4NH9 A;  4JV5 I;  1TC0 A;  4DV4 E;  1H74 A;  3PEJ A;  2O1U A;  5J71 A;  3OWD A;  2HKJ A;  1IBL E;  4LWF A;  4DV6 E;  4NXM I;  3J7A M;  4K0K E;  2OI2 A;  2FWZ A;  3T2S A;  1J5E I;  2Q8G A;  5LMU I;  1BKN A;  2YKJ A;  4XTJ A;  4YHH E;  4X9L A;  2VW5 A;  5CTY A;  5A2Q C;  2XK2 A;  3HEK A;  1ZM3 A;  4JI8 E;  3PYD A;  2UUB E;  2XJJ A;  2UXB I;  4YY3 I;  5D7R A;  2XDL A;  4KQV A;  2YKC A;  5GGZ A;  4LWI A;  1XNR E;  3T0H A;  4CWN A;  3BMY A;  3PEH A;  4HY6 A;  2VQF E;  3HYY A;  4JI1 I;  3GIE A;  4JI4 I;  4JI6 I;  4JAU A;  4JQL A;  2YE2 A;  4FW9 A;  1XMQ E;  2GFD A;  3Q5L A;  4DR6 E;  4WUD A;  2YI7 A;  5IN9 A;  3LTO A;  3GIF A;  4L93 A;  4R3A A;  2NPF A;  4AWO A;  1ZM9 A;  4DV2 E;  2VQE E;  2YE7 A;  4URN A;  2BU7 A;  4MPN A;  4KSH A;  4XC0 A;  5LMN I;  4FPP A;  2ZKJ A;  2JKI A;  1UYD A;  2QG2 A;  4HXW A;  1KKH A;  2WW4 A;  1RR9 A;  4YKT A;  2XEX A;  4P52 A;  5F5R A;  4DR2 E;  2VCJ A;  4DUZ E;  3B28 A;  3CRK A;  1N32 I;  1H72 C;  3CGY A;  4JI7 I;  2FWY A;  2YEB A;  4XDM A;  3T0Z A;  3QDD A;  5F3K A;  4H85 A;  4LPB A;  3OTO E;  4BIU A;  1PIE A;  1IBM E;  1EA6 A;  3JZ3 A;  1U0Z A;  3GIG A;  4YKQ A;  2CCU A;  2YE5 A;  1VIS A;  3ZZU A;  4DV3 I;  4LF7 I;  2YK2 A;  2YJW A;  3B8H A;  4LP0 A;  5FND A;  4B3M E;  4EMD A;  3C0E A;  1YT0 A;  5IT9 C;  4B3S I;  1XNQ E;  5FLX C;  4DR3 I;  4CE1 A;  4DXL A;  3PYF A;  3ZKD A;  2LJP A;  4L8Z A;  2ESA A;  2UUA I;  4U7N A;  5CTU A;  4FWH A;  2XJX A;  3H80 A;  2VCI A;  4GKJ E;  4DPU A;  4O04 A;  4DR7 E;  1H7U A;  2YKI A;  3V2U C;  1N36 E;  3EHG A;  2YEE A;  3FT5 A;  4O0B A;  1D6T A;  5IDJ A;  4MBC A;  1KTV A;  3M6A A;  4KHP E;  3B25 A;  4NH8 A;  3ZM7 A;  1XHK A;  4B7P A;  5M4M A;  2V2Z A;  2E1R A;  4JI3 I;  4DR4 I;  3J81 Q;  3FV5 A;  4CWO A;  4JI5 E;  1NHI A;  1BGQ A;  2YEI A;  4DV4 I;  3PYG A;  4FWG A;  1KVK A;  4E01 A;  4GGL A;  1IBL I;  1YET A;  4I3H A;  1UYE A;  4L91 A;  1Z0V A;  3B24 A;  1YC1 A;  2X36 A;  4B3T I;  4WUB A;  1I94 I;  4K0K I;  4L94 A;  4NXN I;  1N33 I;  3B26 A;  1HR0 I;  3IED A;  3WU5 A;  2XHX A;  2WER A;  4GT8 A;  5FWK A;  3TTZ A;  2ZBK B;  2XX4 A;  4LWE A;  1HNW I;  4LFC E;  2QF6 A;  2UUB I;  4JI8 I;  3QTF A;  4EMV A;  3J80 C;  2YGF A;  4CE3 A;  4LFB E;  4DR1 E;  1ZWH A;  2YE9 A;  1B62 A;  1OJ4 A;  3OMU A;  1FKA E;  1FNM A;  2VQF I;  2YK9 A;  4KSG A;  5IWA E;  2XCM A;  5M4H A;  1ZXM A;  1I5B A;  2HK3 A;  2XHT A;  1FJG I;  1Z0C A;  2VF3 A;  4AWQ A;  1H73 A;  4PRX A;  3VAD A;  4DV2 I;  4E00 A;  3WQ9 A;  4Z7C A;  2H8M A;  1Z59 A;  1AM1 A;  1MX0 A;  4FMT A;  5M4E A;  1Y8O A;  1K47 A;  4XE2 A;  2YI5 A;  2E0A A;  1QZR A;  2H55 A;  2HKE A;  3QT5 A;  4O05 A;  4GQT A;  4DR2 I;  4DUZ I;  4EM7 A;  2XHR A;  2BU8 A;  3V5R A;  2YE4 A;  4XCJ A;  3ZKB A;  2WI3 A;  4PL9 A;  4X62 E;  1IBM I;  4DUH A;  4FCR A;  4ED4 A;  3HYZ A;  2Q8H A;  1FI4 A;  3H4L A;  2BRE A;  4ASG A;  3QT8 A;  1Z0B A;  5L3J A;  4B3M I;  4GCZ A;  1XNQ I;  3R4O A;  1XMO I;  4OX9 I;  4XD8 A;  5M4P A;  3G7B A;  2XX2 A;  3OWB A;  3VHD A;  3MNR P;  3K97 A;  4GKJ I;  2AKP A;  1HNZ I;  1TC6 A;  2R42 A;  2BU5 A;  1WUU A;  2JJC A;  2O1V A;  4O07 A;  3OW6 A;  1JM6 A;  1R62 A;  3WU4 A;  5GMD A;  3JAM Q;  3B27 A;  4QPJ A;  4KHP I;  3T10 A;  4X65 I;  3U67 A;  4XIR A;  4LF9 I;  5D7C A;  2ZIT A;  3OPD A;  4W7T A;  4X64 E;  1YER A;  1U2O A;  4MPC A;  4ASA A;  4LFA E;  4JI5 I;  1U2R A;  2WI2 A;  4U93 A;  4AWP A;  2V2Q A;  2F4V E;  1YSR A;  2YEF A;  3O2F A;  1YT2 A;  3O0I A;  3K17 A;  4JI2 E;  3HZ5 A;  1UY9 A;  4V25 A;  4URL A;  1I59 A;  2Q8I A;  1S16 A;  3T1Y E;  1ZXN A;  4LF4 E;  1EI1 A;  4XKK A;  3D0B A;  5C93 A;  2YKE A;  2EXL A;  1N34 I;  2V8P A;  4B3R E;  3Q5K A;  3A0X A;  3TZ5 A;  1RRE A;  4XKO A;  1AMW A;  1BYQ A;  1A4H A;  1UYI A;  4MOT A;  3ZZT A;  3ZXO A;  3RLQ A;  2YEH A;  3U2K A;  1UYH A;  2UXD E;  4DPT A;  4LFB I;  4DR1 I;  1Z0W A;  1NZ0 A;  1ELO A;  3K1J A;  3ZZ0 A;  2IWS A;  2BM0 A;  3A0W A;  4EGI A;  3VHA A;  2Q8F A;  3EKO A;  2J7K A;  4LF8 I;  5IWA I;  4BIZ A;  4YKU A;  4YKX A;  4MP7 A;  4JV5 E;  3WU6 A;  1UYC A;  4DUY E;  4AQY E;  2WI7 A;  1AH6 A;  4DPW A;  1KZN A;  2UUC I;  2XDK A;  2XJG A;  2Q2E B;  1THN A;  3LPS A;  3A0Y A;  4DV7 E;  4HAC A;  4DZY A;  3R91 A;  1J5E E;  1TID A;  2ZM6 E;  2YI0 A;  5LMU E;  1Z0T A;  3G7E A;  2YI6 A;  2YE3 A;  3INX A;  3HUL A;  5A2Q Q;  3ZXQ A;  3RLP A;  2UXB E;  1NHH A;  4YY3 E;  4X62 I;  2CCS A;  2BV3 A;  5CTX A;  2UXC E;  4DV6 I;  2BT0 A;  2WEP A;  1BXD A;  1TBW A;  4PRV A;  1Y8P A;  4JI4 E;  3K60 A;  1GKZ A;  4YHH I;  4JG4 A;  4B6C A;  2XAB A;  4MP2 A;  1Z5A A;  4MPE A;  4FCP A;  4O09 A;  4EFT A;  4R3M A;  1YC3 A;  2BSM A;  4XIT A;  1L0O A;  1XNR I;  4CE2 A;  4DU7 A;  2YJX A;  4DV1 E;  4CWQ A;  4FN5 A;  5BOD A;  4MYT A;  3WU3 A;  1MU5 A;  3GIG B;  3TZ0 A;  1XMQ I;  3CRL A;  4DR6 I;  4GEE A;  5FNC A;  3EHF A;  1GJV A;  2BM1 A;  2IOQ A;  2XDS A;  2VQE I;  4X64 I;  4YKW A;  1KIJ A;  4FCQ A;  4X66 E;  3B82 A;  3BM9 A;  2F4V I;  1N0V C;  4HZ0 A;  3PYE A;  4P7A A;  4LF7 E;  4V26 A;  3A0T A;  4FWD A;  2HHH E;  1YES A;  1UYK A;  2YEJ A;  4JI0 E;  4P8O A;  3TZ4 A;  4DR3 E;  1ZM4 A;  5IT9 Q;  1UYF A;  2A2D A;  1UY7 A;  2V2V A;  3T1Y I;  5FLX Q;  1N0U A;  2WI5 A;  2UUA E;  2BTZ A;  4LF4 I;  3OTO I;  4DPX A;  5CPH A;  4JYA E;  2EFG A;  5BR8 E;  4YKR A;  4B3R I;  4USM A;  4URO A;  1B3Q A;  3INW A;  3LNU A;  1OSF A;  4CWS A;  3CGZ A;  2HCH A;  1H7S A;  2UXD I;  3WHA A;  2CGF A;  4GKK E;  1UY8 A;  1PKP A;  4GFN A;  4HZ5 A;  3RLR A;  4DR5 E;  5CF0 A;  4ZVI A;  4ASF A;  1TH8 A;  1DAR A;  1NHJ A;  3T1H E;  4LF5 E;  4DR4 E;  4BQJ A;  5M4K A;  1QY8 A;  2BRC A;  2CCT A;  4DUY I;  1AJ6 A;  4AQY I;  2HG1 A;  4DR7 I;  5IDM A;  2CH4 A;  3R4P A;  1Z5B A;  1UYM A;  5BOC A;  1ID0 A;  2IWU A;  3C11 A;  4JAS A;  1N36 I;  3O6O A;  2GS8 A;  4DV7 I;  4Z7Y A;  4B3T E;  1S14 A;  2WEQ A;  1I94 E;  2YEA A;  4NXN E;  2ZM6 I; 
#chains in the Genus database with same CATH topology
 4OO1 F;  1N33 E;  3SL2 A;  4N3O A;  3J81 C;  1YHC A;  1HR0 E;  5D6P A;  4MYU A;  5JEA E;  2Z5B A;  4AIM A;  1US7 A;  2C37 B;  4NBQ A;  4LCH A;  1UDS A;  2PNR A;  2YE8 A;  3CYG A;  2YEC A;  4DPY A;  4JAV A;  1HNW E;  5C0X E;  1Y4S A;  2XX5 A;  3J80 Q;  2UXC I;  2E5L E;  4DV5 E;  4DV0 E;  1UEK A;  3FT8 A;  4HY1 A;  1YT1 A;  1I5C A;  1UYL A;  1IBK E;  3VHC A;  2NN6 D;  1FJG E;  4LCF A;  1HNX E;  1I5A A;  3G75 A;  4CWR A;  1QYE A;  4U3B A;  2C38 A;  3R92 A;  4LFC I;  3M85 G;  2HK2 A;  4DU8 A;  1ZM2 A;  2BU6 A;  4LF6 E;  2HFU A;  2YGA A;  4XKA A;  2HFS A;  2JT2 A;  2PNL A;  1Y60 A;  2Z5C A;  2UU9 E;  2BU2 A;  4DV1 I;  4IFD C;  4KTN A;  3PS1 A;  1P42 A;  2UWD A;  3D2R A;  3U1K A;  4CWT A;  3HHU A;  3U2D A;  2PO0 A;  3CWV A;  3GON A;  2GQP A;  2WI6 A;  4CWF A;  5J6A A;  3TZ2 A;  2WNR B;  4X66 I;  4PU9 A;  5ELW A;  5DRO A;  5C0X F;  2NN6 C;  4NXM E;  1YC4 A;  2BYH A;  3EHJ A;  3HZ1 A;  4LWH A;  2WI4 A;  3S5T A;  3J7A G;  2HHH I;  1Z0E A;  2WI1 A;  4U7O A;  4XIQ A;  4R1F A;  4BA2 A;  2CG9 A;  4HXZ A;  4JI0 I;  3Q1Q A;  1YSZ A;  2YGE A;  5D6Q A;  4EGK A;  4CWP A;  3K99 A;  4ASB A;  4USK A;  1XMO E;  1UY6 A;  2YE6 A;  4OX9 E;  5JEA D;  3D36 A;  1Z0G A;  2CZ9 A;  4JYA I;  3K98 A;  2V34 A;  3D4J A;  5BR8 I;  1S4E A;  1UDQ A;  2YEG A;  3Q5J A;  2XDX A;  2BZ5 A;  4XIP A;  5IDJ A;  2FXS A;  1VI7 A;  1HNZ E;  5GME A;  3T1K A;  5C0X D;  2QFO A;  2ZDX A;  5K36 D;  4JI1 E;  2VWC A;  4JI6 E;  4H7Q A;  2NN6 B;  5FNF A;  2BYI A;  4GKK I;  4URM A;  3TUH A;  4HYM A;  4DR5 I;  3KE6 A;  3B78 A;  5EL9 A;  4X65 E;  3T1H I;  3F0N A;  4LF5 I;  4LF9 E;  2BA0 D;  1Y8N A;  3EHH A;  5D7D A;  4BAE A;  2A2C A;  1TIL A;  2IWX A;  2DEI A;  4EGH A;  1YS3 A;  2JEA B;  4XCL A;  5LMN E;  2C2A A;  4Q20 A;  4BQG A;  5EKW A;  5JEA C;  2QG0 A;  2XDU A;  4K4O A;  4M1K A;  4EFU A;  3JAM C;  4FW6 A;  2ZDY A;  4KP4 A;  3A0Z A;  4UT4 A;  1N32 E;  4E02 A;  5CTW A;  4JI7 E;  3CDJ A;  5C0X C;  3CDI A;  4RPF A;  5K36 C;  2JEB B;  4AS9 A;  1E3P A;  3P76 A;  4I5S A;  1AH8 A;  1N34 E;  3R4M A;  4UTG A;  4WUC A;  4MU3 A;  4LFA I;  3U1Y A;  3R4N A;  2YED A;  4YKY A;  4MU1 A;  4DV3 E;  1UYG A;  4NH7 A;  1B63 A;  3EKR A;  1MG7 A;  3GME A;  1I5D A;  4JI2 I;  3P3E A;  2DEJ A;  4B3S E;  3QT7 A;  4J3D A;  2E5L I;  5JEA B;  4MQY A;  4DV5 I;  2K5B A;  2O1T A;  4DV0 I;  2NN6 E;  2IOR A;  4BXI A;  3DGE A;  1IXM A;  2XD6 A;  4LF8 E;  3NMQ A;  4KFG A;  1IBK I;  1I58 A;  2FYP A;  2YKB A;  5M4N A;  4HAC B;  5K36 B;  5LL6 R;  1HNX I;  3UHM A;  4ZKI A;  4FW7 A;  2UUC E;  1Y4U A;  3A0R A;  4YKZ A;  1A6F A;  4LOM A;  4EEH A;  1ZW9 A;  2X7I A;  2AJ4 A;  4LF6 I;  4HYP A;  4LWG A;  4IS9 A;  1PVG A;  3QT6 A;  2WP8 B;  4L90 A;  2UU9 I;  2PNZ A;  3Q6N A;  4H81 A;  4JI3 E;  3H1C A;  3RKZ A;  2O1W A;  1FWL A;  2IOP A;  2VES A;  1GKX A;  1Z5C A;  1FWK A;  2R3V A;  4MB9 A;  4NH9 A;  4JV5 I;  1TC0 A;  4FW4 A;  4DV4 E;  1H74 A;  3PEJ A;  2O1U A;  5J71 A;  3OWD A;  2HKJ A;  1IBL E;  3PS2 A;  4LWF A;  2J65 A;  4DV6 E;  4NXM I;  3J7A M;  4K0K E;  2OI2 A;  2FWZ A;  3T2S A;  1J5E I;  2Q8G A;  5LMU I;  1BKN A;  2YKJ A;  4XTJ A;  4YHH E;  4IZJ D;  4X9L A;  2NN6 F;  4ISA A;  2VW5 A;  5CTY A;  5A2Q C;  2XK2 A;  3HEK A;  1ZM3 A;  4JI8 E;  3PYD A;  2UUB E;  5K36 E;  2UXB I;  2XJJ A;  4YY3 I;  5D7R A;  2XDL A;  4KQV A;  2YKC A;  5GGZ A;  4LWI A;  1XNR E;  4IFD A;  3T0H A;  4CWN A;  3BMY A;  3PEH A;  4HY6 A;  2VQF E;  3HYY A;  4JI1 I;  3GIE A;  4JI4 I;  4JI6 I;  2BA1 G;  1OYS A;  2YE2 A;  4JAU A;  4JQL A;  4FW9 A;  1XMQ E;  2GFD A;  3Q5L A;  4DR6 E;  4WUD A;  2YI7 A;  5IN9 A;  3LTO A;  3GIF A;  4L93 A;  3NZK A;  4OO1 A;  4R3A A;  2NPF A;  4AWO A;  1ZM9 A;  4DV2 E;  2VQE E;  2YE7 A;  4URN A;  2BU7 A;  4OKG A;  4QNJ A;  4MPN A;  4KSH A;  4XC0 A;  4BA1 B;  4AID A;  5LMN I;  2ZKJ A;  4FPP A;  2JKI A;  1UYD A;  2QG2 A;  4HXW A;  1KKH A;  1YH8 A;  5JEN A;  2WW4 A;  1RR9 A;  4YKT A;  2XEX A;  4P52 A;  5F5R A;  4DR2 E;  2VCJ A;  4DUZ E;  3B28 A;  3CRK A;  3L7Z B;  1H72 C;  1N32 I;  4JI7 I;  5JEA F;  2FWY A;  2YEB A;  3CGY A;  4XDM A;  3QDD A;  5F3K A;  3T0Z A;  4H85 A;  4LPB A;  3OTO E;  4BIU A;  1E3H A;  3PRY A;  1PIE A;  1IBM E;  1EA6 A;  3JZ3 A;  1U0Z A;  3GIG A;  4YKQ A;  2CCU A;  2YE5 A;  1VIS A;  3ZZU A;  5K36 F;  4DV3 I;  4LF7 I;  4IZJ B;  2YJW A;  3B8H A;  2YK2 A;  2BR2 B;  2GQ0 A;  3DD6 A;  4EMD A;  4B3M E;  4LP0 A;  5FND A;  4FW3 A;  3C0E A;  1YT0 A;  5IT9 C;  1UDO A;  2PO2 A;  4B3S I;  1XNQ E;  4LPF A;  5FLX C;  4DR3 I;  4DXL A;  4CE1 A;  3PYF A;  2BA0 G;  3ZKD A;  2LJP A;  4L8Z A;  2ESA A;  2UUA I;  4U7N A;  4IZK A;  5CTU A;  1R6M A;  4FWH A;  2XJX A;  3HJC A;  2PO1 B;  2VCI A;  3H80 A;  4GKJ E;  4DPU A;  4O04 A;  4DR7 E;  1H7U A;  2YKI A;  3V2U C;  2Z5B B;  1N36 E;  3EHG A;  2YEE A;  3FT5 A;  2IES A;  5C0X A;  1D6T A;  4O0B A;  2C39 A;  2C1G A;  1KTV A;  3M6A A;  4KHP E;  3B25 A;  4MBC A;  3ZM7 A;  1XHK A;  4NH8 A;  4B7P A;  2V2Z A;  2E1R A;  4JI3 I;  4DR4 I;  5M4M A;  3J81 Q;  4OZE A;  3FV5 A;  2IER A;  4CWO A;  4E72 A;  4JI5 E;  1NHI A;  1BGQ A;  2YEI A;  4DV4 I;  3PYG A;  4FWG A;  1KVK A;  4E01 A;  4GGL A;  1IBL I;  1YET A;  2O3Z A;  4I3H A;  1UYE A;  2JE6 A;  1Z0V A;  3B24 A;  4L91 A;  1YC1 A;  2X36 A;  4B3T I;  4WUB A;  1I94 I;  4K0K I;  2C38 B;  4L94 A;  4NXN I;  1N33 I;  2GO4 A;  3B26 A;  1HR0 I;  3IED A;  3WU5 A;  2XHX A;  2WER A;  4GT8 A;  2Z5C B;  5FWK A;  3TTZ A;  2F1D A;  2ZBK B;  3P3G A;  2XX4 A;  4LWE A;  1HNW I;  4LFC E;  2QF6 A;  2UUB I;  4JI8 I;  3QTF A;  4MDT A;  4EMV A;  3J80 C;  2YGF A;  4CE3 A;  4LFB E;  4DR1 E;  2C37 A;  1ZWH A;  2YE9 A;  1B62 A;  4U3D A;  3M7N G;  1OJ4 A;  3OMU A;  1OYR A;  1FNM A;  2PO0 B;  2VQF I;  1FKA E;  2YK9 A;  3GCM A;  4KSG A;  5IWA E;  2XCM A;  5M4H A;  1ZXM A;  1I5B A;  2HK3 A;  2XHT A;  1FJG I;  1Z0C A;  2VF3 A;  4AWQ A;  1H73 A;  4PRX A;  3VAD A;  4DV2 I;  4BA2 B;  4E00 A;  1Y5Y A;  3WQ9 A;  4Z7C A;  2H8M A;  1RHY A;  1Z59 A;  1MX0 A;  1AM1 A;  4FMT A;  5M4E A;  1Y8O A;  1K47 A;  4XE2 A;  2YI5 A;  5DRP A;  3B4T A;  2E0A A;  1QZR A;  4OO1 E;  2H55 A;  2HKE A;  3QT5 A;  4O05 A;  4GQT A;  4DR2 I;  2PNM A;  4DUZ I;  2XHR A;  4EM7 A;  2BU8 A;  3V5R A;  2YE4 A;  4XCJ A;  3ZKB A;  2WI3 A;  4PL9 A;  4X62 E;  1IBM I;  4DUH A;  4FCR A;  4ED4 A;  3HYZ A;  2Q8H A;  1FI4 A;  3H4L A;  2BRE A;  4ASG A;  3QT8 A;  1Z0B A;  2GO3 A;  5L3J A;  4B3M I;  4GCZ A;  2WNR A;  5DRQ A;  1XNQ I;  3R4O A;  1XMO I;  3LMM A;  4OX9 I;  4XD8 A;  5M4P A;  3G7B A;  2XX2 A;  3OWB A;  4QPK A;  3VHD A;  3MNR P;  3K97 A;  4GKJ I;  2AKP A;  1HNZ I;  1TC6 A;  2R42 A;  2BU5 A;  1WUU A;  2O1V A;  2JJC A;  4O07 A;  3OW6 A;  1JM6 A;  1R62 A;  3WU4 A;  4LCG A;  5GMD A;  3JAM Q;  3B27 A;  4KHP I;  4QPJ A;  3T10 A;  4X65 I;  3P3C A;  3U67 A;  4XIR A;  4LF9 I;  5D7C A;  2ZIT A;  3OPD A;  4W7T A;  4X64 E;  1YER A;  1U2O A;  2NN6 A;  3P06 A;  4MPC A;  4ASA A;  4LFA E;  4JI5 I;  1U2R A;  2WI2 A;  4U93 A;  4AWP A;  2V2Q A;  2F4V E;  1YSR A;  2YEF A;  4IFD D;  1Y6Z A;  4MU0 A;  3O2F A;  1YT2 A;  3O0I A;  1R6L A;  3K17 A;  4JI2 E;  3HZ5 A;  1UDN A;  1UY9 A;  4V25 A;  4URL A;  1I59 A;  2Q8I A;  2JEA A;  1S16 A;  3T1Y E;  1ZXN A;  4LF4 E;  1EI1 A;  4XKK A;  4OO1 D;  3D0B A;  5C93 A;  2YKE A;  2EXL A;  1N34 I;  2V8P A;  4B3R E;  3Q5K A;  3A0X A;  3TZ5 A;  1RRE A;  4XKO A;  2PNZ B;  1AMW A;  1BYQ A;  1A4H A;  1UYI A;  4MOT A;  3ZZT A;  3ZXO A;  1XXE A;  3RLQ A;  2YEH A;  3U2K A;  1UYH A;  2UXD E;  2JEB A;  4DPT A;  4LFB I;  4DR1 I;  1Z0W A;  1NZ0 A;  1ELO A;  3K1J A;  2AE8 A;  3ZZ0 A;  2IWS A;  1HK7 A;  2BM0 A;  3A0W A;  4EGI A;  4QNK A;  3VHA A;  2Q8F A;  3EKO A;  2J7K A;  4LF8 I;  2BA1 D;  5IWA I;  4BIZ A;  4YKU A;  4FW5 A;  4MP7 A;  4YKX A;  4JV5 E;  3WU6 A;  1UYC A;  4DUY E;  4AQY E;  5JEA A;  2WI7 A;  1AH6 A;  4DPW A;  1KZN A;  2UUC I;  2XDK A;  2XJG A;  2Q2E B;  4OO1 C;  1THN A;  3LPS A;  3M85 D;  4DV7 E;  3A0Y A;  4HAC A;  4DZY A;  5K36 A;  1J5E E;  3GLL A;  2ZM6 E;  1TID A;  2YI0 A;  5LMU E;  3R91 A;  1Z0T A;  3G7E A;  2YI6 A;  2YE3 A;  5DNX A;  4IFD B;  3INX A;  2CGE A;  2WP8 A;  3HUL A;  5A2Q Q;  3ZXQ A;  3RLP A;  2UXB E;  1NHH A;  4YY3 E;  4X62 I;  2CCS A;  2BV3 A;  5CTX A;  2UXC E;  4DV6 I;  2BT0 A;  1USU A;  4OO1 B;  2WEP A;  1BXD A;  1TBW A;  4PRV A;  1Y8P A;  4JI4 E;  1OYP A;  3K60 A;  1GKZ A;  5DRR A;  4YHH I;  4JG4 A;  4B6C A;  2XAB A;  2Z5E A;  4MP2 A;  1Z5A A;  4MPE A;  4FCP A;  4O09 A;  4EFT A;  4R3M A;  1YC3 A;  2BSM A;  4XIT A;  1L0O A;  3K85 A;  1XNR I;  2CVE A;  4CE2 A;  1USV A;  4DU7 A;  2YJX A;  3KRN A;  4DV1 E;  4CWQ A;  4FN5 A;  5BOD A;  4MYT A;  3WU3 A;  1MU5 A;  3GIG B;  3TZ0 A;  1XMQ I;  3CRL A;  4DR6 I;  4GEE A;  5FNC A;  3PS3 A;  3EHF A;  1GJV A;  2BM1 A;  2IOQ A;  4IFD E;  2XDS A;  2VQE I;  4X64 I;  2PO2 B;  1KIJ A;  4FCQ A;  4X66 E;  4YKW A;  3B82 A;  3BM9 A;  2F4V I;  1N0V C;  4HZ0 A;  3PYE A;  4P7A A;  4LF7 E;  4V26 A;  3A0T A;  4FWD A;  2HHH E;  1YES A;  1UYK A;  2HHI A;  4IZK B;  2YEJ A;  4JI0 E;  1F51 A;  4P8O A;  3TZ4 A;  4DR3 E;  1ZM4 A;  5IT9 Q;  1UYF A;  2A2D A;  1UY7 A;  2V2V A;  3T1Y I;  4BA1 A;  1N0U A;  5FLX Q;  2WI5 A;  2UUA E;  2BTZ A;  4LF4 I;  3OTO I;  4DPX A;  5CPH A;  4JYA E;  2EFG A;  5BR8 E;  5C0X B;  4B3R I;  4YKR A;  2C39 B;  4USM A;  4URO A;  1B3Q A;  2C1I A;  3L7Z A;  3INW A;  3LNU A;  1OSF A;  4CWS A;  3CGZ A;  2HCH A;  1H7S A;  2UXD I;  3WHA A;  2CGF A;  4GKK E;  1UY8 A;  1PKP A;  4GFN A;  4HZ5 A;  3RLR A;  4DR5 E;  5CF0 A;  4ZVI A;  4ASF A;  4MU4 A;  3M7N D;  1TH8 A;  1DAR A;  1NHJ A;  3T1H E;  4LF5 E;  4DR4 E;  4BQJ A;  5M4K A;  4IZJ A;  2BR2 A;  2JE6 B;  1QY8 A;  2BRC A;  2CCT A;  4GQU A;  4AM3 A;  4IFD F;  4DUY I;  1AJ6 A;  4AQY I;  2HG1 A;  4DR7 I;  5IDM A;  5DNL A;  2CH4 A;  1Z5B A;  1UYM A;  3R4P A;  5BOC A;  1ID0 A;  2IWU A;  2FTK A;  3C11 A;  4JAS A;  1N36 I;  3O6O A;  2GS8 A;  4DV7 I;  3HKM A;  4Z7Y A;  3Q6M A;  4B3T E;  2PO1 A;  1I94 E;  1S14 A;  2WEQ A;  2YEA A;  4NXN E;  2ZM6 I; 
#chains in the Genus database with same CATH homology
 1N33 E;  3SL2 A;  4N3O A;  3J81 C;  1HR0 E;  5D6P A;  4MYU A;  2Z5B A;  1US7 A;  2PNR A;  2YE8 A;  2YEC A;  4DPY A;  4JAV A;  1HNW E;  1Y4S A;  2XX5 A;  3J80 Q;  2UXC I;  2E5L E;  4DV5 E;  4DV0 E;  1UEK A;  3FT8 A;  4HY1 A;  1YT1 A;  1I5C A;  1UYL A;  1IBK E;  3VHC A;  3G75 A;  1FJG E;  1HNX E;  1I5A A;  4CWR A;  1QYE A;  3R92 A;  4LFC I;  2HK2 A;  4DU8 A;  1ZM2 A;  2BU6 A;  4LF6 E;  2HFU A;  2YGA A;  4XKA A;  2HFS A;  2PNL A;  2Z5C A;  2UU9 E;  2BU2 A;  4DV1 I;  4KTN A;  2UWD A;  3D2R A;  4CWT A;  3HHU A;  3U2D A;  3CWV A;  3GON A;  2GQP A;  2WI6 A;  4CWF A;  5J6A A;  3TZ2 A;  4X66 I;  4PU9 A;  1YC4 A;  3EHJ A;  4NXM E;  3HZ1 A;  4QPK A;  2BYH A;  4LWH A;  2WI4 A;  3J7A G;  2HHH I;  1Z0E A;  2WI1 A;  4U7O A;  4XIQ A;  4R1F A;  2CG9 A;  4HXZ A;  4JI0 I;  3Q1Q A;  1YSZ A;  2YGE A;  5D6Q A;  4EGK A;  4CWP A;  3K99 A;  4ASB A;  4USK A;  1XMO E;  1UY6 A;  2YE6 A;  4OX9 E;  3D36 A;  1Z0G A;  2CZ9 A;  4JYA I;  3K98 A;  2V34 A;  3D4J A;  5BR8 I;  1S4E A;  3Q5J A;  2YEG A;  4XIP A;  2XDX A;  2BZ5 A;  2FXS A;  1HNZ E;  5GME A;  3T1K A;  2QFO A;  2ZDX A;  2VWC A;  4JI1 E;  4JI6 E;  4H7Q A;  5FNF A;  2BYI A;  4GKK I;  4URM A;  3TUH A;  4HYM A;  4DR5 I;  3KE6 A;  3B78 A;  4X65 E;  1Y8N A;  3T1H I;  3F0N A;  4LF5 I;  4LF9 E;  5D7D A;  3EHH A;  4BAE A;  2A2C A;  1TIL A;  2IWX A;  2DEI A;  4EGH A;  1YS3 A;  4XCL A;  5LMN E;  2C2A A;  4Q20 A;  4BQG A;  2QG0 A;  2XDU A;  4K4O A;  4M1K A;  4EFU A;  3JAM C;  4KP4 A;  2ZDY A;  3A0Z A;  4UT4 A;  1N32 E;  4E02 A;  5CTW A;  4JI7 E;  4RPF A;  4AS9 A;  4I5S A;  1AH8 A;  1N34 E;  3R4M A;  4UTG A;  4WUC A;  4LFA I;  3R4N A;  2YED A;  4YKY A;  4DV3 E;  1UYG A;  4NH7 A;  1B63 A;  3EKR A;  1MG7 A;  1I5D A;  4JI2 I;  2DEJ A;  4B3S E;  3QT7 A;  2E5L I;  2K5B A;  4DV5 I;  2O1T A;  4DV0 I;  2IOR A;  4BXI A;  3DGE A;  2XD6 A;  4LF8 E;  3NMQ A;  4KFG A;  1IBK I;  1I58 A;  2FYP A;  2YKB A;  5M4N A;  4HAC B;  5LL6 R;  1HNX I;  4ZKI A;  2UUC E;  1Y4U A;  3A0R A;  4YKZ A;  1A6F A;  4EEH A;  1ZW9 A;  2X7I A;  2AJ4 A;  4LF6 I;  4HYP A;  4LWG A;  1PVG A;  3QT6 A;  4L90 A;  2UU9 I;  3Q6N A;  4H81 A;  4JI3 E;  3RKZ A;  2O1W A;  1FWL A;  2IOP A;  1GKX A;  1Z5C A;  1FWK A;  2R3V A;  4MB9 A;  4NH9 A;  4JV5 I;  1TC0 A;  4DV4 E;  1H74 A;  3PEJ A;  2O1U A;  5J71 A;  3OWD A;  2HKJ A;  1IBL E;  4LWF A;  4DV6 E;  4NXM I;  3J7A M;  4K0K E;  2OI2 A;  2FWZ A;  3T2S A;  1J5E I;  2Q8G A;  5LMU I;  1BKN A;  2YKJ A;  4XTJ A;  4YHH E;  4IZJ D;  4X9L A;  2VW5 A;  5CTY A;  5A2Q C;  2XK2 A;  3HEK A;  1ZM3 A;  4JI8 E;  3PYD A;  2UUB E;  2XJJ A;  2UXB I;  4YY3 I;  5D7R A;  2XDL A;  4KQV A;  2YKC A;  5GGZ A;  4LWI A;  1XNR E;  3T0H A;  4CWN A;  3BMY A;  3PEH A;  4HY6 A;  2VQF E;  3HYY A;  4JI1 I;  3GIE A;  4JI4 I;  4JI6 I;  4JAU A;  4JQL A;  2YE2 A;  4FW9 A;  1XMQ E;  2GFD A;  3Q5L A;  4DR6 E;  4WUD A;  2YI7 A;  5IN9 A;  3LTO A;  3GIF A;  4L93 A;  4R3A A;  2NPF A;  4AWO A;  1ZM9 A;  4DV2 E;  2VQE E;  2YE7 A;  4URN A;  2BU7 A;  4MPN A;  4KSH A;  4XC0 A;  5LMN I;  4FPP A;  2ZKJ A;  2JKI A;  1UYD A;  2QG2 A;  4HXW A;  1KKH A;  2WW4 A;  1RR9 A;  4YKT A;  2XEX A;  4P52 A;  5F5R A;  4DR2 E;  2VCJ A;  4DUZ E;  3B28 A;  3CRK A;  1N32 I;  1H72 C;  3CGY A;  4JI7 I;  2FWY A;  2YEB A;  4XDM A;  3T0Z A;  3QDD A;  5F3K A;  4H85 A;  4LPB A;  3OTO E;  4BIU A;  3PRY A;  1PIE A;  1IBM E;  1EA6 A;  3JZ3 A;  1U0Z A;  3GIG A;  4YKQ A;  2CCU A;  2YE5 A;  1VIS A;  3ZZU A;  4DV3 I;  4LF7 I;  4IZJ B;  2YJW A;  3B8H A;  2YK2 A;  4LP0 A;  2GQ0 A;  4B3M E;  4EMD A;  5FND A;  3C0E A;  1YT0 A;  5IT9 C;  4B3S I;  1XNQ E;  5FLX C;  4DR3 I;  4CE1 A;  4DXL A;  3PYF A;  3ZKD A;  2LJP A;  4L8Z A;  2ESA A;  2UUA I;  4U7N A;  4IZK A;  5CTU A;  4FWH A;  2XJX A;  3HJC A;  3H80 A;  2VCI A;  4GKJ E;  4DPU A;  4O04 A;  4DR7 E;  1H7U A;  2YKI A;  3V2U C;  2Z5B B;  1N36 E;  3EHG A;  2YEE A;  3FT5 A;  4O0B A;  1D6T A;  5IDJ A;  4MBC A;  1KTV A;  3M6A A;  4KHP E;  3B25 A;  4NH8 A;  3ZM7 A;  1XHK A;  4B7P A;  5M4M A;  2V2Z A;  2E1R A;  4JI3 I;  4DR4 I;  3J81 Q;  3FV5 A;  4CWO A;  4JI5 E;  1NHI A;  1BGQ A;  2YEI A;  4DV4 I;  3PYG A;  4FWG A;  1KVK A;  4E01 A;  4GGL A;  1IBL I;  1YET A;  4I3H A;  1UYE A;  4L91 A;  1Z0V A;  3B24 A;  1YC1 A;  2X36 A;  4B3T I;  4WUB A;  1I94 I;  4K0K I;  4L94 A;  4NXN I;  1N33 I;  3B26 A;  1HR0 I;  3IED A;  3WU5 A;  2XHX A;  2WER A;  4GT8 A;  2Z5C B;  5FWK A;  3TTZ A;  2ZBK B;  2XX4 A;  4LWE A;  1HNW I;  4LFC E;  2QF6 A;  2UUB I;  4JI8 I;  3QTF A;  4EMV A;  3J80 C;  2YGF A;  4CE3 A;  4LFB E;  4DR1 E;  1ZWH A;  2YE9 A;  1B62 A;  1OJ4 A;  3OMU A;  1FKA E;  1FNM A;  2VQF I;  2YK9 A;  4KSG A;  5IWA E;  2XCM A;  5M4H A;  1ZXM A;  1I5B A;  2HK3 A;  2XHT A;  1FJG I;  1Z0C A;  2VF3 A;  4AWQ A;  1H73 A;  4PRX A;  3VAD A;  4DV2 I;  4E00 A;  3WQ9 A;  4Z7C A;  2H8M A;  1Z59 A;  1AM1 A;  1MX0 A;  4FMT A;  5M4E A;  1Y8O A;  1K47 A;  4XE2 A;  2YI5 A;  2E0A A;  1QZR A;  2H55 A;  2HKE A;  3QT5 A;  4O05 A;  4GQT A;  4DR2 I;  2PNM A;  4DUZ I;  2XHR A;  4EM7 A;  2BU8 A;  3V5R A;  2YE4 A;  4XCJ A;  3ZKB A;  2WI3 A;  4PL9 A;  4X62 E;  1IBM I;  4DUH A;  4FCR A;  4ED4 A;  3HYZ A;  2Q8H A;  1FI4 A;  3H4L A;  2BRE A;  4ASG A;  3QT8 A;  1Z0B A;  5L3J A;  4B3M I;  4GCZ A;  1XNQ I;  3R4O A;  1XMO I;  4OX9 I;  4XD8 A;  5M4P A;  3G7B A;  2XX2 A;  3OWB A;  3VHD A;  3MNR P;  3K97 A;  4GKJ I;  2AKP A;  1HNZ I;  1TC6 A;  2R42 A;  2BU5 A;  1WUU A;  2O1V A;  2JJC A;  4O07 A;  3OW6 A;  1JM6 A;  1R62 A;  3WU4 A;  5GMD A;  3JAM Q;  3B27 A;  4QPJ A;  4KHP I;  3T10 A;  4X65 I;  3U67 A;  4XIR A;  4LF9 I;  5D7C A;  2ZIT A;  3OPD A;  4W7T A;  4X64 E;  1YER A;  1U2O A;  3P06 A;  4MPC A;  4ASA A;  4LFA E;  4JI5 I;  1U2R A;  2WI2 A;  4U93 A;  4AWP A;  2V2Q A;  2F4V E;  1YSR A;  2YEF A;  1Y6Z A;  3O2F A;  1YT2 A;  3O0I A;  3K17 A;  4JI2 E;  3HZ5 A;  1UY9 A;  4V25 A;  4URL A;  1I59 A;  2Q8I A;  1S16 A;  3T1Y E;  1ZXN A;  4LF4 E;  1EI1 A;  4XKK A;  3D0B A;  5C93 A;  2YKE A;  2EXL A;  1N34 I;  2V8P A;  4B3R E;  3Q5K A;  3A0X A;  3TZ5 A;  1RRE A;  4XKO A;  1AMW A;  1BYQ A;  1A4H A;  1UYI A;  4MOT A;  3ZZT A;  3ZXO A;  3RLQ A;  2YEH A;  3U2K A;  1UYH A;  2UXD E;  4DPT A;  4LFB I;  4DR1 I;  1Z0W A;  1NZ0 A;  1ELO A;  3K1J A;  3ZZ0 A;  2IWS A;  1HK7 A;  2BM0 A;  3A0W A;  4EGI A;  3VHA A;  2Q8F A;  3EKO A;  2J7K A;  4LF8 I;  5IWA I;  4BIZ A;  4YKU A;  4YKX A;  4MP7 A;  4JV5 E;  3WU6 A;  1UYC A;  4DUY E;  4AQY E;  2WI7 A;  1AH6 A;  4DPW A;  1KZN A;  2UUC I;  2XDK A;  2XJG A;  2Q2E B;  1THN A;  3LPS A;  3A0Y A;  4DV7 E;  4HAC A;  4DZY A;  3R91 A;  1J5E E;  1TID A;  2ZM6 E;  2YI0 A;  5LMU E;  1Z0T A;  3G7E A;  2YI6 A;  2YE3 A;  3INX A;  2CGE A;  3HUL A;  5A2Q Q;  3ZXQ A;  3RLP A;  2UXB E;  1NHH A;  4YY3 E;  4X62 I;  2CCS A;  2BV3 A;  5CTX A;  2UXC E;  4DV6 I;  2BT0 A;  1USU A;  2WEP A;  1BXD A;  1TBW A;  4PRV A;  1Y8P A;  4JI4 E;  3K60 A;  1GKZ A;  4YHH I;  4JG4 A;  4B6C A;  2XAB A;  2Z5E A;  4MP2 A;  1Z5A A;  4MPE A;  4FCP A;  4O09 A;  4EFT A;  4R3M A;  1YC3 A;  2BSM A;  4XIT A;  1L0O A;  3K85 A;  1XNR I;  4CE2 A;  1USV A;  4DU7 A;  2YJX A;  4DV1 E;  4CWQ A;  4FN5 A;  5BOD A;  4MYT A;  3WU3 A;  1MU5 A;  3GIG B;  3TZ0 A;  1XMQ I;  3CRL A;  4DR6 I;  4GEE A;  5FNC A;  3EHF A;  1GJV A;  2BM1 A;  2IOQ A;  2XDS A;  2VQE I;  4X64 I;  4YKW A;  1KIJ A;  4FCQ A;  4X66 E;  3B82 A;  3BM9 A;  2F4V I;  1N0V C;  4HZ0 A;  3PYE A;  4P7A A;  4LF7 E;  4V26 A;  3A0T A;  4FWD A;  2HHH E;  1YES A;  1UYK A;  4IZK B;  2YEJ A;  4JI0 E;  4P8O A;  3TZ4 A;  4DR3 E;  1ZM4 A;  5IT9 Q;  1UYF A;  2A2D A;  1UY7 A;  2V2V A;  3T1Y I;  5FLX Q;  1N0U A;  2WI5 A;  2UUA E;  2BTZ A;  4LF4 I;  3OTO I;  4DPX A;  5CPH A;  4JYA E;  2EFG A;  5BR8 E;  4YKR A;  4B3R I;  4USM A;  4URO A;  1B3Q A;  3INW A;  3LNU A;  1OSF A;  4CWS A;  3CGZ A;  2HCH A;  1H7S A;  2UXD I;  3WHA A;  2CGF A;  4GKK E;  1UY8 A;  1PKP A;  4GFN A;  4HZ5 A;  3RLR A;  4DR5 E;  5CF0 A;  4ZVI A;  4ASF A;  1TH8 A;  1DAR A;  1NHJ A;  3T1H E;  4LF5 E;  4DR4 E;  4BQJ A;  5M4K A;  4IZJ A;  1QY8 A;  2BRC A;  2CCT A;  4DUY I;  1AJ6 A;  4AQY I;  2HG1 A;  4DR7 I;  5IDM A;  2CH4 A;  3R4P A;  1Z5B A;  1UYM A;  5BOC A;  1ID0 A;  2IWU A;  3C11 A;  4JAS A;  1N36 I;  3O6O A;  2GS8 A;  4DV7 I;  4Z7Y A;  3Q6M A;  4B3T E;  1S14 A;  1I94 E;  2WEQ A;  2YEA A;  4NXN E;  2ZM6 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...