4P7AA

Crystal structure of human mlh1
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
334
structure length
303
Chain Sequence
FVAGVIRRLDETVVNRIAAGEVIQRPANAIKEMIENCLDAKSTSIQVIVKEGGLKLIQIQDNGTGIRKEDLDIVCERFTTSKLGFRGEALASISHVAHVTITTKTADGKCAYRASYSDGKLKAPPKPCAGNQGTQITVEDLFYNIATRRKALKNPSEEYGKILEVVGRYSVHNAGISFSVKKQGETVADVRTLPNASTVDNIRSIFGNAVSRELIEIGCEDKTLAFKMNGYISNANYSVKKCIFLLFINHRLVESTSLRKAIETVYAAYLPKNTHPFLYLSLEISPESILERVQQHIESKLLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the human MLH1 N-terminus: implications for predisposition to Lynch syndrome.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
molecule keywords DNA mismatch repair protein Mlh1
total genus 88
structure length 303
sequence length 334
ec nomenclature
pdb deposition date 2014-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01119 DNA_mis_repair DNA mismatch repair protein, C-terminal domain
A PF13589 HATPase_c_3 Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4p7aA02
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 4p7aA01
4DV6I 4JI0I 4JI3I 1TBWA 4FCQA 4HYPA 1Y4UA 4X66I 4JI1I 3CGZA 4WUBA 1ZWHA 2YECA 4I3HA 1UYIA 2IOPA 4DV5I 3HEKA 2HK3A 3O2FA 2BSMA 2VCJA 2YJXA 4YHHE 4LWGA 3ZXOA 5LMNE 4DV2E 4XIRA 4OX9E 2IORA 1UEKA 3QDDA 2ZITA 1FJGE 2XX4A 1K47A 1HR0E 2HHHI 4X66E 2BU7A 4B3RI 3TTZA 4XIQA 1YETA 2YGAA 3B78A 2HK2A 2WW4A 3PYEA 4XKOA 4YKXA 4KHPI 3HYZA 5FNCA 4DV3I 4KP4A 4DV0I 2YI0A 2XCMA 5GGZA 4YKZA 1U2RA 2YI6A 4X62E 3NMQA 4BXIA 1J5EE 4DR1I 5CTXA 2BREA 3QT5A 1Z0VA 4AWOA 4DUYI 4U7OA 2YKIA 4MPCA 1YS3A 4JV5I 3ZZUA 4KHPE 1Y4SA 2XHRA 3OWBA 2UUBE 4GGLA 3TZ5A 4B3SE 4E00A 4FN5A 5IWAE 4DUZI 3HZ5A 4L94A 4NH7A 2YKEA 5IN9A 2YEDA 3GONA 4PRVA 4NXMI 4JI0E 1AH8A 5M4HA 4DPUA 3EHFA 1BGQA 1H72C 4EFUA 2PNRA 2QG0A 1ZM4A 1OSFA 1UY7A 1HNWI 2O1VA 2NPFA 5FNFA 4NH9A 4XKAA 4H7QA 2CCSA 1UY9A 1YSZA 4FCPA 1N0UA 4FPPA 4URNA 2BM0A 1S16A 2UU9I 1BYQA 2YE5A 3K99A 4L8ZA 4DPWA 1B3QA 1D6TA 2V2ZA 1UYFA 5BR8E 1I94E 4O09A 1FJGI 4DZYA 2HFSA 3JAMQ 3MNRP 5CTUA 4YY3E 1JM6A 1US7A 3M6AA 4JI4I 1XNQE 3J7AM 2VQEE 5LMUE 4XTJA 3INXA 3Q5KA 4GFNA 4HZ5A 4DV3E 4EMVA 1N0VC 4DV0E 1ZXNA 3JZ3A 4BAEA 1YERA 4QPJA 4LFBE 3A0RA 2JKIA 3VHDA 4GKJE 4JI7I 4X62I 1GJVA 1THNA 4PRXA 2WEPA 1Z0GA 3V5RA 4LF8E 4JI5E 1ZM2A 4AWPA 4DR3I 4JI4E 2YEEA 3EHJA 4DR6I 4DPTA 4MBCA 2UUCI 2Q8HA 5M4KA 4O0BA 2BU6A 2UWDA 3K97A 4XKKA 4OX9I 3R91A 3WU3A 4R3MA 4P8OA 3TZ0A 5CF0A 3A0XA 4E01A 2XHXA 1HR0I 3B25A 3VADA 1PVGA 4GQTA 2VCIA 1Y8NA 3RKZA 4DUHA 1HNXE 1AM1A 4DV4E 4H81A 3HHUA 3H4LA 1U2OA 1Y8PA 1YC1A 1IBLE 2XABA 3RLQA 4AS9A 2UU9E 1H74A 4JI8I 3T1YE 2V2VA 1IBKE 1N32E 1IBMI 1GKXA 2YEJA 3G75A 4KSHA 4X64E 4DR2E 4JASA 4JAUA 2ESAA 3B28A 1RREA 4L91A 3OW6A 2UXBE 2YGFA 3GIEA 4UROA 1H7SA 3INWA 3QT7A 4L93A 3A0WA 4LWIA 2HFUA 2BM1A 1AMWA 4WUDA 2YE2A 3PEJA 5CPHA 5FWKA 4X64I 2HHHE 4NXNI 4X65I 3GIGB 5LL6R 3T2SA 1I58A 4XC0A 4CE1A 3T1KA 5FLXC 2XJXA 2QF6A 2VQFI 1FWLA 3KE6A 3VHAA 5M4EA 1UYCA 1Z0TA 2YE6A 5GMEA 3TZ2A 1QZRA 2EXLA 5M4PA 4ASAA 2XK2A 3OTOI 4MPEA 3QT6A 4PU9A 4DR7E 2H55A 3H80A 1UY6A 3PYDA 4JYAI 1TILA 4YKRA 2HKJA 2Q8IA 2FWYA 2VQFE 2YK2A 2VQEI 5LMUI 5BOCA 2O1UA 5IT9C 2VF3A 4JAVA 2J7KA 3OTOE 2BZ5A 1S14A 4URLA 3T0ZA 4EGKA 2ZDXA 3PEHA 4DR2I 4CWRA 3U2KA 5D7DA 3R4OA 1QY8A 4LPBA 1UYLA 4MYTA 4JI5I 4BIUA 1XHKA 2XX5A 4K0KI 4O07A 2XEXA 1YC3A 2V8PA 1R62A 4JG4A 1N34I 3D2RA 4I5SA 3R4MA 1YC4A 5D7CA 4JI6E 3G7BA 1B63A 2X36A 4HY6A 4B6CA 2R3VA 1Z59A 4WUCA 1Z5AA 4GEEA 4DR1E 3RLPA 4XITA 4ASGA 4PL9A 4LF5I 4DUYE 2UUAI 4HXZA 4K0KE 4B3TE 3C11A 3GIFA 3A0ZA 2VWCA 4URMA 3D36A 2BYIA 5M4MA 1UYHA 1FNMA 4YKQA 1Z5CA 1TC0A 1FKAE 2K5BA 2GFDA 4LF9E 5D6QA 1I5BA 4AWQA 3U67A 3B26A 5A2QQ 2BYHA 1UYGA 2XDKA 1NHJA 2A2CA 4B3RE 1L0OA 2CCUA 2E0AA 3TUHA 2IWSA 4P7AA 1A6FA 4MP2A 1HNZE 3F0NA 1XNRE 1S4EA 4P52A 2UXCE 5BR8I 3LTOA 2XD6A 2YEBA 2ZBKB 4LWEA 4R3AA 4LF4E 2IOQA 1ZM3A 2FYPA 1N33E 2BU8A 2BV3A 4DV4I 3J80C 2YKJA 2EFGA 1YSRA 1GKZA 1FWKA 4MOTA 2UUBI 1IBLI 4LWHA 3PYGA 4U93A 1AJ6A 2YE8A 1IBKI 1N32I 1NHIA 3O6OA 2DEIA 4DR7I 5D6PA 4KFGA 2E5LE 2BTZA 4EFTA 2ZM6I 1XMQI 2GQPA 3BMYA 1UYKA 4YKWA 2V2QA 5IDMA 2YE9A 3BM9A 4O04A 3WU5A 1A4HA 3LNUA 2CGFA 4ED4A 3B27A 1Z5BA 4Z7YA 2HKEA 4AQYE 2WI1A 4JQLA 4YKTA 2WI4A 3TZ4A 2BU2A 3K60A 2BT0A 4EGHA 5IT9Q 1I94I 3C0EA 4X65E 4DR5I 4NXNE 2V34A 2XDSA 4FWGA 3J80Q 1AH6A 1ZW9A 4HXWA 2YGEA 3B82A 3WU4A 4GKKE 4V25A 1YT0A 3WU6A 4CWPA 2JJCA 1N34E 3ZKBA 2CCTA 2DEJA 5LMNI 1XNQI 4JI2E 2YEHA 3WHAA 1TH8A 1IBME 4Z7CA 4DR5E 4GKJI 5BODA 3Q5LA 3GIGA 3O0IA 3J81C 1YT2A 4DV1E 4CWOA 4DXLA 2C2AA 2XDUA 4LFBI 2YJWA 3ZXQA 1N36I 3JAMC 1MU5A 1N33I 4USKA 4DR6E 2UXBI 4EMDA 4B3TI 4V26A 4LF8I 5F3KA 1OJ4A 3QTFA 3J81Q 4JI2I 4GCZA 1Y8OA 4M1KA 4HY1A 1EI1A 4CWSA 5CTYA 1I5AA 1HNXI 2WI3A 2XJJA 4NH8A 1ZM9A 3LPSA 4KQVA 4FCRA 4UT4A 4AQYI 3EHGA 4UTGA 3ZZ0A 1NHHA 4B3SI 3EKRA 2CZ9A 4HACA 3DGEA 1QYEA 3HYYA 5D7RA 4MYUA 2WI2A 2XX2A 4XIPA 4YHHI 2UXCI 1TIDA 4B3MI 1DARA 2YE3A 2YE7A 1WUUA 2ZDYA 4MB9A 4BQGA 4LF4I 3T1HI 4EM7A 3J7AG 4XD8A 4LF5E 1EA6A 5FNDA 1B62A 4BIZA 2YKCA 2AJ4A 4MPNA 4FW9A 2WEQA 2HG1A 1ELOA 1VISA 2FXSA 4XCLA 3SL2A 3OMUA 4B3ME 4KTNA 2ZKJA 1N36E 4YKYA 2IWUA 4YY3I 5J71A 1J5EI 2YKBA 1Z0CA 4DV6E 4RPFA 3EHHA 1MG7A 2YEAA 2E1RA 2H8MA 4LWFA 4QPKA 2GS8A 4DR4E 3G7EA 3K17A 3VHCA 4LF7E 2CG9A 2XJGA 1YESA 3QT8A 5FLXQ 2BU5A 1UY8A 3FT8A 4JI7E 1YT1A 3A0TA 4CWNA 3A0YA 2UUCE 2QFOA 3EKOA 1I5DA 3IEDA 4MP7A 3CRLA 4GT8A 3Q1QA 4K4OA 4W7TA 4LF9I 2ZM6E 3T1HE 3B8HA 5IDJA 2Q2EB 4LFCI 4DPYA 2Q8FA 4USMA 1Z0BA 4XE2A 4DU8A 1BXDA 4LFAE 1I59A 1UYMA 1U0ZA 3OWDA 4EEHA 3T1YI 1XNRI 3V2UC 1ZXMA 2YI7A 2YE4A 4XDMA 3D0BA 5CTWA 4ASFA 2XDXA 4YKUA 4EGIA 2UUAE 3CGYA 2HCHA 1PIEA 1XMOE 3T0HA 2CH4A 5F5RA 3WQ9A 4O05A 4XCJA 5GMDA 2F4VI 2FWZA 3R4NA 1PKPA 1KTVA 2BRCA 4DR4I 2WERA 1FI4A 5J6AA 3CWVA 4DV1I 2O1WA 5L3JA 2WI5A 4B7PA 3PYFA 3K98A 2UXDE 4L90A 1UYDA 4ZVIA 2YEGA 3RLRA 4JI3E 1XMOI 4FWHA 4CE2A 2AKPA 2VW5A 4JI1E 2A2DA 1BKNA 1KVKA 2YEIA 2X7IA 3FV5A 4JV5E 4DV5E 2WI7A 1HNZI 3CRKA 4LFCE 4DUZE 3ZKDA 4DPXA 4FWDA 5IWAI 4CE3A 2LJPA 3D4JA 4R1FA 3HULA 4NXME 4JYAE 1ID0A 3T10A 1UYEA 1I5CA 1Z0WA 4KSGA 4ZKIA 3U2DA 4E02A 4LFAI 4GKKI 4Q20A 1TC6A 1H7UA 4DU7A 1HNWE 2YK9A 5A2QC 4DR3E 4CWFA 3R92A 3ZZTA 5M4NA 4HZ0A 4HYMA 2Q8GA 4DV7I 4CWTA 5C93A 2OI2A 1NZ0A 4LF7I 4FMTA 3ZM7A 2E5LI 4LF6E 4X9LA 2QG2A 2YEFA 1XMQE 3B24A 3HZ1A 4BQJA 3R4PA 4U7NA 1KZNA 3OPDA 1MX0A 4HACB 1KKHA 4ASBA 2F4VE 4DV7E 4CWQA 2R42A 2XHTA 3FT5A 3Q5JA 1RR9A 4H85A 1KIJA 4LP0A 2XDLA 1H73A 4DV2I 2WI6A 2UXDI 2YI5A 4JI8E 2IWXA 4JI6I 1Z0EA 4LF6I 3K1JA
chains in the Genus database with same CATH superfamily
4DV6I 4JI0I 4JI3I 1HK7A 1YHCA 1TBWA 4FCQA 2PO1A 1Y4UA 4HYPA 4X66I 4IS9A 4JI1I 5JEAB 3CGZA 4WUBA 1ZWHA 2YECA 2C37A 4I3HA 1UYIA 2IOPA 4DV5I 3HEKA 2HK3A 3O2FA 2BSMA 2VCJA 2YJXA 4YHHE 4LWGA 3ZXOA 5LMNE 3M85D 4DV2E 3HJCA 4XIRA 4OX9E 2BA1G 2IORA 1UEKA 3QDDA 2ZITA 1FJGE 2XX4A 1K47A 1HR0E 2HHHI 4X66E 2BU7A 4B3RI 2PNMA 3TTZA 3PS2A 1YETA 2YGAA 4XIQA 5M4NA 5C0XC 3B78A 2HK2A 2WW4A 3PYEA 4XKOA 4YKXA 4KHPI 3HYZA 4LPFA 5FNCA 4DV3I 3U1KA 1Y6ZA 4DV0I 2YI0A 4KP4A 2XCMA 5GGZA 4FW6A 4YKZA 1U2RA 2YI6A 4X62E 3NMQA 4IFDE 1J5EE 3U1YA 4DR1I 2BREA 5CTXA 3CDIA 2GQ0A 3QT5A 1Z0VA 2Z5CB 4MDTA 4DUYI 4MU0A 5C0XD 4U7OA 4AWOA 2YKIA 4MPCA 1YS3A 5DROA 4LCHA 4JV5I 3ZZUA 4KHPE 1Y4SA 2XHRA 3OWBA 2UUBE 4GGLA 3TZ5A 4B3SE 3GMEA 4E00A 2VESA 4FN5A 5IWAE 4DUZI 3HZ5A 4L94A 4NH7A 2YKEA 5IN9A 2YEDA 3GONA 4PRVA 4NXMI 4JI0E 1AH8A 5M4HA 4DPUA 4BA2B 3EHFA 2PNLA 5K36F 1BGQA 1H72C 4EFUA 5ELWA 2PNRA 2QG0A 1ZM4A 1OSFA 1UY7A 1HNWI 2O1VA 2NN6D 2NPFA 5FNFA 4U3DA 4QNJA 4NH9A 4XKAA 4H7QA 2CCSA 1UY9A 1YSZA 4FCPA 1N0UA 4FPPA 4URNA 2BM0A 1S16A 2UU9I 1BYQA 2YE5A 3K99A 4L8ZA 4DPWA 4FW5A 1B3QA 1D6TA 2V2ZA 1UYFA 2NN6A 5BR8E 4AIMA 1I94E 1FJGI 4O09A 4DZYA 2WP8B 2HFSA 3JAMQ 3MNRP 2NN6E 5CTUA 4YY3E 2C37B 4IZJA 1JM6A 3M6AA 1US7A 4JI4I 1XNQE 3J7AM 2AE8A 2VQEE 4XTJA 5LMUE 3INXA 3Q5KA 4GFNA 4DV3E 4HZ5A 4EMVA 1N0VC 4FW7A 4DV0E 1ZXNA 3JZ3A 4BAEA 1YERA 4QPJA 4LFBE 5C0XA 3A0RA 2JKIA 3VHDA 4GKJE 4JI7I 4X62I 1GJVA 1THNA 4PRXA 2WEPA 2PO0A 1Z0GA 3V5RA 4ISAA 4OO1A 4LF8E 4JI5E 1ZM2A 4AWPA 4DR3I 4JI4E 2YEEA 3EHJA 4DR6I 4DPTA 4MBCA 2UUCI 2Q8HA 5M4KA 1OYSA 4GQUA 4O0BA 2BU6A 2UWDA 3K97A 4XKKA 3KRNA 2BA1D 4OX9I 3R91A 2PO2A 3WU3A 4P8OA 1IXMA 4R3MA 3TZ0A 2C1GA 3A0XA 4E01A 5CF0A 2XHXA 1HR0I 3L7ZB 3B25A 3VADA 1PVGA 4GQTA 2VCIA 4BXIA 3HKMA 2BR2A 1Y8NA 3RKZA 4DUHA 1HNXE 1AM1A 4DV4E 2BA0G 4H81A 3HHUA 3H4LA 1U2OA 1Y8PA 4MU4A 4N3OA 1YC1A 1IBLE 2XABA 3RLQA 4AS9A 2UU9E 1H74A 4JI8I 3T1YE 2V2VA 1IBKE 1N32E 1IBMI 1GKXA 2YEJA 3G75A 4KSHA 4X64E 4DR2E 4IFDB 4JASA 4JAUA 2ESAA 2C39B 3B28A 1RREA 2WNRB 4OZEA 4L91A 3OW6A 2UXBE 2YGFA 3GIEA 4UROA 1H7SA 3INWA 3QT7A 4L93A 2JEAA 3A0WA 4LWIA 2HFUA 2BM1A 1AMWA 4WUDA 2YE2A 3PEJA 5CPHA 5FWKA 4X64I 2HHHE 4NXNI 4X65I 3GIGB 5LL6R 3T2SA 4BA2A 1I58A 4XC0A 4CE1A 3T1KA 5DRPA 5FLXC 2XJXA 2QF6A 2VQFI 1FWLA 3KE6A 3VHAA 5M4EA 1YH8A 1Z0TA 1UYCA 5GMEA 2YE6A 4IFDF 3TZ2A 1QZRA 2EXLA 5M4PA 1USUA 2XK2A 3OTOI 4MPEA 4ASAA 3QT6A 4PU9A 4DR7E 5EL9A 2H55A 3H80A 1UY6A 4OKGA 3PYDA 4JYAI 1TILA 4YKRA 2HKJA 2Q8IA 2FWYA 5JEAE 2VQFE 2YK2A 2VQEI 5LMUI 5BOCA 2O1UA 5IT9C 2VF3A 2CVEA 4JAVA 2C39A 5JEAD 2J7KA 3OTOE 2BZ5A 2GO4A 4URLA 1S14A 3T0ZA 4EGKA 2C1IA 4U3BA 2BA0D 2ZDXA 3PEHA 4DR2I 4CWRA 5K36B 3U2KA 1E3PA 4AIDA 5D7DA 3R4OA 1QY8A 4LPBA 1UYLA 4MYTA 4JI5I 4BIUA 4LCFA 1XHKA 2JEBA 2XX5A 5JEAF 4K0KI 4O07A 2XEXA 1YC3A 2V8PA 3M7NG 1R62A 4JG4A 1N34I 3D2RA 4I5SA 3R4MA 4LOMA 1YC4A 3P3CA 5D7CA 4JI6E 4IZKB 3G7BA 1B63A 2X36A 2PO2B 4HY6A 4B6CA 2R3VA 1Z59A 4WUCA 1Z5AA 4GEEA 4DR1E 3RLPA 3P3GA 4XITA 4ASGA 4PL9A 4LF5I 4DUYE 2UUAI 4HXZA 4IFDC 4K0KE 4B3TE 1UDSA 2C38B 2JEAB 3C11A 3GIFA 3A0ZA 2VWCA 4URMA 3M7ND 3D36A 2BYIA 5M4MA 1UYHA 1FNMA 4YKQA 1Z5CA 1TC0A 1FKAE 2K5BA 2GFDA 4LF9E 1USVA 4FW4A 5D6QA 1I5BA 4EM7A 4AWQA 3CDJA 3U67A 1XXEA 3B26A 5A2QQ 4OO1E 4OO1F 2BYHA 1UYGA 2XDKA 1NHJA 2A2CA 4B3RE 1L0OA 2CCUA 2E0AA 4E72A 3TUHA 3DD6A 4P7AA 2IWSA 1A6FA 4MP2A 1HNZE 4MU3A 3F0NA 1XNRE 1S4EA 4P52A 2UXCE 5BR8I 3LTOA 1F51A 2XD6A 2ZBKB 2YEBA 4LWEA 4R3AA 2IOQA 4LF4E 1ZM3A 1R6MA 2FYPA 1N33E 2BU8A 2BV3A 4DV4I 3J80C 2YKJA 2EFGA 1YSRA 1GKZA 1FWKA 4MOTA 2UUBI 1IBLI 4IFDD 4LWHA 3PYGA 4U93A 1AJ6A 2YE8A 1IBKI 1N32I 1NHIA 3O6OA 2DEIA 4DR7I 5D6PA 4KFGA 2E5LE 2BTZA 3S5TA 4EFTA 2ZM6I 1XMQI 2GQPA 3BMYA 1UYKA 4YKWA 2V2QA 5IDMA 4LCGA 2YE9A 3BM9A 4O04A 3WU5A 1A4HA 3LNUA 2IERA 2CGFA 4ED4A 3B27A 1Z5BA 4Z7YA 1OYRA 2HKEA 4AQYE 2WI1A 4JQLA 4YKTA 2WI4A 3TZ4A 2BU2A 3K60A 1Y60A 3P3EA 2IESA 2BT0A 5IT9Q 4EGHA 3PRYA 1I94I 3C0EA 4X65E 4DR5I 4NXNE 2V34A 2XDSA 2PNZA 4FWGA 1UDNA 3J80Q 1AH6A 3CYGA 1ZW9A 4HXWA 3PS1A 2YGEA 3GLLA 3B82A 3WU4A 4GKKE 4V25A 1YT0A 2O3ZA 3WU6A 2JJCA 4CWPA 1N34E 4MU1A 3ZKBA 2CCTA 2DEJA 5LMNI 3GCMA 1XNQI 4JI2E 5DRQA 2YEHA 1TH8A 3WHAA 1IBME 4Z7CA 4DR5E 4GKJI 5BODA 3Q5LA 3GIGA 3O0IA 3J81C 1YT2A 4DV1E 4CWOA 4DXLA 2JE6A 2C2AA 2XDUA 4LFBI 2YJWA 1E3HA 1N36I 3ZXQA 3JAMC 1MU5A 1N33I 4USKA 4DR6E 2UXBI 4EMDA 4B3TI 4V26A 4LF8I 1OYPA 2C38A 5F3KA 1OJ4A 3QTFA 3J81Q 4JI2I 4GCZA 2NN6F 1Y8OA 2Z5CA 4M1KA 4HY1A 4NBQA 1EI1A 4CWSA 5CTYA 1I5AA 1HNXI 2WI3A 2XJJA 4NH8A 1ZM9A 5DNXA 3LPSA 4KQVA 4FCRA 4UT4A 4AQYI 3EHGA 4UTGA 3ZZ0A 4BA1B 1Y5YA 1NHHA 4B3SI 3EKRA 2CZ9A 4HACA 3DGEA 5EKWA 4AM3A 1QYEA 3HYYA 5D7RA 4MYUA 2WI2A 2XX2A 4XIPA 4YHHI 2UXCI 1TIDA 4B3MI 1DARA 2YE3A 2YE7A 1WUUA 5K36A 2ZDYA 4MB9A 4LF4I 3T1HI 4BQGA 3J7AG 4XD8A 4LF5E 1RHYA 1EA6A 5FNDA 4OO1D 1B62A 4BIZA 2YKCA 2AJ4A 4MPNA 3M85G 4FW9A 2WEQA 2HG1A 3P76A 1ELOA 1VISA 2FXSA 4XCLA 3SL2A 3OMUA 4IZJB 4B3ME 4KTNA 2ZKJA 1N36E 4YKYA 2IWUA 4YY3I 5J71A 1J5EI 2YKBA 1Z0CA 4DV6E 4RPFA 5K36D 3EHHA 2JEBB 1MG7A 2E1RA 2H8MA 2YEAA 4LWFA 2GS8A 4QPKA 3Q6NA 2PO0B 2O1TA 4DR4E 4OO1B 5C0XE 3G7EA 3K17A 2F1DA 5DNLA 2JE6B 4QNKA 5DRRA 4LF7E 2CG9A 2XJGA 3VHCA 1YESA 3QT8A 5FLXQ 2BU5A 1UY8A 3FT8A 4JI7E 1YT1A 3A0TA 4CWNA 3A0YA 2UUCE 5K36C 3K85A 2QFOA 3EKOA 2HHIA 1I5DA 3IEDA 2CGEA 4MP7A 3CRLA 4GT8A 3Q1QA 4K4OA 4W7TA 4LF9I 2FTKA 2ZM6E 3T1HE 3LMMA 3B8HA 5IDJA 2WP8A 5JENA 2Q2EB 4LFCI 1R6LA 4DPYA 2Q8FA 4USMA 4IZKA 4MQYA 1Z0BA 4XE2A 4DU8A 1BXDA 4LFAE 1I59A 2Z5BA 1UYMA 1U0ZA 3OWDA 4EEHA 3T1YI 1XNRI 3V2UC 1ZXMA 2YI7A 2YE4A 4J3DA 4XDMA 5C0XB 3D0BA 5CTWA 4ASFA 2BR2B 2XDXA 4YKUA 4EGIA 2UUAE 3CGYA 5C0XF 2HCHA 1PIEA 1XMOE 3T0HA 2CH4A 5F5RA 3B4TA 3WQ9A 4O05A 4BA1A 5GMDA 2F4VI 2FWZA 3R4NA 4XCJA 1PKPA 1KTVA 2BRCA 1UDOA 4DR4I 2WERA 1FI4A 2WNRA 5J6AA 3CWVA 3NZKA 4DV1I 2O1WA 5L3JA 2PNZB 2WI5A 3L7ZA 2J65A 3PYFA 4B7PA 3K98A 2UXDE 4L90A 1UYDA 4ZVIA 2YEGA 3RLRA 1VI7A 4IZJD 3UHMA 4JI3E 1XMOI 4FWHA 4CE2A 2AKPA 2VW5A 2NN6C 4JI1E 1P42A 2A2DA 1BKNA 1KVKA 1UDQA 2YEIA 2X7IA 2PO1B 3FV5A 4JV5E 5JEAC 5JEAA 3PS3A 4DV5E 2WI7A 1HNZI 4IFDA 3CRKA 4LFCE 3ZKDA 4DPXA 2JT2A 4FWDA 5IWAI 4DUZE 4CE3A 2LJPA 3D4JA 4R1FA 3HULA 4NXME 4JYAE 1ID0A 3T10A 1UYEA 1I5CA 1Z0WA 4KSGA 4ZKIA 3U2DA 4E02A 4LFAI 4GKKI 4Q20A 1TC6A 1H7UA 4DU7A 1HNWE 2GO3A 2YK9A 5A2QC 4DR3E 4CWFA 3R92A 3P06A 3ZZTA 4HZ0A 2Z5EA 4HYMA 4DV7I 2Q8GA 4CWTA 5C93A 2OI2A 3H1CA 1NZ0A 2NN6B 4LF7I 4FMTA 3ZM7A 2E5LI 4LF6E 4X9LA 2QG2A 2YEFA 1XMQE 3B24A 3HZ1A 4BQJA 3R4PA 2Z5BB 4U7NA 4FW3A 4OO1C 1KZNA 3OPDA 1MX0A 4HACB 1KKHA 4ASBA 2F4VE 4DV7E 4CWQA 2R42A 5K36E 2XHTA 3FT5A 3Q5JA 1RR9A 4H85A 1KIJA 4LP0A 2XDLA 1H73A 4DV2I 2WI6A 3Q6MA 2UXDI 4JI8E 2IWXA 2YI5A 4JI6I 1Z0EA 4LF6I 3K1JA
chains in the Genus database with same CATH topology
4DV6I 4JI0I 4JI3I 1HK7A 1TBWA 4FCQA 4HYPA 1Y4UA 4X66I 4JI1I 3CGZA 4WUBA 1ZWHA 2YECA 4I3HA 1UYIA 2IOPA 4DV5I 3HEKA 2HK3A 3O2FA 2BSMA 2VCJA 2YJXA 4YHHE 4LWGA 3ZXOA 5LMNE 4DV2E 4XIRA 3HJCA 4OX9E 2IORA 1UEKA 3QDDA 2ZITA 1FJGE 2XX4A 1K47A 1HR0E 2HHHI 4X66E 2BU7A 4B3RI 2PNMA 3TTZA 4XIQA 1YETA 2YGAA 5M4NA 3B78A 2HK2A 2WW4A 3PYEA 4XKOA 4YKXA 4KHPI 3HYZA 5FNCA 4DV3I 1Y6ZA 4DV0I 2YI0A 4KP4A 2XCMA 5GGZA 4YKZA 1U2RA 2YI6A 4X62E 3NMQA 4BXIA 1J5EE 4DR1I 5CTXA 2BREA 2GQ0A 3QT5A 1Z0VA 2Z5CB 4AWOA 4DUYI 4U7OA 2YKIA 4MPCA 1YS3A 4JV5I 3ZZUA 4KHPE 1Y4SA 2XHRA 3OWBA 2UUBE 4GGLA 3TZ5A 4B3SE 4E00A 4FN5A 5IWAE 4DUZI 3HZ5A 4L94A 4NH7A 2YKEA 5IN9A 2YEDA 3GONA 4PRVA 4NXMI 4JI0E 1AH8A 5M4HA 4DPUA 3EHFA 2PNLA 1BGQA 1H72C 4EFUA 2PNRA 2QG0A 1ZM4A 1OSFA 1UY7A 1HNWI 2O1VA 2NPFA 5FNFA 4NH9A 4XKAA 4H7QA 2CCSA 1UY9A 1YSZA 4FCPA 1N0UA 4FPPA 4URNA 2BM0A 1S16A 2UU9I 1BYQA 2YE5A 3K99A 4L8ZA 4DPWA 1B3QA 1D6TA 2V2ZA 1UYFA 5BR8E 1I94E 4O09A 1FJGI 4DZYA 2HFSA 3JAMQ 3MNRP 5CTUA 4YY3E 4IZJA 1JM6A 3M6AA 1US7A 4JI4I 1XNQE 3J7AM 2VQEE 5LMUE 4XTJA 3INXA 3Q5KA 4GFNA 4HZ5A 4DV3E 4EMVA 1N0VC 4DV0E 1ZXNA 3JZ3A 4BAEA 1YERA 4QPJA 4LFBE 3A0RA 2JKIA 3VHDA 4GKJE 4JI7I 4X62I 1GJVA 1THNA 4PRXA 2WEPA 1Z0GA 3V5RA 4LF8E 4JI5E 1ZM2A 4AWPA 4DR3I 4JI4E 2YEEA 3EHJA 4DR6I 4DPTA 4MBCA 2UUCI 2Q8HA 5M4KA 4O0BA 2BU6A 2UWDA 3K97A 4XKKA 4OX9I 3R91A 3WU3A 4R3MA 4P8OA 3TZ0A 5CF0A 3A0XA 4E01A 2XHXA 1HR0I 3B25A 3VADA 1PVGA 4GQTA 2VCIA 1Y8NA 3RKZA 4DUHA 1HNXE 1AM1A 4DV4E 4H81A 3HHUA 3H4LA 1U2OA 1Y8PA 4N3OA 1YC1A 1IBLE 2XABA 3RLQA 4AS9A 2UU9E 1H74A 4JI8I 3T1YE 2V2VA 1IBKE 1N32E 1IBMI 1GKXA 2YEJA 3G75A 4KSHA 4X64E 4DR2E 4JASA 4JAUA 2ESAA 3B28A 1RREA 4L91A 3OW6A 2UXBE 2YGFA 3GIEA 4UROA 1H7SA 3INWA 3QT7A 4L93A 3A0WA 4LWIA 2HFUA 2BM1A 1AMWA 4WUDA 2YE2A 3PEJA 5CPHA 5FWKA 4X64I 2HHHE 4NXNI 4X65I 3GIGB 5LL6R 3T2SA 1I58A 4XC0A 4CE1A 3T1KA 5FLXC 2XJXA 2QF6A 2VQFI 1FWLA 3KE6A 3VHAA 5M4EA 1UYCA 1Z0TA 2YE6A 5GMEA 3TZ2A 1QZRA 2EXLA 5M4PA 1USUA 2XK2A 3OTOI 4MPEA 4ASAA 3QT6A 4PU9A 4DR7E 2H55A 3H80A 1UY6A 3PYDA 4JYAI 1TILA 4YKRA 2HKJA 2Q8IA 2FWYA 2VQFE 2YK2A 2VQEI 5LMUI 5BOCA 2O1UA 5IT9C 2VF3A 4JAVA 2J7KA 3OTOE 2BZ5A 1S14A 4URLA 3T0ZA 4EGKA 2ZDXA 3PEHA 4DR2I 4CWRA 3U2KA 5D7DA 3R4OA 1QY8A 4LPBA 1UYLA 4MYTA 4JI5I 4BIUA 1XHKA 2XX5A 4K0KI 4O07A 2XEXA 1YC3A 2V8PA 1R62A 4JG4A 1N34I 3D2RA 4I5SA 3R4MA 1YC4A 5D7CA 4JI6E 4IZKB 3G7BA 1B63A 2X36A 4HY6A 4B6CA 2R3VA 1Z59A 4WUCA 1Z5AA 4GEEA 4DR1E 3RLPA 4XITA 4ASGA 4PL9A 4LF5I 4DUYE 2UUAI 4HXZA 4K0KE 4B3TE 3C11A 3GIFA 3A0ZA 2VWCA 4URMA 3D36A 2BYIA 5M4MA 1UYHA 1FNMA 4YKQA 1Z5CA 1TC0A 1FKAE 2K5BA 2GFDA 4LF9E 1USVA 5D6QA 1I5BA 4AWQA 3U67A 3B26A 5A2QQ 2BYHA 1UYGA 2XDKA 1NHJA 2A2CA 4B3RE 1L0OA 2CCUA 2E0AA 3TUHA 2IWSA 4P7AA 1A6FA 4MP2A 1HNZE 3F0NA 1XNRE 1S4EA 4P52A 2UXCE 5BR8I 3LTOA 2XD6A 2YEBA 2ZBKB 4LWEA 4R3AA 2IOQA 4LF4E 1ZM3A 2FYPA 1N33E 2BU8A 2BV3A 4DV4I 3J80C 2YKJA 2EFGA 1YSRA 1GKZA 1FWKA 4MOTA 2UUBI 1IBLI 4LWHA 3PYGA 4U93A 1AJ6A 2YE8A 1IBKI 1N32I 1NHIA 3O6OA 2DEIA 4DR7I 5D6PA 4KFGA 2E5LE 2BTZA 4EFTA 2ZM6I 1XMQI 2GQPA 3BMYA 1UYKA 4YKWA 2V2QA 5IDMA 2YE9A 3BM9A 4O04A 3WU5A 1A4HA 3LNUA 2CGFA 4ED4A 3B27A 1Z5BA 4Z7YA 2HKEA 4AQYE 2WI1A 4JQLA 4YKTA 2WI4A 3TZ4A 2BU2A 3K60A 2BT0A 4EGHA 5IT9Q 3PRYA 1I94I 3C0EA 4X65E 4DR5I 4NXNE 2V34A 2XDSA 4FWGA 3J80Q 1AH6A 1ZW9A 4HXWA 2YGEA 3B82A 3WU4A 4GKKE 4V25A 1YT0A 3WU6A 4CWPA 2JJCA 1N34E 3ZKBA 2CCTA 2DEJA 5LMNI 1XNQI 4JI2E 2YEHA 3WHAA 1TH8A 1IBME 4Z7CA 4DR5E 4GKJI 5BODA 3Q5LA 3GIGA 3O0IA 3J81C 1YT2A 4DV1E 4CWOA 4DXLA 2C2AA 2XDUA 4LFBI 2YJWA 3ZXQA 1N36I 3JAMC 1MU5A 1N33I 4USKA 4DR6E 2UXBI 4EMDA 4B3TI 4V26A 4LF8I 5F3KA 1OJ4A 3QTFA 3J81Q 4JI2I 4GCZA 1Y8OA 2Z5CA 4M1KA 4HY1A 1EI1A 4CWSA 5CTYA 1I5AA 1HNXI 2WI3A 2XJJA 4NH8A 1ZM9A 3LPSA 4KQVA 4FCRA 4UT4A 4AQYI 3EHGA 4UTGA 3ZZ0A 1NHHA 4B3SI 3EKRA 2CZ9A 4HACA 3DGEA 1QYEA 3HYYA 5D7RA 4MYUA 2WI2A 2XX2A 4XIPA 4YHHI 2UXCI 1TIDA 4B3MI 1DARA 2YE3A 2YE7A 1WUUA 2ZDYA 4MB9A 4BQGA 4LF4I 3T1HI 4EM7A 3J7AG 4XD8A 4LF5E 1EA6A 5FNDA 1B62A 4BIZA 2YKCA 2AJ4A 4MPNA 4FW9A 2WEQA 2HG1A 1ELOA 1VISA 2FXSA 4XCLA 3SL2A 3OMUA 4IZJB 4B3ME 4KTNA 2ZKJA 1N36E 4YKYA 2IWUA 4YY3I 5J71A 1J5EI 2YKBA 1Z0CA 4DV6E 4RPFA 3EHHA 1MG7A 2YEAA 2E1RA 2H8MA 4LWFA 4QPKA 2GS8A 3Q6NA 2O1TA 4DR4E 3G7EA 3K17A 3VHCA 4LF7E 2CG9A 2XJGA 1YESA 3QT8A 5FLXQ 2BU5A 1UY8A 3FT8A 4JI7E 1YT1A 3A0TA 4CWNA 3A0YA 2UUCE 3K85A 2QFOA 3EKOA 1I5DA 3IEDA 2CGEA 4MP7A 3CRLA 4GT8A 3Q1QA 4K4OA 4W7TA 4LF9I 2ZM6E 3T1HE 3B8HA 5IDJA 2Q2EB 4LFCI 4DPYA 2Q8FA 4USMA 4IZKA 1Z0BA 4XE2A 4DU8A 1BXDA 4LFAE 1I59A 2Z5BA 1UYMA 1U0ZA 3OWDA 4EEHA 3T1YI 1XNRI 3V2UC 1ZXMA 2YI7A 2YE4A 4XDMA 3D0BA 5CTWA 4ASFA 2XDXA 4YKUA 4EGIA 2UUAE 3CGYA 2HCHA 1PIEA 1XMOE 3T0HA 2CH4A 5F5RA 3WQ9A 4O05A 4XCJA 5GMDA 2F4VI 2FWZA 3R4NA 1PKPA 1KTVA 2BRCA 4DR4I 2WERA 1FI4A 5J6AA 3CWVA 4DV1I 2O1WA 5L3JA 2WI5A 4B7PA 3PYFA 3K98A 2UXDE 4L90A 1UYDA 4ZVIA 2YEGA 3RLRA 4IZJD 4JI3E 1XMOI 4FWHA 4CE2A 2AKPA 2VW5A 4JI1E 2A2DA 1BKNA 1KVKA 2YEIA 2X7IA 3FV5A 4JV5E 4DV5E 2WI7A 1HNZI 3CRKA 4LFCE 4DUZE 3ZKDA 4DPXA 4FWDA 5IWAI 4CE3A 2LJPA 3D4JA 4R1FA 3HULA 4NXME 4JYAE 1ID0A 3T10A 1UYEA 1I5CA 1Z0WA 4KSGA 4ZKIA 3U2DA 4E02A 4LFAI 4GKKI 4Q20A 1TC6A 1H7UA 4DU7A 1HNWE 2YK9A 5A2QC 4DR3E 4CWFA 3R92A 3P06A 3ZZTA 4HZ0A 2Z5EA 4HYMA 4DV7I 2Q8GA 4CWTA 5C93A 2OI2A 1NZ0A 4LF7I 4FMTA 3ZM7A 2E5LI 4LF6E 4X9LA 2QG2A 2YEFA 1XMQE 3B24A 3HZ1A 4BQJA 3R4PA 2Z5BB 4U7NA 1KZNA 3OPDA 1MX0A 4HACB 1KKHA 4ASBA 2F4VE 4DV7E 4CWQA 2R42A 2XHTA 3FT5A 3Q5JA 1RR9A 4H85A 1KIJA 4LP0A 2XDLA 1H73A 4DV2I 2WI6A 3Q6MA 2UXDI 4JI8E 2IWXA 2YI5A 4JI6I 1Z0EA 4LF6I 3K1JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV6 I;  4JI0 I;  4JI3 I;  1TBW A;  4FCQ A;  4HYP A;  1Y4U A;  4X66 I;  4JI1 I;  3CGZ A;  4WUB A;  1ZWH A;  2YEC A;  4I3H A;  1UYI A;  2IOP A;  4DV5 I;  3HEK A;  2HK3 A;  3O2F A;  2BSM A;  2VCJ A;  2YJX A;  4YHH E;  4LWG A;  3ZXO A;  5LMN E;  4DV2 E;  4XIR A;  4OX9 E;  2IOR A;  1UEK A;  3QDD A;  2ZIT A;  1FJG E;  2XX4 A;  1K47 A;  1HR0 E;  2HHH I;  4X66 E;  2BU7 A;  4B3R I;  3TTZ A;  4XIQ A;  1YET A;  2YGA A;  3B78 A;  2HK2 A;  2WW4 A;  3PYE A;  4XKO A;  4YKX A;  4KHP I;  3HYZ A;  5FNC A;  4DV3 I;  4KP4 A;  4DV0 I;  2YI0 A;  2XCM A;  5GGZ A;  4YKZ A;  1U2R A;  2YI6 A;  4X62 E;  3NMQ A;  4BXI A;  1J5E E;  4DR1 I;  5CTX A;  2BRE A;  3QT5 A;  1Z0V A;  4AWO A;  4DUY I;  4U7O A;  2YKI A;  4MPC A;  1YS3 A;  4JV5 I;  3ZZU A;  4KHP E;  1Y4S A;  2XHR A;  3OWB A;  2UUB E;  4GGL A;  3TZ5 A;  4B3S E;  4E00 A;  4FN5 A;  5IWA E;  4DUZ I;  3HZ5 A;  4L94 A;  4NH7 A;  2YKE A;  5IN9 A;  2YED A;  3GON A;  4PRV A;  4NXM I;  4JI0 E;  1AH8 A;  5M4H A;  4DPU A;  3EHF A;  1BGQ A;  1H72 C;  4EFU A;  2PNR A;  2QG0 A;  1ZM4 A;  1OSF A;  1UY7 A;  1HNW I;  2O1V A;  2NPF A;  5FNF A;  4NH9 A;  4XKA A;  4H7Q A;  2CCS A;  1UY9 A;  1YSZ A;  4FCP A;  1N0U A;  4FPP A;  4URN A;  2BM0 A;  1S16 A;  2UU9 I;  1BYQ A;  2YE5 A;  3K99 A;  4L8Z A;  4DPW A;  1B3Q A;  1D6T A;  2V2Z A;  1UYF A;  5BR8 E;  1I94 E;  4O09 A;  1FJG I;  4DZY A;  2HFS A;  3JAM Q;  3MNR P;  5CTU A;  4YY3 E;  1JM6 A;  1US7 A;  3M6A A;  4JI4 I;  1XNQ E;  3J7A M;  2VQE E;  5LMU E;  4XTJ A;  3INX A;  3Q5K A;  4GFN A;  4HZ5 A;  4DV3 E;  4EMV A;  1N0V C;  4DV0 E;  1ZXN A;  3JZ3 A;  4BAE A;  1YER A;  4QPJ A;  4LFB E;  3A0R A;  2JKI A;  3VHD A;  4GKJ E;  4JI7 I;  4X62 I;  1GJV A;  1THN A;  4PRX A;  2WEP A;  1Z0G A;  3V5R A;  4LF8 E;  4JI5 E;  1ZM2 A;  4AWP A;  4DR3 I;  4JI4 E;  2YEE A;  3EHJ A;  4DR6 I;  4DPT A;  4MBC A;  2UUC I;  2Q8H A;  5M4K A;  4O0B A;  2BU6 A;  2UWD A;  3K97 A;  4XKK A;  4OX9 I;  3R91 A;  3WU3 A;  4R3M A;  4P8O A;  3TZ0 A;  5CF0 A;  3A0X A;  4E01 A;  2XHX A;  1HR0 I;  3B25 A;  3VAD A;  1PVG A;  4GQT A;  2VCI A;  1Y8N A;  3RKZ A;  4DUH A;  1HNX E;  1AM1 A;  4DV4 E;  4H81 A;  3HHU A;  3H4L A;  1U2O A;  1Y8P A;  1YC1 A;  1IBL E;  2XAB A;  3RLQ A;  4AS9 A;  2UU9 E;  1H74 A;  4JI8 I;  3T1Y E;  2V2V A;  1IBK E;  1N32 E;  1IBM I;  1GKX A;  2YEJ A;  3G75 A;  4KSH A;  4X64 E;  4DR2 E;  4JAS A;  4JAU A;  2ESA A;  3B28 A;  1RRE A;  4L91 A;  3OW6 A;  2UXB E;  2YGF A;  3GIE A;  4URO A;  1H7S A;  3INW A;  3QT7 A;  4L93 A;  3A0W A;  4LWI A;  2HFU A;  2BM1 A;  1AMW A;  4WUD A;  2YE2 A;  3PEJ A;  5CPH A;  5FWK A;  4X64 I;  2HHH E;  4NXN I;  4X65 I;  3GIG B;  5LL6 R;  3T2S A;  1I58 A;  4XC0 A;  4CE1 A;  3T1K A;  5FLX C;  2XJX A;  2QF6 A;  2VQF I;  1FWL A;  3KE6 A;  3VHA A;  5M4E A;  1UYC A;  1Z0T A;  2YE6 A;  5GME A;  3TZ2 A;  1QZR A;  2EXL A;  5M4P A;  4ASA A;  2XK2 A;  3OTO I;  4MPE A;  3QT6 A;  4PU9 A;  4DR7 E;  2H55 A;  3H80 A;  1UY6 A;  3PYD A;  4JYA I;  1TIL A;  4YKR A;  2HKJ A;  2Q8I A;  2FWY A;  2VQF E;  2YK2 A;  2VQE I;  5LMU I;  5BOC A;  2O1U A;  5IT9 C;  2VF3 A;  4JAV A;  2J7K A;  3OTO E;  2BZ5 A;  1S14 A;  4URL A;  3T0Z A;  4EGK A;  2ZDX A;  3PEH A;  4DR2 I;  4CWR A;  3U2K A;  5D7D A;  3R4O A;  1QY8 A;  4LPB A;  1UYL A;  4MYT A;  4JI5 I;  4BIU A;  1XHK A;  2XX5 A;  4K0K I;  4O07 A;  2XEX A;  1YC3 A;  2V8P A;  1R62 A;  4JG4 A;  1N34 I;  3D2R A;  4I5S A;  3R4M A;  1YC4 A;  5D7C A;  4JI6 E;  3G7B A;  1B63 A;  2X36 A;  4HY6 A;  4B6C A;  2R3V A;  1Z59 A;  4WUC A;  1Z5A A;  4GEE A;  4DR1 E;  3RLP A;  4XIT A;  4ASG A;  4PL9 A;  4LF5 I;  4DUY E;  2UUA I;  4HXZ A;  4K0K E;  4B3T E;  3C11 A;  3GIF A;  3A0Z A;  2VWC A;  4URM A;  3D36 A;  2BYI A;  5M4M A;  1UYH A;  1FNM A;  4YKQ A;  1Z5C A;  1TC0 A;  1FKA E;  2K5B A;  2GFD A;  4LF9 E;  5D6Q A;  1I5B A;  4AWQ A;  3U67 A;  3B26 A;  5A2Q Q;  2BYH A;  1UYG A;  2XDK A;  1NHJ A;  2A2C A;  4B3R E;  1L0O A;  2CCU A;  2E0A A;  3TUH A;  2IWS A;  4P7A A;  1A6F A;  4MP2 A;  1HNZ E;  3F0N A;  1XNR E;  1S4E A;  4P52 A;  2UXC E;  5BR8 I;  3LTO A;  2XD6 A;  2YEB A;  2ZBK B;  4LWE A;  4R3A A;  4LF4 E;  2IOQ A;  1ZM3 A;  2FYP A;  1N33 E;  2BU8 A;  2BV3 A;  4DV4 I;  3J80 C;  2YKJ A;  2EFG A;  1YSR A;  1GKZ A;  1FWK A;  4MOT A;  2UUB I;  1IBL I;  4LWH A;  3PYG A;  4U93 A;  1AJ6 A;  2YE8 A;  1IBK I;  1N32 I;  1NHI A;  3O6O A;  2DEI A;  4DR7 I;  5D6P A;  4KFG A;  2E5L E;  2BTZ A;  4EFT A;  2ZM6 I;  1XMQ I;  2GQP A;  3BMY A;  1UYK A;  4YKW A;  2V2Q A;  5IDM A;  2YE9 A;  3BM9 A;  4O04 A;  3WU5 A;  1A4H A;  3LNU A;  2CGF A;  4ED4 A;  3B27 A;  1Z5B A;  4Z7Y A;  2HKE A;  4AQY E;  2WI1 A;  4JQL A;  4YKT A;  2WI4 A;  3TZ4 A;  2BU2 A;  3K60 A;  2BT0 A;  4EGH A;  5IT9 Q;  1I94 I;  3C0E A;  4X65 E;  4DR5 I;  4NXN E;  2V34 A;  2XDS A;  4FWG A;  3J80 Q;  1AH6 A;  1ZW9 A;  4HXW A;  2YGE A;  3B82 A;  3WU4 A;  4GKK E;  4V25 A;  1YT0 A;  3WU6 A;  4CWP A;  2JJC A;  1N34 E;  3ZKB A;  2CCT A;  2DEJ A;  5LMN I;  1XNQ I;  4JI2 E;  2YEH A;  3WHA A;  1TH8 A;  1IBM E;  4Z7C A;  4DR5 E;  4GKJ I;  5BOD A;  3Q5L A;  3GIG A;  3O0I A;  3J81 C;  1YT2 A;  4DV1 E;  4CWO A;  4DXL A;  2C2A A;  2XDU A;  4LFB I;  2YJW A;  3ZXQ A;  1N36 I;  3JAM C;  1MU5 A;  1N33 I;  4USK A;  4DR6 E;  2UXB I;  4EMD A;  4B3T I;  4V26 A;  4LF8 I;  5F3K A;  1OJ4 A;  3QTF A;  3J81 Q;  4JI2 I;  4GCZ A;  1Y8O A;  4M1K A;  4HY1 A;  1EI1 A;  4CWS A;  5CTY A;  1I5A A;  1HNX I;  2WI3 A;  2XJJ A;  4NH8 A;  1ZM9 A;  3LPS A;  4KQV A;  4FCR A;  4UT4 A;  4AQY I;  3EHG A;  4UTG A;  3ZZ0 A;  1NHH A;  4B3S I;  3EKR A;  2CZ9 A;  4HAC A;  3DGE A;  1QYE A;  3HYY A;  5D7R A;  4MYU A;  2WI2 A;  2XX2 A;  4XIP A;  4YHH I;  2UXC I;  1TID A;  4B3M I;  1DAR A;  2YE3 A;  2YE7 A;  1WUU A;  2ZDY A;  4MB9 A;  4BQG A;  4LF4 I;  3T1H I;  4EM7 A;  3J7A G;  4XD8 A;  4LF5 E;  1EA6 A;  5FND A;  1B62 A;  4BIZ A;  2YKC A;  2AJ4 A;  4MPN A;  4FW9 A;  2WEQ A;  2HG1 A;  1ELO A;  1VIS A;  2FXS A;  4XCL A;  3SL2 A;  3OMU A;  4B3M E;  4KTN A;  2ZKJ A;  1N36 E;  4YKY A;  2IWU A;  4YY3 I;  5J71 A;  1J5E I;  2YKB A;  1Z0C A;  4DV6 E;  4RPF A;  3EHH A;  1MG7 A;  2YEA A;  2E1R A;  2H8M A;  4LWF A;  4QPK A;  2GS8 A;  4DR4 E;  3G7E A;  3K17 A;  3VHC A;  4LF7 E;  2CG9 A;  2XJG A;  1YES A;  3QT8 A;  5FLX Q;  2BU5 A;  1UY8 A;  3FT8 A;  4JI7 E;  1YT1 A;  3A0T A;  4CWN A;  3A0Y A;  2UUC E;  2QFO A;  3EKO A;  1I5D A;  3IED A;  4MP7 A;  3CRL A;  4GT8 A;  3Q1Q A;  4K4O A;  4W7T A;  4LF9 I;  2ZM6 E;  3T1H E;  3B8H A;  5IDJ A;  2Q2E B;  4LFC I;  4DPY A;  2Q8F A;  4USM A;  1Z0B A;  4XE2 A;  4DU8 A;  1BXD A;  4LFA E;  1I59 A;  1UYM A;  1U0Z A;  3OWD A;  4EEH A;  3T1Y I;  1XNR I;  3V2U C;  1ZXM A;  2YI7 A;  2YE4 A;  4XDM A;  3D0B A;  5CTW A;  4ASF A;  2XDX A;  4YKU A;  4EGI A;  2UUA E;  3CGY A;  2HCH A;  1PIE A;  1XMO E;  3T0H A;  2CH4 A;  5F5R A;  3WQ9 A;  4O05 A;  4XCJ A;  5GMD A;  2F4V I;  2FWZ A;  3R4N A;  1PKP A;  1KTV A;  2BRC A;  4DR4 I;  2WER A;  1FI4 A;  5J6A A;  3CWV A;  4DV1 I;  2O1W A;  5L3J A;  2WI5 A;  4B7P A;  3PYF A;  3K98 A;  2UXD E;  4L90 A;  1UYD A;  4ZVI A;  2YEG A;  3RLR A;  4JI3 E;  1XMO I;  4FWH A;  4CE2 A;  2AKP A;  2VW5 A;  4JI1 E;  2A2D A;  1BKN A;  1KVK A;  2YEI A;  2X7I A;  3FV5 A;  4JV5 E;  4DV5 E;  2WI7 A;  1HNZ I;  3CRK A;  4LFC E;  4DUZ E;  3ZKD A;  4DPX A;  4FWD A;  5IWA I;  4CE3 A;  2LJP A;  3D4J A;  4R1F A;  3HUL A;  4NXM E;  4JYA E;  1ID0 A;  3T10 A;  1UYE A;  1I5C A;  1Z0W A;  4KSG A;  4ZKI A;  3U2D A;  4E02 A;  4LFA I;  4GKK I;  4Q20 A;  1TC6 A;  1H7U A;  4DU7 A;  1HNW E;  2YK9 A;  5A2Q C;  4DR3 E;  4CWF A;  3R92 A;  3ZZT A;  5M4N A;  4HZ0 A;  4HYM A;  2Q8G A;  4DV7 I;  4CWT A;  5C93 A;  2OI2 A;  1NZ0 A;  4LF7 I;  4FMT A;  3ZM7 A;  2E5L I;  4LF6 E;  4X9L A;  2QG2 A;  2YEF A;  1XMQ E;  3B24 A;  3HZ1 A;  4BQJ A;  3R4P A;  4U7N A;  1KZN A;  3OPD A;  1MX0 A;  4HAC B;  1KKH A;  4ASB A;  2F4V E;  4DV7 E;  4CWQ A;  2R42 A;  2XHT A;  3FT5 A;  3Q5J A;  1RR9 A;  4H85 A;  1KIJ A;  4LP0 A;  2XDL A;  1H73 A;  4DV2 I;  2WI6 A;  2UXD I;  2YI5 A;  4JI8 E;  2IWX A;  4JI6 I;  1Z0E A;  4LF6 I;  3K1J A; 
#chains in the Genus database with same CATH topology
 4DV6 I;  4JI0 I;  4JI3 I;  1HK7 A;  1YHC A;  1TBW A;  4FCQ A;  2PO1 A;  1Y4U A;  4HYP A;  4X66 I;  4IS9 A;  4JI1 I;  5JEA B;  3CGZ A;  4WUB A;  1ZWH A;  2YEC A;  2C37 A;  4I3H A;  1UYI A;  2IOP A;  4DV5 I;  3HEK A;  2HK3 A;  3O2F A;  2BSM A;  2VCJ A;  2YJX A;  4YHH E;  4LWG A;  3ZXO A;  5LMN E;  3M85 D;  4DV2 E;  3HJC A;  4XIR A;  4OX9 E;  2BA1 G;  2IOR A;  1UEK A;  3QDD A;  2ZIT A;  1FJG E;  2XX4 A;  1K47 A;  1HR0 E;  2HHH I;  4X66 E;  2BU7 A;  4B3R I;  2PNM A;  3TTZ A;  3PS2 A;  1YET A;  2YGA A;  4XIQ A;  5M4N A;  5C0X C;  3B78 A;  2HK2 A;  2WW4 A;  3PYE A;  4XKO A;  4YKX A;  4KHP I;  3HYZ A;  4LPF A;  5FNC A;  4DV3 I;  3U1K A;  1Y6Z A;  4DV0 I;  2YI0 A;  4KP4 A;  2XCM A;  5GGZ A;  4FW6 A;  4YKZ A;  1U2R A;  2YI6 A;  4X62 E;  3NMQ A;  4IFD E;  1J5E E;  3U1Y A;  4DR1 I;  2BRE A;  5CTX A;  3CDI A;  2GQ0 A;  3QT5 A;  1Z0V A;  2Z5C B;  4MDT A;  4DUY I;  4MU0 A;  5C0X D;  4U7O A;  4AWO A;  2YKI A;  4MPC A;  1YS3 A;  5DRO A;  4LCH A;  4JV5 I;  3ZZU A;  4KHP E;  1Y4S A;  2XHR A;  3OWB A;  2UUB E;  4GGL A;  3TZ5 A;  4B3S E;  3GME A;  4E00 A;  2VES A;  4FN5 A;  5IWA E;  4DUZ I;  3HZ5 A;  4L94 A;  4NH7 A;  2YKE A;  5IN9 A;  2YED A;  3GON A;  4PRV A;  4NXM I;  4JI0 E;  1AH8 A;  5M4H A;  4DPU A;  4BA2 B;  3EHF A;  2PNL A;  5K36 F;  1BGQ A;  1H72 C;  4EFU A;  5ELW A;  2PNR A;  2QG0 A;  1ZM4 A;  1OSF A;  1UY7 A;  1HNW I;  2O1V A;  2NN6 D;  2NPF A;  5FNF A;  4U3D A;  4QNJ A;  4NH9 A;  4XKA A;  4H7Q A;  2CCS A;  1UY9 A;  1YSZ A;  4FCP A;  1N0U A;  4FPP A;  4URN A;  2BM0 A;  1S16 A;  2UU9 I;  1BYQ A;  2YE5 A;  3K99 A;  4L8Z A;  4DPW A;  4FW5 A;  1B3Q A;  1D6T A;  2V2Z A;  1UYF A;  2NN6 A;  5BR8 E;  4AIM A;  1I94 E;  1FJG I;  4O09 A;  4DZY A;  2WP8 B;  2HFS A;  3JAM Q;  3MNR P;  2NN6 E;  5CTU A;  4YY3 E;  2C37 B;  4IZJ A;  1JM6 A;  3M6A A;  1US7 A;  4JI4 I;  1XNQ E;  3J7A M;  2AE8 A;  2VQE E;  4XTJ A;  5LMU E;  3INX A;  3Q5K A;  4GFN A;  4DV3 E;  4HZ5 A;  4EMV A;  1N0V C;  4FW7 A;  4DV0 E;  1ZXN A;  3JZ3 A;  4BAE A;  1YER A;  4QPJ A;  4LFB E;  5C0X A;  3A0R A;  2JKI A;  3VHD A;  4GKJ E;  4JI7 I;  4X62 I;  1GJV A;  1THN A;  4PRX A;  2WEP A;  2PO0 A;  1Z0G A;  3V5R A;  4ISA A;  4OO1 A;  4LF8 E;  4JI5 E;  1ZM2 A;  4AWP A;  4DR3 I;  4JI4 E;  2YEE A;  3EHJ A;  4DR6 I;  4DPT A;  4MBC A;  2UUC I;  2Q8H A;  5M4K A;  1OYS A;  4GQU A;  4O0B A;  2BU6 A;  2UWD A;  3K97 A;  4XKK A;  3KRN A;  2BA1 D;  4OX9 I;  3R91 A;  2PO2 A;  3WU3 A;  4P8O A;  1IXM A;  4R3M A;  3TZ0 A;  2C1G A;  3A0X A;  4E01 A;  5CF0 A;  2XHX A;  1HR0 I;  3L7Z B;  3B25 A;  3VAD A;  1PVG A;  4GQT A;  2VCI A;  4BXI A;  3HKM A;  2BR2 A;  1Y8N A;  3RKZ A;  4DUH A;  1HNX E;  1AM1 A;  4DV4 E;  2BA0 G;  4H81 A;  3HHU A;  3H4L A;  1U2O A;  1Y8P A;  4MU4 A;  4N3O A;  1YC1 A;  1IBL E;  2XAB A;  3RLQ A;  4AS9 A;  2UU9 E;  1H74 A;  4JI8 I;  3T1Y E;  2V2V A;  1IBK E;  1N32 E;  1IBM I;  1GKX A;  2YEJ A;  3G75 A;  4KSH A;  4X64 E;  4DR2 E;  4IFD B;  4JAS A;  4JAU A;  2ESA A;  2C39 B;  3B28 A;  1RRE A;  2WNR B;  4OZE A;  4L91 A;  3OW6 A;  2UXB E;  2YGF A;  3GIE A;  4URO A;  1H7S A;  3INW A;  3QT7 A;  4L93 A;  2JEA A;  3A0W A;  4LWI A;  2HFU A;  2BM1 A;  1AMW A;  4WUD A;  2YE2 A;  3PEJ A;  5CPH A;  5FWK A;  4X64 I;  2HHH E;  4NXN I;  4X65 I;  3GIG B;  5LL6 R;  3T2S A;  4BA2 A;  1I58 A;  4XC0 A;  4CE1 A;  3T1K A;  5DRP A;  5FLX C;  2XJX A;  2QF6 A;  2VQF I;  1FWL A;  3KE6 A;  3VHA A;  5M4E A;  1YH8 A;  1Z0T A;  1UYC A;  5GME A;  2YE6 A;  4IFD F;  3TZ2 A;  1QZR A;  2EXL A;  5M4P A;  1USU A;  2XK2 A;  3OTO I;  4MPE A;  4ASA A;  3QT6 A;  4PU9 A;  4DR7 E;  5EL9 A;  2H55 A;  3H80 A;  1UY6 A;  4OKG A;  3PYD A;  4JYA I;  1TIL A;  4YKR A;  2HKJ A;  2Q8I A;  2FWY A;  5JEA E;  2VQF E;  2YK2 A;  2VQE I;  5LMU I;  5BOC A;  2O1U A;  5IT9 C;  2VF3 A;  2CVE A;  4JAV A;  2C39 A;  5JEA D;  2J7K A;  3OTO E;  2BZ5 A;  2GO4 A;  4URL A;  1S14 A;  3T0Z A;  4EGK A;  2C1I A;  4U3B A;  2BA0 D;  2ZDX A;  3PEH A;  4DR2 I;  4CWR A;  5K36 B;  3U2K A;  1E3P A;  4AID A;  5D7D A;  3R4O A;  1QY8 A;  4LPB A;  1UYL A;  4MYT A;  4JI5 I;  4BIU A;  4LCF A;  1XHK A;  2JEB A;  2XX5 A;  5JEA F;  4K0K I;  4O07 A;  2XEX A;  1YC3 A;  2V8P A;  3M7N G;  1R62 A;  4JG4 A;  1N34 I;  3D2R A;  4I5S A;  3R4M A;  4LOM A;  1YC4 A;  3P3C A;  5D7C A;  4JI6 E;  4IZK B;  3G7B A;  1B63 A;  2X36 A;  2PO2 B;  4HY6 A;  4B6C A;  2R3V A;  1Z59 A;  4WUC A;  1Z5A A;  4GEE A;  4DR1 E;  3RLP A;  3P3G A;  4XIT A;  4ASG A;  4PL9 A;  4LF5 I;  4DUY E;  2UUA I;  4HXZ A;  4IFD C;  4K0K E;  4B3T E;  1UDS A;  2C38 B;  2JEA B;  3C11 A;  3GIF A;  3A0Z A;  2VWC A;  4URM A;  3M7N D;  3D36 A;  2BYI A;  5M4M A;  1UYH A;  1FNM A;  4YKQ A;  1Z5C A;  1TC0 A;  1FKA E;  2K5B A;  2GFD A;  4LF9 E;  1USV A;  4FW4 A;  5D6Q A;  1I5B A;  4EM7 A;  4AWQ A;  3CDJ A;  3U67 A;  1XXE A;  3B26 A;  5A2Q Q;  4OO1 E;  4OO1 F;  2BYH A;  1UYG A;  2XDK A;  1NHJ A;  2A2C A;  4B3R E;  1L0O A;  2CCU A;  2E0A A;  4E72 A;  3TUH A;  3DD6 A;  4P7A A;  2IWS A;  1A6F A;  4MP2 A;  1HNZ E;  4MU3 A;  3F0N A;  1XNR E;  1S4E A;  4P52 A;  2UXC E;  5BR8 I;  3LTO A;  1F51 A;  2XD6 A;  2ZBK B;  2YEB A;  4LWE A;  4R3A A;  2IOQ A;  4LF4 E;  1ZM3 A;  1R6M A;  2FYP A;  1N33 E;  2BU8 A;  2BV3 A;  4DV4 I;  3J80 C;  2YKJ A;  2EFG A;  1YSR A;  1GKZ A;  1FWK A;  4MOT A;  2UUB I;  1IBL I;  4IFD D;  4LWH A;  3PYG A;  4U93 A;  1AJ6 A;  2YE8 A;  1IBK I;  1N32 I;  1NHI A;  3O6O A;  2DEI A;  4DR7 I;  5D6P A;  4KFG A;  2E5L E;  2BTZ A;  3S5T A;  4EFT A;  2ZM6 I;  1XMQ I;  2GQP A;  3BMY A;  1UYK A;  4YKW A;  2V2Q A;  5IDM A;  4LCG A;  2YE9 A;  3BM9 A;  4O04 A;  3WU5 A;  1A4H A;  3LNU A;  2IER A;  2CGF A;  4ED4 A;  3B27 A;  1Z5B A;  4Z7Y A;  1OYR A;  2HKE A;  4AQY E;  2WI1 A;  4JQL A;  4YKT A;  2WI4 A;  3TZ4 A;  2BU2 A;  3K60 A;  1Y60 A;  3P3E A;  2IES A;  2BT0 A;  5IT9 Q;  4EGH A;  3PRY A;  1I94 I;  3C0E A;  4X65 E;  4DR5 I;  4NXN E;  2V34 A;  2XDS A;  2PNZ A;  4FWG A;  1UDN A;  3J80 Q;  1AH6 A;  3CYG A;  1ZW9 A;  4HXW A;  3PS1 A;  2YGE A;  3GLL A;  3B82 A;  3WU4 A;  4GKK E;  4V25 A;  1YT0 A;  2O3Z A;  3WU6 A;  2JJC A;  4CWP A;  1N34 E;  4MU1 A;  3ZKB A;  2CCT A;  2DEJ A;  5LMN I;  3GCM A;  1XNQ I;  4JI2 E;  5DRQ A;  2YEH A;  1TH8 A;  3WHA A;  1IBM E;  4Z7C A;  4DR5 E;  4GKJ I;  5BOD A;  3Q5L A;  3GIG A;  3O0I A;  3J81 C;  1YT2 A;  4DV1 E;  4CWO A;  4DXL A;  2JE6 A;  2C2A A;  2XDU A;  4LFB I;  2YJW A;  1E3H A;  1N36 I;  3ZXQ A;  3JAM C;  1MU5 A;  1N33 I;  4USK A;  4DR6 E;  2UXB I;  4EMD A;  4B3T I;  4V26 A;  4LF8 I;  1OYP A;  2C38 A;  5F3K A;  1OJ4 A;  3QTF A;  3J81 Q;  4JI2 I;  4GCZ A;  2NN6 F;  1Y8O A;  2Z5C A;  4M1K A;  4HY1 A;  4NBQ A;  1EI1 A;  4CWS A;  5CTY A;  1I5A A;  1HNX I;  2WI3 A;  2XJJ A;  4NH8 A;  1ZM9 A;  5DNX A;  3LPS A;  4KQV A;  4FCR A;  4UT4 A;  4AQY I;  3EHG A;  4UTG A;  3ZZ0 A;  4BA1 B;  1Y5Y A;  1NHH A;  4B3S I;  3EKR A;  2CZ9 A;  4HAC A;  3DGE A;  5EKW A;  4AM3 A;  1QYE A;  3HYY A;  5D7R A;  4MYU A;  2WI2 A;  2XX2 A;  4XIP A;  4YHH I;  2UXC I;  1TID A;  4B3M I;  1DAR A;  2YE3 A;  2YE7 A;  1WUU A;  5K36 A;  2ZDY A;  4MB9 A;  4LF4 I;  3T1H I;  4BQG A;  3J7A G;  4XD8 A;  4LF5 E;  1RHY A;  1EA6 A;  5FND A;  4OO1 D;  1B62 A;  4BIZ A;  2YKC A;  2AJ4 A;  4MPN A;  3M85 G;  4FW9 A;  2WEQ A;  2HG1 A;  3P76 A;  1ELO A;  1VIS A;  2FXS A;  4XCL A;  3SL2 A;  3OMU A;  4IZJ B;  4B3M E;  4KTN A;  2ZKJ A;  1N36 E;  4YKY A;  2IWU A;  4YY3 I;  5J71 A;  1J5E I;  2YKB A;  1Z0C A;  4DV6 E;  4RPF A;  5K36 D;  3EHH A;  2JEB B;  1MG7 A;  2E1R A;  2H8M A;  2YEA A;  4LWF A;  2GS8 A;  4QPK A;  3Q6N A;  2PO0 B;  2O1T A;  4DR4 E;  4OO1 B;  5C0X E;  3G7E A;  3K17 A;  2F1D A;  5DNL A;  2JE6 B;  4QNK A;  5DRR A;  4LF7 E;  2CG9 A;  2XJG A;  3VHC A;  1YES A;  3QT8 A;  5FLX Q;  2BU5 A;  1UY8 A;  3FT8 A;  4JI7 E;  1YT1 A;  3A0T A;  4CWN A;  3A0Y A;  2UUC E;  5K36 C;  3K85 A;  2QFO A;  3EKO A;  2HHI A;  1I5D A;  3IED A;  2CGE A;  4MP7 A;  3CRL A;  4GT8 A;  3Q1Q A;  4K4O A;  4W7T A;  4LF9 I;  2FTK A;  2ZM6 E;  3T1H E;  3LMM A;  3B8H A;  5IDJ A;  2WP8 A;  5JEN A;  2Q2E B;  4LFC I;  1R6L A;  4DPY A;  2Q8F A;  4USM A;  4IZK A;  4MQY A;  1Z0B A;  4XE2 A;  4DU8 A;  1BXD A;  4LFA E;  1I59 A;  2Z5B A;  1UYM A;  1U0Z A;  3OWD A;  4EEH A;  3T1Y I;  1XNR I;  3V2U C;  1ZXM A;  2YI7 A;  2YE4 A;  4J3D A;  4XDM A;  5C0X B;  3D0B A;  5CTW A;  4ASF A;  2BR2 B;  2XDX A;  4YKU A;  4EGI A;  2UUA E;  3CGY A;  5C0X F;  2HCH A;  1PIE A;  1XMO E;  3T0H A;  2CH4 A;  5F5R A;  3B4T A;  3WQ9 A;  4O05 A;  4BA1 A;  5GMD A;  2F4V I;  2FWZ A;  3R4N A;  4XCJ A;  1PKP A;  1KTV A;  2BRC A;  1UDO A;  4DR4 I;  2WER A;  1FI4 A;  2WNR A;  5J6A A;  3CWV A;  3NZK A;  4DV1 I;  2O1W A;  5L3J A;  2PNZ B;  2WI5 A;  3L7Z A;  2J65 A;  3PYF A;  4B7P A;  3K98 A;  2UXD E;  4L90 A;  1UYD A;  4ZVI A;  2YEG A;  3RLR A;  1VI7 A;  4IZJ D;  3UHM A;  4JI3 E;  1XMO I;  4FWH A;  4CE2 A;  2AKP A;  2VW5 A;  2NN6 C;  4JI1 E;  1P42 A;  2A2D A;  1BKN A;  1KVK A;  1UDQ A;  2YEI A;  2X7I A;  2PO1 B;  3FV5 A;  4JV5 E;  5JEA C;  5JEA A;  3PS3 A;  4DV5 E;  2WI7 A;  1HNZ I;  4IFD A;  3CRK A;  4LFC E;  3ZKD A;  4DPX A;  2JT2 A;  4FWD A;  5IWA I;  4DUZ E;  4CE3 A;  2LJP A;  3D4J A;  4R1F A;  3HUL A;  4NXM E;  4JYA E;  1ID0 A;  3T10 A;  1UYE A;  1I5C A;  1Z0W A;  4KSG A;  4ZKI A;  3U2D A;  4E02 A;  4LFA I;  4GKK I;  4Q20 A;  1TC6 A;  1H7U A;  4DU7 A;  1HNW E;  2GO3 A;  2YK9 A;  5A2Q C;  4DR3 E;  4CWF A;  3R92 A;  3P06 A;  3ZZT A;  4HZ0 A;  2Z5E A;  4HYM A;  4DV7 I;  2Q8G A;  4CWT A;  5C93 A;  2OI2 A;  3H1C A;  1NZ0 A;  2NN6 B;  4LF7 I;  4FMT A;  3ZM7 A;  2E5L I;  4LF6 E;  4X9L A;  2QG2 A;  2YEF A;  1XMQ E;  3B24 A;  3HZ1 A;  4BQJ A;  3R4P A;  2Z5B B;  4U7N A;  4FW3 A;  4OO1 C;  1KZN A;  3OPD A;  1MX0 A;  4HAC B;  1KKH A;  4ASB A;  2F4V E;  4DV7 E;  4CWQ A;  2R42 A;  5K36 E;  2XHT A;  3FT5 A;  3Q5J A;  1RR9 A;  4H85 A;  1KIJ A;  4LP0 A;  2XDL A;  1H73 A;  4DV2 I;  2WI6 A;  3Q6M A;  2UXD I;  4JI8 E;  2IWX A;  2YI5 A;  4JI6 I;  1Z0E A;  4LF6 I;  3K1J A; 
#chains in the Genus database with same CATH homology
 4DV6 I;  4JI0 I;  4JI3 I;  1HK7 A;  1TBW A;  4FCQ A;  4HYP A;  1Y4U A;  4X66 I;  4JI1 I;  3CGZ A;  4WUB A;  1ZWH A;  2YEC A;  4I3H A;  1UYI A;  2IOP A;  4DV5 I;  3HEK A;  2HK3 A;  3O2F A;  2BSM A;  2VCJ A;  2YJX A;  4YHH E;  4LWG A;  3ZXO A;  5LMN E;  4DV2 E;  4XIR A;  3HJC A;  4OX9 E;  2IOR A;  1UEK A;  3QDD A;  2ZIT A;  1FJG E;  2XX4 A;  1K47 A;  1HR0 E;  2HHH I;  4X66 E;  2BU7 A;  4B3R I;  2PNM A;  3TTZ A;  4XIQ A;  1YET A;  2YGA A;  5M4N A;  3B78 A;  2HK2 A;  2WW4 A;  3PYE A;  4XKO A;  4YKX A;  4KHP I;  3HYZ A;  5FNC A;  4DV3 I;  1Y6Z A;  4DV0 I;  2YI0 A;  4KP4 A;  2XCM A;  5GGZ A;  4YKZ A;  1U2R A;  2YI6 A;  4X62 E;  3NMQ A;  4BXI A;  1J5E E;  4DR1 I;  5CTX A;  2BRE A;  2GQ0 A;  3QT5 A;  1Z0V A;  2Z5C B;  4AWO A;  4DUY I;  4U7O A;  2YKI A;  4MPC A;  1YS3 A;  4JV5 I;  3ZZU A;  4KHP E;  1Y4S A;  2XHR A;  3OWB A;  2UUB E;  4GGL A;  3TZ5 A;  4B3S E;  4E00 A;  4FN5 A;  5IWA E;  4DUZ I;  3HZ5 A;  4L94 A;  4NH7 A;  2YKE A;  5IN9 A;  2YED A;  3GON A;  4PRV A;  4NXM I;  4JI0 E;  1AH8 A;  5M4H A;  4DPU A;  3EHF A;  2PNL A;  1BGQ A;  1H72 C;  4EFU A;  2PNR A;  2QG0 A;  1ZM4 A;  1OSF A;  1UY7 A;  1HNW I;  2O1V A;  2NPF A;  5FNF A;  4NH9 A;  4XKA A;  4H7Q A;  2CCS A;  1UY9 A;  1YSZ A;  4FCP A;  1N0U A;  4FPP A;  4URN A;  2BM0 A;  1S16 A;  2UU9 I;  1BYQ A;  2YE5 A;  3K99 A;  4L8Z A;  4DPW A;  1B3Q A;  1D6T A;  2V2Z A;  1UYF A;  5BR8 E;  1I94 E;  4O09 A;  1FJG I;  4DZY A;  2HFS A;  3JAM Q;  3MNR P;  5CTU A;  4YY3 E;  4IZJ A;  1JM6 A;  3M6A A;  1US7 A;  4JI4 I;  1XNQ E;  3J7A M;  2VQE E;  5LMU E;  4XTJ A;  3INX A;  3Q5K A;  4GFN A;  4HZ5 A;  4DV3 E;  4EMV A;  1N0V C;  4DV0 E;  1ZXN A;  3JZ3 A;  4BAE A;  1YER A;  4QPJ A;  4LFB E;  3A0R A;  2JKI A;  3VHD A;  4GKJ E;  4JI7 I;  4X62 I;  1GJV A;  1THN A;  4PRX A;  2WEP A;  1Z0G A;  3V5R A;  4LF8 E;  4JI5 E;  1ZM2 A;  4AWP A;  4DR3 I;  4JI4 E;  2YEE A;  3EHJ A;  4DR6 I;  4DPT A;  4MBC A;  2UUC I;  2Q8H A;  5M4K A;  4O0B A;  2BU6 A;  2UWD A;  3K97 A;  4XKK A;  4OX9 I;  3R91 A;  3WU3 A;  4R3M A;  4P8O A;  3TZ0 A;  5CF0 A;  3A0X A;  4E01 A;  2XHX A;  1HR0 I;  3B25 A;  3VAD A;  1PVG A;  4GQT A;  2VCI A;  1Y8N A;  3RKZ A;  4DUH A;  1HNX E;  1AM1 A;  4DV4 E;  4H81 A;  3HHU A;  3H4L A;  1U2O A;  1Y8P A;  4N3O A;  1YC1 A;  1IBL E;  2XAB A;  3RLQ A;  4AS9 A;  2UU9 E;  1H74 A;  4JI8 I;  3T1Y E;  2V2V A;  1IBK E;  1N32 E;  1IBM I;  1GKX A;  2YEJ A;  3G75 A;  4KSH A;  4X64 E;  4DR2 E;  4JAS A;  4JAU A;  2ESA A;  3B28 A;  1RRE A;  4L91 A;  3OW6 A;  2UXB E;  2YGF A;  3GIE A;  4URO A;  1H7S A;  3INW A;  3QT7 A;  4L93 A;  3A0W A;  4LWI A;  2HFU A;  2BM1 A;  1AMW A;  4WUD A;  2YE2 A;  3PEJ A;  5CPH A;  5FWK A;  4X64 I;  2HHH E;  4NXN I;  4X65 I;  3GIG B;  5LL6 R;  3T2S A;  1I58 A;  4XC0 A;  4CE1 A;  3T1K A;  5FLX C;  2XJX A;  2QF6 A;  2VQF I;  1FWL A;  3KE6 A;  3VHA A;  5M4E A;  1UYC A;  1Z0T A;  2YE6 A;  5GME A;  3TZ2 A;  1QZR A;  2EXL A;  5M4P A;  1USU A;  2XK2 A;  3OTO I;  4MPE A;  4ASA A;  3QT6 A;  4PU9 A;  4DR7 E;  2H55 A;  3H80 A;  1UY6 A;  3PYD A;  4JYA I;  1TIL A;  4YKR A;  2HKJ A;  2Q8I A;  2FWY A;  2VQF E;  2YK2 A;  2VQE I;  5LMU I;  5BOC A;  2O1U A;  5IT9 C;  2VF3 A;  4JAV A;  2J7K A;  3OTO E;  2BZ5 A;  1S14 A;  4URL A;  3T0Z A;  4EGK A;  2ZDX A;  3PEH A;  4DR2 I;  4CWR A;  3U2K A;  5D7D A;  3R4O A;  1QY8 A;  4LPB A;  1UYL A;  4MYT A;  4JI5 I;  4BIU A;  1XHK A;  2XX5 A;  4K0K I;  4O07 A;  2XEX A;  1YC3 A;  2V8P A;  1R62 A;  4JG4 A;  1N34 I;  3D2R A;  4I5S A;  3R4M A;  1YC4 A;  5D7C A;  4JI6 E;  4IZK B;  3G7B A;  1B63 A;  2X36 A;  4HY6 A;  4B6C A;  2R3V A;  1Z59 A;  4WUC A;  1Z5A A;  4GEE A;  4DR1 E;  3RLP A;  4XIT A;  4ASG A;  4PL9 A;  4LF5 I;  4DUY E;  2UUA I;  4HXZ A;  4K0K E;  4B3T E;  3C11 A;  3GIF A;  3A0Z A;  2VWC A;  4URM A;  3D36 A;  2BYI A;  5M4M A;  1UYH A;  1FNM A;  4YKQ A;  1Z5C A;  1TC0 A;  1FKA E;  2K5B A;  2GFD A;  4LF9 E;  1USV A;  5D6Q A;  1I5B A;  4AWQ A;  3U67 A;  3B26 A;  5A2Q Q;  2BYH A;  1UYG A;  2XDK A;  1NHJ A;  2A2C A;  4B3R E;  1L0O A;  2CCU A;  2E0A A;  3TUH A;  2IWS A;  4P7A A;  1A6F A;  4MP2 A;  1HNZ E;  3F0N A;  1XNR E;  1S4E A;  4P52 A;  2UXC E;  5BR8 I;  3LTO A;  2XD6 A;  2YEB A;  2ZBK B;  4LWE A;  4R3A A;  2IOQ A;  4LF4 E;  1ZM3 A;  2FYP A;  1N33 E;  2BU8 A;  2BV3 A;  4DV4 I;  3J80 C;  2YKJ A;  2EFG A;  1YSR A;  1GKZ A;  1FWK A;  4MOT A;  2UUB I;  1IBL I;  4LWH A;  3PYG A;  4U93 A;  1AJ6 A;  2YE8 A;  1IBK I;  1N32 I;  1NHI A;  3O6O A;  2DEI A;  4DR7 I;  5D6P A;  4KFG A;  2E5L E;  2BTZ A;  4EFT A;  2ZM6 I;  1XMQ I;  2GQP A;  3BMY A;  1UYK A;  4YKW A;  2V2Q A;  5IDM A;  2YE9 A;  3BM9 A;  4O04 A;  3WU5 A;  1A4H A;  3LNU A;  2CGF A;  4ED4 A;  3B27 A;  1Z5B A;  4Z7Y A;  2HKE A;  4AQY E;  2WI1 A;  4JQL A;  4YKT A;  2WI4 A;  3TZ4 A;  2BU2 A;  3K60 A;  2BT0 A;  4EGH A;  5IT9 Q;  3PRY A;  1I94 I;  3C0E A;  4X65 E;  4DR5 I;  4NXN E;  2V34 A;  2XDS A;  4FWG A;  3J80 Q;  1AH6 A;  1ZW9 A;  4HXW A;  2YGE A;  3B82 A;  3WU4 A;  4GKK E;  4V25 A;  1YT0 A;  3WU6 A;  4CWP A;  2JJC A;  1N34 E;  3ZKB A;  2CCT A;  2DEJ A;  5LMN I;  1XNQ I;  4JI2 E;  2YEH A;  3WHA A;  1TH8 A;  1IBM E;  4Z7C A;  4DR5 E;  4GKJ I;  5BOD A;  3Q5L A;  3GIG A;  3O0I A;  3J81 C;  1YT2 A;  4DV1 E;  4CWO A;  4DXL A;  2C2A A;  2XDU A;  4LFB I;  2YJW A;  3ZXQ A;  1N36 I;  3JAM C;  1MU5 A;  1N33 I;  4USK A;  4DR6 E;  2UXB I;  4EMD A;  4B3T I;  4V26 A;  4LF8 I;  5F3K A;  1OJ4 A;  3QTF A;  3J81 Q;  4JI2 I;  4GCZ A;  1Y8O A;  2Z5C A;  4M1K A;  4HY1 A;  1EI1 A;  4CWS A;  5CTY A;  1I5A A;  1HNX I;  2WI3 A;  2XJJ A;  4NH8 A;  1ZM9 A;  3LPS A;  4KQV A;  4FCR A;  4UT4 A;  4AQY I;  3EHG A;  4UTG A;  3ZZ0 A;  1NHH A;  4B3S I;  3EKR A;  2CZ9 A;  4HAC A;  3DGE A;  1QYE A;  3HYY A;  5D7R A;  4MYU A;  2WI2 A;  2XX2 A;  4XIP A;  4YHH I;  2UXC I;  1TID A;  4B3M I;  1DAR A;  2YE3 A;  2YE7 A;  1WUU A;  2ZDY A;  4MB9 A;  4BQG A;  4LF4 I;  3T1H I;  4EM7 A;  3J7A G;  4XD8 A;  4LF5 E;  1EA6 A;  5FND A;  1B62 A;  4BIZ A;  2YKC A;  2AJ4 A;  4MPN A;  4FW9 A;  2WEQ A;  2HG1 A;  1ELO A;  1VIS A;  2FXS A;  4XCL A;  3SL2 A;  3OMU A;  4IZJ B;  4B3M E;  4KTN A;  2ZKJ A;  1N36 E;  4YKY A;  2IWU A;  4YY3 I;  5J71 A;  1J5E I;  2YKB A;  1Z0C A;  4DV6 E;  4RPF A;  3EHH A;  1MG7 A;  2YEA A;  2E1R A;  2H8M A;  4LWF A;  4QPK A;  2GS8 A;  3Q6N A;  2O1T A;  4DR4 E;  3G7E A;  3K17 A;  3VHC A;  4LF7 E;  2CG9 A;  2XJG A;  1YES A;  3QT8 A;  5FLX Q;  2BU5 A;  1UY8 A;  3FT8 A;  4JI7 E;  1YT1 A;  3A0T A;  4CWN A;  3A0Y A;  2UUC E;  3K85 A;  2QFO A;  3EKO A;  1I5D A;  3IED A;  2CGE A;  4MP7 A;  3CRL A;  4GT8 A;  3Q1Q A;  4K4O A;  4W7T A;  4LF9 I;  2ZM6 E;  3T1H E;  3B8H A;  5IDJ A;  2Q2E B;  4LFC I;  4DPY A;  2Q8F A;  4USM A;  4IZK A;  1Z0B A;  4XE2 A;  4DU8 A;  1BXD A;  4LFA E;  1I59 A;  2Z5B A;  1UYM A;  1U0Z A;  3OWD A;  4EEH A;  3T1Y I;  1XNR I;  3V2U C;  1ZXM A;  2YI7 A;  2YE4 A;  4XDM A;  3D0B A;  5CTW A;  4ASF A;  2XDX A;  4YKU A;  4EGI A;  2UUA E;  3CGY A;  2HCH A;  1PIE A;  1XMO E;  3T0H A;  2CH4 A;  5F5R A;  3WQ9 A;  4O05 A;  4XCJ A;  5GMD A;  2F4V I;  2FWZ A;  3R4N A;  1PKP A;  1KTV A;  2BRC A;  4DR4 I;  2WER A;  1FI4 A;  5J6A A;  3CWV A;  4DV1 I;  2O1W A;  5L3J A;  2WI5 A;  4B7P A;  3PYF A;  3K98 A;  2UXD E;  4L90 A;  1UYD A;  4ZVI A;  2YEG A;  3RLR A;  4IZJ D;  4JI3 E;  1XMO I;  4FWH A;  4CE2 A;  2AKP A;  2VW5 A;  4JI1 E;  2A2D A;  1BKN A;  1KVK A;  2YEI A;  2X7I A;  3FV5 A;  4JV5 E;  4DV5 E;  2WI7 A;  1HNZ I;  3CRK A;  4LFC E;  4DUZ E;  3ZKD A;  4DPX A;  4FWD A;  5IWA I;  4CE3 A;  2LJP A;  3D4J A;  4R1F A;  3HUL A;  4NXM E;  4JYA E;  1ID0 A;  3T10 A;  1UYE A;  1I5C A;  1Z0W A;  4KSG A;  4ZKI A;  3U2D A;  4E02 A;  4LFA I;  4GKK I;  4Q20 A;  1TC6 A;  1H7U A;  4DU7 A;  1HNW E;  2YK9 A;  5A2Q C;  4DR3 E;  4CWF A;  3R92 A;  3P06 A;  3ZZT A;  4HZ0 A;  2Z5E A;  4HYM A;  4DV7 I;  2Q8G A;  4CWT A;  5C93 A;  2OI2 A;  1NZ0 A;  4LF7 I;  4FMT A;  3ZM7 A;  2E5L I;  4LF6 E;  4X9L A;  2QG2 A;  2YEF A;  1XMQ E;  3B24 A;  3HZ1 A;  4BQJ A;  3R4P A;  2Z5B B;  4U7N A;  1KZN A;  3OPD A;  1MX0 A;  4HAC B;  1KKH A;  4ASB A;  2F4V E;  4DV7 E;  4CWQ A;  2R42 A;  2XHT A;  3FT5 A;  3Q5J A;  1RR9 A;  4H85 A;  1KIJ A;  4LP0 A;  2XDL A;  1H73 A;  4DV2 I;  2WI6 A;  3Q6M A;  2UXD I;  4JI8 E;  2IWX A;  2YI5 A;  4JI6 I;  1Z0E A;  4LF6 I;  3K1J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...