5C93A

Histidine kinase with atp
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
239
structure length
235
Chain Sequence
VTEQQKIDNDRKQFVSNVSHELRTPLTSLRSYIEALSDGAWKDPEVAPGFLKVTQEETDRMIRMINELLSLSRMDSGTTRVDMELVNINEMFNYVLDRFDMILKKDDNPAKYYTIKREFTKRDLWVEIDTDKFTQVLDNIMNNAIKYSPDGGVVTCRLLETHNQVIISISDQGLGIPRADLGHVFDRFFRVDKAQGGTGLGLAISKEVVQMLGGRIWVDSVEGKGSTFYISLPYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histidine kinase
publication title Conformational dynamics of the essential sensor histidine kinase WalK.
pubmed doi rcsb
source organism Lactobacillus plantarum 16
molecule tags Transferase
total genus 82
structure length 235
sequence length 239
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2015-06-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5c93A01
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 5c93A02
2YEBA 5D6QA 3CRLA 4L93A 5IDMA 5FNCA 2YGEA 4JAVA 3GIFA 2BREA 5M4KA 1YT2A 4BQJA 2WI3A 1OSFA 4XTJA 1Z5CA 5FNFA 3T0ZA 1UYKA 4URLA 2XX4A 4LP0A 1ZWHA 4AS9A 4XIRA 2XK2A 4JQLA 1MX0A 3OMUA 4HY1A 3GIEA 2BU7A 2HKJA 3RKZA 3HYZA 4KQVA 3VHAA 4CE1A 2YEDA 2LFRA 4XIPA 4BQGA 2WI6A 2XHTA 1AH6A 2YJXA 1UYFA 4ASBA 3INWA 3OW6A 3D0BA 4QPJA 1I5DA 1UYEA 2ZDYA 1UYGA 2YKIA 2YE5A 3A0YA 1UYHA 3PEHA 1YS3A 4CE2A 3CRKA 4UROA 3ZXOA 2YE3A 2YKJA 2JKIA 4FCRA 3B27A 2Q8FA 3TTZA 4GGLA 4AWPA 3U67A 1YERA 4EEHA 4CWPA 1Y8OA 1YESA 2BU8A 5IN9A 1AM1A 1UYDA 2CCSA 5D7CA 4XC0A 2GQPA 2YKCA 3EKOA 3ZKDA 4K4OA 4EM7A 1BKNA 4FMTA 4LC1A 4O05A 2XDSA 5M4MA 4L91A 2ZBKB 4MPCA 3TUHA 2WERA 3VADA 3CGZA 4MP7A 2WEPA 3R4NA 4H85A 4NH9A 2IOPA 3FT8A 2XDXA 2YGFA 2HCHA 1I59A 2XJXA 3MD0A 1UYCA 3ZRXA 3RLPA 4MPEA 3BMYA 3R91A 1YSZA 2PNRA 4FPPA 4MP2A 1NHJA 5BOCA 4I5SA 5F5RA 2ESAA 3FV5A 4KP4A 4YKTA 1EI1A 2WEQA 4HXWA 4XIQA 2BYIA 1Y4SA 2IWXA 3IEDA 4GT8A 3HZ1A 1Y8PA 4XCJA 1GJVA 3Q5LA 3EHJA 5M4EA 2VWCA 4XCLA 4E02A 4PRXA 2Q2EB 4CWOA 2IORA 4GT1A 3ZM7A 2VW5A 2GFDA 4HYMA 2WI7A 3ZXQA 5M4PA 1NHHA 2BSMA 5FNDA 4XKOA 2Q8HA 4XDMA 4CWFA 3QTFA 3B24A 4BXIA 5J6AA 5B1NA 1S16A 2H55A 2YE9A 5D6PA 1TILA 3ZCCA 2BYHA 2XD6A 3A0TA 4O04A 3K98A 4HZ5A 1F51A 4ASFA 4O0BA 4HY6A 4GFNA 4V25A 2O1UA 5C93A 5J71A 4EMVA 2YE4A 2ZKJA 4HYPA 2ZDXA 4R1FA 4L90A 1I5CA 4ZKIA 1ZXNA 2CH4A 2FTKA 1B63A 3G75A 2WI5A 2CGFA 4H81A 3TZ4A 3O6OA 1TC0A 4JYBA 4E01A 3B26A 1UYLA 2XDKA 3VHDA 1BYQA 1YSRA 4CWQA 1H7UA 3LNUA 3CGYA 5D7DA 3R92A 3BM9A 4BIZA 2O1WA 2YI7A 2BT0A 3INXA 2Q8IA 1I5AA 2FWZA 1YC1A 2QM7A 3U2DA 1UYIA 3HZ5A 1THNA 2YEJA 2QFOA 3D2RA 4LPBA 2BU5A 4L8ZA 4HZ0A 3T10A 4LWFA 2XX2A 2LFSA 4KFGA 1U2OA 4L94A 2VCIA 2YEGA 4WUBA 4LWHA 4AWOA 2YI5A 1TC6A 1ZW9A 2BU6A 1QYEA 1B3QA 4YKZA 4MBCA 4PRVA 5F3KA 4B6CA 3H80A 4KSGA 2YEHA 2YE2A 4NH8A 4DUHA 3HHUA 3TZ5A 3TK1A 2XJJA 3NMQA 2C2AA 3B25A 4I3HA 3C11A 4NH7A 1YC4A 3T1KA 4P8OA 4ZVIA 1Z5BA 1R62A 4AWQA 2JJCA 3EHFA 3B28A 4PL9A 1YC3A 1Y4UA 3VHCA 3DGEA 2H8MA 2QG0A 2XCMA 3D36A 4JAUA 4MTXA 2AKPA 4YKWA 4O07A 2BZ5A 4GEEA 2YEFA 3EKRA 4MOTA 1U0ZA 2O1VA 3HYYA 4MB9A 2QM8A 5IDJA 2HG1A 4EFUA 1S14A 4DZYA 3RLRA 3ZKBA 3H4LA 1JM6A 1BXDA 4U7NA 2IWSA 4B7PA 4P7AA 1L0OA 3K99A 4R3MA 5L3JA 4WUDA 3OWBA 1Z5AA 2Q8GA 2WI4A 3A0RA 2YE6A 1Y8NA 2UWDA 4FCQA 4U93A 1UY8A 2BTZA 3R4MA 2E0AA 4KSHA 3T2SA 2XDUA 3Q5JA 4GQTA 4BIUA 4EGIA 4MPNA 5BODA 2XABA 2YE8A 4PU9A 2FXSA 1ZXMA 2FWYA 2CCTA 4XD8A 1KZNA 4Q20A 1UY7A 3U2KA 3P32A 4W7TA 3O2FA 1YETA 3A0XA 2YI0A 1UYMA 4CWRA 3EHHA 4JYCA 2K5BA 5CPHA 4YKUA 2YEIA 4U7OA 5CTXA 1NHIA 2IWUA 2FYPA 3ZRWB 2CCUA 2XHXA 3WQ9A 2QF6A 5CF0A 1GKZA 3A0WA 3OPDA 4HXZA 5FWKA 4FCPA 3JZ3A 3ZRVA 3SL2A 4XE2A 2YJWA 4CWSA 2YK2A 4EGKA 1AMWA 1EA6A 3Q5KA 4O09A 4YKQA 3FT5A 1B62A 2XHRA 3ZRWA 2QG2A 2YKEA 4QPKA 4R3AA 1QY8A 3K60A 4MT8A 2XJGA 4JASA 3NXSA 1KIJA 2BU2A 3RLQA 4X9LA 3CWVA 4XKKA 3OWDA 3TZ2A 2YK9A 2YE7A 3HEKA 2WWWA 5D7RA 3PEJA 4EGHA 1A4HA 1I58A 5CTYA 3O0IA 1ID0A 2P67A 3G7EA 4XKAA 4LWIA 3K97A 2BRCA 1UY6A 4EFTA 3KE6A 2VCJA 4YKXA 4ASGA 4WUCA 2CG9A 3C0EA 5GGZA 5M4HA 4URMA 1IXMA 1GKXA 3GIGB 5M4NA 4CWTA 1MU5A 1JOYA 1TBWA 2WI2A 2XDLA 4LWGA 2WI1A 2YKBA 4LWEA 1I5BA 3TZ0A 3EHGA 4YKYA 1QZRA 3T0HA 3WHAA 5CTUA 2EXLA 1AJ6A 4XITA 4CE3A 3G7BA 1UY9A 2IOQA 4ASAA 1Z59A 4E00A 3GIGA 1TH8A 3R4OA 1AH8A 2YI6A 3QDDA 1YT1A 1BGQA 4CWNA 1H7SA 4BAEA 2YECA 4H7QA 1PVGA 4YKRA 1YT0A 5B1OA 5CTWA 3MNRP 2YEEA 2YGAA 4GCZA 4KTNA 3A0ZA 3LPSA 2YEAA 4V26A 1TIDA 1US7A 4URNA 2XX5A 3R4PA
chains in the Genus database with same CATH superfamily
1F23A 1AROP 3QTCA 2KG7B 4RUFA 3CRLA 4L93A 2NR5A 4JGSA 1Q86W 4J80A 1VQ8V 3JAWA 3UO2A 2YGEA 4GX2A 1YDXA 4B3TB 5M4KA 1XQ8A 3E2EA 1NBMG 4K8XA 1Z5CA 4LNUB 3RYCA 4URLA 2NLJC 4I0XA 2XK2A 4JQLA 2V7QG 1BQ0A 5J2UA 5KMGA 1LUVA 2UXNA 1CEZA 4HY1A 2BU7A 4GKKB 2HKJA 1GKFA 3SPHA 3FB5C 2LGQA 3DC6A 3HKEA 4O4LA 3E8HA 1G1XB 1S3JA 4PJ0Z 1SRYA 4XIPA 2PYJA 4BQGA 2Q4PA 4MVRA 5B1AC 4O4JA 1XL6A 4TV9A 5KHGA 4X88A 1UYEA 4X64O 2ZDYA 1RSOB 2OT5A 5KAFZ 4PV1B 1HNWO 5H6QA 4DR4B 4WFEA 1JCHA 2Y0IA 2UUBB 4UROA 4HBNA 2YKJA 3ASNB 2HFEC 3B27A 1WJZA 4JI6B 1SKVA 1B6QA 3E35A 5IN9A 1QLEC 2IBZH 2EZPA 4CH4A 4B3SO 2X6BA 5CB4B 1VQ5V 4PA7A 5D7CA 1N8RW 1IBLO 4J10A 5JVDA 4AILC 4UVAA 5B1BB 1YCIA 1KC8W 2Q8VA 2EX3A 3L70H 4LFCO 1NKDA 3KKYA 4TUYB 2P06A 3EFFK 5GW7A 4E72A 2ZBKB 4F6RB 3HKCB 3E8BA 1MA1A 4D7SA 2ZT9B 4N21A 2HKOA 4YJ2A 4H85A 1FXVA 2EBOA 3FT8A 1I94O 2MW2B 1VQNV 4LWSA 2UXBO 2HP8A 3ZRXA 2QTSA 3CCRV 1VQ7V 3BMYA 4MPEA 2FMLA 2RQ6A 1ZAUA 1NHJA 2ZD9A 1DLBA 2ESAA 4DYLA 4JI4O 2UU9B 4L87A 5CBHA 2BYIA 2IWXA 1S5HC 1Y8PA 1UFIA 5BXZA 1YVWA 2W0XA 3Q5LA 4CH6A 4IHJA 2QKCA 3CX5F 1S72V 3CSXA 4XCLA 4I4TA 2IORA 1O9GA 3ZM7A 2H3OA 3CCVV 2VW5A 2BSKA 1QNMA 3GVMA 3RYFB 3BA8A 4XKOA 4CWFA 1NS1A 2QKAA 3CPWU 3OMAB 3B24A 3H1HH 5B1NA 1AP5A 4DV5B 3X2QC 4FLUA 3VQYA 3HKDA 2BYHA 2OYQA 1TVKB 3A0TA 4O04A 3OGIB 1KKDA 1SQGA 4P9OA 4X62B 4QE9A 4CC5A 1OCCC 2Y69B 2VQEO 2YE4A 4HYPA 4UCTA 1GAXA 3ETGA 2CH4A 2FTKA 1SQQH 3S3XA 1M1KW 2WI5A 1BZKA 1NQTA 1WP7A 2OCCB 4X9QA 1M93A 4G27B 2XDKA 2P5OA 4DV3B 3J7AU 2EZOA 3CGYA 3ABUA 4Z2WA 4U3JA 2O1WA 3INXA 4I55A 4LBEC 1X4TA 2QDOA 1UYIA 1FPOA 4DV4B 4ABMA 4AQYO 3DXRA 4W4KA 2BU5A 4L8ZA 1E1RG 4KFGA 3K58A 4X66O 4IL6Z 1U2OA 4L94A 3W7TA 2QGNA 2C1IA 3WB2A 4AWOA 2E5LO 1K9MW 1ROPA 2HR3A 1KECA 3AK1A 3LSSA 3GB7C 4WBNB 2UUCO 1OCOB 1TGOA 2W6JG 5EC2C 4AHCA 1V55B 1QU7A 2OIGA 4I7ZB 5JJEB 2WA4A 5EIBD 3H80A 4KSGA 2YEHA 3K08A 3MHSC 4NH8A 3LSUA 1DF5A 2ZNJA 4ZHQB 1AI5A 5IE9A 1S76D 4PELA 2XJJA 1IBLB 3BPZA 3BABA 3EHBB 1PNLA 4R7CA 1SETA 3NMQA 2IU0A 1Y76A 3OD4A 2H94A 1VQKV 3C11A 1GN3A 1YC4A 3FB6C 4DR5B 4LFCB 3ZMZA 1M9NA 4P8OA 1XNQO 2RMKB 5B3SB 3G6EV 2JJCA 3EHFA 3T2MA 3B28A 3Q4HA 1ORQC 1V54C 3LDCA 2PI5A 1NI8A 1QVFU 4DK1A 5FPRA 2H8MA 2QG0A 2AKPA 1JJOA 4GEEA 1QLNA 1U0ZA 3HYYA 2YI9A 3QG5A 2B5UA 3U10A 4JI4B 5LL6Y 5BZBA 3ABMC 1S14A 4EFUA 2DYSB 3H4LA 1BS3A 5EYPB 3ZMTA 3ZHTA 2E74B 1L0OA 3RN4A 3OR6C 2EIKB 1ZUQA 1R3JC 3OWBA 2WI4A 4B3RO 5LXTB 1SQVH 1UY8A 4X89A 3SYQA 4O4HA 1YIJV 3Q5JA 2QJ1A 5H9CA 4K0KB 4BIUA 3T1HB 1SA0B 4RO2A 1N4CA 4LF6O 1G8MA 4XD8A 2YDEA 3CCJV 4K35A 1UY7A 4DR1O 3LSQA 5K1PA 3CRRA 1YETA 4N23A 1HP8A 3JASB 5L3DA 3CCLV 1SC5B 3OMIB 1UYMA 4TWKA 4LCUC 2K5BA 4DO2A 2VQEB 4H37A 5HFLA 1OCRC 3HPLC 5LBQA 2CCUA 2XHXA 1F4NA 5CMUA 2AGAA 2QF6A 1K5SA 1JA8A 4O2BB 3OPDA 3SJBC 1EZVH 4EB6B 3UKMA 1FFXA 1GO3F 1Y6XA 5E79Z 4EFEA 3JZ3A 3SL2A 2DJVA 2YJWA 4CWSA 3ETQA 2AZ0A 1AMWA 5AG2A 3L72H 4DR7O 4YKQA 3FT5A 5LA6B 3SJQC 2XHRA 2GTSA 1KBHA 1PKXA 4JZGA 2YICA 1Q3EA 3H1IH 4BW9A 1N34B 3RW0A 2YI8A 4AQYB 3ABKC 4X66B 2LW7A 3RLQA 4XKKA 4DR3B 3TZ2A 2DWDC 2WWWA 2E76B 4P2ZA 4TQFA 3WB0A 3CS5A 5D5PA 2RJZA 3BVOA 2PY5A 3PEJA 4EGHA 2UUCB 1QVGU 2CH7A 3ML0A 2HVJC 2P67A 3G7EA 1AJQA 2EULA 3E8GA 4K3AA 1UY6A 4XDKA 1GTOA 3KE6A 2ITCC 4YKXA 5ITZA 3QNEA 5JH7B 2CGOA 5EBLC 4ASGA 2CG9A 3W7WA 5GGZA 3W7SA 4H0LB 5M4HA 2IM9A 2IJJA 2F1MA 1KD1W 1JOYA 1TBWA 2WI2A 4RWUA 2YEVA 4ZOLA 2LO1A 3F7YC 1I5BA 4LFAB 3KCXA 1P7GA 4KHPB 3IAYA 1R1BA 4KL1A 5CTUA 1U97A 1IBKB 3CRAA 3TCUA 4XITA 4PDMA 2AXTZ 3G7BA 3CC7V 3LNNA 5GONB 3LDEA 2IOQA 4E00A 3GIGA 4JI1O 2X6CA 1J95A 4FIPC 1YHQV 2IJKA 3JAKB 1QCEA 1K8AW 1H8HG 4BAEA 4EFBA 4HZ3A 1XREA 2BCCH 3FFQA 1YT0A 2GSMB 3ASOB 2RCVA 3MNRP 4GCZA 4LH7A 1COWG 4B3TO 4B3RB 4URNA 5KAIZ 2ETNA 5IWAO 3R4PA 5EZYA 2YEBA 5D6QA 2B1IA 2WLJA 5FNCA 4X1YB 4UCVA 4BWAA 3ZIAG 2CTPA 1EM1A 1FXKB 2HG5C 1GM8A 4H33A 2V4DA 3DTUB 4LF6B 2BREA 4F4LA 1YT2A 4BQJA 1OSFA 4GKKO 5FNFA 4X1KA 1D2DA 4DR1B 2EINB 4I50A 5IY5C 3AEIA 3QO5A 2KG7A 1B06A 1Q6IA 3G71V 1XOUA 2UUAB 3GIEA 3SYCA 1P7BA 3RKZA 2EJRA 4KQVA 1RPOA 1URFA 3G67A 3VHAA 4CE1A 2YEDA 1H2LA 5EK0A 4LNUA 5IYBO 4JYYA 2UUBO 4CBCA 5K1XA 1D5NA 3M8AA 3D0BA 4JI7O 3FAVB 1XUQA 4QPJA 1I5DA 5JWPA 1WPBA 2Q0AA 1UYGA 3A0YA 4FLZA 1UYHA 4FZ0A 2PTMA 4GKJO 3PEHA 1YS3A 1CXZB 5DM6V 4DR7B 3ZXOA 2EILB 3JAMN 1K97A 2YE3A 2JKIA 2YIBA 4FCRA 3APOA 2QM4A 3JYCA 4GGLA 1VMGA 2JGDB 3QF7A 2EJ7A 3FB7C 1YERA 4NR1A 2JRIA 1YESA 2BU8A 1RSOA 1VQLV 4B7EA 1V9PA 1UYDA 3FB8C 2CCSA 1I5YA 3WG7C 2GQPA 3EKOA 3OUFA 1MG1A 4LR3A 3E8FA 1MZEA 1CPYA 1IBMB 3D8CA 4EM7A 2Z5UA 1BKNA 2XDSA 1QQCA 4L91A 2PI4A 2EIMC 3ABLC 2WERA 5FNVB 4YXWG 5CB4A 4NH9A 2Q73A 4XDJA 5KHKA 4NTWA 1HNXO 3L71H 4UXNA 4DV7B 1UYCA 4YY3O 4JI0O 4TUYA 2PNRA 4FPPA 4MP2A 5BOCA 2WLKA 4I5SA 4F6RA 3HKCA 5IYDO 1S0VA 5JCOA 4UCRA 4LF7B 4I9WA 2WEQA 4MW3A 4XIQA 4FLXA 1Y4SA 1WAZA 3HZ1A 2R70A 4JI1B 2WA3A 1NTKH 3EHJA 2HJFC 4UCSA 1BCCH 4JV5B 2Q2EB 2QKSA 2P7TC 3AG2C 4X65O 4DV5O 3K06A 4HYMA 5M4PA 2X0LA 1Q6HA 4MVSA 1NHHA 1DGSA 2PYLA 3QTFA 4CZZA 2JEUA 4BXIA 2GDSA 4X62O 1OCZB 4L8JA 1IZ3A 2VQFO 3CCUV 1EN5A 3TGUH 4B08A 1TILA 2ARHA 1KMIZ 4FFBB 4U3FH 5IWAB 3F5TA 4TOIA 4GX5A 3K98A 3A8TA 4FVMA 4HZ5A 1Q6UA 4ASFA 4O0BA 4V25A 3RYFA 4R6ZA 3OR7C 5J71A 4EMVA 4J9ZB 3K9SA 1Y67A 2R9AA 4R1FA 4YIOA 3O65A 1TUEB 4ZKIA 1ZXNA 4H81A 3RFRA 4DV3O 3B40A 3O6OA 1TVKA 4JYBA 4WFGA 4E01A 4PDVA 2X7RB 4BIOA 2QWOB 3PN1A 4EKWA 4WFFA 4BR6A 1KB9F 2F95B 4DV4O 3BFRA 1ZL8B 4FLWA 1XMQB 2DQ3A 5EIBC 4Z1VA 2C1GA 2VWKA 4PI2A 4WCEV 3R92A 4BIZA 3AG4B 5LMNO 1YC1A 1TA8A 3U2DA 1SZXA 4JI7B 1S77D 3ZN1A 4LPBA 2YEJA 3D2RA 3ETDA 3O9OA 4DV6O 4PI0A 2DOSA 4HZ0A 3SYOA 1N32O 4MVZA 4GKJB 2XX2A 2XAFA 2QSAA 1FS0G 2AZ2A 1MNGA 1RM1C 3S5TA 2BU6A 4GUNA 4IIJB 3JSLA 1B3QA 4YKZA 1U96A 1R3KC 1O9HA 1AI4A 3H1KH 4W4LA 2YE2A 4DR5O 1PL0A 2XT9A 2JDIG 4DUHA 3HHUA 3TZ5A 3TK1A 2K9PA 4P9PA 1W0JG 2XASA 2R9IA 1YZBA 2JS3A 3GWKC 1AR5A 4FK5C 2HHIA 3B25A 4I3HA 5IYZB 5KHIA 3T1KA 4WBNA 4WFBV 2CTQA 1KU9A 3IJ4A 4PL9A 2WLLB 1IDSA 1HNZB 2DQ0A 4ZHQA 1SF9A 3D3IA 2CAZC 3H9VA 3W7XA 5DN6G 4YKWA 4O07A 1HNXB 5JJNB 2FB5A 4MOTA 3TETA 4YY3B 4JI0B 1WPXA 5IDJA 5KLVH 4LF9B 1UPGA 2M6YA 4J42A 3ZKBA 4GYCB 4JTDB 2Y4TA 5GTIZ 4U7NA 4CS2A 2IWSA 4P7AA 3K99A 4R3MA 1WN7A 5B1BC 4K0KO 1K3EA 3JD0A 3T1HO 3ZS8C 5L3JA 1Z5AA 3OAAG 5BR8O 4X65B 1Y8NA 2UWDA 2BTZA 2ZE5A 2ZR2A 4WFHA 1GN2A 5JCOC 4FZ1A 2E0AA 3CJHB 4KSHA 3T2SA 1HWYA 2ADQB 1XL4A 1R6TA 2FKXA 2DE0X 3IGAC 4EGIA 5EYPA 1TAEA 2Q7EA 4PU9A 2FXSA 2VQFB 1ZXMA 2CCTA 5LGTA 1Q5OA 3SPGA 5JQGB 5LXTA 2ZE6A 4MTFA 5LHGA 4O4LB 5JJJB 2OCHA 3EHHA 1NZ6A 4JYCA 1FFTB 5CPHA 2ITDC 2YEIA 1K4CC 1QBZA 1E1QG 1SA0A 4U7OA 3W7UA 2WLHA 4GX0A 1ENVA 4TSFG 1GN4A 5KA5A 3WQ9A 1GKZA 3SJAC 3LNMB 4YHHB 5DEDA 3JASA 3WB1A 1N34O 4MTGA 1L0NH 2WLNA 4QE7A 4NXNO 1K92A 2YK2A 5DECA 1VF5B 1EN6A 3ZRSA 1I0HA 1B62A 5LMNB 2YKEA 4G2KA 4DR3O 5D5QA 2ZM6O 2A06H 4O2BA 3UM7A 1QY8A 4EB6A 4DV6B 2XJGA 1N0NA 3K5MA 1N32B 3TJTA 2Y69C 2BU2A 1AJPA 2LP7A 1F4MA 1M5IA 2DMXA 2WLIB 1YJWV 1K5QA 1TUBB 3CC2V 3HEKA 4KXRA 5LA6A 5CTYA 2CDYA 2Y48A 4JI5B 4DR6B 4XKAA 1P4RA 4MSWC 2OCCC 1MSWD 3K97A 2E75B 4JAAA 3JARB 3QO8A 3H1LH 4EFTA 2W0FC 2ZXWB 5HFMA 4LFAO 4OGQB 4KHPO 3C0EA 4URMA 3OMNB 1IBKO 1AR1B 1H2MA 1GKXA 3UQ8A 5M4NA 4CWTA 2Q5ZA 2YIAA 1N0JA 1VP7A 2XDLA 4MVOA 2WI1A 2YKBA 3APQA 2E3CA 3RYIB 2ZQMA 5EBMC 1VARA 2F23A 5CBFA 3T4ZA 1SQPH 1AJ6A 5JH7A 2A7WA 2EIJB 2YXHA 4B3MO 1UY9A 4MVQA 2IH3C 2UXDB 4ASAA 5BMVB 1AH8A 2YI6A 3QDDA 1YT1A 3ZMSA 2ZR3A 1BGQA 1OCOC 5LYJB 2HHHB 1MABG 2XNDG 4FM0A 4ZI7B 1H7SA 1L0LH 1XHXA 4DUZB 3AG3B 1Z2GA 4O4IB 5BY1A 2Y4UA 5GONA 5B1OA 1IX9A 2XHBA 4MVMA 2YEEA 2PGGA 4KTNA 4WF9V 4DV0B 3A0ZA 2BOCC 4BW5A 5BR8B 3JAKA 2DW4A 4FJCC 3RGBA 2XX5A 4GX1A 5B3SC 2Q9LA 3N27A 4JAVA 3EVKA 4TV8B 1AB3A 3GIFA 4AI8A 1D5AA 4J9YB 2N74A 2UUAO 1KYOF 4XTJA 3STLC 5A2QN 3CEIA 5E1AC 1MSDA 1Y66A 3JATB 5L3BA 4LP0A 4MS2A 4AS9A 2IW5A 4XIRA 4A5UB 4CS4A 1SQBH 1MX0A 4OX9B 2Z3YA 2DYSC 4XDLA 1FXKA 2JS5A 4PHZA 3SYPA 1GM7A 1QHTA 2H8PC 2EIKC 3BA9A 2WI6A 2YXLA 2XHTA 1AH6A 1UYFA 1M4UA 1SZTA 3INWA 3OW6A 1YEWA 5FPOA 4JI3B 2F43G 1PL4A 2YSUB 4O2AB 4NXNB 4J7JA 4DR2B 5J2TB 3CRKA 3KG2A 1AI7A 3BRCA 4G28B 3CMAV 1YF2A 2Q8FA 2ZM6B 2JIZG 1IVSA 3FAVA 4NXMO 4CWPA 4R8CA 1XMOB 2FL4A 1Y8OA 1H38A 3TXQA 1IBMO 4DRXB 2F66C 4UB6Z 1VIBA 5LHHA 1R3IC 1BHBA 1EBOA 2N05A 4PA3A 2JGDA 4FMTA 4LC1A 2UXXA 3CMEV 4P30A 1I08A 5M4MA 1K33A 5LP6B 1NTMH 3N2KB 3TUHA 4DV7O 1H8EG 3CGZA 3CWBH 2VS0A 1DTOA 3R4NA 1AILA 2XDXA 2YGFA 1MOFA 2HCHA 4LF7O 1I59A 2XJXA 3ABTA 4LF4O 4WFAV 3MD0A 5EBWC 2PZSA 3RLPA 1R3LC 3JD4A 4X1IA 5F5RA 3OTOO 4JV5O 4KP4A 3FV5A 5FNVA 1EI1A 4B3MB 3FKSG 4DK0A 1GMGA 2BE3A 4DW0A 3IEDA 3JD2A 4XCJA 4NVPA 2QTOA 2W6IG 5IY5B 5M4EA 2VWCA 3AG1B 3C3TA 3SYAA 3B09A 3DSQA 2GFDA 4PDLA 3HKBB 2GHYA 3J81N 3A2FA 5J6AA 1R73A 3DC5A 3LDDA 4LFBO 2CTWA 2QA4V 1S16A 2YE9A 1SQXH 3SDLA 2WSSG 2XD6A 3JALB 1S5LZ 4RAIA 3OM3B 2P22C 4J7KA 4GFNA 2DYRC 1L1FA 1YI2V 2ZDIA 5LOVB 1GM9A 2ZDXA 3PJSK 4L90A 1I5CA 1XDCA 3H01A 1B63A 1FXHA 2WPDG 3G75A 3QO7A 3TZ4A 4FFBA 1TC0A 1E79G 4IYIA 1XMQO 4D6TH 3THOA 1HW7A 4PA6A 2Q69A 2QR4A 3B26A 2HLDG 1YTFB 3CB2A 3N2GB 3VHDA 4CWQA 1AR4A 1H7UA 2OTJV 3JD1A 2GUZB 3ASOC 3LNUA 5CA0B 1RFYA 1JR9A 4UV8A 1US6A 5D7DA 4C7UA 3BM9A 2GV9A 2YI7A 5CA3A 2Q8IA 4JTAB 4RQEA 4E2LA 2XAJA 3G4SV 5B5EZ 2QEXV 1ZX3A 4EEQA 1THNA 3T10A 3C90A 2P4VA 1FD9A 3R66A 1FXKC 1M57B 4FFKA 2BTOA 2MK3A 4JF3A 1ZL8A 2VCIA 2YEGA 1WLEA 4WUBA 5L3GA 3U0ZA 4LWHA 1TC6A 2KQXA 4OPHA 1ZW9A 1QR9A 1QYEA 2QE7G 3I55V 4ASUG 3FX7A 1F7YA 4NXMB 3ETEA 4LH6A 3ZJZA 1K73W 1NH2D 5F3KA 1VQ9V 1BGYH 2LJ2A 2ZE8A 2B1GA 3BAAA 3ZHVA 2C2AA 1HNZO 3ZHSA 4UUJC 2M7WA 1M56B 2NN4A 4NH7A 4IIJA 2YXYA 3STZC 4ZVIA 1MZFA 1THZA 4MVUA 1OJHA 4AWQA 1LUWA 4IT5A 2KB1A 1YC3A 1ZWIC 3JD3A 2EILC 3ICXA 1WB8A 4LF9O 1AVMA 4MTXA 1KKCA 4GLXA 2BZ5A 1WA8B 3CC4V 4K8ZA 4LF4B 2X6AA 4TQDA 5IYZA 3EKRA 4MB9A 1FJGO 3VQVA 3OTOB 3F5WC 2WLLA 1R6KA 3K5OA 3I56V 3FYIB 4B7PA 1G4YB 4J7ZA 4X20B 3A0HZ 1Y74B 3SPCA 3RYHB 5B1AB 2JGUA 3VBBA 5LMUO 3A0RA 1YJ9V 2VRZA 4FCQA 1H2NA 4HNAB 2Q68A 3E22B 5LGUA 3K9AA 1DK1A 3K04A 2UXCB 2XABA 2KKWA 5C8YB 2YE8A 1YITV 2OIEA 4LFBB 2FWYA 5LHIA 1KZNA 3U2KA 1JQ0A 3A0XA 3U11A 4PDRA 2YI0A 2GTAA 3CJHA 1QLEB 4YJ3B 2ODMA 3AK3A 4CWRA 4QNHB 4JZ2A 3UT5B 1N33B 4B7KA 5IJ9B 4YHHO 1RM1B 3I5DA 4YKUA 2P4KA 5GTHZ 5IJ0B 4QGPA 4PA9A 3ZRWB 4UCUA 4R50A 5JQGA 5CF0A 3JCZA 1AP6A 3A0WA 1BSMA 3ZMUA 5J9PC 5CA1B 5FWKA 3ZBHA 3WU2Z 3OEHG 4OXSA 3F7VC 3RT3C 4XE2A 2ZDIC 4EGKA 1EA6A 1R6NA 3Q5KA 3T1YB 1OCZC 1JFFB 2CK3G 4R3AA 1BL8A 2BOBC 4I9QA 3HR0A 3K60A 4JASA 3E83A 1VQ6V 3K3WA 3ZHUA 1PD3A 3K0DA 4DV2O 4JI5O 2HVKC 5L3EA 4DR6O 3R65A 4X9LA 3M7MX 2YUAA 2YK9A 3BEHA 4MTOA 2XUMA 3IFXA 4QJFB 1Q82W 5B66Z 4JI2O 2BTQB 1A4HA 1I58A 3E86A 1ID0A 4DW1A 2RDCA 2D3OW 4LWIA 1XEQA 2P6JA 4QIWF 2WAMA 4JI8B 2WLIA 2R72A 2QWNB 1TUBA 1IXMA 3AG4C 4ZBMA 1ZSPA 1HR0B 2IH1C 3X2QB 3K57A 2UXDO 3ASNC 2XAHA 3TZ0A 3EHGA 4YKYA 5CN0A 3T0HA 3JARA 3WHAA 1PNKA 2HHHO 3E89A 5KX5B 1OCCB 1PNMA 4DUZO 4PA4A 1BQZA 3IC7A 1YTFD 1TH8A 1IXBA 5CBGA 1HDJA 4CWNA 1FJGB 3RYIA 1J5EB 4JYAO 4DV0O 1GK9A 4H7QA 3JAWB 1PM9A 1PVGA 1SS3A 4E4EA 1VQMV 2ADPA 5BMVA 2YGAA 3RYCB 1Y4MA 2YEAA 4V26A 1TIDA 5LYJA 3SGIA 5KA6A 5LMUB 1US7A 4I0XB 4ZI7A 1Q8IA 1Q90D 1AJNA 5J2UB 3MHHC 5KMGB 2CGNA 5IDMA 3MAQA 1XBLA 4O4IA 3HKEB 3K5NA 4OX9O 2ZIOA 1SQFA 1SESA 2WI3A 3RWRD 3T0ZA 3FYEB 1UYKA 2ZE7A 3SR2C 2XX4A 5A9GA 3OE7G 4LF8O 1ZWHA 4O4JB 4CC6A 4FM1A 4TV9B 1OHHG 2QWPB 1EN4A 1NVPD 1JPXA 1BMFG 4IGGA 2RNBA 1JMKC 3OMUA 2A3QA 2IJHA 4TV8A 1YJNV 3HYZA 1JVMA 3ZN0A 1JX9A 3ZX6A 2LFRA 4YIPA 4JI3O 1P49A 3SJCC 4UV9A 4F6EA 4DR2O 1B04A 3B8NA 2YJXA 3JATA 4ASBA 2O57A 1UJWB 1DF4A 3P3PA 5IYCO 1I7FA 2YE5A 2YKIA 2ZKOA 3OW2U 5KHJA 1V54B 3BHPA 1XMOO 2OWOA 4OPAA 4ICGA 4CE2A 1FYJA 5JVDB 1BHAA 2CUGA 4FLYA 4X64B 3TTZA 2A0LA 1HNWB 4AWPA 3U67A 2FYUH 4EEHA 3CRQA 1YXBA 1XNRO 1AM1A 4O2AA 4DV2B 1VQPV 3ABMB 3CCQV 4YJ2B 4PD4F 5J2TA 4Z1MG 3K59A 4XC0A 2YKCA 1PP9H 4LWSB 3ZKDA 4H44B 4CS3A 4JI2B 4K4OA 3SPJA 3K79A 4O05A 3D3QA 2YC0A 4B3SB 1W59A 4MPCA 3CCEV 4DRXA 2RN9A 3VADA 2XTAA 3G6BA 4MP7A 3VQXA 2WEPA 2YS8A 5L3CA 2IOPA 3L9DA 4IHJB 4LP8A 3ZHRA 1FKAO 4I4TB 3MDSA 3R91A 1YSZA 5LP6A 3N2KA 1M90W 2BSKB 1I94B 5FL7G 1V55C 4LF5O 2UXBB 4YKTA 4HXWA 5LGNA 2HEPA 2JVDA 4UCOA 3B4SA 3CP1A 1RPRA 4GT8A 1OCRB 3P3NA 1GJVA 2F4VO 1NT2B 3HKDB 4ZIBA 4E02A 4PRXA 2YIBD 3CCMV 1NH2B 4RQFA 4CWOA 1H2GA 4GT1A 4JYAB 3S3WA 1WNSA 2WI7A 3ZXQA 2ZCEA 4UB8Z 2BSMA 2ZXWC 3UCSC 5FNDA 2Q8HA 4XDMA 3P30A 2ZINA 3G80A 2H55A 5D6PA 3ZCCA 1LNQA 4IYHA 3L73H 1F51A 3ABKB 4JTCB 4HYOA 3T4DA 4HY6A 1VF6A 1W0KG 2PUSA 1VQ4V 4BAYA 2O1UA 5C93A 3HKBA 2Y0PA 1I5XA 2EIJC 3GWOA 1H2KA 2ZKJA 3RVZA 5KHHA 4X1YA 2LW1A 4U3JB 2XAGA 3T1CA 2CGFA 4I55B 4LF8B 1L8DA 3JALA 1KP2A 2OTLV 4NB5A 3A0BZ 2L6LA 2HJDA 4MW8A 1MMMA 1PV0A 3AG3C 3DXRB 1IURA 1UYLA 3IC9A 2A79B 2QWQB 1BYQA 1YSRA 3OGCC 5LOVA 4X8AA 1K7DA 4J11A 2Z0AA 1GH6A 1Q7YW 2DWEC 3ZMVA 1KQSU 1SERA 2BT0A 1I5AA 2FWZA 2IJIA 2QM7A 1S5JA 3HZ5A 2QFOA 2R9RB 3N2GA 4LWFA 1G6UA 2LFSA 4CH5A 3LUTB 2GUZA 4UVCA 1ZTEA 2Q0OC 5CA0A 2YI5A 1Y76B 3AK2A 3CRMA 4MBCA 4PRVA 1NR1A 1XNRB 4DV1O 3OT7A 2K1EA 3CXCU 4B6CA 3K0GA 2CTRA 3Q4HB 2E5LB 4KUMA 1NU1H 1T5EA 4DXWA 3FD9A 5JENA 1KP3A 1EFRG 1W2BU 5TISZ 1AI6A 1R62A 1Z5BA 1WB7A 3RBZA 1Z5VA 5KUKA 1FAFA 5KUMA 1OZ0A 3AG7A 3L74H 1Y4UA 3EXAA 3VHCA 2DN9A 3DGEA 2AHZA 4DUYO 2XCMA 3D36A 1QR8A 1XNQB 4JAUA 4HAMA 3WFVA 1EZJA 2YEFA 2ILMA 2O1VA 3OTFA 2ZNIA 2DYRB 1PPJH 2QM8A 2HG1A 4LF5B 4O4HB 3M99B 4DZYA 3RLRA 1VEWA 1JM6A 1BXDA 1NJIW 1NTZH 2F4VB 1BE3H 1WA8A 2G38A 1N36O 2CE4A 2UXCO 4WUDA 1JJ2U 2Q7HA 2VWJA 2Q8GA 3VQWA 2L35A 5LP6C 2YE6A 1KUQA 4U93A 5EC1C 5F2VO 3CD6V 3R4MA 2XDUA 1WP8A 2ATKC 4GQTA 3B2EE 1LR1A 2PF4E 2JK5C 4MPNA 5BODA 2JJ1G 2JEXA 3CYOA 2P90A 4FLVA 3JCUZ 2Q6AA 4X20A 2GBOA 1N33O 4Q20A 1Y74A 3P32A 4W7TA 3RYHA 5FLXN 3O2FA 2XOKG 3RVYA 1FFXB 4HNAA 3E22A 4FLTA 1P84F 1CP9A 5C8YA 5CTXA 1NHIA 3WG7B 2IWUA 3CHXA 3NR7A 3CCSV 1OV9A 1GRJA 3L75H 4D7TA 2FYPA 2LQTA 4NKGB 3AG1C 3T1YO 4H13B 1X59A 3KCYA 4HXZA 3OUSA 4NTYA 1VF6C 4FCPA 2A9HA 4Q6GA 4YJ3A 3ZRVA 2EIMB 3CXHF 3ABLB 3UT5A 5IJ9A 3BCCH 4DR4O 1YSCA 1Q43A 5IJ0A 4O09A 3KZIZ 3K03A 5H6RA 3CRCA 4RUEA 3ZRWA 2QG2A 4QPKA 3ZEDA 2CH7B 2QWRB 3TXSA 2NNUA 2ZIMA 3SPIA 3HB3B 4MT8A 4JI6O 4JPRA 2KSDA 5CA1A 2EINC 3NXSA 4FM2A 1KIJA 4TT3G 5ITZB 3CWVA 3OWDA 3ZHQA 3OEEG 3K5LA 2YE7A 4XBFA 1JFFA 4JI8O 2IU3A 3BY6A 1VQOV 5D7RA 1RP3B 3O0IA 1NVPB 3B77A 2YEVB 2Q67A 4ZOLB 4DV1B 1HR0O 3H1JH 1Z5WA 3AG2B 2BRCA 1ZLZA 3C3SA 2XAQA 2VCJA 4NYKA 2Q7GA 4WUCA 1BT8A 2YIDA 3GIGB 2WLMA 2JJ2G 1MU5A 2F93B 2BTQA 1XILA 4X1IB 4LWGA 4UVBA 1Q81W 2AHYA 4LWEA 5L3FA 3LMMA 5H5NA 4J41A 5H2FZ 1QZRA 1M57C 2EXLA 3UO3A 1XHZA 2D2CB 2UU9O 3CYGA 1J5EO 4CE3A 4DUYB 3JSNA 4KFMA 5IT9N 1Z59A 1GN6A 1K4DC 4CH3A 1VF7A 3R4OA 3CE2A 2AW9A 5EZYB 4UFZA 2YECA 4NTXA 2N04A 4GZRB 1H2SB 5KX5A 1NR7A 2LGWA 3QVNA 4YKRA 3D36C 3OFNG 3J80N 5CTWA 2B9ZA 1N36B 3VOUA 1M56C 4X1KB 1XI1A 3LPSA 1A32A 2V1DA 3B8MA 4I50B 1K34A
chains in the Genus database with same CATH topology
1F23A 1AROP 4RUFA 3CRLA 4L93A 4JGSA 1Q86W 1VQ8V 2YGEA 4GX2A 5M4KA 3E2EA 1NBMG 1Z5CA 4URLA 2NLJC 2XK2A 4JQLA 2V7QG 2UXNA 1CEZA 4HY1A 2BU7A 2HKJA 1GKFA 3SPHA 3FB5C 3E8HA 1S3JA 1SRYA 4XIPA 4BQGA 4MVRA 5B1AC 1XL6A 4X88A 1UYEA 2ZDYA 2OT5A 5H6QA 4WFEA 1JCHA 4UROA 2YKJA 3ASNB 2HFEC 3B27A 1B6QA 3E35A 5IN9A 1QLEC 2EZPA 2X6BA 1VQ5V 4PA7A 5D7CA 1N8RW 4UVAA 5B1BB 1KC8W 1NKDA 3EFFK 5GW7A 2ZBKB 3E8BA 4N21A 2HKOA 4H85A 1FXVA 2EBOA 3FT8A 1VQNV 3ZRXA 1VQ7V 3CCRV 3BMYA 4MPEA 1NHJA 2ZD9A 1DLBA 2ESAA 4L87A 5CBHA 2BYIA 2IWXA 1S5HC 1Y8PA 3Q5LA 1S72V 4XCLA 2IORA 3ZM7A 3CCVV 2VW5A 4XKOA 4CWFA 3CPWU 3OMAB 3B24A 5B1NA 3X2QC 2BYHA 3A0TA 4O04A 1KKDA 4P9OA 4QE9A 1OCCC 2Y69B 2YE4A 4HYPA 3ETGA 2CH4A 2FTKA 1M1KW 2WI5A 1NQTA 2OCCB 4G27B 2XDKA 2EZOA 3CGYA 3ABUA 2O1WA 3INXA 4LBEC 1UYIA 2BU5A 4L8ZA 1E1RG 4KFGA 1U2OA 4L94A 3W7TA 4AWOA 1K9MW 1ROPA 2HR3A 1KECA 3LSSA 3GB7C 1OCOB 2W6JG 5EC2C 1V55B 3H80A 4KSGA 2YEHA 3K08A 3MHSC 4NH8A 1DF5A 1AI5A 1S76D 4PELA 2XJJA 3EHBB 1PNLA 4R7CA 1SETA 3NMQA 2IU0A 2H94A 1VQKV 3C11A 1YC4A 3FB6C 3ZMZA 1M9NA 4P8OA 5B3SB 3G6EV 3EHFA 2JJCA 3T2MA 3B28A 1ORQC 1V54C 3LDCA 2PI5A 1QVFU 2H8MA 2QG0A 2AKPA 4GEEA 1QLNA 1U0ZA 3HYYA 2B5UA 4EFUA 5BZBA 3ABMC 1S14A 2DYSB 3H4LA 3ZMTA 1L0OA 3OR6C 2EIKB 1R3JC 3OWBA 2WI4A 1UY8A 4X89A 3SYQA 1YIJV 3Q5JA 5H9CA 4BIUA 4RO2A 1G8MA 4XD8A 3CCJV 1UY7A 3LSQA 1YETA 4N23A 5L3DA 3CCLV 3OMIB 1UYMA 4TWKA 4LCUC 2K5BA 4DO2A 4H37A 5HFLA 1OCRC 3HPLC 5LBQA 2CCUA 2XHXA 1F4NA 5CMUA 2QF6A 1K5SA 3OPDA 3UKMA 1GO3F 3JZ3A 3SL2A 2YJWA 4CWSA 1AMWA 4YKQA 3FT5A 3SJQC 2XHRA 1PKXA 3RW0A 3ABKC 3RLQA 4XKKA 3TZ2A 2DWDC 2WWWA 4P2ZA 3PEJA 4EGHA 1QVGU 3ML0A 2HVJC 2P67A 3G7EA 1AJQA 3E8GA 1UY6A 4XDKA 1GTOA 3KE6A 2ITCC 4YKXA 3QNEA 5EBLC 4ASGA 2CG9A 3W7WA 5GGZA 3W7SA 5M4HA 2IJJA 1KD1W 1JOYA 1TBWA 2WI2A 2YEVA 3F7YC 1I5BA 5CTUA 3TCUA 4XITA 4PDMA 3G7BA 3CC7V 3LDEA 2IOQA 4E00A 3GIGA 2X6CA 1J95A 4FIPC 1YHQV 2IJKA 1QCEA 1K8AW 1H8HG 4BAEA 4HZ3A 1YT0A 2GSMB 3ASOB 3MNRP 4GCZA 1COWG 4URNA 3R4PA 2YEBA 5D6QA 2B1IA 2WLJA 5FNCA 3ZIAG 1FXKB 2HG5C 1GM8A 4H33A 3DTUB 2BREA 4F4LA 1YT2A 4BQJA 1OSFA 5FNFA 2EINB 5IY5C 3AEIA 3QO5A 3G71V 3GIEA 3SYCA 1P7BA 3RKZA 2EJRA 4KQVA 1RPOA 3VHAA 4CE1A 2YEDA 5EK0A 5IYBO 4CBCA 3D0BA 4QPJA 1I5DA 1UYGA 3A0YA 1UYHA 3PEHA 1YS3A 5DM6V 3ZXOA 2EILB 1K97A 2YE3A 2JKIA 4FCRA 3JYCA 4GGLA 3FB7C 1YERA 1YESA 2BU8A 1VQLV 1UYDA 3FB8C 2CCSA 1I5YA 3WG7C 2GQPA 3EKOA 3OUFA 1MG1A 3E8FA 1CPYA 4EM7A 2Z5UA 1BKNA 2XDSA 4L91A 2PI4A 2EIMC 3ABLC 2WERA 4YXWG 4NH9A 4XDJA 4UXNA 1UYCA 2PNRA 4FPPA 4MP2A 5BOCA 2WLKA 4I5SA 5IYDO 1S0VA 4I9WA 2WEQA 4MW3A 4XIQA 1Y4SA 3HZ1A 3EHJA 2HJFC 2Q2EB 2QKSA 2P7TC 3AG2C 3K06A 4HYMA 5M4PA 2X0LA 1NHHA 4MVSA 3QTFA 4CZZA 2JEUA 4BXIA 1OCZB 3CCUV 1TILA 3K98A 4GX5A 4HZ5A 4ASFA 4O0BA 4V25A 4R6ZA 3OR7C 5J71A 4EMVA 4J9ZB 4R1FA 1TUEB 4ZKIA 1ZXNA 4H81A 3O6OA 4JYBA 4WFGA 4E01A 4PDVA 2X7RB 4EKWA 4WFFA 2DQ3A 3R92A 4WCEV 4BIZA 3AG4B 1YC1A 3U2DA 1S77D 3ZN1A 4LPBA 2YEJA 3D2RA 3ETDA 4HZ0A 3SYOA 4MVZA 2XX2A 2XAFA 1FS0G 1RM1C 2BU6A 1B3QA 4YKZA 1R3KC 1AI4A 2YE2A 1PL0A 2JDIG 4DUHA 3HHUA 3TZ5A 3TK1A 4P9PA 1W0JG 2XASA 2R9IA 4FK5C 3B25A 4I3HA 3T1KA 4WFBV 4PL9A 2WLLB 2DQ0A 3D3IA 3W7XA 5DN6G 4YKWA 4O07A 4MOTA 3TETA 1WPXA 5IDJA 3ZKBA 4JTDB 4U7NA 2IWSA 4P7AA 3K99A 4R3MA 5B1BC 1K3EA 3JD0A 5L3JA 1Z5AA 3OAAG 1Y8NA 2UWDA 2BTZA 2ZR2A 4WFHA 2E0AA 4KSHA 3T2SA 1HWYA 1XL4A 3IGAC 4EGIA 4PU9A 2FXSA 1ZXMA 2CCTA 5LGTA 3SPGA 4MTFA 5LHGA 3EHHA 4JYCA 1FFTB 5CPHA 2ITDC 2YEIA 1K4CC 1QBZA 1E1QG 4U7OA 3W7UA 2WLHA 4GX0A 1ENVA 4TSFG 5KA5A 3WQ9A 1GKZA 3LNMB 4MTGA 2WLNA 4QE7A 1K92A 2YK2A 3ZRSA 1B62A 2YKEA 4G2KA 3UM7A 1QY8A 2XJGA 2Y69C 2BU2A 1AJPA 2LP7A 1F4MA 2WLIB 1YJWV 1K5QA 3CC2V 3HEKA 5CTYA 2Y48A 4XKAA 1P4RA 2OCCC 4MSWC 1MSWD 3K97A 3QO8A 4EFTA 2W0FC 2ZXWB 5HFMA 3C0EA 4URMA 3OMNB 1AR1B 1GKXA 5M4NA 4CWTA 2XDLA 4MVOA 2WI1A 2YKBA 2ZQMA 5EBMC 5CBFA 3T4ZA 1AJ6A 2EIJB 1UY9A 4MVQA 2IH3C 4ASAA 1AH8A 2YI6A 3QDDA 1YT1A 3ZMSA 2ZR3A 1BGQA 1OCOC 1MABG 2XNDG 1H7SA 3AG3B 5B1OA 4MVMA 2YEEA 4KTNA 4WF9V 3A0ZA 2BOCC 4BW5A 2DW4A 4FJCC 2XX5A 4GX1A 5B3SC 4JAVA 3GIFA 4J9YB 4XTJA 3STLC 5E1AC 1Y66A 4LP0A 5L3BA 4MS2A 4AS9A 2IW5A 4XIRA 1MX0A 2Z3YA 2DYSC 4XDLA 1FXKA 3SYPA 1GM7A 2H8PC 2EIKC 2WI6A 2XHTA 1AH6A 1UYFA 1SZTA 3INWA 3OW6A 2F43G 2YSUB 3CRKA 3KG2A 1AI7A 4G28B 3CMAV 2Q8FA 2JIZG 4CWPA 4R8CA 1Y8OA 1H38A 5LHHA 1R3IC 1BHBA 1EBOA 4PA3A 4FMTA 4LC1A 2UXXA 3CMEV 4P30A 5M4MA 1K33A 3TUHA 1H8EG 3CGZA 1DTOA 3R4NA 2XDXA 2YGFA 1MOFA 2HCHA 1I59A 2XJXA 3ABTA 4WFAV 3MD0A 5EBWC 3RLPA 1R3LC 3JD4A 5F5RA 3FV5A 4KP4A 1EI1A 3FKSG 1GMGA 3IEDA 3JD2A 4XCJA 2QTOA 2W6IG 5IY5B 5M4EA 2VWCA 3AG1B 3SYAA 2GFDA 4PDLA 2GHYA 5J6AA 1R73A 3LDDA 2QA4V 1S16A 2YE9A 2WSSG 2XD6A 4RAIA 3OM3B 4GFNA 2DYRC 1L1FA 1YI2V 2ZDIA 1GM9A 2ZDXA 3PJSK 4L90A 1I5CA 3H01A 1B63A 1FXHA 2WPDG 3G75A 3QO7A 3TZ4A 1TC0A 1E79G 2Q69A 4PA6A 3B26A 2HLDG 1YTFB 3VHDA 4CWQA 1H7UA 2OTJV 3JD1A 3ASOC 3LNUA 4UV8A 5D7DA 3BM9A 2YI7A 5CA3A 2Q8IA 4JTAB 4RQEA 4E2LA 2XAJA 3G4SV 2QEXV 1THNA 3T10A 1FXKC 1M57B 2MK3A 4JF3A 2VCIA 2YEGA 1WLEA 4WUBA 5L3GA 4LWHA 1TC6A 1ZW9A 1QR9A 1QYEA 2QE7G 3I55V 4ASUG 3ETEA 5F3KA 3ZJZA 1K73W 1NH2D 1VQ9V 2B1GA 2C2AA 4UUJC 2M7WA 1M56B 4NH7A 4ZVIA 3STZC 1THZA 4MVUA 4AWQA 2KB1A 1YC3A 1ZWIC 3JD3A 2EILC 4MTXA 2BZ5A 3CC4V 2X6AA 3EKRA 4MB9A 3F5WC 2WLLA 1R6KA 3I56V 3FYIB 4B7PA 1G4YB 3SPCA 5B1AB 1YJ9V 3VBBA 3A0RA 4FCQA 2Q68A 5LGUA 3K9AA 3K04A 2XABA 2YE8A 1YITV 2FWYA 5LHIA 1KZNA 3U2KA 1JQ0A 3A0XA 4PDRA 2YI0A 4CWRA 1QLEB 4QNHB 1RM1B 4YKUA 4PA9A 3ZRWB 4R50A 5CF0A 3JCZA 3A0WA 3ZMUA 5J9PC 5FWKA 3OEHG 4OXSA 3F7VC 4XE2A 2ZDIC 4EGKA 1EA6A 1R6NA 3Q5KA 1OCZC 2CK3G 4R3AA 1BL8A 2BOBC 3K60A 4JASA 3E83A 1VQ6V 3K3WA 1PD3A 3K0DA 2HVKC 5L3EA 3R65A 4X9LA 2YK9A 3BEHA 4MTOA 3IFXA 4QJFB 1Q82W 1A4HA 1I58A 3E86A 1ID0A 2D3OW 4LWIA 2P6JA 4QIWF 2WAMA 2WLIA 1IXMA 3AG4C 4ZBMA 2IH1C 3X2QB 3ASNC 2XAHA 3TZ0A 3EHGA 4YKYA 5CN0A 3T0HA 3WHAA 1PNKA 3E89A 1OCCB 1PNMA 4PA4A 3IC7A 1YTFD 1TH8A 5CBGA 4CWNA 1GK9A 4H7QA 1PVGA 1VQMV 2YGAA 1Y4MA 2YEAA 4V26A 1TIDA 5KA6A 1US7A 1AJNA 3MHHC 5IDMA 1SESA 2WI3A 3T0ZA 3FYEB 1UYKA 2XX4A 3OE7G 1ZWHA 1OHHG 1NVPD 1JPXA 1BMFG 3OMUA 2IJHA 1YJNV 3HYZA 1JVMA 3ZN0A 1JX9A 2LFRA 4UV9A 3B8NA 2YJXA 4ASBA 1UJWB 1DF4A 5IYCO 2YKIA 2YE5A 3OW2U 1V54B 4CE2A 1BHAA 3TTZA 2A0LA 4AWPA 3U67A 4EEHA 1AM1A 1VQPV 3ABMB 3CCQV 4Z1MG 4XC0A 2YKCA 3ZKDA 4K4OA 3SPJA 3K79A 4O05A 4MPCA 3CCEV 3VADA 4MP7A 2WEPA 5L3CA 2IOPA 4LP8A 3R91A 1YSZA 1M90W 5FL7G 1V55C 4YKTA 4HXWA 5LGNA 3CP1A 1RPRA 4GT8A 1OCRB 1GJVA 4E02A 4PRXA 3CCMV 1NH2B 4RQFA 4CWOA 1H2GA 4GT1A 2WI7A 3ZXQA 2BSMA 2ZXWC 5FNDA 2Q8HA 4XDMA 3P30A 2H55A 5D6PA 3ZCCA 1LNQA 1F51A 3ABKB 4JTCB 4HYOA 3T4DA 4HY6A 1W0KG 1VQ4V 4BAYA 2O1UA 5C93A 1I5XA 2EIJC 3GWOA 2ZKJA 3RVZA 2XAGA 3T1CA 2CGFA 1KP2A 2OTLV 4MW8A 3AG3C 1UYLA 2A79B 1BYQA 1YSRA 3OGCC 4X8AA 1K7DA 1Q7YW 2DWEC 3ZMVA 1KQSU 1SERA 2BT0A 1I5AA 2FWZA 2IJIA 2QM7A 3HZ5A 2QFOA 2R9RB 4LWFA 2LFSA 3LUTB 4UVCA 2YI5A 4MBCA 4PRVA 1NR1A 3CXCU 2K1EA 4B6CA 3K0GA 4KUMA 4DXWA 1KP3A 1EFRG 1W2BU 1AI6A 1R62A 1Z5BA 3RBZA 5KUKA 5KUMA 1OZ0A 1Y4UA 3VHCA 3DGEA 2AHZA 2XCMA 3D36A 1QR8A 4JAUA 4HAMA 3WFVA 1EZJA 2YEFA 2O1VA 2DYRB 2QM8A 2HG1A 3M99B 4DZYA 3RLRA 1JM6A 1BXDA 1NJIW 4WUDA 1JJ2U 2Q8GA 2YE6A 4U93A 5EC1C 3CD6V 3R4MA 2XDUA 2ATKC 4GQTA 4MPNA 5BODA 2JK5C 2JJ1G 2JEXA 3CYOA 2P90A 2Q6AA 4Q20A 3P32A 4W7TA 3O2FA 2XOKG 3RVYA 1CP9A 5CTXA 1NHIA 3WG7B 2IWUA 3CCSV 2FYPA 3AG1C 4HXZA 3OUSA 4FCPA 2A9HA 3ZRVA 2EIMB 3ABLB 1YSCA 4O09A 3K03A 5H6RA 4RUEA 3ZRWA 2QG2A 4QPKA 2NNUA 3SPIA 3HB3B 4MT8A 4JPRA 2EINC 3NXSA 1KIJA 4TT3G 3CWVA 3OWDA 3OEEG 2YE7A 4XBFA 2IU3A 3BY6A 1VQOV 5D7RA 3O0IA 1NVPB 3B77A 2YEVB 2Q67A 3AG2B 2BRCA 2XAQA 2VCJA 4WUCA 3GIGB 2WLMA 2JJ2G 1MU5A 4LWGA 4UVBA 1Q81W 2AHYA 4LWEA 5L3FA 1QZRA 1M57C 2EXLA 4CE3A 4KFMA 1Z59A 1K4DC 3R4OA 2YECA 1NR7A 4YKRA 3OFNG 5CTWA 3VOUA 1M56C 3LPSA 2V1DA 3B8MA 1K34A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YEB A;  5D6Q A;  3CRL A;  4L93 A;  5IDM A;  5FNC A;  2YGE A;  4JAV A;  3GIF A;  2BRE A;  5M4K A;  1YT2 A;  4BQJ A;  2WI3 A;  1OSF A;  4XTJ A;  1Z5C A;  5FNF A;  3T0Z A;  1UYK A;  4URL A;  2XX4 A;  4LP0 A;  1ZWH A;  4AS9 A;  4XIR A;  2XK2 A;  4JQL A;  1MX0 A;  3OMU A;  4HY1 A;  3GIE A;  2BU7 A;  2HKJ A;  3RKZ A;  3HYZ A;  4KQV A;  3VHA A;  4CE1 A;  2YED A;  2LFR A;  4XIP A;  4BQG A;  2WI6 A;  2XHT A;  1AH6 A;  2YJX A;  1UYF A;  4ASB A;  3INW A;  3OW6 A;  3D0B A;  4QPJ A;  1I5D A;  1UYE A;  2ZDY A;  1UYG A;  2YKI A;  2YE5 A;  3A0Y A;  1UYH A;  3PEH A;  1YS3 A;  4CE2 A;  3CRK A;  4URO A;  3ZXO A;  2YE3 A;  2YKJ A;  2JKI A;  4FCR A;  3B27 A;  2Q8F A;  3TTZ A;  4GGL A;  4AWP A;  3U67 A;  1YER A;  4EEH A;  4CWP A;  1Y8O A;  1YES A;  2BU8 A;  5IN9 A;  1AM1 A;  1UYD A;  2CCS A;  5D7C A;  4XC0 A;  2GQP A;  2YKC A;  3EKO A;  3ZKD A;  4K4O A;  4EM7 A;  1BKN A;  4FMT A;  4LC1 A;  4O05 A;  2XDS A;  5M4M A;  4L91 A;  2ZBK B;  4MPC A;  3TUH A;  2WER A;  3VAD A;  3CGZ A;  4MP7 A;  2WEP A;  3R4N A;  4H85 A;  4NH9 A;  2IOP A;  3FT8 A;  2XDX A;  2YGF A;  2HCH A;  1I59 A;  2XJX A;  3MD0 A;  1UYC A;  3ZRX A;  3RLP A;  4MPE A;  3BMY A;  3R91 A;  1YSZ A;  2PNR A;  4FPP A;  4MP2 A;  1NHJ A;  5BOC A;  4I5S A;  5F5R A;  2ESA A;  3FV5 A;  4KP4 A;  4YKT A;  1EI1 A;  2WEQ A;  4HXW A;  4XIQ A;  2BYI A;  1Y4S A;  2IWX A;  3IED A;  4GT8 A;  3HZ1 A;  1Y8P A;  4XCJ A;  1GJV A;  3Q5L A;  3EHJ A;  5M4E A;  2VWC A;  4XCL A;  4E02 A;  4PRX A;  2Q2E B;  4CWO A;  2IOR A;  4GT1 A;  3ZM7 A;  2VW5 A;  2GFD A;  4HYM A;  2WI7 A;  3ZXQ A;  5M4P A;  1NHH A;  2BSM A;  5FND A;  4XKO A;  2Q8H A;  4XDM A;  4CWF A;  3QTF A;  3B24 A;  4BXI A;  5J6A A;  5B1N A;  1S16 A;  2H55 A;  2YE9 A;  5D6P A;  1TIL A;  3ZCC A;  2BYH A;  2XD6 A;  3A0T A;  4O04 A;  3K98 A;  4HZ5 A;  1F51 A;  4ASF A;  4O0B A;  4HY6 A;  4GFN A;  4V25 A;  2O1U A;  5C93 A;  5J71 A;  4EMV A;  2YE4 A;  2ZKJ A;  4HYP A;  2ZDX A;  4R1F A;  4L90 A;  1I5C A;  4ZKI A;  1ZXN A;  2CH4 A;  2FTK A;  1B63 A;  3G75 A;  2WI5 A;  2CGF A;  4H81 A;  3TZ4 A;  3O6O A;  1TC0 A;  4JYB A;  4E01 A;  3B26 A;  1UYL A;  2XDK A;  3VHD A;  1BYQ A;  1YSR A;  4CWQ A;  1H7U A;  3LNU A;  3CGY A;  5D7D A;  3R92 A;  3BM9 A;  4BIZ A;  2O1W A;  2YI7 A;  2BT0 A;  3INX A;  2Q8I A;  1I5A A;  2FWZ A;  1YC1 A;  2QM7 A;  3U2D A;  1UYI A;  3HZ5 A;  1THN A;  2YEJ A;  2QFO A;  3D2R A;  4LPB A;  2BU5 A;  4L8Z A;  4HZ0 A;  3T10 A;  4LWF A;  2XX2 A;  2LFS A;  4KFG A;  1U2O A;  4L94 A;  2VCI A;  2YEG A;  4WUB A;  4LWH A;  4AWO A;  2YI5 A;  1TC6 A;  1ZW9 A;  2BU6 A;  1QYE A;  1B3Q A;  4YKZ A;  4MBC A;  4PRV A;  5F3K A;  4B6C A;  3H80 A;  4KSG A;  2YEH A;  2YE2 A;  4NH8 A;  4DUH A;  3HHU A;  3TZ5 A;  3TK1 A;  2XJJ A;  3NMQ A;  2C2A A;  3B25 A;  4I3H A;  3C11 A;  4NH7 A;  1YC4 A;  3T1K A;  4P8O A;  4ZVI A;  1Z5B A;  1R62 A;  4AWQ A;  2JJC A;  3EHF A;  3B28 A;  4PL9 A;  1YC3 A;  1Y4U A;  3VHC A;  3DGE A;  2H8M A;  2QG0 A;  2XCM A;  3D36 A;  4JAU A;  4MTX A;  2AKP A;  4YKW A;  4O07 A;  2BZ5 A;  4GEE A;  2YEF A;  3EKR A;  4MOT A;  1U0Z A;  2O1V A;  3HYY A;  4MB9 A;  2QM8 A;  5IDJ A;  2HG1 A;  4EFU A;  1S14 A;  4DZY A;  3RLR A;  3ZKB A;  3H4L A;  1JM6 A;  1BXD A;  4U7N A;  2IWS A;  4B7P A;  4P7A A;  1L0O A;  3K99 A;  4R3M A;  5L3J A;  4WUD A;  3OWB A;  1Z5A A;  2Q8G A;  2WI4 A;  3A0R A;  2YE6 A;  1Y8N A;  2UWD A;  4FCQ A;  4U93 A;  1UY8 A;  2BTZ A;  3R4M A;  2E0A A;  4KSH A;  3T2S A;  2XDU A;  3Q5J A;  4GQT A;  4BIU A;  4EGI A;  4MPN A;  5BOD A;  2XAB A;  2YE8 A;  4PU9 A;  2FXS A;  1ZXM A;  2FWY A;  2CCT A;  4XD8 A;  1KZN A;  4Q20 A;  1UY7 A;  3U2K A;  3P32 A;  4W7T A;  3O2F A;  1YET A;  3A0X A;  2YI0 A;  1UYM A;  4CWR A;  3EHH A;  4JYC A;  2K5B A;  5CPH A;  4YKU A;  2YEI A;  4U7O A;  5CTX A;  1NHI A;  2IWU A;  2FYP A;  3ZRW B;  2CCU A;  2XHX A;  3WQ9 A;  2QF6 A;  5CF0 A;  1GKZ A;  3A0W A;  3OPD A;  4HXZ A;  5FWK A;  4FCP A;  3JZ3 A;  3ZRV A;  3SL2 A;  4XE2 A;  2YJW A;  4CWS A;  2YK2 A;  4EGK A;  1AMW A;  1EA6 A;  3Q5K A;  4O09 A;  4YKQ A;  3FT5 A;  1B62 A;  2XHR A;  3ZRW A;  2QG2 A;  2YKE A;  4QPK A;  4R3A A;  1QY8 A;  3K60 A;  4MT8 A;  2XJG A;  4JAS A;  3NXS A;  1KIJ A;  2BU2 A;  3RLQ A;  4X9L A;  3CWV A;  4XKK A;  3OWD A;  3TZ2 A;  2YK9 A;  2YE7 A;  3HEK A;  2WWW A;  5D7R A;  3PEJ A;  4EGH A;  1A4H A;  1I58 A;  5CTY A;  3O0I A;  1ID0 A;  2P67 A;  3G7E A;  4XKA A;  4LWI A;  3K97 A;  2BRC A;  1UY6 A;  4EFT A;  3KE6 A;  2VCJ A;  4YKX A;  4ASG A;  4WUC A;  2CG9 A;  3C0E A;  5GGZ A;  5M4H A;  4URM A;  1IXM A;  1GKX A;  3GIG B;  5M4N A;  4CWT A;  1MU5 A;  1JOY A;  1TBW A;  2WI2 A;  2XDL A;  4LWG A;  2WI1 A;  2YKB A;  4LWE A;  1I5B A;  3TZ0 A;  3EHG A;  4YKY A;  1QZR A;  3T0H A;  3WHA A;  5CTU A;  2EXL A;  1AJ6 A;  4XIT A;  4CE3 A;  3G7B A;  1UY9 A;  2IOQ A;  4ASA A;  1Z59 A;  4E00 A;  3GIG A;  1TH8 A;  3R4O A;  1AH8 A;  2YI6 A;  3QDD A;  1YT1 A;  1BGQ A;  4CWN A;  1H7S A;  4BAE A;  2YEC A;  4H7Q A;  1PVG A;  4YKR A;  1YT0 A;  5B1O A;  5CTW A;  3MNR P;  2YEE A;  2YGA A;  4GCZ A;  4KTN A;  3A0Z A;  3LPS A;  2YEA A;  4V26 A;  1TID A;  1US7 A;  4URN A;  2XX5 A;  3R4P A; 
#chains in the Genus database with same CATH topology
 1F23 A;  1ARO P;  3QTC A;  2KG7 B;  4RUF A;  3CRL A;  4L93 A;  2NR5 A;  4JGS A;  1Q86 W;  4J80 A;  1VQ8 V;  3JAW A;  3UO2 A;  2YGE A;  4GX2 A;  1YDX A;  4B3T B;  5M4K A;  1XQ8 A;  3E2E A;  1NBM G;  4K8X A;  1Z5C A;  4LNU B;  3RYC A;  4URL A;  2NLJ C;  4I0X A;  2XK2 A;  4JQL A;  2V7Q G;  1BQ0 A;  5J2U A;  5KMG A;  1LUV A;  2UXN A;  1CEZ A;  4HY1 A;  2BU7 A;  4GKK B;  2HKJ A;  1GKF A;  3SPH A;  3FB5 C;  2LGQ A;  3DC6 A;  3HKE A;  4O4L A;  3E8H A;  1G1X B;  1S3J A;  4PJ0 Z;  1SRY A;  4XIP A;  2PYJ A;  4BQG A;  2Q4P A;  4MVR A;  5B1A C;  4O4J A;  1XL6 A;  4TV9 A;  5KHG A;  4X88 A;  1UYE A;  4X64 O;  2ZDY A;  1RSO B;  2OT5 A;  5KAF Z;  4PV1 B;  1HNW O;  5H6Q A;  4DR4 B;  4WFE A;  1JCH A;  2Y0I A;  2UUB B;  4URO A;  4HBN A;  2YKJ A;  3ASN B;  2HFE C;  3B27 A;  1WJZ A;  4JI6 B;  1SKV A;  1B6Q A;  3E35 A;  5IN9 A;  1QLE C;  2IBZ H;  2EZP A;  4CH4 A;  4B3S O;  2X6B A;  5CB4 B;  1VQ5 V;  4PA7 A;  5D7C A;  1N8R W;  1IBL O;  4J10 A;  5JVD A;  4AIL C;  4UVA A;  5B1B B;  1YCI A;  1KC8 W;  2Q8V A;  2EX3 A;  3L70 H;  4LFC O;  1NKD A;  3KKY A;  4TUY B;  2P06 A;  3EFF K;  5GW7 A;  4E72 A;  2ZBK B;  4F6R B;  3HKC B;  3E8B A;  1MA1 A;  4D7S A;  2ZT9 B;  4N21 A;  2HKO A;  4YJ2 A;  4H85 A;  1FXV A;  2EBO A;  3FT8 A;  1I94 O;  2MW2 B;  1VQN V;  4LWS A;  2UXB O;  2HP8 A;  3ZRX A;  2QTS A;  3CCR V;  1VQ7 V;  3BMY A;  4MPE A;  2FML A;  2RQ6 A;  1ZAU A;  1NHJ A;  2ZD9 A;  1DLB A;  2ESA A;  4DYL A;  4JI4 O;  2UU9 B;  4L87 A;  5CBH A;  2BYI A;  2IWX A;  1S5H C;  1Y8P A;  1UFI A;  5BXZ A;  1YVW A;  2W0X A;  3Q5L A;  4CH6 A;  4IHJ A;  2QKC A;  3CX5 F;  1S72 V;  3CSX A;  4XCL A;  4I4T A;  2IOR A;  1O9G A;  3ZM7 A;  2H3O A;  3CCV V;  2VW5 A;  2BSK A;  1QNM A;  3GVM A;  3RYF B;  3BA8 A;  4XKO A;  4CWF A;  1NS1 A;  2QKA A;  3CPW U;  3OMA B;  3B24 A;  3H1H H;  5B1N A;  1AP5 A;  4DV5 B;  3X2Q C;  4FLU A;  3VQY A;  3HKD A;  2BYH A;  2OYQ A;  1TVK B;  3A0T A;  4O04 A;  3OGI B;  1KKD A;  1SQG A;  4P9O A;  4X62 B;  4QE9 A;  4CC5 A;  1OCC C;  2Y69 B;  2VQE O;  2YE4 A;  4HYP A;  4UCT A;  1GAX A;  3ETG A;  2CH4 A;  2FTK A;  1SQQ H;  3S3X A;  1M1K W;  2WI5 A;  1BZK A;  1NQT A;  1WP7 A;  2OCC B;  4X9Q A;  1M93 A;  4G27 B;  2XDK A;  2P5O A;  4DV3 B;  3J7A U;  2EZO A;  3CGY A;  3ABU A;  4Z2W A;  4U3J A;  2O1W A;  3INX A;  4I55 A;  4LBE C;  1X4T A;  2QDO A;  1UYI A;  1FPO A;  4DV4 B;  4ABM A;  4AQY O;  3DXR A;  4W4K A;  2BU5 A;  4L8Z A;  1E1R G;  4KFG A;  3K58 A;  4X66 O;  4IL6 Z;  1U2O A;  4L94 A;  3W7T A;  2QGN A;  2C1I A;  3WB2 A;  4AWO A;  2E5L O;  1K9M W;  1ROP A;  2HR3 A;  1KEC A;  3AK1 A;  3LSS A;  3GB7 C;  4WBN B;  2UUC O;  1OCO B;  1TGO A;  2W6J G;  5EC2 C;  4AHC A;  1V55 B;  1QU7 A;  2OIG A;  4I7Z B;  5JJE B;  2WA4 A;  5EIB D;  3H80 A;  4KSG A;  2YEH A;  3K08 A;  3MHS C;  4NH8 A;  3LSU A;  1DF5 A;  2ZNJ A;  4ZHQ B;  1AI5 A;  5IE9 A;  1S76 D;  4PEL A;  2XJJ A;  1IBL B;  3BPZ A;  3BAB A;  3EHB B;  1PNL A;  4R7C A;  1SET A;  3NMQ A;  2IU0 A;  1Y76 A;  3OD4 A;  2H94 A;  1VQK V;  3C11 A;  1GN3 A;  1YC4 A;  3FB6 C;  4DR5 B;  4LFC B;  3ZMZ A;  1M9N A;  4P8O A;  1XNQ O;  2RMK B;  5B3S B;  3G6E V;  2JJC A;  3EHF A;  3T2M A;  3B28 A;  3Q4H A;  1ORQ C;  1V54 C;  3LDC A;  2PI5 A;  1NI8 A;  1QVF U;  4DK1 A;  5FPR A;  2H8M A;  2QG0 A;  2AKP A;  1JJO A;  4GEE A;  1QLN A;  1U0Z A;  3HYY A;  2YI9 A;  3QG5 A;  2B5U A;  3U10 A;  4JI4 B;  5LL6 Y;  5BZB A;  3ABM C;  1S14 A;  4EFU A;  2DYS B;  3H4L A;  1BS3 A;  5EYP B;  3ZMT A;  3ZHT A;  2E74 B;  1L0O A;  3RN4 A;  3OR6 C;  2EIK B;  1ZUQ A;  1R3J C;  3OWB A;  2WI4 A;  4B3R O;  5LXT B;  1SQV H;  1UY8 A;  4X89 A;  3SYQ A;  4O4H A;  1YIJ V;  3Q5J A;  2QJ1 A;  5H9C A;  4K0K B;  4BIU A;  3T1H B;  1SA0 B;  4RO2 A;  1N4C A;  4LF6 O;  1G8M A;  4XD8 A;  2YDE A;  3CCJ V;  4K35 A;  1UY7 A;  4DR1 O;  3LSQ A;  5K1P A;  3CRR A;  1YET A;  4N23 A;  1HP8 A;  3JAS B;  5L3D A;  3CCL V;  1SC5 B;  3OMI B;  1UYM A;  4TWK A;  4LCU C;  2K5B A;  4DO2 A;  2VQE B;  4H37 A;  5HFL A;  1OCR C;  3HPL C;  5LBQ A;  2CCU A;  2XHX A;  1F4N A;  5CMU A;  2AGA A;  2QF6 A;  1K5S A;  1JA8 A;  4O2B B;  3OPD A;  3SJB C;  1EZV H;  4EB6 B;  3UKM A;  1FFX A;  1GO3 F;  1Y6X A;  5E79 Z;  4EFE A;  3JZ3 A;  3SL2 A;  2DJV A;  2YJW A;  4CWS A;  3ETQ A;  2AZ0 A;  1AMW A;  5AG2 A;  3L72 H;  4DR7 O;  4YKQ A;  3FT5 A;  5LA6 B;  3SJQ C;  2XHR A;  2GTS A;  1KBH A;  1PKX A;  4JZG A;  2YIC A;  1Q3E A;  3H1I H;  4BW9 A;  1N34 B;  3RW0 A;  2YI8 A;  4AQY B;  3ABK C;  4X66 B;  2LW7 A;  3RLQ A;  4XKK A;  4DR3 B;  3TZ2 A;  2DWD C;  2WWW A;  2E76 B;  4P2Z A;  4TQF A;  3WB0 A;  3CS5 A;  5D5P A;  2RJZ A;  3BVO A;  2PY5 A;  3PEJ A;  4EGH A;  2UUC B;  1QVG U;  2CH7 A;  3ML0 A;  2HVJ C;  2P67 A;  3G7E A;  1AJQ A;  2EUL A;  3E8G A;  4K3A A;  1UY6 A;  4XDK A;  1GTO A;  3KE6 A;  2ITC C;  4YKX A;  5ITZ A;  3QNE A;  5JH7 B;  2CGO A;  5EBL C;  4ASG A;  2CG9 A;  3W7W A;  5GGZ A;  3W7S A;  4H0L B;  5M4H A;  2IM9 A;  2IJJ A;  2F1M A;  1KD1 W;  1JOY A;  1TBW A;  2WI2 A;  4RWU A;  2YEV A;  4ZOL A;  2LO1 A;  3F7Y C;  1I5B A;  4LFA B;  3KCX A;  1P7G A;  4KHP B;  3IAY A;  1R1B A;  4KL1 A;  5CTU A;  1U97 A;  1IBK B;  3CRA A;  3TCU A;  4XIT A;  4PDM A;  2AXT Z;  3G7B A;  3CC7 V;  3LNN A;  5GON B;  3LDE A;  2IOQ A;  4E00 A;  3GIG A;  4JI1 O;  2X6C A;  1J95 A;  4FIP C;  1YHQ V;  2IJK A;  3JAK B;  1QCE A;  1K8A W;  1H8H G;  4BAE A;  4EFB A;  4HZ3 A;  1XRE A;  2BCC H;  3FFQ A;  1YT0 A;  2GSM B;  3ASO B;  2RCV A;  3MNR P;  4GCZ A;  4LH7 A;  1COW G;  4B3T O;  4B3R B;  4URN A;  5KAI Z;  2ETN A;  5IWA O;  3R4P A;  5EZY A;  2YEB A;  5D6Q A;  2B1I A;  2WLJ A;  5FNC A;  4X1Y B;  4UCV A;  4BWA A;  3ZIA G;  2CTP A;  1EM1 A;  1FXK B;  2HG5 C;  1GM8 A;  4H33 A;  2V4D A;  3DTU B;  4LF6 B;  2BRE A;  4F4L A;  1YT2 A;  4BQJ A;  1OSF A;  4GKK O;  5FNF A;  4X1K A;  1D2D A;  4DR1 B;  2EIN B;  4I50 A;  5IY5 C;  3AEI A;  3QO5 A;  2KG7 A;  1B06 A;  1Q6I A;  3G71 V;  1XOU A;  2UUA B;  3GIE A;  3SYC A;  1P7B A;  3RKZ A;  2EJR A;  4KQV A;  1RPO A;  1URF A;  3G67 A;  3VHA A;  4CE1 A;  2YED A;  1H2L A;  5EK0 A;  4LNU A;  5IYB O;  4JYY A;  2UUB O;  4CBC A;  5K1X A;  1D5N A;  3M8A A;  3D0B A;  4JI7 O;  3FAV B;  1XUQ A;  4QPJ A;  1I5D A;  5JWP A;  1WPB A;  2Q0A A;  1UYG A;  3A0Y A;  4FLZ A;  1UYH A;  4FZ0 A;  2PTM A;  4GKJ O;  3PEH A;  1YS3 A;  1CXZ B;  5DM6 V;  4DR7 B;  3ZXO A;  2EIL B;  3JAM N;  1K97 A;  2YE3 A;  2JKI A;  2YIB A;  4FCR A;  3APO A;  2QM4 A;  3JYC A;  4GGL A;  1VMG A;  2JGD B;  3QF7 A;  2EJ7 A;  3FB7 C;  1YER A;  4NR1 A;  2JRI A;  1YES A;  2BU8 A;  1RSO A;  1VQL V;  4B7E A;  1V9P A;  1UYD A;  3FB8 C;  2CCS A;  1I5Y A;  3WG7 C;  2GQP A;  3EKO A;  3OUF A;  1MG1 A;  4LR3 A;  3E8F A;  1MZE A;  1CPY A;  1IBM B;  3D8C A;  4EM7 A;  2Z5U A;  1BKN A;  2XDS A;  1QQC A;  4L91 A;  2PI4 A;  2EIM C;  3ABL C;  2WER A;  5FNV B;  4YXW G;  5CB4 A;  4NH9 A;  2Q73 A;  4XDJ A;  5KHK A;  4NTW A;  1HNX O;  3L71 H;  4UXN A;  4DV7 B;  1UYC A;  4YY3 O;  4JI0 O;  4TUY A;  2PNR A;  4FPP A;  4MP2 A;  5BOC A;  2WLK A;  4I5S A;  4F6R A;  3HKC A;  5IYD O;  1S0V A;  5JCO A;  4UCR A;  4LF7 B;  4I9W A;  2WEQ A;  4MW3 A;  4XIQ A;  4FLX A;  1Y4S A;  1WAZ A;  3HZ1 A;  2R70 A;  4JI1 B;  2WA3 A;  1NTK H;  3EHJ A;  2HJF C;  4UCS A;  1BCC H;  4JV5 B;  2Q2E B;  2QKS A;  2P7T C;  3AG2 C;  4X65 O;  4DV5 O;  3K06 A;  4HYM A;  5M4P A;  2X0L A;  1Q6H A;  4MVS A;  1NHH A;  1DGS A;  2PYL A;  3QTF A;  4CZZ A;  2JEU A;  4BXI A;  2GDS A;  4X62 O;  1OCZ B;  4L8J A;  1IZ3 A;  2VQF O;  3CCU V;  1EN5 A;  3TGU H;  4B08 A;  1TIL A;  2ARH A;  1KMI Z;  4FFB B;  4U3F H;  5IWA B;  3F5T A;  4TOI A;  4GX5 A;  3K98 A;  3A8T A;  4FVM A;  4HZ5 A;  1Q6U A;  4ASF A;  4O0B A;  4V25 A;  3RYF A;  4R6Z A;  3OR7 C;  5J71 A;  4EMV A;  4J9Z B;  3K9S A;  1Y67 A;  2R9A A;  4R1F A;  4YIO A;  3O65 A;  1TUE B;  4ZKI A;  1ZXN A;  4H81 A;  3RFR A;  4DV3 O;  3B40 A;  3O6O A;  1TVK A;  4JYB A;  4WFG A;  4E01 A;  4PDV A;  2X7R B;  4BIO A;  2QWO B;  3PN1 A;  4EKW A;  4WFF A;  4BR6 A;  1KB9 F;  2F95 B;  4DV4 O;  3BFR A;  1ZL8 B;  4FLW A;  1XMQ B;  2DQ3 A;  5EIB C;  4Z1V A;  2C1G A;  2VWK A;  4PI2 A;  4WCE V;  3R92 A;  4BIZ A;  3AG4 B;  5LMN O;  1YC1 A;  1TA8 A;  3U2D A;  1SZX A;  4JI7 B;  1S77 D;  3ZN1 A;  4LPB A;  2YEJ A;  3D2R A;  3ETD A;  3O9O A;  4DV6 O;  4PI0 A;  2DOS A;  4HZ0 A;  3SYO A;  1N32 O;  4MVZ A;  4GKJ B;  2XX2 A;  2XAF A;  2QSA A;  1FS0 G;  2AZ2 A;  1MNG A;  1RM1 C;  3S5T A;  2BU6 A;  4GUN A;  4IIJ B;  3JSL A;  1B3Q A;  4YKZ A;  1U96 A;  1R3K C;  1O9H A;  1AI4 A;  3H1K H;  4W4L A;  2YE2 A;  4DR5 O;  1PL0 A;  2XT9 A;  2JDI G;  4DUH A;  3HHU A;  3TZ5 A;  3TK1 A;  2K9P A;  4P9P A;  1W0J G;  2XAS A;  2R9I A;  1YZB A;  2JS3 A;  3GWK C;  1AR5 A;  4FK5 C;  2HHI A;  3B25 A;  4I3H A;  5IYZ B;  5KHI A;  3T1K A;  4WBN A;  4WFB V;  2CTQ A;  1KU9 A;  3IJ4 A;  4PL9 A;  2WLL B;  1IDS A;  1HNZ B;  2DQ0 A;  4ZHQ A;  1SF9 A;  3D3I A;  2CAZ C;  3H9V A;  3W7X A;  5DN6 G;  4YKW A;  4O07 A;  1HNX B;  5JJN B;  2FB5 A;  4MOT A;  3TET A;  4YY3 B;  4JI0 B;  1WPX A;  5IDJ A;  5KLV H;  4LF9 B;  1UPG A;  2M6Y A;  4J42 A;  3ZKB A;  4GYC B;  4JTD B;  2Y4T A;  5GTI Z;  4U7N A;  4CS2 A;  2IWS A;  4P7A A;  3K99 A;  4R3M A;  1WN7 A;  5B1B C;  4K0K O;  1K3E A;  3JD0 A;  3T1H O;  3ZS8 C;  5L3J A;  1Z5A A;  3OAA G;  5BR8 O;  4X65 B;  1Y8N A;  2UWD A;  2BTZ A;  2ZE5 A;  2ZR2 A;  4WFH A;  1GN2 A;  5JCO C;  4FZ1 A;  2E0A A;  3CJH B;  4KSH A;  3T2S A;  1HWY A;  2ADQ B;  1XL4 A;  1R6T A;  2FKX A;  2DE0 X;  3IGA C;  4EGI A;  5EYP A;  1TAE A;  2Q7E A;  4PU9 A;  2FXS A;  2VQF B;  1ZXM A;  2CCT A;  5LGT A;  1Q5O A;  3SPG A;  5JQG B;  5LXT A;  2ZE6 A;  4MTF A;  5LHG A;  4O4L B;  5JJJ B;  2OCH A;  3EHH A;  1NZ6 A;  4JYC A;  1FFT B;  5CPH A;  2ITD C;  2YEI A;  1K4C C;  1QBZ A;  1E1Q G;  1SA0 A;  4U7O A;  3W7U A;  2WLH A;  4GX0 A;  1ENV A;  4TSF G;  1GN4 A;  5KA5 A;  3WQ9 A;  1GKZ A;  3SJA C;  3LNM B;  4YHH B;  5DED A;  3JAS A;  3WB1 A;  1N34 O;  4MTG A;  1L0N H;  2WLN A;  4QE7 A;  4NXN O;  1K92 A;  2YK2 A;  5DEC A;  1VF5 B;  1EN6 A;  3ZRS A;  1I0H A;  1B62 A;  5LMN B;  2YKE A;  4G2K A;  4DR3 O;  5D5Q A;  2ZM6 O;  2A06 H;  4O2B A;  3UM7 A;  1QY8 A;  4EB6 A;  4DV6 B;  2XJG A;  1N0N A;  3K5M A;  1N32 B;  3TJT A;  2Y69 C;  2BU2 A;  1AJP A;  2LP7 A;  1F4M A;  1M5I A;  2DMX A;  2WLI B;  1YJW V;  1K5Q A;  1TUB B;  3CC2 V;  3HEK A;  4KXR A;  5LA6 A;  5CTY A;  2CDY A;  2Y48 A;  4JI5 B;  4DR6 B;  4XKA A;  1P4R A;  4MSW C;  2OCC C;  1MSW D;  3K97 A;  2E75 B;  4JAA A;  3JAR B;  3QO8 A;  3H1L H;  4EFT A;  2W0F C;  2ZXW B;  5HFM A;  4LFA O;  4OGQ B;  4KHP O;  3C0E A;  4URM A;  3OMN B;  1IBK O;  1AR1 B;  1H2M A;  1GKX A;  3UQ8 A;  5M4N A;  4CWT A;  2Q5Z A;  2YIA A;  1N0J A;  1VP7 A;  2XDL A;  4MVO A;  2WI1 A;  2YKB A;  3APQ A;  2E3C A;  3RYI B;  2ZQM A;  5EBM C;  1VAR A;  2F23 A;  5CBF A;  3T4Z A;  1SQP H;  1AJ6 A;  5JH7 A;  2A7W A;  2EIJ B;  2YXH A;  4B3M O;  1UY9 A;  4MVQ A;  2IH3 C;  2UXD B;  4ASA A;  5BMV B;  1AH8 A;  2YI6 A;  3QDD A;  1YT1 A;  3ZMS A;  2ZR3 A;  1BGQ A;  1OCO C;  5LYJ B;  2HHH B;  1MAB G;  2XND G;  4FM0 A;  4ZI7 B;  1H7S A;  1L0L H;  1XHX A;  4DUZ B;  3AG3 B;  1Z2G A;  4O4I B;  5BY1 A;  2Y4U A;  5GON A;  5B1O A;  1IX9 A;  2XHB A;  4MVM A;  2YEE A;  2PGG A;  4KTN A;  4WF9 V;  4DV0 B;  3A0Z A;  2BOC C;  4BW5 A;  5BR8 B;  3JAK A;  2DW4 A;  4FJC C;  3RGB A;  2XX5 A;  4GX1 A;  5B3S C;  2Q9L A;  3N27 A;  4JAV A;  3EVK A;  4TV8 B;  1AB3 A;  3GIF A;  4AI8 A;  1D5A A;  4J9Y B;  2N74 A;  2UUA O;  1KYO F;  4XTJ A;  3STL C;  5A2Q N;  3CEI A;  5E1A C;  1MSD A;  1Y66 A;  3JAT B;  5L3B A;  4LP0 A;  4MS2 A;  4AS9 A;  2IW5 A;  4XIR A;  4A5U B;  4CS4 A;  1SQB H;  1MX0 A;  4OX9 B;  2Z3Y A;  2DYS C;  4XDL A;  1FXK A;  2JS5 A;  4PHZ A;  3SYP A;  1GM7 A;  1QHT A;  2H8P C;  2EIK C;  3BA9 A;  2WI6 A;  2YXL A;  2XHT A;  1AH6 A;  1UYF A;  1M4U A;  1SZT A;  3INW A;  3OW6 A;  1YEW A;  5FPO A;  4JI3 B;  2F43 G;  1PL4 A;  2YSU B;  4O2A B;  4NXN B;  4J7J A;  4DR2 B;  5J2T B;  3CRK A;  3KG2 A;  1AI7 A;  3BRC A;  4G28 B;  3CMA V;  1YF2 A;  2Q8F A;  2ZM6 B;  2JIZ G;  1IVS A;  3FAV A;  4NXM O;  4CWP A;  4R8C A;  1XMO B;  2FL4 A;  1Y8O A;  1H38 A;  3TXQ A;  1IBM O;  4DRX B;  2F66 C;  4UB6 Z;  1VIB A;  5LHH A;  1R3I C;  1BHB A;  1EBO A;  2N05 A;  4PA3 A;  2JGD A;  4FMT A;  4LC1 A;  2UXX A;  3CME V;  4P30 A;  1I08 A;  5M4M A;  1K33 A;  5LP6 B;  1NTM H;  3N2K B;  3TUH A;  4DV7 O;  1H8E G;  3CGZ A;  3CWB H;  2VS0 A;  1DTO A;  3R4N A;  1AIL A;  2XDX A;  2YGF A;  1MOF A;  2HCH A;  4LF7 O;  1I59 A;  2XJX A;  3ABT A;  4LF4 O;  4WFA V;  3MD0 A;  5EBW C;  2PZS A;  3RLP A;  1R3L C;  3JD4 A;  4X1I A;  5F5R A;  3OTO O;  4JV5 O;  4KP4 A;  3FV5 A;  5FNV A;  1EI1 A;  4B3M B;  3FKS G;  4DK0 A;  1GMG A;  2BE3 A;  4DW0 A;  3IED A;  3JD2 A;  4XCJ A;  4NVP A;  2QTO A;  2W6I G;  5IY5 B;  5M4E A;  2VWC A;  3AG1 B;  3C3T A;  3SYA A;  3B09 A;  3DSQ A;  2GFD A;  4PDL A;  3HKB B;  2GHY A;  3J81 N;  3A2F A;  5J6A A;  1R73 A;  3DC5 A;  3LDD A;  4LFB O;  2CTW A;  2QA4 V;  1S16 A;  2YE9 A;  1SQX H;  3SDL A;  2WSS G;  2XD6 A;  3JAL B;  1S5L Z;  4RAI A;  3OM3 B;  2P22 C;  4J7K A;  4GFN A;  2DYR C;  1L1F A;  1YI2 V;  2ZDI A;  5LOV B;  1GM9 A;  2ZDX A;  3PJS K;  4L90 A;  1I5C A;  1XDC A;  3H01 A;  1B63 A;  1FXH A;  2WPD G;  3G75 A;  3QO7 A;  3TZ4 A;  4FFB A;  1TC0 A;  1E79 G;  4IYI A;  1XMQ O;  4D6T H;  3THO A;  1HW7 A;  4PA6 A;  2Q69 A;  2QR4 A;  3B26 A;  2HLD G;  1YTF B;  3CB2 A;  3N2G B;  3VHD A;  4CWQ A;  1AR4 A;  1H7U A;  2OTJ V;  3JD1 A;  2GUZ B;  3ASO C;  3LNU A;  5CA0 B;  1RFY A;  1JR9 A;  4UV8 A;  1US6 A;  5D7D A;  4C7U A;  3BM9 A;  2GV9 A;  2YI7 A;  5CA3 A;  2Q8I A;  4JTA B;  4RQE A;  4E2L A;  2XAJ A;  3G4S V;  5B5E Z;  2QEX V;  1ZX3 A;  4EEQ A;  1THN A;  3T10 A;  3C90 A;  2P4V A;  1FD9 A;  3R66 A;  1FXK C;  1M57 B;  4FFK A;  2BTO A;  2MK3 A;  4JF3 A;  1ZL8 A;  2VCI A;  2YEG A;  1WLE A;  4WUB A;  5L3G A;  3U0Z A;  4LWH A;  1TC6 A;  2KQX A;  4OPH A;  1ZW9 A;  1QR9 A;  1QYE A;  2QE7 G;  3I55 V;  4ASU G;  3FX7 A;  1F7Y A;  4NXM B;  3ETE A;  4LH6 A;  3ZJZ A;  1K73 W;  1NH2 D;  5F3K A;  1VQ9 V;  1BGY H;  2LJ2 A;  2ZE8 A;  2B1G A;  3BAA A;  3ZHV A;  2C2A A;  1HNZ O;  3ZHS A;  4UUJ C;  2M7W A;  1M56 B;  2NN4 A;  4NH7 A;  4IIJ A;  2YXY A;  3STZ C;  4ZVI A;  1MZF A;  1THZ A;  4MVU A;  1OJH A;  4AWQ A;  1LUW A;  4IT5 A;  2KB1 A;  1YC3 A;  1ZWI C;  3JD3 A;  2EIL C;  3ICX A;  1WB8 A;  4LF9 O;  1AVM A;  4MTX A;  1KKC A;  4GLX A;  2BZ5 A;  1WA8 B;  3CC4 V;  4K8Z A;  4LF4 B;  2X6A A;  4TQD A;  5IYZ A;  3EKR A;  4MB9 A;  1FJG O;  3VQV A;  3OTO B;  3F5W C;  2WLL A;  1R6K A;  3K5O A;  3I56 V;  3FYI B;  4B7P A;  1G4Y B;  4J7Z A;  4X20 B;  3A0H Z;  1Y74 B;  3SPC A;  3RYH B;  5B1A B;  2JGU A;  3VBB A;  5LMU O;  3A0R A;  1YJ9 V;  2VRZ A;  4FCQ A;  1H2N A;  4HNA B;  2Q68 A;  3E22 B;  5LGU A;  3K9A A;  1DK1 A;  3K04 A;  2UXC B;  2XAB A;  2KKW A;  5C8Y B;  2YE8 A;  1YIT V;  2OIE A;  4LFB B;  2FWY A;  5LHI A;  1KZN A;  3U2K A;  1JQ0 A;  3A0X A;  3U11 A;  4PDR A;  2YI0 A;  2GTA A;  3CJH A;  1QLE B;  4YJ3 B;  2ODM A;  3AK3 A;  4CWR A;  4QNH B;  4JZ2 A;  3UT5 B;  1N33 B;  4B7K A;  5IJ9 B;  4YHH O;  1RM1 B;  3I5D A;  4YKU A;  2P4K A;  5GTH Z;  5IJ0 B;  4QGP A;  4PA9 A;  3ZRW B;  4UCU A;  4R50 A;  5JQG A;  5CF0 A;  3JCZ A;  1AP6 A;  3A0W A;  1BSM A;  3ZMU A;  5J9P C;  5CA1 B;  5FWK A;  3ZBH A;  3WU2 Z;  3OEH G;  4OXS A;  3F7V C;  3RT3 C;  4XE2 A;  2ZDI C;  4EGK A;  1EA6 A;  1R6N A;  3Q5K A;  3T1Y B;  1OCZ C;  1JFF B;  2CK3 G;  4R3A A;  1BL8 A;  2BOB C;  4I9Q A;  3HR0 A;  3K60 A;  4JAS A;  3E83 A;  1VQ6 V;  3K3W A;  3ZHU A;  1PD3 A;  3K0D A;  4DV2 O;  4JI5 O;  2HVK C;  5L3E A;  4DR6 O;  3R65 A;  4X9L A;  3M7M X;  2YUA A;  2YK9 A;  3BEH A;  4MTO A;  2XUM A;  3IFX A;  4QJF B;  1Q82 W;  5B66 Z;  4JI2 O;  2BTQ B;  1A4H A;  1I58 A;  3E86 A;  1ID0 A;  4DW1 A;  2RDC A;  2D3O W;  4LWI A;  1XEQ A;  2P6J A;  4QIW F;  2WAM A;  4JI8 B;  2WLI A;  2R72 A;  2QWN B;  1TUB A;  1IXM A;  3AG4 C;  4ZBM A;  1ZSP A;  1HR0 B;  2IH1 C;  3X2Q B;  3K57 A;  2UXD O;  3ASN C;  2XAH A;  3TZ0 A;  3EHG A;  4YKY A;  5CN0 A;  3T0H A;  3JAR A;  3WHA A;  1PNK A;  2HHH O;  3E89 A;  5KX5 B;  1OCC B;  1PNM A;  4DUZ O;  4PA4 A;  1BQZ A;  3IC7 A;  1YTF D;  1TH8 A;  1IXB A;  5CBG A;  1HDJ A;  4CWN A;  1FJG B;  3RYI A;  1J5E B;  4JYA O;  4DV0 O;  1GK9 A;  4H7Q A;  3JAW B;  1PM9 A;  1PVG A;  1SS3 A;  4E4E A;  1VQM V;  2ADP A;  5BMV A;  2YGA A;  3RYC B;  1Y4M A;  2YEA A;  4V26 A;  1TID A;  5LYJ A;  3SGI A;  5KA6 A;  5LMU B;  1US7 A;  4I0X B;  4ZI7 A;  1Q8I A;  1Q90 D;  1AJN A;  5J2U B;  3MHH C;  5KMG B;  2CGN A;  5IDM A;  3MAQ A;  1XBL A;  4O4I A;  3HKE B;  3K5N A;  4OX9 O;  2ZIO A;  1SQF A;  1SES A;  2WI3 A;  3RWR D;  3T0Z A;  3FYE B;  1UYK A;  2ZE7 A;  3SR2 C;  2XX4 A;  5A9G A;  3OE7 G;  4LF8 O;  1ZWH A;  4O4J B;  4CC6 A;  4FM1 A;  4TV9 B;  1OHH G;  2QWP B;  1EN4 A;  1NVP D;  1JPX A;  1BMF G;  4IGG A;  2RNB A;  1JMK C;  3OMU A;  2A3Q A;  2IJH A;  4TV8 A;  1YJN V;  3HYZ A;  1JVM A;  3ZN0 A;  1JX9 A;  3ZX6 A;  2LFR A;  4YIP A;  4JI3 O;  1P49 A;  3SJC C;  4UV9 A;  4F6E A;  4DR2 O;  1B04 A;  3B8N A;  2YJX A;  3JAT A;  4ASB A;  2O57 A;  1UJW B;  1DF4 A;  3P3P A;  5IYC O;  1I7F A;  2YE5 A;  2YKI A;  2ZKO A;  3OW2 U;  5KHJ A;  1V54 B;  3BHP A;  1XMO O;  2OWO A;  4OPA A;  4ICG A;  4CE2 A;  1FYJ A;  5JVD B;  1BHA A;  2CUG A;  4FLY A;  4X64 B;  3TTZ A;  2A0L A;  1HNW B;  4AWP A;  3U67 A;  2FYU H;  4EEH A;  3CRQ A;  1YXB A;  1XNR O;  1AM1 A;  4O2A A;  4DV2 B;  1VQP V;  3ABM B;  3CCQ V;  4YJ2 B;  4PD4 F;  5J2T A;  4Z1M G;  3K59 A;  4XC0 A;  2YKC A;  1PP9 H;  4LWS B;  3ZKD A;  4H44 B;  4CS3 A;  4JI2 B;  4K4O A;  3SPJ A;  3K79 A;  4O05 A;  3D3Q A;  2YC0 A;  4B3S B;  1W59 A;  4MPC A;  3CCE V;  4DRX A;  2RN9 A;  3VAD A;  2XTA A;  3G6B A;  4MP7 A;  3VQX A;  2WEP A;  2YS8 A;  5L3C A;  2IOP A;  3L9D A;  4IHJ B;  4LP8 A;  3ZHR A;  1FKA O;  4I4T B;  3MDS A;  3R91 A;  1YSZ A;  5LP6 A;  3N2K A;  1M90 W;  2BSK B;  1I94 B;  5FL7 G;  1V55 C;  4LF5 O;  2UXB B;  4YKT A;  4HXW A;  5LGN A;  2HEP A;  2JVD A;  4UCO A;  3B4S A;  3CP1 A;  1RPR A;  4GT8 A;  1OCR B;  3P3N A;  1GJV A;  2F4V O;  1NT2 B;  3HKD B;  4ZIB A;  4E02 A;  4PRX A;  2YIB D;  3CCM V;  1NH2 B;  4RQF A;  4CWO A;  1H2G A;  4GT1 A;  4JYA B;  3S3W A;  1WNS A;  2WI7 A;  3ZXQ A;  2ZCE A;  4UB8 Z;  2BSM A;  2ZXW C;  3UCS C;  5FND A;  2Q8H A;  4XDM A;  3P30 A;  2ZIN A;  3G80 A;  2H55 A;  5D6P A;  3ZCC A;  1LNQ A;  4IYH A;  3L73 H;  1F51 A;  3ABK B;  4JTC B;  4HYO A;  3T4D A;  4HY6 A;  1VF6 A;  1W0K G;  2PUS A;  1VQ4 V;  4BAY A;  2O1U A;  5C93 A;  3HKB A;  2Y0P A;  1I5X A;  2EIJ C;  3GWO A;  1H2K A;  2ZKJ A;  3RVZ A;  5KHH A;  4X1Y A;  2LW1 A;  4U3J B;  2XAG A;  3T1C A;  2CGF A;  4I55 B;  4LF8 B;  1L8D A;  3JAL A;  1KP2 A;  2OTL V;  4NB5 A;  3A0B Z;  2L6L A;  2HJD A;  4MW8 A;  1MMM A;  1PV0 A;  3AG3 C;  3DXR B;  1IUR A;  1UYL A;  3IC9 A;  2A79 B;  2QWQ B;  1BYQ A;  1YSR A;  3OGC C;  5LOV A;  4X8A A;  1K7D A;  4J11 A;  2Z0A A;  1GH6 A;  1Q7Y W;  2DWE C;  3ZMV A;  1KQS U;  1SER A;  2BT0 A;  1I5A A;  2FWZ A;  2IJI A;  2QM7 A;  1S5J A;  3HZ5 A;  2QFO A;  2R9R B;  3N2G A;  4LWF A;  1G6U A;  2LFS A;  4CH5 A;  3LUT B;  2GUZ A;  4UVC A;  1ZTE A;  2Q0O C;  5CA0 A;  2YI5 A;  1Y76 B;  3AK2 A;  3CRM A;  4MBC A;  4PRV A;  1NR1 A;  1XNR B;  4DV1 O;  3OT7 A;  2K1E A;  3CXC U;  4B6C A;  3K0G A;  2CTR A;  3Q4H B;  2E5L B;  4KUM A;  1NU1 H;  1T5E A;  4DXW A;  3FD9 A;  5JEN A;  1KP3 A;  1EFR G;  1W2B U;  5TIS Z;  1AI6 A;  1R62 A;  1Z5B A;  1WB7 A;  3RBZ A;  1Z5V A;  5KUK A;  1FAF A;  5KUM A;  1OZ0 A;  3AG7 A;  3L74 H;  1Y4U A;  3EXA A;  3VHC A;  2DN9 A;  3DGE A;  2AHZ A;  4DUY O;  2XCM A;  3D36 A;  1QR8 A;  1XNQ B;  4JAU A;  4HAM A;  3WFV A;  1EZJ A;  2YEF A;  2ILM A;  2O1V A;  3OTF A;  2ZNI A;  2DYR B;  1PPJ H;  2QM8 A;  2HG1 A;  4LF5 B;  4O4H B;  3M99 B;  4DZY A;  3RLR A;  1VEW A;  1JM6 A;  1BXD A;  1NJI W;  1NTZ H;  2F4V B;  1BE3 H;  1WA8 A;  2G38 A;  1N36 O;  2CE4 A;  2UXC O;  4WUD A;  1JJ2 U;  2Q7H A;  2VWJ A;  2Q8G A;  3VQW A;  2L35 A;  5LP6 C;  2YE6 A;  1KUQ A;  4U93 A;  5EC1 C;  5F2V O;  3CD6 V;  3R4M A;  2XDU A;  1WP8 A;  2ATK C;  4GQT A;  3B2E E;  1LR1 A;  2PF4 E;  2JK5 C;  4MPN A;  5BOD A;  2JJ1 G;  2JEX A;  3CYO A;  2P90 A;  4FLV A;  3JCU Z;  2Q6A A;  4X20 A;  2GBO A;  1N33 O;  4Q20 A;  1Y74 A;  3P32 A;  4W7T A;  3RYH A;  5FLX N;  3O2F A;  2XOK G;  3RVY A;  1FFX B;  4HNA A;  3E22 A;  4FLT A;  1P84 F;  1CP9 A;  5C8Y A;  5CTX A;  1NHI A;  3WG7 B;  2IWU A;  3CHX A;  3NR7 A;  3CCS V;  1OV9 A;  1GRJ A;  3L75 H;  4D7T A;  2FYP A;  2LQT A;  4NKG B;  3AG1 C;  3T1Y O;  4H13 B;  1X59 A;  3KCY A;  4HXZ A;  3OUS A;  4NTY A;  1VF6 C;  4FCP A;  2A9H A;  4Q6G A;  4YJ3 A;  3ZRV A;  2EIM B;  3CXH F;  3ABL B;  3UT5 A;  5IJ9 A;  3BCC H;  4DR4 O;  1YSC A;  1Q43 A;  5IJ0 A;  4O09 A;  3KZI Z;  3K03 A;  5H6R A;  3CRC A;  4RUE A;  3ZRW A;  2QG2 A;  4QPK A;  3ZED A;  2CH7 B;  2QWR B;  3TXS A;  2NNU A;  2ZIM A;  3SPI A;  3HB3 B;  4MT8 A;  4JI6 O;  4JPR A;  2KSD A;  5CA1 A;  2EIN C;  3NXS A;  4FM2 A;  1KIJ A;  4TT3 G;  5ITZ B;  3CWV A;  3OWD A;  3ZHQ A;  3OEE G;  3K5L A;  2YE7 A;  4XBF A;  1JFF A;  4JI8 O;  2IU3 A;  3BY6 A;  1VQO V;  5D7R A;  1RP3 B;  3O0I A;  1NVP B;  3B77 A;  2YEV B;  2Q67 A;  4ZOL B;  4DV1 B;  1HR0 O;  3H1J H;  1Z5W A;  3AG2 B;  2BRC A;  1ZLZ A;  3C3S A;  2XAQ A;  2VCJ A;  4NYK A;  2Q7G A;  4WUC A;  1BT8 A;  2YID A;  3GIG B;  2WLM A;  2JJ2 G;  1MU5 A;  2F93 B;  2BTQ A;  1XIL A;  4X1I B;  4LWG A;  4UVB A;  1Q81 W;  2AHY A;  4LWE A;  5L3F A;  3LMM A;  5H5N A;  4J41 A;  5H2F Z;  1QZR A;  1M57 C;  2EXL A;  3UO3 A;  1XHZ A;  2D2C B;  2UU9 O;  3CYG A;  1J5E O;  4CE3 A;  4DUY B;  3JSN A;  4KFM A;  5IT9 N;  1Z59 A;  1GN6 A;  1K4D C;  4CH3 A;  1VF7 A;  3R4O A;  3CE2 A;  2AW9 A;  5EZY B;  4UFZ A;  2YEC A;  4NTX A;  2N04 A;  4GZR B;  1H2S B;  5KX5 A;  1NR7 A;  2LGW A;  3QVN A;  4YKR A;  3D36 C;  3OFN G;  3J80 N;  5CTW A;  2B9Z A;  1N36 B;  3VOU A;  1M56 C;  4X1K B;  1XI1 A;  3LPS A;  1A32 A;  2V1D A;  3B8M A;  4I50 B;  1K34 A; 
#chains in the Genus database with same CATH homology
 1F23 A;  1ARO P;  4RUF A;  3CRL A;  4L93 A;  4JGS A;  1Q86 W;  1VQ8 V;  2YGE A;  4GX2 A;  5M4K A;  3E2E A;  1NBM G;  1Z5C A;  4URL A;  2NLJ C;  2XK2 A;  4JQL A;  2V7Q G;  2UXN A;  1CEZ A;  4HY1 A;  2BU7 A;  2HKJ A;  1GKF A;  3SPH A;  3FB5 C;  3E8H A;  1S3J A;  1SRY A;  4XIP A;  4BQG A;  4MVR A;  5B1A C;  1XL6 A;  4X88 A;  1UYE A;  2ZDY A;  2OT5 A;  5H6Q A;  4WFE A;  1JCH A;  4URO A;  2YKJ A;  3ASN B;  2HFE C;  3B27 A;  1B6Q A;  3E35 A;  5IN9 A;  1QLE C;  2EZP A;  2X6B A;  1VQ5 V;  4PA7 A;  5D7C A;  1N8R W;  4UVA A;  5B1B B;  1KC8 W;  1NKD A;  3EFF K;  5GW7 A;  2ZBK B;  3E8B A;  4N21 A;  2HKO A;  4H85 A;  1FXV A;  2EBO A;  3FT8 A;  1VQN V;  3ZRX A;  1VQ7 V;  3CCR V;  3BMY A;  4MPE A;  1NHJ A;  2ZD9 A;  1DLB A;  2ESA A;  4L87 A;  5CBH A;  2BYI A;  2IWX A;  1S5H C;  1Y8P A;  3Q5L A;  1S72 V;  4XCL A;  2IOR A;  3ZM7 A;  3CCV V;  2VW5 A;  4XKO A;  4CWF A;  3CPW U;  3OMA B;  3B24 A;  5B1N A;  3X2Q C;  2BYH A;  3A0T A;  4O04 A;  1KKD A;  4P9O A;  4QE9 A;  1OCC C;  2Y69 B;  2YE4 A;  4HYP A;  3ETG A;  2CH4 A;  2FTK A;  1M1K W;  2WI5 A;  1NQT A;  2OCC B;  4G27 B;  2XDK A;  2EZO A;  3CGY A;  3ABU A;  2O1W A;  3INX A;  4LBE C;  1UYI A;  2BU5 A;  4L8Z A;  1E1R G;  4KFG A;  1U2O A;  4L94 A;  3W7T A;  4AWO A;  1K9M W;  1ROP A;  2HR3 A;  1KEC A;  3LSS A;  3GB7 C;  1OCO B;  2W6J G;  5EC2 C;  1V55 B;  3H80 A;  4KSG A;  2YEH A;  3K08 A;  3MHS C;  4NH8 A;  1DF5 A;  1AI5 A;  1S76 D;  4PEL A;  2XJJ A;  3EHB B;  1PNL A;  4R7C A;  1SET A;  3NMQ A;  2IU0 A;  2H94 A;  1VQK V;  3C11 A;  1YC4 A;  3FB6 C;  3ZMZ A;  1M9N A;  4P8O A;  5B3S B;  3G6E V;  3EHF A;  2JJC A;  3T2M A;  3B28 A;  1ORQ C;  1V54 C;  3LDC A;  2PI5 A;  1QVF U;  2H8M A;  2QG0 A;  2AKP A;  4GEE A;  1QLN A;  1U0Z A;  3HYY A;  2B5U A;  4EFU A;  5BZB A;  3ABM C;  1S14 A;  2DYS B;  3H4L A;  3ZMT A;  1L0O A;  3OR6 C;  2EIK B;  1R3J C;  3OWB A;  2WI4 A;  1UY8 A;  4X89 A;  3SYQ A;  1YIJ V;  3Q5J A;  5H9C A;  4BIU A;  4RO2 A;  1G8M A;  4XD8 A;  3CCJ V;  1UY7 A;  3LSQ A;  1YET A;  4N23 A;  5L3D A;  3CCL V;  3OMI B;  1UYM A;  4TWK A;  4LCU C;  2K5B A;  4DO2 A;  4H37 A;  5HFL A;  1OCR C;  3HPL C;  5LBQ A;  2CCU A;  2XHX A;  1F4N A;  5CMU A;  2QF6 A;  1K5S A;  3OPD A;  3UKM A;  1GO3 F;  3JZ3 A;  3SL2 A;  2YJW A;  4CWS A;  1AMW A;  4YKQ A;  3FT5 A;  3SJQ C;  2XHR A;  1PKX A;  3RW0 A;  3ABK C;  3RLQ A;  4XKK A;  3TZ2 A;  2DWD C;  2WWW A;  4P2Z A;  3PEJ A;  4EGH A;  1QVG U;  3ML0 A;  2HVJ C;  2P67 A;  3G7E A;  1AJQ A;  3E8G A;  1UY6 A;  4XDK A;  1GTO A;  3KE6 A;  2ITC C;  4YKX A;  3QNE A;  5EBL C;  4ASG A;  2CG9 A;  3W7W A;  5GGZ A;  3W7S A;  5M4H A;  2IJJ A;  1KD1 W;  1JOY A;  1TBW A;  2WI2 A;  2YEV A;  3F7Y C;  1I5B A;  5CTU A;  3TCU A;  4XIT A;  4PDM A;  3G7B A;  3CC7 V;  3LDE A;  2IOQ A;  4E00 A;  3GIG A;  2X6C A;  1J95 A;  4FIP C;  1YHQ V;  2IJK A;  1QCE A;  1K8A W;  1H8H G;  4BAE A;  4HZ3 A;  1YT0 A;  2GSM B;  3ASO B;  3MNR P;  4GCZ A;  1COW G;  4URN A;  3R4P A;  2YEB A;  5D6Q A;  2B1I A;  2WLJ A;  5FNC A;  3ZIA G;  1FXK B;  2HG5 C;  1GM8 A;  4H33 A;  3DTU B;  2BRE A;  4F4L A;  1YT2 A;  4BQJ A;  1OSF A;  5FNF A;  2EIN B;  5IY5 C;  3AEI A;  3QO5 A;  3G71 V;  3GIE A;  3SYC A;  1P7B A;  3RKZ A;  2EJR A;  4KQV A;  1RPO A;  3VHA A;  4CE1 A;  2YED A;  5EK0 A;  5IYB O;  4CBC A;  3D0B A;  4QPJ A;  1I5D A;  1UYG A;  3A0Y A;  1UYH A;  3PEH A;  1YS3 A;  5DM6 V;  3ZXO A;  2EIL B;  1K97 A;  2YE3 A;  2JKI A;  4FCR A;  3JYC A;  4GGL A;  3FB7 C;  1YER A;  1YES A;  2BU8 A;  1VQL V;  1UYD A;  3FB8 C;  2CCS A;  1I5Y A;  3WG7 C;  2GQP A;  3EKO A;  3OUF A;  1MG1 A;  3E8F A;  1CPY A;  4EM7 A;  2Z5U A;  1BKN A;  2XDS A;  4L91 A;  2PI4 A;  2EIM C;  3ABL C;  2WER A;  4YXW G;  4NH9 A;  4XDJ A;  4UXN A;  1UYC A;  2PNR A;  4FPP A;  4MP2 A;  5BOC A;  2WLK A;  4I5S A;  5IYD O;  1S0V A;  4I9W A;  2WEQ A;  4MW3 A;  4XIQ A;  1Y4S A;  3HZ1 A;  3EHJ A;  2HJF C;  2Q2E B;  2QKS A;  2P7T C;  3AG2 C;  3K06 A;  4HYM A;  5M4P A;  2X0L A;  1NHH A;  4MVS A;  3QTF A;  4CZZ A;  2JEU A;  4BXI A;  1OCZ B;  3CCU V;  1TIL A;  3K98 A;  4GX5 A;  4HZ5 A;  4ASF A;  4O0B A;  4V25 A;  4R6Z A;  3OR7 C;  5J71 A;  4EMV A;  4J9Z B;  4R1F A;  1TUE B;  4ZKI A;  1ZXN A;  4H81 A;  3O6O A;  4JYB A;  4WFG A;  4E01 A;  4PDV A;  2X7R B;  4EKW A;  4WFF A;  2DQ3 A;  3R92 A;  4WCE V;  4BIZ A;  3AG4 B;  1YC1 A;  3U2D A;  1S77 D;  3ZN1 A;  4LPB A;  2YEJ A;  3D2R A;  3ETD A;  4HZ0 A;  3SYO A;  4MVZ A;  2XX2 A;  2XAF A;  1FS0 G;  1RM1 C;  2BU6 A;  1B3Q A;  4YKZ A;  1R3K C;  1AI4 A;  2YE2 A;  1PL0 A;  2JDI G;  4DUH A;  3HHU A;  3TZ5 A;  3TK1 A;  4P9P A;  1W0J G;  2XAS A;  2R9I A;  4FK5 C;  3B25 A;  4I3H A;  3T1K A;  4WFB V;  4PL9 A;  2WLL B;  2DQ0 A;  3D3I A;  3W7X A;  5DN6 G;  4YKW A;  4O07 A;  4MOT A;  3TET A;  1WPX A;  5IDJ A;  3ZKB A;  4JTD B;  4U7N A;  2IWS A;  4P7A A;  3K99 A;  4R3M A;  5B1B C;  1K3E A;  3JD0 A;  5L3J A;  1Z5A A;  3OAA G;  1Y8N A;  2UWD A;  2BTZ A;  2ZR2 A;  4WFH A;  2E0A A;  4KSH A;  3T2S A;  1HWY A;  1XL4 A;  3IGA C;  4EGI A;  4PU9 A;  2FXS A;  1ZXM A;  2CCT A;  5LGT A;  3SPG A;  4MTF A;  5LHG A;  3EHH A;  4JYC A;  1FFT B;  5CPH A;  2ITD C;  2YEI A;  1K4C C;  1QBZ A;  1E1Q G;  4U7O A;  3W7U A;  2WLH A;  4GX0 A;  1ENV A;  4TSF G;  5KA5 A;  3WQ9 A;  1GKZ A;  3LNM B;  4MTG A;  2WLN A;  4QE7 A;  1K92 A;  2YK2 A;  3ZRS A;  1B62 A;  2YKE A;  4G2K A;  3UM7 A;  1QY8 A;  2XJG A;  2Y69 C;  2BU2 A;  1AJP A;  2LP7 A;  1F4M A;  2WLI B;  1YJW V;  1K5Q A;  3CC2 V;  3HEK A;  5CTY A;  2Y48 A;  4XKA A;  1P4R A;  2OCC C;  4MSW C;  1MSW D;  3K97 A;  3QO8 A;  4EFT A;  2W0F C;  2ZXW B;  5HFM A;  3C0E A;  4URM A;  3OMN B;  1AR1 B;  1GKX A;  5M4N A;  4CWT A;  2XDL A;  4MVO A;  2WI1 A;  2YKB A;  2ZQM A;  5EBM C;  5CBF A;  3T4Z A;  1AJ6 A;  2EIJ B;  1UY9 A;  4MVQ A;  2IH3 C;  4ASA A;  1AH8 A;  2YI6 A;  3QDD A;  1YT1 A;  3ZMS A;  2ZR3 A;  1BGQ A;  1OCO C;  1MAB G;  2XND G;  1H7S A;  3AG3 B;  5B1O A;  4MVM A;  2YEE A;  4KTN A;  4WF9 V;  3A0Z A;  2BOC C;  4BW5 A;  2DW4 A;  4FJC C;  2XX5 A;  4GX1 A;  5B3S C;  4JAV A;  3GIF A;  4J9Y B;  4XTJ A;  3STL C;  5E1A C;  1Y66 A;  4LP0 A;  5L3B A;  4MS2 A;  4AS9 A;  2IW5 A;  4XIR A;  1MX0 A;  2Z3Y A;  2DYS C;  4XDL A;  1FXK A;  3SYP A;  1GM7 A;  2H8P C;  2EIK C;  2WI6 A;  2XHT A;  1AH6 A;  1UYF A;  1SZT A;  3INW A;  3OW6 A;  2F43 G;  2YSU B;  3CRK A;  3KG2 A;  1AI7 A;  4G28 B;  3CMA V;  2Q8F A;  2JIZ G;  4CWP A;  4R8C A;  1Y8O A;  1H38 A;  5LHH A;  1R3I C;  1BHB A;  1EBO A;  4PA3 A;  4FMT A;  4LC1 A;  2UXX A;  3CME V;  4P30 A;  5M4M A;  1K33 A;  3TUH A;  1H8E G;  3CGZ A;  1DTO A;  3R4N A;  2XDX A;  2YGF A;  1MOF A;  2HCH A;  1I59 A;  2XJX A;  3ABT A;  4WFA V;  3MD0 A;  5EBW C;  3RLP A;  1R3L C;  3JD4 A;  5F5R A;  3FV5 A;  4KP4 A;  1EI1 A;  3FKS G;  1GMG A;  3IED A;  3JD2 A;  4XCJ A;  2QTO A;  2W6I G;  5IY5 B;  5M4E A;  2VWC A;  3AG1 B;  3SYA A;  2GFD A;  4PDL A;  2GHY A;  5J6A A;  1R73 A;  3LDD A;  2QA4 V;  1S16 A;  2YE9 A;  2WSS G;  2XD6 A;  4RAI A;  3OM3 B;  4GFN A;  2DYR C;  1L1F A;  1YI2 V;  2ZDI A;  1GM9 A;  2ZDX A;  3PJS K;  4L90 A;  1I5C A;  3H01 A;  1B63 A;  1FXH A;  2WPD G;  3G75 A;  3QO7 A;  3TZ4 A;  1TC0 A;  1E79 G;  2Q69 A;  4PA6 A;  3B26 A;  2HLD G;  1YTF B;  3VHD A;  4CWQ A;  1H7U A;  2OTJ V;  3JD1 A;  3ASO C;  3LNU A;  4UV8 A;  5D7D A;  3BM9 A;  2YI7 A;  5CA3 A;  2Q8I A;  4JTA B;  4RQE A;  4E2L A;  2XAJ A;  3G4S V;  2QEX V;  1THN A;  3T10 A;  1FXK C;  1M57 B;  2MK3 A;  4JF3 A;  2VCI A;  2YEG A;  1WLE A;  4WUB A;  5L3G A;  4LWH A;  1TC6 A;  1ZW9 A;  1QR9 A;  1QYE A;  2QE7 G;  3I55 V;  4ASU G;  3ETE A;  5F3K A;  3ZJZ A;  1K73 W;  1NH2 D;  1VQ9 V;  2B1G A;  2C2A A;  4UUJ C;  2M7W A;  1M56 B;  4NH7 A;  4ZVI A;  3STZ C;  1THZ A;  4MVU A;  4AWQ A;  2KB1 A;  1YC3 A;  1ZWI C;  3JD3 A;  2EIL C;  4MTX A;  2BZ5 A;  3CC4 V;  2X6A A;  3EKR A;  4MB9 A;  3F5W C;  2WLL A;  1R6K A;  3I56 V;  3FYI B;  4B7P A;  1G4Y B;  3SPC A;  5B1A B;  1YJ9 V;  3VBB A;  3A0R A;  4FCQ A;  2Q68 A;  5LGU A;  3K9A A;  3K04 A;  2XAB A;  2YE8 A;  1YIT V;  2FWY A;  5LHI A;  1KZN A;  3U2K A;  1JQ0 A;  3A0X A;  4PDR A;  2YI0 A;  4CWR A;  1QLE B;  4QNH B;  1RM1 B;  4YKU A;  4PA9 A;  3ZRW B;  4R50 A;  5CF0 A;  3JCZ A;  3A0W A;  3ZMU A;  5J9P C;  5FWK A;  3OEH G;  4OXS A;  3F7V C;  4XE2 A;  2ZDI C;  4EGK A;  1EA6 A;  1R6N A;  3Q5K A;  1OCZ C;  2CK3 G;  4R3A A;  1BL8 A;  2BOB C;  3K60 A;  4JAS A;  3E83 A;  1VQ6 V;  3K3W A;  1PD3 A;  3K0D A;  2HVK C;  5L3E A;  3R65 A;  4X9L A;  2YK9 A;  3BEH A;  4MTO A;  3IFX A;  4QJF B;  1Q82 W;  1A4H A;  1I58 A;  3E86 A;  1ID0 A;  2D3O W;  4LWI A;  2P6J A;  4QIW F;  2WAM A;  2WLI A;  1IXM A;  3AG4 C;  4ZBM A;  2IH1 C;  3X2Q B;  3ASN C;  2XAH A;  3TZ0 A;  3EHG A;  4YKY A;  5CN0 A;  3T0H A;  3WHA A;  1PNK A;  3E89 A;  1OCC B;  1PNM A;  4PA4 A;  3IC7 A;  1YTF D;  1TH8 A;  5CBG A;  4CWN A;  1GK9 A;  4H7Q A;  1PVG A;  1VQM V;  2YGA A;  1Y4M A;  2YEA A;  4V26 A;  1TID A;  5KA6 A;  1US7 A;  1AJN A;  3MHH C;  5IDM A;  1SES A;  2WI3 A;  3T0Z A;  3FYE B;  1UYK A;  2XX4 A;  3OE7 G;  1ZWH A;  1OHH G;  1NVP D;  1JPX A;  1BMF G;  3OMU A;  2IJH A;  1YJN V;  3HYZ A;  1JVM A;  3ZN0 A;  1JX9 A;  2LFR A;  4UV9 A;  3B8N A;  2YJX A;  4ASB A;  1UJW B;  1DF4 A;  5IYC O;  2YKI A;  2YE5 A;  3OW2 U;  1V54 B;  4CE2 A;  1BHA A;  3TTZ A;  2A0L A;  4AWP A;  3U67 A;  4EEH A;  1AM1 A;  1VQP V;  3ABM B;  3CCQ V;  4Z1M G;  4XC0 A;  2YKC A;  3ZKD A;  4K4O A;  3SPJ A;  3K79 A;  4O05 A;  4MPC A;  3CCE V;  3VAD A;  4MP7 A;  2WEP A;  5L3C A;  2IOP A;  4LP8 A;  3R91 A;  1YSZ A;  1M90 W;  5FL7 G;  1V55 C;  4YKT A;  4HXW A;  5LGN A;  3CP1 A;  1RPR A;  4GT8 A;  1OCR B;  1GJV A;  4E02 A;  4PRX A;  3CCM V;  1NH2 B;  4RQF A;  4CWO A;  1H2G A;  4GT1 A;  2WI7 A;  3ZXQ A;  2BSM A;  2ZXW C;  5FND A;  2Q8H A;  4XDM A;  3P30 A;  2H55 A;  5D6P A;  3ZCC A;  1LNQ A;  1F51 A;  3ABK B;  4JTC B;  4HYO A;  3T4D A;  4HY6 A;  1W0K G;  1VQ4 V;  4BAY A;  2O1U A;  5C93 A;  1I5X A;  2EIJ C;  3GWO A;  2ZKJ A;  3RVZ A;  2XAG A;  3T1C A;  2CGF A;  1KP2 A;  2OTL V;  4MW8 A;  3AG3 C;  1UYL A;  2A79 B;  1BYQ A;  1YSR A;  3OGC C;  4X8A A;  1K7D A;  1Q7Y W;  2DWE C;  3ZMV A;  1KQS U;  1SER A;  2BT0 A;  1I5A A;  2FWZ A;  2IJI A;  2QM7 A;  3HZ5 A;  2QFO A;  2R9R B;  4LWF A;  2LFS A;  3LUT B;  4UVC A;  2YI5 A;  4MBC A;  4PRV A;  1NR1 A;  3CXC U;  2K1E A;  4B6C A;  3K0G A;  4KUM A;  4DXW A;  1KP3 A;  1EFR G;  1W2B U;  1AI6 A;  1R62 A;  1Z5B A;  3RBZ A;  5KUK A;  5KUM A;  1OZ0 A;  1Y4U A;  3VHC A;  3DGE A;  2AHZ A;  2XCM A;  3D36 A;  1QR8 A;  4JAU A;  4HAM A;  3WFV A;  1EZJ A;  2YEF A;  2O1V A;  2DYR B;  2QM8 A;  2HG1 A;  3M99 B;  4DZY A;  3RLR A;  1JM6 A;  1BXD A;  1NJI W;  4WUD A;  1JJ2 U;  2Q8G A;  2YE6 A;  4U93 A;  5EC1 C;  3CD6 V;  3R4M A;  2XDU A;  2ATK C;  4GQT A;  4MPN A;  5BOD A;  2JK5 C;  2JJ1 G;  2JEX A;  3CYO A;  2P90 A;  2Q6A A;  4Q20 A;  3P32 A;  4W7T A;  3O2F A;  2XOK G;  3RVY A;  1CP9 A;  5CTX A;  1NHI A;  3WG7 B;  2IWU A;  3CCS V;  2FYP A;  3AG1 C;  4HXZ A;  3OUS A;  4FCP A;  2A9H A;  3ZRV A;  2EIM B;  3ABL B;  1YSC A;  4O09 A;  3K03 A;  5H6R A;  4RUE A;  3ZRW A;  2QG2 A;  4QPK A;  2NNU A;  3SPI A;  3HB3 B;  4MT8 A;  4JPR A;  2EIN C;  3NXS A;  1KIJ A;  4TT3 G;  3CWV A;  3OWD A;  3OEE G;  2YE7 A;  4XBF A;  2IU3 A;  3BY6 A;  1VQO V;  5D7R A;  3O0I A;  1NVP B;  3B77 A;  2YEV B;  2Q67 A;  3AG2 B;  2BRC A;  2XAQ A;  2VCJ A;  4WUC A;  3GIG B;  2WLM A;  2JJ2 G;  1MU5 A;  4LWG A;  4UVB A;  1Q81 W;  2AHY A;  4LWE A;  5L3F A;  1QZR A;  1M57 C;  2EXL A;  4CE3 A;  4KFM A;  1Z59 A;  1K4D C;  3R4O A;  2YEC A;  1NR7 A;  4YKR A;  3OFN G;  5CTW A;  3VOU A;  1M56 C;  3LPS A;  2V1D A;  3B8M A;  1K34 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...