5C93A

Histidine kinase with atp
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
239
structure length
235
Chain Sequence
VTEQQKIDNDRKQFVSNVSHELRTPLTSLRSYIEALSDGAWKDPEVAPGFLKVTQEETDRMIRMINELLSLSRMDSGTTRVDMELVNINEMFNYVLDRFDMILKKDDNPAKYYTIKREFTKRDLWVEIDTDKFTQVLDNIMNNAIKYSPDGGVVTCRLLETHNQVIISISDQGLGIPRADLGHVFDRFFRVDKAQGGTGLGLAISKEVVQMLGGRIWVDSVEGKGSTFYISLPYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Conformational dynamics of the essential sensor histidine kinase WalK.
pubmed doi rcsb
source organism Lactobacillus plantarum 16
molecule tags Transferase
molecule keywords Histidine kinase
total genus 82
structure length 235
sequence length 239
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2015-06-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5c93A01
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 5c93A02
4WUBA 2QFOA 1US7A 3EHJA 3INXA 5L3JA 2ZDXA 2YJXA 3RLRA 4QPJA 4H81A 4L90A 2YECA 3HHUA 3PEHA 4NH7A 4EEHA 3A0TA 1UY9A 2FTKA 3B27A 1PVGA 1EI1A 1YESA 2YEDA 5BODA 1I5DA 4GCZA 5CF0A 4YKTA 1QZRA 4EGIA 1NHHA 1ZW9A 2YGEA 5FNDA 2VCJA 3EKRA 1AJ6A 3WHAA 4ZKIA 3CGZA 1I5AA 3IEDA 4XIPA 1ZWHA 3JZ3A 2XK2A 4R3MA 3T0HA 2XDLA 4HZ0A 1U2OA 2O1UA 4NH9A 2XABA 3OWDA 3U2KA 4V25A 2YE6A 2YK2A 3K97A 4CWNA 2BU8A 4LWEA 4GT1A 3B26A 2XHTA 1I5BA 4YKXA 4LWIA 4EGHA 5M4PA 2YGAA 1UYGA 2IWUA 2FXSA 2VCIA 4W7TA 1U0ZA 2PNRA 4JAVA 4XIRA 3R4MA 3K60A 1Z59A 2P67A 4PRXA 2YEJA 1Z5AA 1Y8OA 2ZBKB 3FV5A 1ID0A 4LWGA 4XTJA 4EGKA 4O09A 2Q8FA 3LNUA 5D7CA 3ZRWB 4O0BA 3TZ2A 2YEGA 3QTFA 1UY8A 4URLA 4GFNA 4LWFA 3O6OA 2YK9A 1JOYA 2BT0A 1I5CA 2YKIA 3R91A 2YEBA 4GT8A 1H7UA 1B62A 3TTZA 2Q8IA 4XC0A 4PU9A 4AWOA 1YS3A 1YT1A 4L94A 2XX2A 1GKZA 1I59A 1YC4A 2BYHA 2CG9A 2CCSA 2HKJA 3RKZA 2XJJA 4E00A 3TZ5A 2YI0A 2VW5A 1AMWA 4LWHA 1JM6A 2VWCA 4HYMA 3ZXOA 4MTXA 3ZRXA 4MP2A 2IOQA 4XCJA 3ZCCA 2H55A 4UROA 1TC0A 3LPSA 4XKAA 4HY6A 1TC6A 4GGLA 4V26A 5J6AA 4LPBA 2QM7A 1YETA 1YC1A 3T10A 2BU6A 4HXZA 1UY7A 4O07A 3T0ZA 4HXWA 1NHJA 1UYFA 2HG1A 1S16A 4HZ5A 4DZYA 4QPKA 3VADA 2WI2A 3D2RA 4L93A 4ASFA 4URMA 2XDUA 2YKCA 4LP0A 4YKWA 2XDXA 3K98A 4YKRA 2YKJA 4MPNA 3P32A 3PEJA 3SL2A 1YT2A 4WUDA 3R4PA 4NH8A 2WI3A 3Q5JA 1QY8A 3Q5LA 5B1OA 4XD8A 2YI7A 4JQLA 3WQ9A 3R92A 3T2SA 4MP7A 5CTWA 4E01A 3G75A 4YKYA 4JAUA 4L8ZA 4XKKA 3ZKBA 2YGFA 4FCRA 4CE1A 4I5SA 4HY1A 4MPEA 2JJCA 4CWSA 1UYKA 4AWPA 2XDKA 3O0IA 4XIQA 2XDSA 5FWKA 4CE2A 2YEHA 1F51A 2YEAA 2BSMA 3GIGB 2IORA 3HYZA 4DUHA 3GIFA 1Y4UA 2FWZA 1UYLA 2ZDYA 3ZRWA 5CTUA 3CGYA 3FT5A 1B3QA 2UWDA 3EKOA 1UYMA 3U2DA 3VHAA 4GEEA 1ZXMA 3NXSA 2WI7A 4XDMA 4MB9A 1BXDA 4JYCA 2XX5A 1UYDA 2CCTA 2CH4A 4FCQA 4K4OA 4AWQA 3H80A 2XX4A 2LFRA 3INWA 2O1VA 3OPDA 2YI6A 3TZ4A 1BYQA 1OSFA 2H8MA 2YKBA 2Q2EB 3VHDA 2C2AA 4EFUA 4L91A 2GFDA 1UYIA 2QF6A 2XJXA 1UYCA 4H7QA 1EA6A 2WEQA 2FYPA 5J71A 2K5BA 4XCLA 3HEKA 4JYBA 1TILA 2BZ5A 3EHHA 4Q20A 4YKUA 4ZVIA 3FT8A 3D0BA 3A0YA 2WI6A 5GGZA 4PRVA 3ZM7A 1GJVA 4P7AA 2WI4A 4AS9A 1YT0A 4WUCA 4U7OA 4B6CA 4BQJA 5IDJA 4MT8A 2IWXA 2XHRA 3A0WA 4ASGA 4U7NA 2QG2A 2YE8A 2QG0A 4MBCA 5D7DA 4XE2A 4JASA 2JKIA 3A0XA 2Q8GA 1R62A 3CRKA 4HYPA 4KTNA 3B28A 4EFTA 1NHIA 4CWFA 3B24A 3OWBA 1AH8A 5CTXA 2WWWA 2FWYA 4PL9A 3TK1A 1ZXNA 3C0EA 5IDMA 4CWTA 5D7RA 2YJWA 3TUHA 1KIJA 3OW6A 4X9LA 2O1WA 2YE5A 2BU2A 4E02A 1Z5BA 1MX0A 5M4MA 1S14A 4CWRA 1UYEA 4URNA 4YKZA 4GQTA 2BTZA 4EM7A 5M4EA 1TIDA 3R4NA 1AH6A 4R3AA 2YE7A 1BGQA 4XITA 5D6QA 4LC1A 2YE9A 1AM1A 2WERA 5CPHA 2XHXA 3QDDA 3D36A 2XCMA 3G7EA 1BKNA 3RLQA 3T1KA 4BXIA 4H85A 4O05A 3Q5KA 5F3KA 3HZ1A 1H7SA 2BYIA 4KQVA 4BQGA 3CRLA 2AKPA 4CWPA 2Q8HA 3EHFA 2XD6A 5IN9A 3G7BA 4EMVA 2WI1A 4I3HA 1THNA 2ZKJA 2BU7A 2CGFA 3O2FA 4BAEA 4YKQA 3K99A 2YE3A 4P8OA 5BOCA 1Y8PA 3B25A 5M4NA 1MU5A 1YSRA 2LFSA 3C11A 3ZXQA 5C93A 5FNFA 3U67A 3A0RA 4CWOA 3BM9A 1Z5CA 1TH8A 2XJGA 4KSHA 2HCHA 2BU5A 5CTYA 3CWVA 1YSZA 3R4OA 2QM8A 1YC3A 4KFGA 5B1NA 5M4KA 4XKOA 3MNRP 1QYEA 2YEFA 2IWSA 1B63A 3TZ0A 4FPPA 3RLPA 1L0OA 3H4LA 2ESAA 3GIEA 4ASAA 2YI5A 4BIZA 4FCPA 3KE6A 3A0ZA 2YE4A 3OMUA 4MPCA 3ZRVA 1YERA 4BIUA 2YE2A 3HYYA 4MOTA 1TBWA 2WEPA 1I58A 3HZ5A 4CWQA 2WI5A 4ASBA 4KSGA 4B7PA 3ZKDA 5D6PA 2YEIA 5FNCA 2YEEA 3VHCA 3BMYA 2IOPA 4CE3A 3MD0A 3GIGA 2BRCA 1GKXA 1Y8NA 1IXMA 1UY6A 2E0AA 4FMTA 5M4HA 3DGEA 1KZNA 1A4HA 4KP4A 2BREA 3NMQA 4U93A 2EXLA 2YKEA 3EHGA 5F5RA 1Y4SA 2GQPA 2CCUA 1UYHA 4O04A 4R1FA
chains in the Genus database with same CATH superfamily
1BGYH 2QWRB 5ITZA 3ZBHA 4J7KA 1KECA 1P7BA 3K0GA 3RYHB 4DV2B 1G8MA 3RLRA 4QPJA 3HHUA 1SA0A 3QO8A 2BSKA 1TGOA 4EEHA 2ZIMA 1YJ9V 1NI8A 4GX0A 2K9PA 1BQZA 5BODA 3SPIA 1MABG 1QLEB 4GCZA 1HNWB 5KHHA 1NTZH 1SS3A 4PA6A 2ZT9B 1ZW9A 1Q8IA 2YGEA 4XDLA 2VCJA 3WHAA 4E4EA 1I5AA 2QKCA 5E79Z 1HDJA 5H6QA 1ZWHA 2NLJC 4XIPA 2XK2A 3T0HA 4Z2WA 5IJ0A 2O1UA 3ETDA 4TUYA 4NH9A 1FJGO 3OWDA 3U2KA 1GTOA 4I4TB 2ZCEA 2F4VB 4WFGA 4NTXA 4CWNA 3L73H 5B1BB 3STZC 4I55B 1Q6HA 5LXTA 1EZJA 2YGAA 4FZ0A 1JFFB 3OUSA 2FXSA 1M1KW 2VCIA 2Q0OC 5BZBA 4LF9O 4PI0A 2UXNA 4J7JA 2D3OW 4W7TA 2UXXA 4JAVA 4XIRA 4H44B 3GB7C 1Q82W 1Z59A 2QTSA 3A0HZ 5KX5B 1Q81W 2B1IA 4GZRB 4DW1A 1FPOA 4JI3O 4PRXA 2DYRB 2YEJA 4CZZA 4NXMB 5D5PA 3CCRV 3ETQA 1TA8A 1VQ4V 5BR8O 3CRCA 4I0XA 5B1AC 1S5JA 4DV6O 4GYCB 4BR6A 4PD4F 2YEGA 5BY1A 4B7EA 3IC7A 3O6OA 5KHKA 2YEBA 2IBZH 2UXBB 1GAXA 3TTZA 1B62A 2Q8IA 4XC0A 1SZXA 3DC6A 4AWOA 4W4KA 3ETGA 5IE9A 2H3OA 4W4LA 2XX2A 2GUZA 2XAJA 3I5DA 1GKZA 2B1GA 2WLIB 2BCCH 3RWRD 4J9ZB 3SGIA 4EB6A 2BYHA 2CG9A 1QU7A 1BHBA 2H94A 4E72A 4PHZA 1VQNV 4DV4B 2C1IA 4IHJA 4LWHA 5JQGA 3RYCB 2Q9LA 1L8DA 3OUFA 4OX9B 4O4LB 4XCJA 3ZCCA 1IVSA 2H55A 1M57B 1TC0A 3LPSA 4UCVA 2E3CA 5EK0A 5IYZB 5JJEB 1DF4A 3E8BA 1IBLB 1TC6A 5J6AA 4LF7O 2QM7A 4NKGB 3T10A 2L35A 3FYEB 5LP6A 3S5TA 1VF5B 4WCEV 3ABMC 1H2KA 1S16A 1OCCB 1XL4A 4DZYA 1AR5A 1EM1A 3VADA 3CJHA 3T1YB 3D2RA 2WLLA 2PZSA 1OZ0A 1VQ7V 2UUAB 1G1XB 2YKCA 5IJ9A 4YIOA 2EIJB 4H13B 4MPNA 4MVSA 4JV5O 1U97A 3JARA 3SL2A 3R4PA 1M4UA 5FPOA 4X1YB 3Q5LA 4YHHB 3OR7C 4DR3B 3FB8C 1BHAA 2KKWA 2LW1A 3WQ9A 3JASA 4IYHA 3E22A 5CTWA 3G75A 4N21A 4WBNB 4L8ZA 1RSOA 4J80A 3ZKBA 2QSAA 1M90W 4I5SA 4HY1A 2CDYA 1XHZA 1XNRB 4DV1O 4LF5B 1EZVH 4X20B 1QR8A 2NR5A 2ZQMA 2YICA 2XDSA 5FWKA 1HNZB 1AP5A 2ILMA 4JYAO 3F7YC 4UB8Z 4R6ZA 2BSMA 3KG2A 4DUHA 2RN9A 1Y4UA 2RCVA 4ZHQB 2ZDYA 2HG5C 3T4DA 4FIPC 1B3QA 2Y0IA 3SYOA 2KSDA 2DWDC 2UWDA 3ABKC 2ZR2A 4Z1MG 1WP7A 4GEEA 4TUYB 5J9PC 4MTOA 4FCQA 4UCUA 1XDCA 4AQYO 4JTAB 2E76B 2LFRA 4HYOA 2UXCB 2W0FC 1YI2V 3TZ4A 2PI4A 3LNNA 3CSXA 5B1AB 4EFUA 2C2AA 1OV9A 3CRAA 1XI1A 4IYIA 1E1RG 1VF7A 2Q8VA 1B04A 1L0LH 4OPHA 4O4IB 1EA6A 2FYPA 5J71A 5LHHA 3W7UA 4CH6A 4G28B 1N34O 1EBOA 3SPHA 3UQ8A 2K5BA 2BOBC 4XCLA 1H8EG 1K9MW 1TILA 1FAFA 3EHHA 4X9QA 4Q20A 2EIKB 3D36C 2P22C 4LNUB 3Q4HA 2ZKOA 1LUVA 3PJSK 2AZ2A 4DR5O 3DTUB 3E8FA 4TV8A 4AS9A 2F66C 2AW9A 1Y76B 2WLJA 4WUCA 1GN6A 4WBNA 4E2LA 2IWXA 4NVPA 4QNHB 5EBLC 1P4RA 2XASA 5JVDB 2YE8A 4MBCA 1QR9A 3B8NA 2QWOB 4DV7B 3OMNB 2Q8GA 4HYPA 4KHPB 2CH7B 5EZYB 4CWFA 4ZOLA 4BAYA 5CTXA 4DO2A 1NBMG 3TK1A 4CWTA 1VQKV 5D7RA 1NT2B 3TUHA 2NNUA 5CA3A 2OIEA 4X9LA 2O1WA 1H38A 3C3TA 5DEDA 3CCSV 4LH6A 1UYEA 1H2GA 3G71V 1K97A 1XL6A 1FXKA 5LGUA 1AH6A 1VF6C 4HAMA 3G4SV 1TIDA 3R4NA 2AHZA 3CB2A 2A9HA 4HNAB 2BTQA 5D6QA 4DV1B 2YE9A 4CS2A 1MA1A 4FLXA 3QDDA 4DR4O 3RLQA 4IIJA 4LP8A 1AJNA 4O05A 5LA6A 4MVOA 2ZD9A 2EIKC 2PY5A 1IBKB 5F3KA 2BYIA 1XNQB 3Q4HB 2WLLB 1FFTB 2XTAA 2Q8HA 4RWUA 4MS2A 4X8AA 3UM7A 1XREA 3X2QB 3M8AA 2RDCA 2JVDA 4KL1A 4D7SA 5IWAO 3K99A 4BAEA 1SQBH 4UVAA 4K0KB 3T1YO 1V54B 1XMQB 1NU1H 5BMVB 3CC4V 4K8XA 5BOCA 1VQPV 3L71H 3RYIA 3B25A 1R3KC 1MU5A 2HP8A 3SYPA 2LFSA 4X66O 2Q67A 5C93A 5A2QN 5FNFA 2ADPA 5J2TB 3E8HA 5LGNA 3ZEDA 5EBMC 3ZJZA 4MW8A 3ML0A 4DYLA 3CE2A 3CMAV 4Z1VA 1XEQA 5HFMA 1YTFD 1Y76A 1M9NA 2BU5A 3CWVA 1YSZA 1YIJV 4U3FH 1YC3A 1AVMA 4YY3O 4XBFA 4KFGA 5B1NA 4X88A 1AB3A 2YC0A 4XKOA 1FFXA 4LFBO 1KYOF 2GDSA 4FJCC 3K5NA 3BAAA 1JPXA 2XOKG 5JCOA 4X62O 4FPPA 1L0OA 4X1IA 1F7YA 1SETA 1L1FA 3TCUA 4PV1B 4DR7O 4DV0O 3G80A 4O4HA 2HLDG 1J5EO 1IXBA 1SQVH 4TV9B 1P84F 1AI5A 4MPCA 3ZRVA 4BIUA 4I0XB 4MOTA 3B8MA 2QTOA 2R72A 2DW4A 3PN1A 2ZXWB 5CA1B 1I58A 4PDMA 2YIBD 3ABTA 1KD1W 1ORQC 2DYSC 4MVQA 4DV7O 1YCIA 2GTSA 4KHPO 2JEUA 2QGNA 1I94B 4LF4B 3VHCA 3MD0A 3GIGA 4MVZA 4I9QA 1QLEC 1IXMA 1ZTEA 3E83A 4FMTA 5L3EA 2M7WA 1A4HA 5LXTB 4U93A 2EXLA 4DUZO 2VRZA 4U3JA 2Z3YA 3OEEG 5F5RA 4K0KO 2YIAA 1KKCA 4X1KA 2JS5A 3BHPA 1FYJA 3CEIA 2QFOA 4UV9A 4EFEA 3EHJA 3TGUH 3INXA 2PF4E 3AG3B 4L90A 1Z5VA 1JVMA 1QVGU 4DR4B 3OT7A 1UY9A 4IL6Z 1YJWV 1PVGA 5H5NA 1YESA 2CUGA 2YEDA 3SPGA 1M57C 3C90A 1QZRA 4EGIA 1NHHA 2CAZC 3ICXA 5B1BC 2IM9A 3K3WA 3ASOC 3EKRA 4DR3O 4GKJB 3IEDA 2EJRA 3JZ3A 2OTLV 2XDLA 3UKMA 4HZ0A 3CMEV 4V25A 1XILA 4JI7O 3AG7A 1F23A 5J2TA 2JIZG 2PTMA 2EZPA 3A8TA 5IWAB 4DR6B 2E74B 3ZHRA 1SC5B 5LHIA 4FLYA 5M4PA 4JI0B 5GTHZ 3SYCA 3JD4A 5CBHA 4LF6O 3T1HO 4R7CA 5IYDO 4WF9V 3CC2V 3CYGA 1IBMO 4O4IA 4DXWA 2ADQB 2QWQB 3QF7A 2Y0PA 1I5YA 5IYZA 1ZAUA 3QO5A 1MSWD 2QKSA 5CB4A 5LBQA 4OX9O 3K04A 3HKDA 4XTJA 4X62B 4K8ZA 2M6YA 1OCZC 2VQEO 2Q4PA 5JWPA 1E79G 4O0BA 3QTFA 3G6BA 4AHCA 4GFNA 3JCZA 3M7MX 2YK9A 2W6JG 1JOYA 1I5CA 1KC8W 2LO1A 3SYAA 4PU9A 2UUCB 1YEWA 3JSLA 1YS3A 4HNAA 2Q7GA 2QJ1A 2ZXWC 2ZNJA 1I59A 2WA4A 2CCSA 1GM8A 3WG7C 3WB0A 3RKZA 3ZMSA 3CCJV 5H6RA 2YI0A 2VW5A 2FYUH 2EJ7A 3WB1A 4RUEA 3K0DA 1JM6A 3R66A 2P5OA 1CEZA 3KCXA 3RT3C 2IJIA 3QVNA 3L74H 2PUSA 3C3SA 5GTIZ 2FKXA 5LMNO 3P3PA 4HY6A 1SZTA 2YEVB 1JJ2U 4LPBA 5FL7G 2BU6A 4HXZA 2X7RB 3HR0A 2GSMB 3ZMVA 1UYFA 3TXSA 3OGIB 1N33O 1MSDA 1FXHA 2WAMA 4TSFG 1O9HA 4O4JA 5E1AC 4DV0B 2XDUA 4MVUA 2XDXA 3K98A 4YKRA 2HHHB 2YKJA 3PEJA 3BCCH 4WUDA 2YS8A 2IJJA 2QR4A 4NH8A 2WI3A 2G38A 2K1EA 3S3WA 3WG7B 4PELA 3X2QC 3UCSC 4GX2A 1GN4A 4JAAA 3R92A 4YXWG 3ETEA 4JPRA 2UUAO 4JAUA 5KAIZ 3W7SA 5IYBO 3SJBC 1G6UA 3RYCA 3JAKB 2JJCA 2OYQA 1BSMA 5KAFZ 3LDEA 5LMUO 4XIQA 5JJNB 4EEQA 4JI3B 3K79A 2YEAA 2HVKC 1R3LC 4IIJB 4FLUA 2GUZB 3L75H 5KHIA 1XNQO 1RP3B 2E75B 4H33A 4DR1O 1FXKC 3HKEB 3ZRWA 1ZX3A 3QO7A 4DV3B 3SPJA 1YDXA 3CGYA 3FT5A 3MAQA 4DR2O 1K4DC 1PP9H 4CC5A 3EKOA 3SJQC 1UYMA 4TOIA 3F5TA 3VHAA 2KQXA 2WI7A 4XDMA 2LJ2A 3R65A 2YXLA 2XT9A 1UYDA 2RQ6A 2MW2B 4QJFB 1OHHG 3B2EE 2V7QG 1K5SA 1GRJA 3OW2U 2DOSA 4PI2A 2XX4A 1KQSU 4HBNA 2VQEB 3KKYA 4H0LB 1BYQA 1OSFA 1OCZB 2YKBA 2UXDO 2QEXV 4UV8A 1YSCA 2QF6A 2XJXA 1TVKB 1URFA 4ASUG 4O2AA 4H7QA 1I7FA 5JJJB 2R9AA 1CP9A 4JI1B 3WU2Z 4GKKO 4XDKA 2LP7A 1LR1A 3H01A 3ABLC 2UXDB 3BVOA 1WNSA 5BMVA 3O9OA 2RNBA 3RYFA 1CPYA 2IW5A 1H2SB 2BTOA 1H2MA 4KFMA 4YKUA 4ZVIA 4B3SO 3A0YA 1SRYA 4PRVA 5BR8B 3ZM7A 1GJVA 4P7AA 1YTFB 5DN6G 3AG4B 4J7ZA 1J5EB 3JASB 5B66Z 2F93B 1SKVA 5JVDA 2YDEA 4FLWA 5K1PA 4B6CA 5IDJA 2B5UA 3A0WA 5LA6B 3JATB 1IBLO 3ASNB 2QG2A 2FB5A 3CP1A 4JZ2A 5D7DA 4JASA 3LMMA 2XUMA 3T4ZA 1Y66A 4EFTA 1K5QA 2WWWA 1R6KA 1TUBA 5JQGB 1ZXNA 1DTOA 3C0EA 3MHHC 1Y6XA 4D7TA 4BWAA 3OW6A 3ABMB 4QE7A 4JI6B 2XNDG 2BU2A 2YE5A 2GHYA 1Z5BA 1MX0A 4URNA 4YKZA 1EN6A 4GQTA 2BTZA 1FKAO 4R3AA 2YE7A 2P7TC 3U11A 4ZBMA 3AEIA 3CHXA 2QM4A 5CPHA 2XCMA 1BKNA 3OEHG 4DW0A 3OM3B 3BEHA 4H85A 2Q0AA 2IJHA 1M93A 1SQGA 2Y69B 4XDJA 5L3CA 3OTFA 3E89A 5H9CA 4JYAB 4UXNA 3VOUA 3G7BA 4EMVA 3J80N 3DXRB 1Q3EA 3CCEV 1OCOC 3DC5A 3SJCC 2X6CA 3UT5A 1BCCH 1Y4MA 4LF9B 2UUBO 5KMGB 4O4JB 3W7XA 4Q6GA 5IY5B 1JA8A 2JGDA 2A06H 4CWOA 4DV4O 3UO2A 1S0VA 2DQ3A 1TAEA 2PGGA 2DYRC 2XJGA 1PKXA 4K35A 1KMIZ 1KKDA 2ARHA 2QM8A 5IJ0B 1AROP 3K5OA 3RFRA 2P90A 5M4KA 2YIDA 1SQFA 3TZ0A 4KXRA 4LBEC 5EBWC 3H4LA 3N2KA 3ZHUA 3HPLC 3GIEA 4FFBA 4JI5O 3KE6A 2DJVA 1MOFA 2HVJC 2YE4A 3DSQA 4BW9A 1SA0B 4A5UB 1KP2A 3IGAC 5L3DA 3LSUA 4I9WA 1WPXA 3HZ5A 5LP6B 1KBHA 2WI5A 5C8YA 1X4TA 3G67A 1GN3A 1PV0A 2IOPA 2EIMC 1Y74B 5IY5C 4MVRA 3G6EV 2BRCA 2VQFB 3THOA 3EHBB 2F23A 3E8GA 1GKXA 1Y8NA 2E0AA 5M4HA 2QA4V 1R3JC 4KP4A 3NMQA 4HZ3A 3HKCB 4LWSB 1JR9A 1VP7A 1NVPD 2Q6AA 3D3IA 1N32B 1Y4SA 3JD0A 3SDLA 5AG2A 2GQPA 1UYHA 4O04A 3FFQA 1YHQV 4GKKB 1US7A 4UCSA 4O4HB 5L3JA 2ZDXA 2Q7EA 3B4SA 3OAAG 4H81A 1SQXH 2YECA 4NH7A 3A0TA 3F7VC 1EI1A 1ZWIC 4DR5B 2ZE6A 1RPRA 3MHSC 2HR3A 2ETNA 1MZFA 4JF3A 5CF0A 1QLNA 2JGDB 1B06A 1XMOO 4NB5A 2AXTZ 1UPGA 1V55C 1AR4A 1B6QA 3CCQV 3ASNC 1JJOA 3OMAB 1U2OA 2JJ2G 2XABA 1Q7YW 3JAWB 5JH7A 3A0BZ 1FD9A 1Q86W 1OJHA 3K97A 1OCRC 4GT1A 2ZE8A 4LF8B 1PPJH 4B3MB 3H1KH 4LWIA 3ZN0A 4JI8B 3SJAC 3B77A 5D5QA 1DK1A 1UYGA 4DR1B 2DMXA 4EB6B 1HR0O 4I55A 1U0ZA 2PNRA 2ZR3A 1HNXO 3K60A 4OXSA 4ZI7B 3K5LA 4DUYO 4DK1A 3HKDB 2P67A 3RVYA 2GTAA 4DV5O 3RN4A 3BA9A 4J9YB 3GWKC 1Z5AA 2F43G 4WFEA 4EGKA 4O09A 1PL0A 1RPOA 3LNUA 1D2DA 4PDLA 5D7CA 2UXCO 1KUQA 1K3EA 4DV2O 3HKEA 4NTYA 3ZRWB 3CPWU 5KUMA 1UY8A 2N04A 2YKIA 2P6JA 3TXQA 4NXNO 2Z0AA 3CRRA 4PJ0Z 1BE3H 3CCVV 2WPDG 1FFXB 1H7UA 1YITV 4MTGA 1XNRO 4JI1O 1YT1A 4P9OA 4L94A 1ROPA 4ICGA 3J81N 3JCUZ 2F95B 3JATA 1Z2GA 3LSSA 1XQ8A 2A3QA 3CD6V 4UCTA 5BXZA 4TV9A 2XJJA 1N8RW 3CWBH 3HKCA 4P30A 3TZ5A 4R50A 4JI4B 2AGAA 1AMWA 2E5LB 3TJTA 2JDIG 2XAQA 3UT5B 4HYMA 3ZXOA 1VQ9V 3ZRXA 2PYJA 1JX9A 2IOQA 4R8CA 2CTPA 4XKAA 5JCOC 2LQTA 2AHYA 4B3SB 4AI8A 2YI8A 4JYYA 4NR1A 4V26A 4ZOLB 1YETA 5IT9N 1YC1A 4RO2A 1I08A 1QCEA 4O07A 3OD4A 4AQYB 2HG1A 2X6BA 4HZ5A 2B9ZA 4QPKA 4X1KB 3P3NA 1XMOB 2WI2A 4JI5B 4ASFA 4URMA 5CBGA 4NYKA 4FK5C 3RYHA 3CX5F 2WA3A 1YT2A 4B3TO 2OCHA 3Q5JA 2N74A 1MZEA 5B1OA 3SR2C 4XD8A 4J10A 2YI7A 4JQLA 3W7TA 1LNQA 3GVMA 3IC9A 3ZHVA 1ZL8A 3T2SA 4ZIBA 5CA0A 4MP7A 4E01A 5EYPB 4FCRA 5CA1A 4QE9A 1F4MA 5LOVA 4RQFA 1WA8B 3SYQA 1UYKA 2XDKA 3O0IA 1NS1A 2EULA 3VQWA 5EZYA 1FJGB 4F6RA 1DF5A 2YEHA 3I55V 2X0LA 1N36O 3GIGB 2XAFA 4JI2O 2N05A 3K58A 3GIFA 1QBZA 2JGUA 1K7DA 2O57A 4X66B 5CTUA 1HNWO 3JARB 1GM7A 3U2DA 1TUEB 3B40A 2H8PC 3FB5C 2VWKA 2YUAA 4MB9A 3D3QA 1IDSA 2X6AA 2UXBO 1BXDA 3VQYA 2XX5A 1KB9F 4LFCO 5B5EZ 3JALB 1G4YB 2CH4A 1W0JG 3K9SA 2LGQA 3H80A 3K5MA 3U10A 3OPDA 3RBZA 2KG7A 2YI6A 2NN4A 2H8MA 1S77D 3VHDA 3L9DA 3FB6C 4LF5O 3RYIB 4WFBV 1BT8A 1UYIA 2L6LA 4YY3B 1Q6UA 3KCYA 3EVKA 1GO3F 4FZ1A 4JI7B 1Q90D 3ZMZA 3AG4C 1PNLA 2WEQA 1FXVA 3L72H 4RAIA 2CK3G 4MW3A 5KHJA 1NQTA 3HEKA 2EZOA 4JYBA 2V1DA 2C1GA 1VARA 2BZ5A 5GONA 2LW7A 3JAMN 2WLNA 1L0NH 1MG1A 1MMMA 3FT8A 3RGBA 2P06A 3D0BA 4UFZA 2WI6A 4YJ3A 1N33B 3K9AA 4O2BB 4B7KA 1VF6A 2WI4A 2VWJA 2DYSB 4PA4A 1YT0A 4YJ3B 5FNVB 4BQJA 4MT8A 1M5IA 5EIBC 4ASGA 4LF4O 4ZI7A 1XHXA 4U7NA 4DR6O 4LF7B 2QG0A 3AG2B 4XE2A 3A0XA 3CRKA 3CRQA 3QG5A 2EIJC 4DRXA 2VS0A 4JI2B 3T1HB 5FNVA 3OWBA 1YZBA 1AH8A 2QWPB 1N4CA 2ZE5A 3ZHSA 2PI5A 4F6RB 2DWEC 5IDMA 2FL4A 2YJWA 1KIJA 3H1JH 3A2FA 3EXAA 2CH7A 4JI4O 4E02A 1VQ5V 2ZE7A 1RM1C 5M4MA 4CWRA 2YEVA 2PYLA 3AG2C 3FD9A 1IBKO 3IJ4A 4AILC 1N0NA 4X64O 3T2MA 2XHBA 1BGQA 4LC1A 4JTDB 2ZM6O 4LFAB 5LMNB 2WERA 4TV8B 2XHXA 4N23A 3D36A 1D5NA 3F5WC 4BXIA 2ODMA 3WB2A 4DV3O 5LHGA 4LNUA 3Q5KA 4FVMA 4X65B 4JGSA 4X64B 2CTWA 5EYPA 1QNMA 4I7ZB 2EIMB 5EIBD 3HZ1A 2A7WA 1ZL8B 4J42A 4FLVA 2AKPA 1I94O 2YIBA 3EHFA 2XD6A 5IN9A 4MTFA 2QKAA 1U96A 1GN2A 4JI0O 4I3HA 2ZINA 3H1HH 1THNA 1PNMA 3AK2A 1YXBA 2ZKJA 2JRIA 2IU0A 1HP8A 1SF9A 4YKQA 4FFKA 2YE3A 4CH4A 4PA7A 4O4LA 1EN4A 3M99B 2Y48A 5M4NA 2HKOA 1YSRA 5A9GA 3C11A 4LR3A 2WLMA 1Y74A 3APOA 1EN5A 1JQ0A 3A0RA 4WFFA 3BRCA 2LGWA 3BM9A 3ABUA 5K1XA 2QWNB 1OCOB 3N27A 2HCHA 4DR7B 5LP6C 3R4OA 4J41A 1IURA 2VQFO 3K57A 3FX7A 3MNRP 1VQ6V 2YEFA 5LGTA 5CA0B 1B63A 4CBCA 1FS0G 3VQXA 3RLPA 2OIGA 1S5LZ 3ZMUA 3ZMTA 4ASAA 1GKFA 4BIZA 2YXHA 3A0ZA 3BFRA 3OMUA 3HYYA 2YE2A 5KA6A 1NVPB 1US6A 1TBWA 1BQ0A 3CXCU 1Q5OA 4LF6B 1WA8A 2EILC 4ASBA 1GH6A 3UO3A 4B7PA 2IH3C 1AJPA 4I50B 3ZKDA 1WB8A 2MK3A 4CS4A 1R6TA 1K92A 5D6PA 5FNCA 3JYCA 3BMYA 5KA5A 3AK1A 2DQ0A 3K59A 4NXMO 1UY6A 3N2GB 1KZNA 4FM0A 1JMKC 3VBBA 1YJNV 3RYFB 3RW0A 4X1IB 1XMQO 2RJZA 4UB6Z 4BW5A 2CCUA 4URLA 3JD3A 4OGQB 4R1FA 4WUBA 2A0LA 4RQEA 4YJ2A 2YJXA 5DM6V 1M56B 4O2AB 3ZIAG 3PEHA 2UUCO 2FTKA 5CB4B 3B27A 1AI6A 2AZ0A 1JFFA 1H2NA 4JV5B 4X65O 4DRXB 1I5DA 1WN7A 2WSSG 4DR2B 4P2ZA 1VQMV 4YKTA 4OPAA 4J11A 2R9IA 1ENVA 1R73A 5LL6Y 5LOVB 5FNDA 3QTCA 1AJ6A 4ZKIA 3CGZA 3CJHB 4LFCB 4LFBB 1ZLZA 4R3MA 1WJZA 2EILB 2Q68A 4CS3A 2YE6A 1KP3A 4UVBA 2YK2A 5C8YB 3APQA 1RM1B 1Q6IA 5JENA 2BU8A 4LWEA 1I5XA 4K3AA 3B26A 2HJDA 2XHTA 1I5BA 4YKXA 3FAVA 2HFEC 1E1QG 4EGHA 3EFFK 2W6IG 4L87A 4CH5A 2IWUA 2UUBB 3ABLB 3R4MA 1K34A 5EC2C 3LNMB 4IT5A 3LDCA 5GW7A 5ITZB 3T1CA 4JI8O 1Y8OA 1VIBA 3CC7V 2ZBKB 3FV5A 2OTJV 1FXKB 1ID0A 1Q43A 3VQVA 4LWGA 3W7WA 3FYIB 1VQOV 4B08A 2GV9A 1AI4A 1HWYA 5KX5A 2Q8FA 3FB7C 3IFXA 2W0XA 4NTWA 5JH7B 4B3TB 4FLZA 2F4VO 3TZ2A 4LWFA 2KB1A 2BT0A 3R91A 1V54C 4GT8A 4UVCA 4CH3A 3U0ZA 4CC6A 2R9RB 3WFVA 1P49A 3K08A 3CXHF 1YC4A 4FM1A 2HKJA 4F4LA 1PL4A 2IU3A 1RSOB 3OGCC 3GWOA 4E00A 3FAVB 2OT5A 4C7UA 3OR6C 4X1YA 2VWCA 3QNEA 1F4NA 4MTXA 4D6TH 2UU9O 4MP2A 5KMGA 4B3RO 2JEXA 1QVFU 4UROA 1K33A 1DGSA 3AG1C 1A32A 4MSWC 4JZGA 3CRMA 2V4DA 3I56V 4GGLA 1SQQH 3BPZA 4QGPA 4QIWF 1W2BU 1AR1B 3JD1A 1UY7A 4EFBA 3T0ZA 4HXWA 1NHJA 4O2BA 2JS3A 4U3JB 2Q7HA 2JK5C 3P30A 2CTQA 4UCRA 5LYJA 1S72V 4UCOA 4L93A 4UUJC 1K73W 4KUMA 1H2LA 1PNKA 2ITDC 1NR7A 4LP0A 4YKWA 3P32A 2YSUB 2WLHA 1NR1A 1OCCC 2A79B 4GX1A 1BS3A 2ZIOA 3HB3B 3L70H 4FFBB 4TQDA 1QY8A 2OWOA 1RFYA 3D8CA 2JJ1G 4YKYA 1H8HG 5KLVH 4XKKA 3S3XA 1V9PA 2YGFA 4CE1A 1AJQA 4MPEA 3TETA 1R3IC 3LDDA 4CWSA 4AWPA 2EINB 1S5HC 5H2FZ 4I50A 1THZA 2Q73A 1HW7A 4CE2A 1F51A 1QHTA 5KHGA 5L3BA 3OE7G 2YXYA 1MNGA 2IORA 3HYZA 3N2GA 2FWZA 1UYLA 1W0KG 4PA9A 1AILA 4ABMA 1X59A 1ZXMA 3NXSA 4BIOA 1V55B 4JYCA 1COWG 4LH7A 4YJ2B 2CCTA 4WFHA 3DXRA 4K4OA 4AWQA 3ASOB 2F1MA 3FKSG 3O65A 1K8AW 3INWA 1IZ3A 2O1VA 3E35A 4EKWA 1JCHA 1NKDA 3ZX6A 3B09A 5FLXN 4GUNA 1N34B 1VEWA 2Q2EB 4L91A 2GFDA 5J2UA 5FPRA 3ABKB 3J7AU 2XAGA 4NXNB 1UYCA 3OTOB 3ZHTA 1NH2B 1WP8A 4YIPA 5CN0A 3K03A 3CYOA 1GMGA 4PA3A 1NZ6A 4YHHO 1HNXB 2Y4UA 1Z5WA 2CGNA 1N32O 4I4TA 5CBFA 5L3GA 5LYJB 5L3FA 5IYCO 2HHIA 2Y4TA 2RMKB 2EINC 3IAYA 4PDRA 2Y69C 1YF2A 3OTOO 5TISZ 1QQCA 1WLEA 1SERA 1NTKH 5GONB 4DUYB 3JSNA 5GGZA 2BTQB 1SESA 5F2VO 4X89A 2ATKC 4IHJB 2ITCC 1J95A 2HEPA 3AG3C 4U7OA 1XBLA 2XHRA 1KU9A 1XUQA 2QDOA 1O9GA 2BSKB 1NTMH 2CE4A 3OFNG 1WAZA 3CCMV 2IH1C 4GKJO 2OCCC 2JKIA 3H1LH 1P7GA 5DECA 1R62A 1S3JA 1BL8A 2IJKA 2ZDIC 4KTNA 1BZKA 3B28A 1NHIA 4JTCB 1PM9A 3BY6A 3B24A 2HJFC 5B3SC 1UJWB 4DUZB 1BMFG 1NH2D 2FWYA 4PL9A 1VQ8V 1GK9A 5B3SB 3ZN1A 1TVKA 1I0HA 1M56C 1S14A 1IBMB 4MVMA 4X20A 3STLC 4IGGA 2P4VA 4G2KA 3LSQA 2QE7G 5M4EA 4EM7A 1T5EA 2Q69A 4XITA 2FMLA 3ZHQA 3MDSA 1N0JA 4LCUC 1AM1A 1GM9A 3G7EA 3AK3A 3OMIB 4WFAV 4L8JA 4DV5B 2WLKA 4G27B 2BE3A 2ZNIA 3SPCA 1H7SA 4KQVA 1WB7A 4BQGA 3CRLA 4CWPA 2CTRA 2DE0X 3JALA 3CS5A 1HNZO 1N36B 2D2CB 2Z5UA 1ZSPA 2WI1A 4TT3G 4PDVA 2EBOA 2BU7A 2CGFA 3O2FA 3CCUV 2HHHO 1VQLV 3E86A 4LF8O 4B3MO 2BOCC 2E5LO 1XOUA 2Q5ZA 3K06A 3N2KB 4P8OA 3E22B 1TUBB 1NJIW 1HR0B 1Y8PA 3JD2A 4TQFA 3ZXQA 3U67A 4P9PA 2WLIA 4FM2A 1Z5CA 3ZS8C 1TH8A 1WPBA 1SQPH 4KSHA 3JAWA 5CTYA 4DK0A 3H1IH 2UU9B 1S76D 4ZHQA 2KG7B 3AG1B 4RUFA 4H37A 1QYEA 1AP6A 2ZDIA 2IWSA 5J2UB 2R70A 5CMUA 3H9VA 1UFIA 3HKBA 4FLTA 5IJ9B 3LUTB 2CGOA 2ESAA 1ZUQA 1EFRG 4DV6B 1W59A 2YI5A 1K4CC 4FCPA 5LMUB 3ZRSA 1LUWA 4F6EA 5KUKA 1OCRB 1VMGA 1YERA 1D5AA 1Y67A 3KZIZ 4GX5A 1PD3A 3NR7A 2WEPA 3E2EA 1R1BA 1IX9A 2DN9A 4CWQA 2GBOA 3JAKA 4KSGA 2EX3A 4TWKA 1YVWA 5EC1C 3CCLV 5HFLA 2P4KA 4LWSA 4JI6O 3RVZA 2YEIA 2YEEA 4CE3A 3BABA 1R6NA 2XAHA 3DGEA 2BREA 2YKEA 1CXZB 4GLXA 2ZM6B 4LFAO 3EHGA 3BA8A 2YI9A 2OCCB 3HKBB 4B3RB 1DLBA 3T1KA 1AI7A
chains in the Genus database with same CATH topology
4WUBA 2QFOA 4UV9A 2A0LA 1YHQV 1US7A 3EHJA 4RQEA 1KECA 1P7BA 3INXA 5L3JA 2ZDXA 3K0GA 1G8MA 5DM6V 2YJXA 3RLRA 3AG3B 3OAAG 4QPJA 4H81A 4L90A 1M56B 2YECA 3HHUA 1JVMA 3ZIAG 1QVGU 3QO8A 3PEHA 4NH7A 4EEHA 3A0TA 1UY9A 2FTKA 3F7VC 1YJ9V 1AI6A 1YJWV 1EI1A 1PVGA 1YESA 3B27A 2YEDA 4GX0A 1ZWIC 5BODA 3SPGA 3SPIA 1MABG 1RPRA 3MHSC 1I5DA 2HR3A 1QLEB 1M57C 2WSSG 4GCZA 4JF3A 5CF0A 4YKTA 4P2ZA 1VQMV 1QLNA 1QZRA 1NHHA 4EGIA 4PA6A 2R9IA 5B1BC 1ENVA 1R73A 1ZW9A 3K3WA 3ASOC 2YGEA 4XDLA 2VCJA 3EKRA 1AJ6A 5FNDA 3WHAA 4ZKIA 3CGZA 1I5AA 3IEDA 2EJRA 1V55C 5H6QA 2NLJC 1ZWHA 4XIPA 3JZ3A 2OTLV 2XK2A 1B6QA 3CCQV 2EILB 3ASNC 3UKMA 2XDLA 1U2OA 3OMAB 4HZ0A 2JJ2G 2O1UA 3ETDA 4NH9A 3CMEV 2XABA 3OWDA 3U2KA 1Q7YW 4V25A 1GTOA 2Q68A 2YE6A 1KP3A 4UVBA 1Q86W 2YK2A 3K97A 4WFGA 4CWNA 1OCRC 1RM1B 2BU8A 4LWEA 1F23A 4GT1A 1I5XA 2JIZG 5B1BB 3B26A 2EZPA 3STZC 2XHTA 1I5BA 4YKXA 2HFEC 1E1QG 4LWIA 3ZN0A 4EGHA 3EFFK 5LHIA 3B77A 2W6IG 5M4PA 1EZJA 4L87A 3SYCA 1UYGA 3JD4A 5CBHA 3OUSA 2FXSA 2IWUA 2YGAA 1M1KW 2VCIA 4R7CA 5BZBA 5IYDO 4WF9V 3CC2V 2D3OW 2UXNA 4W7TA 1U0ZA 2UXXA 4JAVA 2PNRA 4XIRA 2ZR3A 3ABLB 3GB7C 3R4MA 3K60A 1Q82W 4OXSA 1Z59A 1K34A 5EC2C 4DXWA 3LNMB 1Q81W 3LDCA 5GW7A 3RVYA 1I5YA 2B1IA 2P67A 3T1CA 4PRXA 3QO5A 2DYRB 4J9YB 2QKSA 1MSWD 5LBQA 4CZZA 1Y8OA 3CC7V 1Z5AA 2YEJA 3CCRV 2OTJV 1FXKB 1ID0A 2ZBKB 3K04A 3FV5A 4LWGA 3W7WA 4XTJA 2F43G 3FYIB 4WFEA 1VQOV 1VQ4V 4EGKA 1AI4A 1HWYA 1PL0A 1RPOA 3LNUA 4O09A 3FB7C 1OCZC 3IFXA 5B1AC 2Q8FA 4PDLA 5D7CA 1E79G 1K3EA 3ZRWB 4O0BA 3CPWU 2YEGA 3QTFA 5KUMA 3TZ2A 1UY8A 4URLA 4GFNA 4LWFA 3IC7A 3JCZA 3O6OA 2KB1A 2W6JG 2YK9A 1JOYA 2BT0A 1I5CA 2YKIA 2P6JA 1KC8W 3R91A 2YEBA 3CCVV 2WPDG 1V54C 4GT8A 1H7UA 1YITV 1B62A 4UVCA 3SYAA 4XC0A 4MTGA 2Q8IA 3TTZA 4PU9A 4AWOA 1YS3A 1YT1A 3ETGA 3T0HA 4P9OA 2R9RB 3WFVA 2XX2A 4L94A 2XAJA 3K08A 2B1GA 2WLIB 1ROPA 2ZXWC 1GKZA 1I59A 1YC4A 4J9ZB 2BYHA 3LSSA 2CG9A 2CCSA 2HKJA 4F4LA 1GM8A 2IU3A 3WG7C 3CD6V 3OGCC 3GWOA 3RKZA 1BHBA 2XJJA 2H94A 1N8RW 3ZMSA 1VQNV 4E00A 3CCJV 5H6RA 4P30A 3TZ5A 2OT5A 4R50A 2YI0A 2VW5A 1AMWA 3OR6C 4LWHA 4RUEA 3K0DA 1JM6A 2JDIG 3OUFA 2VWCA 2XAQA 3QNEA 4HYMA 1F4NA 3ZXOA 1CEZA 4MTXA 1VQ9V 3ZRXA 2IJIA 1JX9A 4MP2A 2IOQA 2JEXA 3ZCCA 2H55A 1QVFU 1M57B 4UROA 1TC0A 4R8CA 3LPSA 4XCJA 4XKAA 1K33A 2AHYA 1SZTA 2YEVB 4HY6A 3AG1C 4MSWC 5EK0A 1TC6A 1DF4A 3E8BA 3I56V 1JJ2U 4GGLA 4LPBA 4V26A 5J6AA 5FL7G 2QM7A 1YETA 1YC1A 4QIWF 4RO2A 1AR1B 1W2BU 3T10A 3JD1A 2BU6A 1QCEA 2X7RB 3FYEB 2GSMB 1UY7A 4HXZA 4O07A 3T0ZA 3ZMVA 4HXWA 1NHJA 1UYFA 4WCEV 3ABMC 2HG1A 1S16A 1OCCB 1XL4A 2JK5C 1FXHA 2X6BA 3P30A 4HZ5A 4DZYA 2WAMA 4QPKA 4TSFG 3VADA 1S72V 2WI2A 3D2RA 5E1AC 4UUJC 4L93A 2WLLA 4ASFA 1OZ0A 4KUMA 1K73W 2ITDC 1PNKA 1VQ7V 2XDUA 1NR7A 5CBGA 2YKCA 4LP0A 4URMA 4YKWA 4MVUA 2XDXA 3K98A 4YKRA 4FK5C 2YKJA 2EIJB 4MPNA 4MVSA 3P32A 3PEJA 3SL2A 1YT2A 4WUDA 2IJJA 2YSUB 2WLHA 3R4PA 1NR1A 1OCCC 4NH8A 2A79B 2WI3A 3Q5JA 4GX1A 2K1EA 3HB3B 1QY8A 3Q5LA 5B1OA 4XD8A 3TUHA 3WG7B 3OR7C 4PELA 3X2QC 2YI7A 1BHAA 3FB8C 4GX2A 3W7TA 4JQLA 1LNQA 3WQ9A 3R92A 4YXWG 3ETEA 4JPRA 2JJ1G 4MP7A 5CTWA 3T2SA 4E01A 3G75A 4YKYA 4JAUA 1H8HG 4N21A 4L8ZA 4XKKA 3ZKBA 2YGFA 3W7SA 4FCRA 5IYBO 4CE1A 1AJQA 4QE9A 1F4MA 4RQFA 1M90W 4I5SA 3TETA 4HY1A 4MPEA 1R3IC 2JJCA 3LDDA 4CWSA 3SYQA 1UYKA 4AWPA 3LDEA 2XDKA 2EINB 1S5HC 3O0IA 1QR8A 1THZA 4XIQA 2XDSA 2ZQMA 4CE2A 5FWKA 1DF5A 2YEHA 3K79A 1F51A 3I55V 2X0LA 2YEAA 3F7YC 4R6ZA 2HVKC 5L3BA 2BSMA 3KG2A 3GIGB 2XAFA 3OE7G 2IORA 3HYZA 4DUHA 1R3LC 3GIFA 1Y4UA 1QBZA 1K7DA 2FWZA 4H33A 1W0KG 1UYLA 2ZDYA 4PA9A 1FXKC 2HG5C 3T4DA 3ZRWA 3QO7A 4FIPC 3SPJA 5CTUA 3CGYA 1B3QA 3FT5A 1K4DC 3SYOA 2UWDA 2DWDC 1GM7A 3EKOA 3ABKC 2ZR2A 3SJQC 4Z1MG 1UYMA 1TUEB 3U2DA 2H8PC 3FB5C 4GEEA 3VHAA 1ZXMA 3NXSA 2WI7A 4XDMA 4MB9A 2X6AA 1V55B 3R65A 1BXDA 5J9PC 4JYCA 2XX5A 4MTOA 1COWG 1UYDA 1G4YB 2CCTA 4QJFB 2CH4A 1W0JG 4FCQA 4WFHA 1OHHG 4K4OA 2V7QG 1K5SA 3ASOB 3OW2U 3H80A 4AWQA 3FKSG 4JTAB 1K8AW 2XX4A 2LFRA 3INWA 2O1VA 3OPDA 3E35A 4EKWA 1KQSU 4HYOA 3RBZA 2YI6A 1JCHA 1NKDA 2W0FC 1YI2V 2PI4A 3TZ4A 1BYQA 1OSFA 2H8MA 1OCZB 5B1AB 1S77D 2C2AA 2QEXV 3FB6C 2Q2EB 4UV8A 2YKBA 4L91A 3VHDA 4EFUA 2GFDA 4WFBV 1UYIA 3ABKB 1YSCA 2XAGA 1E1RG 2QF6A 2XJXA 4ASUG 1GO3F 1UYCA 3ZMZA 1NH2B 4H7QA 5CN0A 3K03A 3AG4C 1EA6A 1PNLA 2WEQA 3CYOA 1GMGA 1CP9A 1FXVA 4XDKA 4PA3A 4RAIA 2LP7A 2FYPA 5J71A 2CK3G 3H01A 5LHHA 3W7UA 4MW3A 4G28B 3ABLC 1EBOA 3SPHA 2K5BA 2BOBC 5CBFA 4XCLA 1H8EG 5L3GA 1NQTA 1K9MW 5L3FA 2EZOA 4JYBA 2V1DA 5IYCO 1TILA 3HEKA 1CPYA 2BZ5A 2EINC 3EHHA 2IW5A 4PDRA 2Y69C 4Q20A 4KFMA 2EIKB 2WLNA 4YKUA 4ZVIA 1MG1A 1WLEA 1SERA 3FT8A 3D0BA 3A0YA 2WI6A 1SRYA 5GGZA 3PJSK 4PRVA 1SESA 3ZM7A 1GJVA 3K9AA 4P7AA 3DTUB 5DN6G 3E8FA 2ATKC 3AG4B 4X89A 1YTFB 2WI4A 2ITCC 4AS9A 1J95A 1YT0A 2DYSB 4PA4A 3AG3C 2WLJA 4U7OA 4WUCA 4B6CA 4BQJA 4MT8A 5IDJA 4E2LA 2B5UA 2IWXA 4QNHB 2XHRA 3A0WA 5EBLC 4ASGA 1P4RA 4U7NA 3ASNB 2XASA 3OFNG 2QG2A 2YE8A 2QG0A 3CCMV 1QR9A 3AG2B 2IH1C 3CP1A 4MBCA 5D7DA 2OCCC 4XE2A 4JASA 3B8NA 2JKIA 3A0XA 2Q8GA 1R62A 3OMNB 3CRKA 1S3JA 1BL8A 2EIJC 2IJKA 2ZDIC 1Y66A 3T4ZA 4HYPA 3B28A 4KTNA 4EFTA 1NHIA 4CWFA 4JTCB 3BY6A 3B24A 3OWBA 2HJFC 1K5QA 5B3SC 1UJWB 1BMFG 1AH8A 4BAYA 2WWWA 1NH2D 1R6KA 2FWYA 4DO2A 4PL9A 1NBMG 3TK1A 1VQ8V 1ZXNA 2PI5A 1DTOA 1GK9A 3C0EA 3MHHC 2DWEC 4CWTA 1VQKV 5CTXA 5D7RA 2YJWA 5IDMA 2NNUA 1KIJA 5CA3A 5B3SB 3ABMB 4QE7A 3OW6A 4X9LA 2O1WA 1H38A 3ZN1A 2XNDG 3CCSV 2BU2A 2YE5A 2GHYA 1VQ5V 1Z5BA 4E02A 1MX0A 1RM1C 5M4MA 1M56C 1S14A 1UYEA 4CWRA 4MVMA 4URNA 1H2GA 2YEVA 3G71V 3AG2C 3STLC 1K97A 4YKZA 4GQTA 4G2KA 3LSQA 1XL6A 2QE7G 1FXKA 2BTZA 4EM7A 5M4EA 3T2MA 5LGUA 4HAMA 1AH6A 3G4SV 1TIDA 2Q69A 2AHZA 3R4NA 2A9HA 2YE7A 1BGQA 4R3AA 4XITA 5D6QA 2P7TC 4ZBMA 4LC1A 3AEIA 4JTDB 2YE9A 4LCUC 1AM1A 2WERA 5CPHA 2XHXA 1GM9A 3D36A 4N23A 3QDDA 2XCMA 3F5WC 3G7EA 1BKNA 3OEHG 4LP8A 3RLQA 3T1KA 4BXIA 3OM3B 3BEHA 4H85A 3OMIB 4WFAV 1AJNA 4O05A 5LHGA 2IJHA 2WLKA 4G27B 4MVOA 3Q5KA 2ZD9A 2EIKC 4JGSA 5F3KA 2Y69B 3SPCA 2EIMB 1H7SA 2BYIA 3HZ1A 4KQVA 4BQGA 2WLLB 1FFTB 4XDJA 2AKPA 5L3CA 3CRLA 4CWPA 2Q8HA 4MS2A 2XD6A 3EHFA 5IN9A 4MTFA 3E89A 5H9CA 4UXNA 4X8AA 3UM7A 3VOUA 3G7BA 4EMVA 2Z5UA 2WI1A 4I3HA 4TT3G 1THNA 1PNMA 3X2QB 4PDVA 2EBOA 2ZKJA 3CCEV 2BU7A 2IU0A 2CGFA 3O2FA 3CCUV 4BAEA 1VQLV 3E86A 3K99A 4YKQA 1OCOC 2YE3A 2BOCC 4UVAA 2X6CA 1V54B 4PA7A 3K06A 4P8OA 3CC4V 5BOCA 1VQPV 1Y4MA 3M99B 1NJIW 2Y48A 1Y8PA 3B25A 5M4NA 1R3KC 2HKOA 3JD2A 1MU5A 3SYPA 1YSRA 2LFSA 3C11A 3ZXQA 2WLMA 2Q67A 3W7XA 5C93A 4R3MA 5FNFA 3U67A 1JQ0A 5IY5B 4P9PA 3A0RA 3E8HA 4WFFA 4CWOA 5LGNA 2WLIA 5EBMC 3ZJZA 4MW8A 1S0VA 3ML0A 2DQ3A 3BM9A 1Z5CA 1TH8A 2DYRC 3CMAV 2XJGA 1PKXA 3ABUA 5HFMA 1OCOB 1YTFD 2HCHA 4KSHA 1KKDA 1M9NA 2BU5A 3CWVA 1YSZA 5CTYA 1YIJV 3R4OA 2QM8A 1AROP 1YC3A 1S76D 3AG1B 4XBFA 4KFGA 2P90A 4X88A 5B1NA 5M4KA 4XKOA 3MNRP 4RUFA 1VQ6V 4H37A 1QYEA 4FJCC 2ZDIA 2IWSA 2YEFA 5LGTA 5CMUA 1B63A 1JPXA 4CBCA 2XOKG 3TZ0A 1FS0G 4FPPA 3LUTB 3RLPA 1L0OA 4LBEC 5EBWC 3ZMUA 1SETA 3H4LA 2ESAA 3ZMTA 3HPLC 3GIEA 1L1FA 3TCUA 4ASAA 1EFRG 1GKFA 2YI5A 4BIZA 1K4CC 3KE6A 4FCPA 2HLDG 3ZRSA 5KUKA 1MOFA 2HVJC 3A0ZA 1OCRB 2YE4A 3OMUA 1AI5A 4MPCA 3ZRVA 1YERA 4BIUA 2YE2A 3HYYA 4GX5A 5KA6A 1KP2A 3B8MA 2QTOA 1NVPB 1PD3A 1TBWA 4MOTA 2DW4A 2WEPA 3IGAC 2ZXWB 3CXCU 3E2EA 5L3DA 4I9WA 1I58A 1WPXA 4PDMA 3HZ5A 4CWQA 2WI5A 2EILC 4ASBA 3ABTA 1KD1W 1ORQC 4KSGA 4TWKA 2DYSC 4MVQA 5EC1C 4B7PA 2IH3C 2JEUA 1AJPA 3ZKDA 3CCLV 2MK3A 5HFLA 1K92A 3RVZA 2YEIA 5D6PA 3JYCA 2YEEA 5FNCA 3VHCA 3BMYA 2IOPA 4CE3A 2EIMC 3MD0A 5KA5A 5IY5C 3GIGA 1R6NA 2DQ0A 4MVZA 4MVRA 3G6EV 2BRCA 1QLEC 1GKXA 3EHBB 1IXMA 3E8GA 1UY6A 2XAHA 3E83A 4FMTA 5L3EA 1Y8NA 3DGEA 2QA4V 1KZNA 2M7WA 2E0AA 5M4HA 1A4HA 1R3JC 4KP4A 2BREA 3VBBA 4HZ3A 3NMQA 4U93A 1YJNV 2EXLA 2YKEA 3RW0A 2Z3YA 3EHGA 3OEEG 5F5RA 2OCCB 1NVPD 2Q6AA 3D3IA 1Y4SA 4BW5A 1DLBA 3JD0A 2CCUA 1AI7A 3JD3A 2GQPA 1UYHA 4O04A 4R1FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WUB A;  2QFO A;  1US7 A;  3EHJ A;  3INX A;  5L3J A;  2ZDX A;  2YJX A;  3RLR A;  4QPJ A;  4H81 A;  4L90 A;  2YEC A;  3HHU A;  3PEH A;  4NH7 A;  4EEH A;  3A0T A;  1UY9 A;  2FTK A;  3B27 A;  1PVG A;  1EI1 A;  1YES A;  2YED A;  5BOD A;  1I5D A;  4GCZ A;  5CF0 A;  4YKT A;  1QZR A;  4EGI A;  1NHH A;  1ZW9 A;  2YGE A;  5FND A;  2VCJ A;  3EKR A;  1AJ6 A;  3WHA A;  4ZKI A;  3CGZ A;  1I5A A;  3IED A;  4XIP A;  1ZWH A;  3JZ3 A;  2XK2 A;  4R3M A;  3T0H A;  2XDL A;  4HZ0 A;  1U2O A;  2O1U A;  4NH9 A;  2XAB A;  3OWD A;  3U2K A;  4V25 A;  2YE6 A;  2YK2 A;  3K97 A;  4CWN A;  2BU8 A;  4LWE A;  4GT1 A;  3B26 A;  2XHT A;  1I5B A;  4YKX A;  4LWI A;  4EGH A;  5M4P A;  2YGA A;  1UYG A;  2IWU A;  2FXS A;  2VCI A;  4W7T A;  1U0Z A;  2PNR A;  4JAV A;  4XIR A;  3R4M A;  3K60 A;  1Z59 A;  2P67 A;  4PRX A;  2YEJ A;  1Z5A A;  1Y8O A;  2ZBK B;  3FV5 A;  1ID0 A;  4LWG A;  4XTJ A;  4EGK A;  4O09 A;  2Q8F A;  3LNU A;  5D7C A;  3ZRW B;  4O0B A;  3TZ2 A;  2YEG A;  3QTF A;  1UY8 A;  4URL A;  4GFN A;  4LWF A;  3O6O A;  2YK9 A;  1JOY A;  2BT0 A;  1I5C A;  2YKI A;  3R91 A;  2YEB A;  4GT8 A;  1H7U A;  1B62 A;  3TTZ A;  2Q8I A;  4XC0 A;  4PU9 A;  4AWO A;  1YS3 A;  1YT1 A;  4L94 A;  2XX2 A;  1GKZ A;  1I59 A;  1YC4 A;  2BYH A;  2CG9 A;  2CCS A;  2HKJ A;  3RKZ A;  2XJJ A;  4E00 A;  3TZ5 A;  2YI0 A;  2VW5 A;  1AMW A;  4LWH A;  1JM6 A;  2VWC A;  4HYM A;  3ZXO A;  4MTX A;  3ZRX A;  4MP2 A;  2IOQ A;  4XCJ A;  3ZCC A;  2H55 A;  4URO A;  1TC0 A;  3LPS A;  4XKA A;  4HY6 A;  1TC6 A;  4GGL A;  4V26 A;  5J6A A;  4LPB A;  2QM7 A;  1YET A;  1YC1 A;  3T10 A;  2BU6 A;  4HXZ A;  1UY7 A;  4O07 A;  3T0Z A;  4HXW A;  1NHJ A;  1UYF A;  2HG1 A;  1S16 A;  4HZ5 A;  4DZY A;  4QPK A;  3VAD A;  2WI2 A;  3D2R A;  4L93 A;  4ASF A;  4URM A;  2XDU A;  2YKC A;  4LP0 A;  4YKW A;  2XDX A;  3K98 A;  4YKR A;  2YKJ A;  4MPN A;  3P32 A;  3PEJ A;  3SL2 A;  1YT2 A;  4WUD A;  3R4P A;  4NH8 A;  2WI3 A;  3Q5J A;  1QY8 A;  3Q5L A;  5B1O A;  4XD8 A;  2YI7 A;  4JQL A;  3WQ9 A;  3R92 A;  3T2S A;  4MP7 A;  5CTW A;  4E01 A;  3G75 A;  4YKY A;  4JAU A;  4L8Z A;  4XKK A;  3ZKB A;  2YGF A;  4FCR A;  4CE1 A;  4I5S A;  4HY1 A;  4MPE A;  2JJC A;  4CWS A;  1UYK A;  4AWP A;  2XDK A;  3O0I A;  4XIQ A;  2XDS A;  5FWK A;  4CE2 A;  2YEH A;  1F51 A;  2YEA A;  2BSM A;  3GIG B;  2IOR A;  3HYZ A;  4DUH A;  3GIF A;  1Y4U A;  2FWZ A;  1UYL A;  2ZDY A;  3ZRW A;  5CTU A;  3CGY A;  3FT5 A;  1B3Q A;  2UWD A;  3EKO A;  1UYM A;  3U2D A;  3VHA A;  4GEE A;  1ZXM A;  3NXS A;  2WI7 A;  4XDM A;  4MB9 A;  1BXD A;  4JYC A;  2XX5 A;  1UYD A;  2CCT A;  2CH4 A;  4FCQ A;  4K4O A;  4AWQ A;  3H80 A;  2XX4 A;  2LFR A;  3INW A;  2O1V A;  3OPD A;  2YI6 A;  3TZ4 A;  1BYQ A;  1OSF A;  2H8M A;  2YKB A;  2Q2E B;  3VHD A;  2C2A A;  4EFU A;  4L91 A;  2GFD A;  1UYI A;  2QF6 A;  2XJX A;  1UYC A;  4H7Q A;  1EA6 A;  2WEQ A;  2FYP A;  5J71 A;  2K5B A;  4XCL A;  3HEK A;  4JYB A;  1TIL A;  2BZ5 A;  3EHH A;  4Q20 A;  4YKU A;  4ZVI A;  3FT8 A;  3D0B A;  3A0Y A;  2WI6 A;  5GGZ A;  4PRV A;  3ZM7 A;  1GJV A;  4P7A A;  2WI4 A;  4AS9 A;  1YT0 A;  4WUC A;  4U7O A;  4B6C A;  4BQJ A;  5IDJ A;  4MT8 A;  2IWX A;  2XHR A;  3A0W A;  4ASG A;  4U7N A;  2QG2 A;  2YE8 A;  2QG0 A;  4MBC A;  5D7D A;  4XE2 A;  4JAS A;  2JKI A;  3A0X A;  2Q8G A;  1R62 A;  3CRK A;  4HYP A;  4KTN A;  3B28 A;  4EFT A;  1NHI A;  4CWF A;  3B24 A;  3OWB A;  1AH8 A;  5CTX A;  2WWW A;  2FWY A;  4PL9 A;  3TK1 A;  1ZXN A;  3C0E A;  5IDM A;  4CWT A;  5D7R A;  2YJW A;  3TUH A;  1KIJ A;  3OW6 A;  4X9L A;  2O1W A;  2YE5 A;  2BU2 A;  4E02 A;  1Z5B A;  1MX0 A;  5M4M A;  1S14 A;  4CWR A;  1UYE A;  4URN A;  4YKZ A;  4GQT A;  2BTZ A;  4EM7 A;  5M4E A;  1TID A;  3R4N A;  1AH6 A;  4R3A A;  2YE7 A;  1BGQ A;  4XIT A;  5D6Q A;  4LC1 A;  2YE9 A;  1AM1 A;  2WER A;  5CPH A;  2XHX A;  3QDD A;  3D36 A;  2XCM A;  3G7E A;  1BKN A;  3RLQ A;  3T1K A;  4BXI A;  4H85 A;  4O05 A;  3Q5K A;  5F3K A;  3HZ1 A;  1H7S A;  2BYI A;  4KQV A;  4BQG A;  3CRL A;  2AKP A;  4CWP A;  2Q8H A;  3EHF A;  2XD6 A;  5IN9 A;  3G7B A;  4EMV A;  2WI1 A;  4I3H A;  1THN A;  2ZKJ A;  2BU7 A;  2CGF A;  3O2F A;  4BAE A;  4YKQ A;  3K99 A;  2YE3 A;  4P8O A;  5BOC A;  1Y8P A;  3B25 A;  5M4N A;  1MU5 A;  1YSR A;  2LFS A;  3C11 A;  3ZXQ A;  5C93 A;  5FNF A;  3U67 A;  3A0R A;  4CWO A;  3BM9 A;  1Z5C A;  1TH8 A;  2XJG A;  4KSH A;  2HCH A;  2BU5 A;  5CTY A;  3CWV A;  1YSZ A;  3R4O A;  2QM8 A;  1YC3 A;  4KFG A;  5B1N A;  5M4K A;  4XKO A;  3MNR P;  1QYE A;  2YEF A;  2IWS A;  1B63 A;  3TZ0 A;  4FPP A;  3RLP A;  1L0O A;  3H4L A;  2ESA A;  3GIE A;  4ASA A;  2YI5 A;  4BIZ A;  4FCP A;  3KE6 A;  3A0Z A;  2YE4 A;  3OMU A;  4MPC A;  3ZRV A;  1YER A;  4BIU A;  2YE2 A;  3HYY A;  4MOT A;  1TBW A;  2WEP A;  1I58 A;  3HZ5 A;  4CWQ A;  2WI5 A;  4ASB A;  4KSG A;  4B7P A;  3ZKD A;  5D6P A;  2YEI A;  5FNC A;  2YEE A;  3VHC A;  3BMY A;  2IOP A;  4CE3 A;  3MD0 A;  3GIG A;  2BRC A;  1GKX A;  1Y8N A;  1IXM A;  1UY6 A;  2E0A A;  4FMT A;  5M4H A;  3DGE A;  1KZN A;  1A4H A;  4KP4 A;  2BRE A;  3NMQ A;  4U93 A;  2EXL A;  2YKE A;  3EHG A;  5F5R A;  1Y4S A;  2GQP A;  2CCU A;  1UYH A;  4O04 A;  4R1F A; 
#chains in the Genus database with same CATH topology
 1BGY H;  2QWR B;  5ITZ A;  3ZBH A;  4J7K A;  1KEC A;  1P7B A;  3K0G A;  3RYH B;  4DV2 B;  1G8M A;  3RLR A;  4QPJ A;  3HHU A;  1SA0 A;  3QO8 A;  2BSK A;  1TGO A;  4EEH A;  2ZIM A;  1YJ9 V;  1NI8 A;  4GX0 A;  2K9P A;  1BQZ A;  5BOD A;  3SPI A;  1MAB G;  1QLE B;  4GCZ A;  1HNW B;  5KHH A;  1NTZ H;  1SS3 A;  4PA6 A;  2ZT9 B;  1ZW9 A;  1Q8I A;  2YGE A;  4XDL A;  2VCJ A;  3WHA A;  4E4E A;  1I5A A;  2QKC A;  5E79 Z;  1HDJ A;  5H6Q A;  1ZWH A;  2NLJ C;  4XIP A;  2XK2 A;  3T0H A;  4Z2W A;  5IJ0 A;  2O1U A;  3ETD A;  4TUY A;  4NH9 A;  1FJG O;  3OWD A;  3U2K A;  1GTO A;  4I4T B;  2ZCE A;  2F4V B;  4WFG A;  4NTX A;  4CWN A;  3L73 H;  5B1B B;  3STZ C;  4I55 B;  1Q6H A;  5LXT A;  1EZJ A;  2YGA A;  4FZ0 A;  1JFF B;  3OUS A;  2FXS A;  1M1K W;  2VCI A;  2Q0O C;  5BZB A;  4LF9 O;  4PI0 A;  2UXN A;  4J7J A;  2D3O W;  4W7T A;  2UXX A;  4JAV A;  4XIR A;  4H44 B;  3GB7 C;  1Q82 W;  1Z59 A;  2QTS A;  3A0H Z;  5KX5 B;  1Q81 W;  2B1I A;  4GZR B;  4DW1 A;  1FPO A;  4JI3 O;  4PRX A;  2DYR B;  2YEJ A;  4CZZ A;  4NXM B;  5D5P A;  3CCR V;  3ETQ A;  1TA8 A;  1VQ4 V;  5BR8 O;  3CRC A;  4I0X A;  5B1A C;  1S5J A;  4DV6 O;  4GYC B;  4BR6 A;  4PD4 F;  2YEG A;  5BY1 A;  4B7E A;  3IC7 A;  3O6O A;  5KHK A;  2YEB A;  2IBZ H;  2UXB B;  1GAX A;  3TTZ A;  1B62 A;  2Q8I A;  4XC0 A;  1SZX A;  3DC6 A;  4AWO A;  4W4K A;  3ETG A;  5IE9 A;  2H3O A;  4W4L A;  2XX2 A;  2GUZ A;  2XAJ A;  3I5D A;  1GKZ A;  2B1G A;  2WLI B;  2BCC H;  3RWR D;  4J9Z B;  3SGI A;  4EB6 A;  2BYH A;  2CG9 A;  1QU7 A;  1BHB A;  2H94 A;  4E72 A;  4PHZ A;  1VQN V;  4DV4 B;  2C1I A;  4IHJ A;  4LWH A;  5JQG A;  3RYC B;  2Q9L A;  1L8D A;  3OUF A;  4OX9 B;  4O4L B;  4XCJ A;  3ZCC A;  1IVS A;  2H55 A;  1M57 B;  1TC0 A;  3LPS A;  4UCV A;  2E3C A;  5EK0 A;  5IYZ B;  5JJE B;  1DF4 A;  3E8B A;  1IBL B;  1TC6 A;  5J6A A;  4LF7 O;  2QM7 A;  4NKG B;  3T10 A;  2L35 A;  3FYE B;  5LP6 A;  3S5T A;  1VF5 B;  4WCE V;  3ABM C;  1H2K A;  1S16 A;  1OCC B;  1XL4 A;  4DZY A;  1AR5 A;  1EM1 A;  3VAD A;  3CJH A;  3T1Y B;  3D2R A;  2WLL A;  2PZS A;  1OZ0 A;  1VQ7 V;  2UUA B;  1G1X B;  2YKC A;  5IJ9 A;  4YIO A;  2EIJ B;  4H13 B;  4MPN A;  4MVS A;  4JV5 O;  1U97 A;  3JAR A;  3SL2 A;  3R4P A;  1M4U A;  5FPO A;  4X1Y B;  3Q5L A;  4YHH B;  3OR7 C;  4DR3 B;  3FB8 C;  1BHA A;  2KKW A;  2LW1 A;  3WQ9 A;  3JAS A;  4IYH A;  3E22 A;  5CTW A;  3G75 A;  4N21 A;  4WBN B;  4L8Z A;  1RSO A;  4J80 A;  3ZKB A;  2QSA A;  1M90 W;  4I5S A;  4HY1 A;  2CDY A;  1XHZ A;  1XNR B;  4DV1 O;  4LF5 B;  1EZV H;  4X20 B;  1QR8 A;  2NR5 A;  2ZQM A;  2YIC A;  2XDS A;  5FWK A;  1HNZ B;  1AP5 A;  2ILM A;  4JYA O;  3F7Y C;  4UB8 Z;  4R6Z A;  2BSM A;  3KG2 A;  4DUH A;  2RN9 A;  1Y4U A;  2RCV A;  4ZHQ B;  2ZDY A;  2HG5 C;  3T4D A;  4FIP C;  1B3Q A;  2Y0I A;  3SYO A;  2KSD A;  2DWD C;  2UWD A;  3ABK C;  2ZR2 A;  4Z1M G;  1WP7 A;  4GEE A;  4TUY B;  5J9P C;  4MTO A;  4FCQ A;  4UCU A;  1XDC A;  4AQY O;  4JTA B;  2E76 B;  2LFR A;  4HYO A;  2UXC B;  2W0F C;  1YI2 V;  3TZ4 A;  2PI4 A;  3LNN A;  3CSX A;  5B1A B;  4EFU A;  2C2A A;  1OV9 A;  3CRA A;  1XI1 A;  4IYI A;  1E1R G;  1VF7 A;  2Q8V A;  1B04 A;  1L0L H;  4OPH A;  4O4I B;  1EA6 A;  2FYP A;  5J71 A;  5LHH A;  3W7U A;  4CH6 A;  4G28 B;  1N34 O;  1EBO A;  3SPH A;  3UQ8 A;  2K5B A;  2BOB C;  4XCL A;  1H8E G;  1K9M W;  1TIL A;  1FAF A;  3EHH A;  4X9Q A;  4Q20 A;  2EIK B;  3D36 C;  2P22 C;  4LNU B;  3Q4H A;  2ZKO A;  1LUV A;  3PJS K;  2AZ2 A;  4DR5 O;  3DTU B;  3E8F A;  4TV8 A;  4AS9 A;  2F66 C;  2AW9 A;  1Y76 B;  2WLJ A;  4WUC A;  1GN6 A;  4WBN A;  4E2L A;  2IWX A;  4NVP A;  4QNH B;  5EBL C;  1P4R A;  2XAS A;  5JVD B;  2YE8 A;  4MBC A;  1QR9 A;  3B8N A;  2QWO B;  4DV7 B;  3OMN B;  2Q8G A;  4HYP A;  4KHP B;  2CH7 B;  5EZY B;  4CWF A;  4ZOL A;  4BAY A;  5CTX A;  4DO2 A;  1NBM G;  3TK1 A;  4CWT A;  1VQK V;  5D7R A;  1NT2 B;  3TUH A;  2NNU A;  5CA3 A;  2OIE A;  4X9L A;  2O1W A;  1H38 A;  3C3T A;  5DED A;  3CCS V;  4LH6 A;  1UYE A;  1H2G A;  3G71 V;  1K97 A;  1XL6 A;  1FXK A;  5LGU A;  1AH6 A;  1VF6 C;  4HAM A;  3G4S V;  1TID A;  3R4N A;  2AHZ A;  3CB2 A;  2A9H A;  4HNA B;  2BTQ A;  5D6Q A;  4DV1 B;  2YE9 A;  4CS2 A;  1MA1 A;  4FLX A;  3QDD A;  4DR4 O;  3RLQ A;  4IIJ A;  4LP8 A;  1AJN A;  4O05 A;  5LA6 A;  4MVO A;  2ZD9 A;  2EIK C;  2PY5 A;  1IBK B;  5F3K A;  2BYI A;  1XNQ B;  3Q4H B;  2WLL B;  1FFT B;  2XTA A;  2Q8H A;  4RWU A;  4MS2 A;  4X8A A;  3UM7 A;  1XRE A;  3X2Q B;  3M8A A;  2RDC A;  2JVD A;  4KL1 A;  4D7S A;  5IWA O;  3K99 A;  4BAE A;  1SQB H;  4UVA A;  4K0K B;  3T1Y O;  1V54 B;  1XMQ B;  1NU1 H;  5BMV B;  3CC4 V;  4K8X A;  5BOC A;  1VQP V;  3L71 H;  3RYI A;  3B25 A;  1R3K C;  1MU5 A;  2HP8 A;  3SYP A;  2LFS A;  4X66 O;  2Q67 A;  5C93 A;  5A2Q N;  5FNF A;  2ADP A;  5J2T B;  3E8H A;  5LGN A;  3ZED A;  5EBM C;  3ZJZ A;  4MW8 A;  3ML0 A;  4DYL A;  3CE2 A;  3CMA V;  4Z1V A;  1XEQ A;  5HFM A;  1YTF D;  1Y76 A;  1M9N A;  2BU5 A;  3CWV A;  1YSZ A;  1YIJ V;  4U3F H;  1YC3 A;  1AVM A;  4YY3 O;  4XBF A;  4KFG A;  5B1N A;  4X88 A;  1AB3 A;  2YC0 A;  4XKO A;  1FFX A;  4LFB O;  1KYO F;  2GDS A;  4FJC C;  3K5N A;  3BAA A;  1JPX A;  2XOK G;  5JCO A;  4X62 O;  4FPP A;  1L0O A;  4X1I A;  1F7Y A;  1SET A;  1L1F A;  3TCU A;  4PV1 B;  4DR7 O;  4DV0 O;  3G80 A;  4O4H A;  2HLD G;  1J5E O;  1IXB A;  1SQV H;  4TV9 B;  1P84 F;  1AI5 A;  4MPC A;  3ZRV A;  4BIU A;  4I0X B;  4MOT A;  3B8M A;  2QTO A;  2R72 A;  2DW4 A;  3PN1 A;  2ZXW B;  5CA1 B;  1I58 A;  4PDM A;  2YIB D;  3ABT A;  1KD1 W;  1ORQ C;  2DYS C;  4MVQ A;  4DV7 O;  1YCI A;  2GTS A;  4KHP O;  2JEU A;  2QGN A;  1I94 B;  4LF4 B;  3VHC A;  3MD0 A;  3GIG A;  4MVZ A;  4I9Q A;  1QLE C;  1IXM A;  1ZTE A;  3E83 A;  4FMT A;  5L3E A;  2M7W A;  1A4H A;  5LXT B;  4U93 A;  2EXL A;  4DUZ O;  2VRZ A;  4U3J A;  2Z3Y A;  3OEE G;  5F5R A;  4K0K O;  2YIA A;  1KKC A;  4X1K A;  2JS5 A;  3BHP A;  1FYJ A;  3CEI A;  2QFO A;  4UV9 A;  4EFE A;  3EHJ A;  3TGU H;  3INX A;  2PF4 E;  3AG3 B;  4L90 A;  1Z5V A;  1JVM A;  1QVG U;  4DR4 B;  3OT7 A;  1UY9 A;  4IL6 Z;  1YJW V;  1PVG A;  5H5N A;  1YES A;  2CUG A;  2YED A;  3SPG A;  1M57 C;  3C90 A;  1QZR A;  4EGI A;  1NHH A;  2CAZ C;  3ICX A;  5B1B C;  2IM9 A;  3K3W A;  3ASO C;  3EKR A;  4DR3 O;  4GKJ B;  3IED A;  2EJR A;  3JZ3 A;  2OTL V;  2XDL A;  3UKM A;  4HZ0 A;  3CME V;  4V25 A;  1XIL A;  4JI7 O;  3AG7 A;  1F23 A;  5J2T A;  2JIZ G;  2PTM A;  2EZP A;  3A8T A;  5IWA B;  4DR6 B;  2E74 B;  3ZHR A;  1SC5 B;  5LHI A;  4FLY A;  5M4P A;  4JI0 B;  5GTH Z;  3SYC A;  3JD4 A;  5CBH A;  4LF6 O;  3T1H O;  4R7C A;  5IYD O;  4WF9 V;  3CC2 V;  3CYG A;  1IBM O;  4O4I A;  4DXW A;  2ADQ B;  2QWQ B;  3QF7 A;  2Y0P A;  1I5Y A;  5IYZ A;  1ZAU A;  3QO5 A;  1MSW D;  2QKS A;  5CB4 A;  5LBQ A;  4OX9 O;  3K04 A;  3HKD A;  4XTJ A;  4X62 B;  4K8Z A;  2M6Y A;  1OCZ C;  2VQE O;  2Q4P A;  5JWP A;  1E79 G;  4O0B A;  3QTF A;  3G6B A;  4AHC A;  4GFN A;  3JCZ A;  3M7M X;  2YK9 A;  2W6J G;  1JOY A;  1I5C A;  1KC8 W;  2LO1 A;  3SYA A;  4PU9 A;  2UUC B;  1YEW A;  3JSL A;  1YS3 A;  4HNA A;  2Q7G A;  2QJ1 A;  2ZXW C;  2ZNJ A;  1I59 A;  2WA4 A;  2CCS A;  1GM8 A;  3WG7 C;  3WB0 A;  3RKZ A;  3ZMS A;  3CCJ V;  5H6R A;  2YI0 A;  2VW5 A;  2FYU H;  2EJ7 A;  3WB1 A;  4RUE A;  3K0D A;  1JM6 A;  3R66 A;  2P5O A;  1CEZ A;  3KCX A;  3RT3 C;  2IJI A;  3QVN A;  3L74 H;  2PUS A;  3C3S A;  5GTI Z;  2FKX A;  5LMN O;  3P3P A;  4HY6 A;  1SZT A;  2YEV B;  1JJ2 U;  4LPB A;  5FL7 G;  2BU6 A;  4HXZ A;  2X7R B;  3HR0 A;  2GSM B;  3ZMV A;  1UYF A;  3TXS A;  3OGI B;  1N33 O;  1MSD A;  1FXH A;  2WAM A;  4TSF G;  1O9H A;  4O4J A;  5E1A C;  4DV0 B;  2XDU A;  4MVU A;  2XDX A;  3K98 A;  4YKR A;  2HHH B;  2YKJ A;  3PEJ A;  3BCC H;  4WUD A;  2YS8 A;  2IJJ A;  2QR4 A;  4NH8 A;  2WI3 A;  2G38 A;  2K1E A;  3S3W A;  3WG7 B;  4PEL A;  3X2Q C;  3UCS C;  4GX2 A;  1GN4 A;  4JAA A;  3R92 A;  4YXW G;  3ETE A;  4JPR A;  2UUA O;  4JAU A;  5KAI Z;  3W7S A;  5IYB O;  3SJB C;  1G6U A;  3RYC A;  3JAK B;  2JJC A;  2OYQ A;  1BSM A;  5KAF Z;  3LDE A;  5LMU O;  4XIQ A;  5JJN B;  4EEQ A;  4JI3 B;  3K79 A;  2YEA A;  2HVK C;  1R3L C;  4IIJ B;  4FLU A;  2GUZ B;  3L75 H;  5KHI A;  1XNQ O;  1RP3 B;  2E75 B;  4H33 A;  4DR1 O;  1FXK C;  3HKE B;  3ZRW A;  1ZX3 A;  3QO7 A;  4DV3 B;  3SPJ A;  1YDX A;  3CGY A;  3FT5 A;  3MAQ A;  4DR2 O;  1K4D C;  1PP9 H;  4CC5 A;  3EKO A;  3SJQ C;  1UYM A;  4TOI A;  3F5T A;  3VHA A;  2KQX A;  2WI7 A;  4XDM A;  2LJ2 A;  3R65 A;  2YXL A;  2XT9 A;  1UYD A;  2RQ6 A;  2MW2 B;  4QJF B;  1OHH G;  3B2E E;  2V7Q G;  1K5S A;  1GRJ A;  3OW2 U;  2DOS A;  4PI2 A;  2XX4 A;  1KQS U;  4HBN A;  2VQE B;  3KKY A;  4H0L B;  1BYQ A;  1OSF A;  1OCZ B;  2YKB A;  2UXD O;  2QEX V;  4UV8 A;  1YSC A;  2QF6 A;  2XJX A;  1TVK B;  1URF A;  4ASU G;  4O2A A;  4H7Q A;  1I7F A;  5JJJ B;  2R9A A;  1CP9 A;  4JI1 B;  3WU2 Z;  4GKK O;  4XDK A;  2LP7 A;  1LR1 A;  3H01 A;  3ABL C;  2UXD B;  3BVO A;  1WNS A;  5BMV A;  3O9O A;  2RNB A;  3RYF A;  1CPY A;  2IW5 A;  1H2S B;  2BTO A;  1H2M A;  4KFM A;  4YKU A;  4ZVI A;  4B3S O;  3A0Y A;  1SRY A;  4PRV A;  5BR8 B;  3ZM7 A;  1GJV A;  4P7A A;  1YTF B;  5DN6 G;  3AG4 B;  4J7Z A;  1J5E B;  3JAS B;  5B66 Z;  2F93 B;  1SKV A;  5JVD A;  2YDE A;  4FLW A;  5K1P A;  4B6C A;  5IDJ A;  2B5U A;  3A0W A;  5LA6 B;  3JAT B;  1IBL O;  3ASN B;  2QG2 A;  2FB5 A;  3CP1 A;  4JZ2 A;  5D7D A;  4JAS A;  3LMM A;  2XUM A;  3T4Z A;  1Y66 A;  4EFT A;  1K5Q A;  2WWW A;  1R6K A;  1TUB A;  5JQG B;  1ZXN A;  1DTO A;  3C0E A;  3MHH C;  1Y6X A;  4D7T A;  4BWA A;  3OW6 A;  3ABM B;  4QE7 A;  4JI6 B;  2XND G;  2BU2 A;  2YE5 A;  2GHY A;  1Z5B A;  1MX0 A;  4URN A;  4YKZ A;  1EN6 A;  4GQT A;  2BTZ A;  1FKA O;  4R3A A;  2YE7 A;  2P7T C;  3U11 A;  4ZBM A;  3AEI A;  3CHX A;  2QM4 A;  5CPH A;  2XCM A;  1BKN A;  3OEH G;  4DW0 A;  3OM3 B;  3BEH A;  4H85 A;  2Q0A A;  2IJH A;  1M93 A;  1SQG A;  2Y69 B;  4XDJ A;  5L3C A;  3OTF A;  3E89 A;  5H9C A;  4JYA B;  4UXN A;  3VOU A;  3G7B A;  4EMV A;  3J80 N;  3DXR B;  1Q3E A;  3CCE V;  1OCO C;  3DC5 A;  3SJC C;  2X6C A;  3UT5 A;  1BCC H;  1Y4M A;  4LF9 B;  2UUB O;  5KMG B;  4O4J B;  3W7X A;  4Q6G A;  5IY5 B;  1JA8 A;  2JGD A;  2A06 H;  4CWO A;  4DV4 O;  3UO2 A;  1S0V A;  2DQ3 A;  1TAE A;  2PGG A;  2DYR C;  2XJG A;  1PKX A;  4K35 A;  1KMI Z;  1KKD A;  2ARH A;  2QM8 A;  5IJ0 B;  1ARO P;  3K5O A;  3RFR A;  2P90 A;  5M4K A;  2YID A;  1SQF A;  3TZ0 A;  4KXR A;  4LBE C;  5EBW C;  3H4L A;  3N2K A;  3ZHU A;  3HPL C;  3GIE A;  4FFB A;  4JI5 O;  3KE6 A;  2DJV A;  1MOF A;  2HVJ C;  2YE4 A;  3DSQ A;  4BW9 A;  1SA0 B;  4A5U B;  1KP2 A;  3IGA C;  5L3D A;  3LSU A;  4I9W A;  1WPX A;  3HZ5 A;  5LP6 B;  1KBH A;  2WI5 A;  5C8Y A;  1X4T A;  3G67 A;  1GN3 A;  1PV0 A;  2IOP A;  2EIM C;  1Y74 B;  5IY5 C;  4MVR A;  3G6E V;  2BRC A;  2VQF B;  3THO A;  3EHB B;  2F23 A;  3E8G A;  1GKX A;  1Y8N A;  2E0A A;  5M4H A;  2QA4 V;  1R3J C;  4KP4 A;  3NMQ A;  4HZ3 A;  3HKC B;  4LWS B;  1JR9 A;  1VP7 A;  1NVP D;  2Q6A A;  3D3I A;  1N32 B;  1Y4S A;  3JD0 A;  3SDL A;  5AG2 A;  2GQP A;  1UYH A;  4O04 A;  3FFQ A;  1YHQ V;  4GKK B;  1US7 A;  4UCS A;  4O4H B;  5L3J A;  2ZDX A;  2Q7E A;  3B4S A;  3OAA G;  4H81 A;  1SQX H;  2YEC A;  4NH7 A;  3A0T A;  3F7V C;  1EI1 A;  1ZWI C;  4DR5 B;  2ZE6 A;  1RPR A;  3MHS C;  2HR3 A;  2ETN A;  1MZF A;  4JF3 A;  5CF0 A;  1QLN A;  2JGD B;  1B06 A;  1XMO O;  4NB5 A;  2AXT Z;  1UPG A;  1V55 C;  1AR4 A;  1B6Q A;  3CCQ V;  3ASN C;  1JJO A;  3OMA B;  1U2O A;  2JJ2 G;  2XAB A;  1Q7Y W;  3JAW B;  5JH7 A;  3A0B Z;  1FD9 A;  1Q86 W;  1OJH A;  3K97 A;  1OCR C;  4GT1 A;  2ZE8 A;  4LF8 B;  1PPJ H;  4B3M B;  3H1K H;  4LWI A;  3ZN0 A;  4JI8 B;  3SJA C;  3B77 A;  5D5Q A;  1DK1 A;  1UYG A;  4DR1 B;  2DMX A;  4EB6 B;  1HR0 O;  4I55 A;  1U0Z A;  2PNR A;  2ZR3 A;  1HNX O;  3K60 A;  4OXS A;  4ZI7 B;  3K5L A;  4DUY O;  4DK1 A;  3HKD B;  2P67 A;  3RVY A;  2GTA A;  4DV5 O;  3RN4 A;  3BA9 A;  4J9Y B;  3GWK C;  1Z5A A;  2F43 G;  4WFE A;  4EGK A;  4O09 A;  1PL0 A;  1RPO A;  3LNU A;  1D2D A;  4PDL A;  5D7C A;  2UXC O;  1KUQ A;  1K3E A;  4DV2 O;  3HKE A;  4NTY A;  3ZRW B;  3CPW U;  5KUM A;  1UY8 A;  2N04 A;  2YKI A;  2P6J A;  3TXQ A;  4NXN O;  2Z0A A;  3CRR A;  4PJ0 Z;  1BE3 H;  3CCV V;  2WPD G;  1FFX B;  1H7U A;  1YIT V;  4MTG A;  1XNR O;  4JI1 O;  1YT1 A;  4P9O A;  4L94 A;  1ROP A;  4ICG A;  3J81 N;  3JCU Z;  2F95 B;  3JAT A;  1Z2G A;  3LSS A;  1XQ8 A;  2A3Q A;  3CD6 V;  4UCT A;  5BXZ A;  4TV9 A;  2XJJ A;  1N8R W;  3CWB H;  3HKC A;  4P30 A;  3TZ5 A;  4R50 A;  4JI4 B;  2AGA A;  1AMW A;  2E5L B;  3TJT A;  2JDI G;  2XAQ A;  3UT5 B;  4HYM A;  3ZXO A;  1VQ9 V;  3ZRX A;  2PYJ A;  1JX9 A;  2IOQ A;  4R8C A;  2CTP A;  4XKA A;  5JCO C;  2LQT A;  2AHY A;  4B3S B;  4AI8 A;  2YI8 A;  4JYY A;  4NR1 A;  4V26 A;  4ZOL B;  1YET A;  5IT9 N;  1YC1 A;  4RO2 A;  1I08 A;  1QCE A;  4O07 A;  3OD4 A;  4AQY B;  2HG1 A;  2X6B A;  4HZ5 A;  2B9Z A;  4QPK A;  4X1K B;  3P3N A;  1XMO B;  2WI2 A;  4JI5 B;  4ASF A;  4URM A;  5CBG A;  4NYK A;  4FK5 C;  3RYH A;  3CX5 F;  2WA3 A;  1YT2 A;  4B3T O;  2OCH A;  3Q5J A;  2N74 A;  1MZE A;  5B1O A;  3SR2 C;  4XD8 A;  4J10 A;  2YI7 A;  4JQL A;  3W7T A;  1LNQ A;  3GVM A;  3IC9 A;  3ZHV A;  1ZL8 A;  3T2S A;  4ZIB A;  5CA0 A;  4MP7 A;  4E01 A;  5EYP B;  4FCR A;  5CA1 A;  4QE9 A;  1F4M A;  5LOV A;  4RQF A;  1WA8 B;  3SYQ A;  1UYK A;  2XDK A;  3O0I A;  1NS1 A;  2EUL A;  3VQW A;  5EZY A;  1FJG B;  4F6R A;  1DF5 A;  2YEH A;  3I55 V;  2X0L A;  1N36 O;  3GIG B;  2XAF A;  4JI2 O;  2N05 A;  3K58 A;  3GIF A;  1QBZ A;  2JGU A;  1K7D A;  2O57 A;  4X66 B;  5CTU A;  1HNW O;  3JAR B;  1GM7 A;  3U2D A;  1TUE B;  3B40 A;  2H8P C;  3FB5 C;  2VWK A;  2YUA A;  4MB9 A;  3D3Q A;  1IDS A;  2X6A A;  2UXB O;  1BXD A;  3VQY A;  2XX5 A;  1KB9 F;  4LFC O;  5B5E Z;  3JAL B;  1G4Y B;  2CH4 A;  1W0J G;  3K9S A;  2LGQ A;  3H80 A;  3K5M A;  3U10 A;  3OPD A;  3RBZ A;  2KG7 A;  2YI6 A;  2NN4 A;  2H8M A;  1S77 D;  3VHD A;  3L9D A;  3FB6 C;  4LF5 O;  3RYI B;  4WFB V;  1BT8 A;  1UYI A;  2L6L A;  4YY3 B;  1Q6U A;  3KCY A;  3EVK A;  1GO3 F;  4FZ1 A;  4JI7 B;  1Q90 D;  3ZMZ A;  3AG4 C;  1PNL A;  2WEQ A;  1FXV A;  3L72 H;  4RAI A;  2CK3 G;  4MW3 A;  5KHJ A;  1NQT A;  3HEK A;  2EZO A;  4JYB A;  2V1D A;  2C1G A;  1VAR A;  2BZ5 A;  5GON A;  2LW7 A;  3JAM N;  2WLN A;  1L0N H;  1MG1 A;  1MMM A;  3FT8 A;  3RGB A;  2P06 A;  3D0B A;  4UFZ A;  2WI6 A;  4YJ3 A;  1N33 B;  3K9A A;  4O2B B;  4B7K A;  1VF6 A;  2WI4 A;  2VWJ A;  2DYS B;  4PA4 A;  1YT0 A;  4YJ3 B;  5FNV B;  4BQJ A;  4MT8 A;  1M5I A;  5EIB C;  4ASG A;  4LF4 O;  4ZI7 A;  1XHX A;  4U7N A;  4DR6 O;  4LF7 B;  2QG0 A;  3AG2 B;  4XE2 A;  3A0X A;  3CRK A;  3CRQ A;  3QG5 A;  2EIJ C;  4DRX A;  2VS0 A;  4JI2 B;  3T1H B;  5FNV A;  3OWB A;  1YZB A;  1AH8 A;  2QWP B;  1N4C A;  2ZE5 A;  3ZHS A;  2PI5 A;  4F6R B;  2DWE C;  5IDM A;  2FL4 A;  2YJW A;  1KIJ A;  3H1J H;  3A2F A;  3EXA A;  2CH7 A;  4JI4 O;  4E02 A;  1VQ5 V;  2ZE7 A;  1RM1 C;  5M4M A;  4CWR A;  2YEV A;  2PYL A;  3AG2 C;  3FD9 A;  1IBK O;  3IJ4 A;  4AIL C;  1N0N A;  4X64 O;  3T2M A;  2XHB A;  1BGQ A;  4LC1 A;  4JTD B;  2ZM6 O;  4LFA B;  5LMN B;  2WER A;  4TV8 B;  2XHX A;  4N23 A;  3D36 A;  1D5N A;  3F5W C;  4BXI A;  2ODM A;  3WB2 A;  4DV3 O;  5LHG A;  4LNU A;  3Q5K A;  4FVM A;  4X65 B;  4JGS A;  4X64 B;  2CTW A;  5EYP A;  1QNM A;  4I7Z B;  2EIM B;  5EIB D;  3HZ1 A;  2A7W A;  1ZL8 B;  4J42 A;  4FLV A;  2AKP A;  1I94 O;  2YIB A;  3EHF A;  2XD6 A;  5IN9 A;  4MTF A;  2QKA A;  1U96 A;  1GN2 A;  4JI0 O;  4I3H A;  2ZIN A;  3H1H H;  1THN A;  1PNM A;  3AK2 A;  1YXB A;  2ZKJ A;  2JRI A;  2IU0 A;  1HP8 A;  1SF9 A;  4YKQ A;  4FFK A;  2YE3 A;  4CH4 A;  4PA7 A;  4O4L A;  1EN4 A;  3M99 B;  2Y48 A;  5M4N A;  2HKO A;  1YSR A;  5A9G A;  3C11 A;  4LR3 A;  2WLM A;  1Y74 A;  3APO A;  1EN5 A;  1JQ0 A;  3A0R A;  4WFF A;  3BRC A;  2LGW A;  3BM9 A;  3ABU A;  5K1X A;  2QWN B;  1OCO B;  3N27 A;  2HCH A;  4DR7 B;  5LP6 C;  3R4O A;  4J41 A;  1IUR A;  2VQF O;  3K57 A;  3FX7 A;  3MNR P;  1VQ6 V;  2YEF A;  5LGT A;  5CA0 B;  1B63 A;  4CBC A;  1FS0 G;  3VQX A;  3RLP A;  2OIG A;  1S5L Z;  3ZMU A;  3ZMT A;  4ASA A;  1GKF A;  4BIZ A;  2YXH A;  3A0Z A;  3BFR A;  3OMU A;  3HYY A;  2YE2 A;  5KA6 A;  1NVP B;  1US6 A;  1TBW A;  1BQ0 A;  3CXC U;  1Q5O A;  4LF6 B;  1WA8 A;  2EIL C;  4ASB A;  1GH6 A;  3UO3 A;  4B7P A;  2IH3 C;  1AJP A;  4I50 B;  3ZKD A;  1WB8 A;  2MK3 A;  4CS4 A;  1R6T A;  1K92 A;  5D6P A;  5FNC A;  3JYC A;  3BMY A;  5KA5 A;  3AK1 A;  2DQ0 A;  3K59 A;  4NXM O;  1UY6 A;  3N2G B;  1KZN A;  4FM0 A;  1JMK C;  3VBB A;  1YJN V;  3RYF B;  3RW0 A;  4X1I B;  1XMQ O;  2RJZ A;  4UB6 Z;  4BW5 A;  2CCU A;  4URL A;  3JD3 A;  4OGQ B;  4R1F A;  4WUB A;  2A0L A;  4RQE A;  4YJ2 A;  2YJX A;  5DM6 V;  1M56 B;  4O2A B;  3ZIA G;  3PEH A;  2UUC O;  2FTK A;  5CB4 B;  3B27 A;  1AI6 A;  2AZ0 A;  1JFF A;  1H2N A;  4JV5 B;  4X65 O;  4DRX B;  1I5D A;  1WN7 A;  2WSS G;  4DR2 B;  4P2Z A;  1VQM V;  4YKT A;  4OPA A;  4J11 A;  2R9I A;  1ENV A;  1R73 A;  5LL6 Y;  5LOV B;  5FND A;  3QTC A;  1AJ6 A;  4ZKI A;  3CGZ A;  3CJH B;  4LFC B;  4LFB B;  1ZLZ A;  4R3M A;  1WJZ A;  2EIL B;  2Q68 A;  4CS3 A;  2YE6 A;  1KP3 A;  4UVB A;  2YK2 A;  5C8Y B;  3APQ A;  1RM1 B;  1Q6I A;  5JEN A;  2BU8 A;  4LWE A;  1I5X A;  4K3A A;  3B26 A;  2HJD A;  2XHT A;  1I5B A;  4YKX A;  3FAV A;  2HFE C;  1E1Q G;  4EGH A;  3EFF K;  2W6I G;  4L87 A;  4CH5 A;  2IWU A;  2UUB B;  3ABL B;  3R4M A;  1K34 A;  5EC2 C;  3LNM B;  4IT5 A;  3LDC A;  5GW7 A;  5ITZ B;  3T1C A;  4JI8 O;  1Y8O A;  1VIB A;  3CC7 V;  2ZBK B;  3FV5 A;  2OTJ V;  1FXK B;  1ID0 A;  1Q43 A;  3VQV A;  4LWG A;  3W7W A;  3FYI B;  1VQO V;  4B08 A;  2GV9 A;  1AI4 A;  1HWY A;  5KX5 A;  2Q8F A;  3FB7 C;  3IFX A;  2W0X A;  4NTW A;  5JH7 B;  4B3T B;  4FLZ A;  2F4V O;  3TZ2 A;  4LWF A;  2KB1 A;  2BT0 A;  3R91 A;  1V54 C;  4GT8 A;  4UVC A;  4CH3 A;  3U0Z A;  4CC6 A;  2R9R B;  3WFV A;  1P49 A;  3K08 A;  3CXH F;  1YC4 A;  4FM1 A;  2HKJ A;  4F4L A;  1PL4 A;  2IU3 A;  1RSO B;  3OGC C;  3GWO A;  4E00 A;  3FAV B;  2OT5 A;  4C7U A;  3OR6 C;  4X1Y A;  2VWC A;  3QNE A;  1F4N A;  4MTX A;  4D6T H;  2UU9 O;  4MP2 A;  5KMG A;  4B3R O;  2JEX A;  1QVF U;  4URO A;  1K33 A;  1DGS A;  3AG1 C;  1A32 A;  4MSW C;  4JZG A;  3CRM A;  2V4D A;  3I56 V;  4GGL A;  1SQQ H;  3BPZ A;  4QGP A;  4QIW F;  1W2B U;  1AR1 B;  3JD1 A;  1UY7 A;  4EFB A;  3T0Z A;  4HXW A;  1NHJ A;  4O2B A;  2JS3 A;  4U3J B;  2Q7H A;  2JK5 C;  3P30 A;  2CTQ A;  4UCR A;  5LYJ A;  1S72 V;  4UCO A;  4L93 A;  4UUJ C;  1K73 W;  4KUM A;  1H2L A;  1PNK A;  2ITD C;  1NR7 A;  4LP0 A;  4YKW A;  3P32 A;  2YSU B;  2WLH A;  1NR1 A;  1OCC C;  2A79 B;  4GX1 A;  1BS3 A;  2ZIO A;  3HB3 B;  3L70 H;  4FFB B;  4TQD A;  1QY8 A;  2OWO A;  1RFY A;  3D8C A;  2JJ1 G;  4YKY A;  1H8H G;  5KLV H;  4XKK A;  3S3X A;  1V9P A;  2YGF A;  4CE1 A;  1AJQ A;  4MPE A;  3TET A;  1R3I C;  3LDD A;  4CWS A;  4AWP A;  2EIN B;  1S5H C;  5H2F Z;  4I50 A;  1THZ A;  2Q73 A;  1HW7 A;  4CE2 A;  1F51 A;  1QHT A;  5KHG A;  5L3B A;  3OE7 G;  2YXY A;  1MNG A;  2IOR A;  3HYZ A;  3N2G A;  2FWZ A;  1UYL A;  1W0K G;  4PA9 A;  1AIL A;  4ABM A;  1X59 A;  1ZXM A;  3NXS A;  4BIO A;  1V55 B;  4JYC A;  1COW G;  4LH7 A;  4YJ2 B;  2CCT A;  4WFH A;  3DXR A;  4K4O A;  4AWQ A;  3ASO B;  2F1M A;  3FKS G;  3O65 A;  1K8A W;  3INW A;  1IZ3 A;  2O1V A;  3E35 A;  4EKW A;  1JCH A;  1NKD A;  3ZX6 A;  3B09 A;  5FLX N;  4GUN A;  1N34 B;  1VEW A;  2Q2E B;  4L91 A;  2GFD A;  5J2U A;  5FPR A;  3ABK B;  3J7A U;  2XAG A;  4NXN B;  1UYC A;  3OTO B;  3ZHT A;  1NH2 B;  1WP8 A;  4YIP A;  5CN0 A;  3K03 A;  3CYO A;  1GMG A;  4PA3 A;  1NZ6 A;  4YHH O;  1HNX B;  2Y4U A;  1Z5W A;  2CGN A;  1N32 O;  4I4T A;  5CBF A;  5L3G A;  5LYJ B;  5L3F A;  5IYC O;  2HHI A;  2Y4T A;  2RMK B;  2EIN C;  3IAY A;  4PDR A;  2Y69 C;  1YF2 A;  3OTO O;  5TIS Z;  1QQC A;  1WLE A;  1SER A;  1NTK H;  5GON B;  4DUY B;  3JSN A;  5GGZ A;  2BTQ B;  1SES A;  5F2V O;  4X89 A;  2ATK C;  4IHJ B;  2ITC C;  1J95 A;  2HEP A;  3AG3 C;  4U7O A;  1XBL A;  2XHR A;  1KU9 A;  1XUQ A;  2QDO A;  1O9G A;  2BSK B;  1NTM H;  2CE4 A;  3OFN G;  1WAZ A;  3CCM V;  2IH1 C;  4GKJ O;  2OCC C;  2JKI A;  3H1L H;  1P7G A;  5DEC A;  1R62 A;  1S3J A;  1BL8 A;  2IJK A;  2ZDI C;  4KTN A;  1BZK A;  3B28 A;  1NHI A;  4JTC B;  1PM9 A;  3BY6 A;  3B24 A;  2HJF C;  5B3S C;  1UJW B;  4DUZ B;  1BMF G;  1NH2 D;  2FWY A;  4PL9 A;  1VQ8 V;  1GK9 A;  5B3S B;  3ZN1 A;  1TVK A;  1I0H A;  1M56 C;  1S14 A;  1IBM B;  4MVM A;  4X20 A;  3STL C;  4IGG A;  2P4V A;  4G2K A;  3LSQ A;  2QE7 G;  5M4E A;  4EM7 A;  1T5E A;  2Q69 A;  4XIT A;  2FML A;  3ZHQ A;  3MDS A;  1N0J A;  4LCU C;  1AM1 A;  1GM9 A;  3G7E A;  3AK3 A;  3OMI B;  4WFA V;  4L8J A;  4DV5 B;  2WLK A;  4G27 B;  2BE3 A;  2ZNI A;  3SPC A;  1H7S A;  4KQV A;  1WB7 A;  4BQG A;  3CRL A;  4CWP A;  2CTR A;  2DE0 X;  3JAL A;  3CS5 A;  1HNZ O;  1N36 B;  2D2C B;  2Z5U A;  1ZSP A;  2WI1 A;  4TT3 G;  4PDV A;  2EBO A;  2BU7 A;  2CGF A;  3O2F A;  3CCU V;  2HHH O;  1VQL V;  3E86 A;  4LF8 O;  4B3M O;  2BOC C;  2E5L O;  1XOU A;  2Q5Z A;  3K06 A;  3N2K B;  4P8O A;  3E22 B;  1TUB B;  1NJI W;  1HR0 B;  1Y8P A;  3JD2 A;  4TQF A;  3ZXQ A;  3U67 A;  4P9P A;  2WLI A;  4FM2 A;  1Z5C A;  3ZS8 C;  1TH8 A;  1WPB A;  1SQP H;  4KSH A;  3JAW A;  5CTY A;  4DK0 A;  3H1I H;  2UU9 B;  1S76 D;  4ZHQ A;  2KG7 B;  3AG1 B;  4RUF A;  4H37 A;  1QYE A;  1AP6 A;  2ZDI A;  2IWS A;  5J2U B;  2R70 A;  5CMU A;  3H9V A;  1UFI A;  3HKB A;  4FLT A;  5IJ9 B;  3LUT B;  2CGO A;  2ESA A;  1ZUQ A;  1EFR G;  4DV6 B;  1W59 A;  2YI5 A;  1K4C C;  4FCP A;  5LMU B;  3ZRS A;  1LUW A;  4F6E A;  5KUK A;  1OCR B;  1VMG A;  1YER A;  1D5A A;  1Y67 A;  3KZI Z;  4GX5 A;  1PD3 A;  3NR7 A;  2WEP A;  3E2E A;  1R1B A;  1IX9 A;  2DN9 A;  4CWQ A;  2GBO A;  3JAK A;  4KSG A;  2EX3 A;  4TWK A;  1YVW A;  5EC1 C;  3CCL V;  5HFL A;  2P4K A;  4LWS A;  4JI6 O;  3RVZ A;  2YEI A;  2YEE A;  4CE3 A;  3BAB A;  1R6N A;  2XAH A;  3DGE A;  2BRE A;  2YKE A;  1CXZ B;  4GLX A;  2ZM6 B;  4LFA O;  3EHG A;  3BA8 A;  2YI9 A;  2OCC B;  3HKB B;  4B3R B;  1DLB A;  3T1K A;  1AI7 A; 
#chains in the Genus database with same CATH homology
 4WUB A;  2QFO A;  4UV9 A;  2A0L A;  1YHQ V;  1US7 A;  3EHJ A;  4RQE A;  1KEC A;  1P7B A;  3INX A;  5L3J A;  2ZDX A;  3K0G A;  1G8M A;  5DM6 V;  2YJX A;  3RLR A;  3AG3 B;  3OAA G;  4QPJ A;  4H81 A;  4L90 A;  1M56 B;  2YEC A;  3HHU A;  1JVM A;  3ZIA G;  1QVG U;  3QO8 A;  3PEH A;  4NH7 A;  4EEH A;  3A0T A;  1UY9 A;  2FTK A;  3F7V C;  1YJ9 V;  1AI6 A;  1YJW V;  1EI1 A;  1PVG A;  1YES A;  3B27 A;  2YED A;  4GX0 A;  1ZWI C;  5BOD A;  3SPG A;  3SPI A;  1MAB G;  1RPR A;  3MHS C;  1I5D A;  2HR3 A;  1QLE B;  1M57 C;  2WSS G;  4GCZ A;  4JF3 A;  5CF0 A;  4YKT A;  4P2Z A;  1VQM V;  1QLN A;  1QZR A;  1NHH A;  4EGI A;  4PA6 A;  2R9I A;  5B1B C;  1ENV A;  1R73 A;  1ZW9 A;  3K3W A;  3ASO C;  2YGE A;  4XDL A;  2VCJ A;  3EKR A;  1AJ6 A;  5FND A;  3WHA A;  4ZKI A;  3CGZ A;  1I5A A;  3IED A;  2EJR A;  1V55 C;  5H6Q A;  2NLJ C;  1ZWH A;  4XIP A;  3JZ3 A;  2OTL V;  2XK2 A;  1B6Q A;  3CCQ V;  2EIL B;  3ASN C;  3UKM A;  2XDL A;  1U2O A;  3OMA B;  4HZ0 A;  2JJ2 G;  2O1U A;  3ETD A;  4NH9 A;  3CME V;  2XAB A;  3OWD A;  3U2K A;  1Q7Y W;  4V25 A;  1GTO A;  2Q68 A;  2YE6 A;  1KP3 A;  4UVB A;  1Q86 W;  2YK2 A;  3K97 A;  4WFG A;  4CWN A;  1OCR C;  1RM1 B;  2BU8 A;  4LWE A;  1F23 A;  4GT1 A;  1I5X A;  2JIZ G;  5B1B B;  3B26 A;  2EZP A;  3STZ C;  2XHT A;  1I5B A;  4YKX A;  2HFE C;  1E1Q G;  4LWI A;  3ZN0 A;  4EGH A;  3EFF K;  5LHI A;  3B77 A;  2W6I G;  5M4P A;  1EZJ A;  4L87 A;  3SYC A;  1UYG A;  3JD4 A;  5CBH A;  3OUS A;  2FXS A;  2IWU A;  2YGA A;  1M1K W;  2VCI A;  4R7C A;  5BZB A;  5IYD O;  4WF9 V;  3CC2 V;  2D3O W;  2UXN A;  4W7T A;  1U0Z A;  2UXX A;  4JAV A;  2PNR A;  4XIR A;  2ZR3 A;  3ABL B;  3GB7 C;  3R4M A;  3K60 A;  1Q82 W;  4OXS A;  1Z59 A;  1K34 A;  5EC2 C;  4DXW A;  3LNM B;  1Q81 W;  3LDC A;  5GW7 A;  3RVY A;  1I5Y A;  2B1I A;  2P67 A;  3T1C A;  4PRX A;  3QO5 A;  2DYR B;  4J9Y B;  2QKS A;  1MSW D;  5LBQ A;  4CZZ A;  1Y8O A;  3CC7 V;  1Z5A A;  2YEJ A;  3CCR V;  2OTJ V;  1FXK B;  1ID0 A;  2ZBK B;  3K04 A;  3FV5 A;  4LWG A;  3W7W A;  4XTJ A;  2F43 G;  3FYI B;  4WFE A;  1VQO V;  1VQ4 V;  4EGK A;  1AI4 A;  1HWY A;  1PL0 A;  1RPO A;  3LNU A;  4O09 A;  3FB7 C;  1OCZ C;  3IFX A;  5B1A C;  2Q8F A;  4PDL A;  5D7C A;  1E79 G;  1K3E A;  3ZRW B;  4O0B A;  3CPW U;  2YEG A;  3QTF A;  5KUM A;  3TZ2 A;  1UY8 A;  4URL A;  4GFN A;  4LWF A;  3IC7 A;  3JCZ A;  3O6O A;  2KB1 A;  2W6J G;  2YK9 A;  1JOY A;  2BT0 A;  1I5C A;  2YKI A;  2P6J A;  1KC8 W;  3R91 A;  2YEB A;  3CCV V;  2WPD G;  1V54 C;  4GT8 A;  1H7U A;  1YIT V;  1B62 A;  4UVC A;  3SYA A;  4XC0 A;  4MTG A;  2Q8I A;  3TTZ A;  4PU9 A;  4AWO A;  1YS3 A;  1YT1 A;  3ETG A;  3T0H A;  4P9O A;  2R9R B;  3WFV A;  2XX2 A;  4L94 A;  2XAJ A;  3K08 A;  2B1G A;  2WLI B;  1ROP A;  2ZXW C;  1GKZ A;  1I59 A;  1YC4 A;  4J9Z B;  2BYH A;  3LSS A;  2CG9 A;  2CCS A;  2HKJ A;  4F4L A;  1GM8 A;  2IU3 A;  3WG7 C;  3CD6 V;  3OGC C;  3GWO A;  3RKZ A;  1BHB A;  2XJJ A;  2H94 A;  1N8R W;  3ZMS A;  1VQN V;  4E00 A;  3CCJ V;  5H6R A;  4P30 A;  3TZ5 A;  2OT5 A;  4R50 A;  2YI0 A;  2VW5 A;  1AMW A;  3OR6 C;  4LWH A;  4RUE A;  3K0D A;  1JM6 A;  2JDI G;  3OUF A;  2VWC A;  2XAQ A;  3QNE A;  4HYM A;  1F4N A;  3ZXO A;  1CEZ A;  4MTX A;  1VQ9 V;  3ZRX A;  2IJI A;  1JX9 A;  4MP2 A;  2IOQ A;  2JEX A;  3ZCC A;  2H55 A;  1QVF U;  1M57 B;  4URO A;  1TC0 A;  4R8C A;  3LPS A;  4XCJ A;  4XKA A;  1K33 A;  2AHY A;  1SZT A;  2YEV B;  4HY6 A;  3AG1 C;  4MSW C;  5EK0 A;  1TC6 A;  1DF4 A;  3E8B A;  3I56 V;  1JJ2 U;  4GGL A;  4LPB A;  4V26 A;  5J6A A;  5FL7 G;  2QM7 A;  1YET A;  1YC1 A;  4QIW F;  4RO2 A;  1AR1 B;  1W2B U;  3T10 A;  3JD1 A;  2BU6 A;  1QCE A;  2X7R B;  3FYE B;  2GSM B;  1UY7 A;  4HXZ A;  4O07 A;  3T0Z A;  3ZMV A;  4HXW A;  1NHJ A;  1UYF A;  4WCE V;  3ABM C;  2HG1 A;  1S16 A;  1OCC B;  1XL4 A;  2JK5 C;  1FXH A;  2X6B A;  3P30 A;  4HZ5 A;  4DZY A;  2WAM A;  4QPK A;  4TSF G;  3VAD A;  1S72 V;  2WI2 A;  3D2R A;  5E1A C;  4UUJ C;  4L93 A;  2WLL A;  4ASF A;  1OZ0 A;  4KUM A;  1K73 W;  2ITD C;  1PNK A;  1VQ7 V;  2XDU A;  1NR7 A;  5CBG A;  2YKC A;  4LP0 A;  4URM A;  4YKW A;  4MVU A;  2XDX A;  3K98 A;  4YKR A;  4FK5 C;  2YKJ A;  2EIJ B;  4MPN A;  4MVS A;  3P32 A;  3PEJ A;  3SL2 A;  1YT2 A;  4WUD A;  2IJJ A;  2YSU B;  2WLH A;  3R4P A;  1NR1 A;  1OCC C;  4NH8 A;  2A79 B;  2WI3 A;  3Q5J A;  4GX1 A;  2K1E A;  3HB3 B;  1QY8 A;  3Q5L A;  5B1O A;  4XD8 A;  3TUH A;  3WG7 B;  3OR7 C;  4PEL A;  3X2Q C;  2YI7 A;  1BHA A;  3FB8 C;  4GX2 A;  3W7T A;  4JQL A;  1LNQ A;  3WQ9 A;  3R92 A;  4YXW G;  3ETE A;  4JPR A;  2JJ1 G;  4MP7 A;  5CTW A;  3T2S A;  4E01 A;  3G75 A;  4YKY A;  4JAU A;  1H8H G;  4N21 A;  4L8Z A;  4XKK A;  3ZKB A;  2YGF A;  3W7S A;  4FCR A;  5IYB O;  4CE1 A;  1AJQ A;  4QE9 A;  1F4M A;  4RQF A;  1M90 W;  4I5S A;  3TET A;  4HY1 A;  4MPE A;  1R3I C;  2JJC A;  3LDD A;  4CWS A;  3SYQ A;  1UYK A;  4AWP A;  3LDE A;  2XDK A;  2EIN B;  1S5H C;  3O0I A;  1QR8 A;  1THZ A;  4XIQ A;  2XDS A;  2ZQM A;  4CE2 A;  5FWK A;  1DF5 A;  2YEH A;  3K79 A;  1F51 A;  3I55 V;  2X0L A;  2YEA A;  3F7Y C;  4R6Z A;  2HVK C;  5L3B A;  2BSM A;  3KG2 A;  3GIG B;  2XAF A;  3OE7 G;  2IOR A;  3HYZ A;  4DUH A;  1R3L C;  3GIF A;  1Y4U A;  1QBZ A;  1K7D A;  2FWZ A;  4H33 A;  1W0K G;  1UYL A;  2ZDY A;  4PA9 A;  1FXK C;  2HG5 C;  3T4D A;  3ZRW A;  3QO7 A;  4FIP C;  3SPJ A;  5CTU A;  3CGY A;  1B3Q A;  3FT5 A;  1K4D C;  3SYO A;  2UWD A;  2DWD C;  1GM7 A;  3EKO A;  3ABK C;  2ZR2 A;  3SJQ C;  4Z1M G;  1UYM A;  1TUE B;  3U2D A;  2H8P C;  3FB5 C;  4GEE A;  3VHA A;  1ZXM A;  3NXS A;  2WI7 A;  4XDM A;  4MB9 A;  2X6A A;  1V55 B;  3R65 A;  1BXD A;  5J9P C;  4JYC A;  2XX5 A;  4MTO A;  1COW G;  1UYD A;  1G4Y B;  2CCT A;  4QJF B;  2CH4 A;  1W0J G;  4FCQ A;  4WFH A;  1OHH G;  4K4O A;  2V7Q G;  1K5S A;  3ASO B;  3OW2 U;  3H80 A;  4AWQ A;  3FKS G;  4JTA B;  1K8A W;  2XX4 A;  2LFR A;  3INW A;  2O1V A;  3OPD A;  3E35 A;  4EKW A;  1KQS U;  4HYO A;  3RBZ A;  2YI6 A;  1JCH A;  1NKD A;  2W0F C;  1YI2 V;  2PI4 A;  3TZ4 A;  1BYQ A;  1OSF A;  2H8M A;  1OCZ B;  5B1A B;  1S77 D;  2C2A A;  2QEX V;  3FB6 C;  2Q2E B;  4UV8 A;  2YKB A;  4L91 A;  3VHD A;  4EFU A;  2GFD A;  4WFB V;  1UYI A;  3ABK B;  1YSC A;  2XAG A;  1E1R G;  2QF6 A;  2XJX A;  4ASU G;  1GO3 F;  1UYC A;  3ZMZ A;  1NH2 B;  4H7Q A;  5CN0 A;  3K03 A;  3AG4 C;  1EA6 A;  1PNL A;  2WEQ A;  3CYO A;  1GMG A;  1CP9 A;  1FXV A;  4XDK A;  4PA3 A;  4RAI A;  2LP7 A;  2FYP A;  5J71 A;  2CK3 G;  3H01 A;  5LHH A;  3W7U A;  4MW3 A;  4G28 B;  3ABL C;  1EBO A;  3SPH A;  2K5B A;  2BOB C;  5CBF A;  4XCL A;  1H8E G;  5L3G A;  1NQT A;  1K9M W;  5L3F A;  2EZO A;  4JYB A;  2V1D A;  5IYC O;  1TIL A;  3HEK A;  1CPY A;  2BZ5 A;  2EIN C;  3EHH A;  2IW5 A;  4PDR A;  2Y69 C;  4Q20 A;  4KFM A;  2EIK B;  2WLN A;  4YKU A;  4ZVI A;  1MG1 A;  1WLE A;  1SER A;  3FT8 A;  3D0B A;  3A0Y A;  2WI6 A;  1SRY A;  5GGZ A;  3PJS K;  4PRV A;  1SES A;  3ZM7 A;  1GJV A;  3K9A A;  4P7A A;  3DTU B;  5DN6 G;  3E8F A;  2ATK C;  3AG4 B;  4X89 A;  1YTF B;  2WI4 A;  2ITC C;  4AS9 A;  1J95 A;  1YT0 A;  2DYS B;  4PA4 A;  3AG3 C;  2WLJ A;  4U7O A;  4WUC A;  4B6C A;  4BQJ A;  4MT8 A;  5IDJ A;  4E2L A;  2B5U A;  2IWX A;  4QNH B;  2XHR A;  3A0W A;  5EBL C;  4ASG A;  1P4R A;  4U7N A;  3ASN B;  2XAS A;  3OFN G;  2QG2 A;  2YE8 A;  2QG0 A;  3CCM V;  1QR9 A;  3AG2 B;  2IH1 C;  3CP1 A;  4MBC A;  5D7D A;  2OCC C;  4XE2 A;  4JAS A;  3B8N A;  2JKI A;  3A0X A;  2Q8G A;  1R62 A;  3OMN B;  3CRK A;  1S3J A;  1BL8 A;  2EIJ C;  2IJK A;  2ZDI C;  1Y66 A;  3T4Z A;  4HYP A;  3B28 A;  4KTN A;  4EFT A;  1NHI A;  4CWF A;  4JTC B;  3BY6 A;  3B24 A;  3OWB A;  2HJF C;  1K5Q A;  5B3S C;  1UJW B;  1BMF G;  1AH8 A;  4BAY A;  2WWW A;  1NH2 D;  1R6K A;  2FWY A;  4DO2 A;  4PL9 A;  1NBM G;  3TK1 A;  1VQ8 V;  1ZXN A;  2PI5 A;  1DTO A;  1GK9 A;  3C0E A;  3MHH C;  2DWE C;  4CWT A;  1VQK V;  5CTX A;  5D7R A;  2YJW A;  5IDM A;  2NNU A;  1KIJ A;  5CA3 A;  5B3S B;  3ABM B;  4QE7 A;  3OW6 A;  4X9L A;  2O1W A;  1H38 A;  3ZN1 A;  2XND G;  3CCS V;  2BU2 A;  2YE5 A;  2GHY A;  1VQ5 V;  1Z5B A;  4E02 A;  1MX0 A;  1RM1 C;  5M4M A;  1M56 C;  1S14 A;  1UYE A;  4CWR A;  4MVM A;  4URN A;  1H2G A;  2YEV A;  3G71 V;  3AG2 C;  3STL C;  1K97 A;  4YKZ A;  4GQT A;  4G2K A;  3LSQ A;  1XL6 A;  2QE7 G;  1FXK A;  2BTZ A;  4EM7 A;  5M4E A;  3T2M A;  5LGU A;  4HAM A;  1AH6 A;  3G4S V;  1TID A;  2Q69 A;  2AHZ A;  3R4N A;  2A9H A;  2YE7 A;  1BGQ A;  4R3A A;  4XIT A;  5D6Q A;  2P7T C;  4ZBM A;  4LC1 A;  3AEI A;  4JTD B;  2YE9 A;  4LCU C;  1AM1 A;  2WER A;  5CPH A;  2XHX A;  1GM9 A;  3D36 A;  4N23 A;  3QDD A;  2XCM A;  3F5W C;  3G7E A;  1BKN A;  3OEH G;  4LP8 A;  3RLQ A;  3T1K A;  4BXI A;  3OM3 B;  3BEH A;  4H85 A;  3OMI B;  4WFA V;  1AJN A;  4O05 A;  5LHG A;  2IJH A;  2WLK A;  4G27 B;  4MVO A;  3Q5K A;  2ZD9 A;  2EIK C;  4JGS A;  5F3K A;  2Y69 B;  3SPC A;  2EIM B;  1H7S A;  2BYI A;  3HZ1 A;  4KQV A;  4BQG A;  2WLL B;  1FFT B;  4XDJ A;  2AKP A;  5L3C A;  3CRL A;  4CWP A;  2Q8H A;  4MS2 A;  2XD6 A;  3EHF A;  5IN9 A;  4MTF A;  3E89 A;  5H9C A;  4UXN A;  4X8A A;  3UM7 A;  3VOU A;  3G7B A;  4EMV A;  2Z5U A;  2WI1 A;  4I3H A;  4TT3 G;  1THN A;  1PNM A;  3X2Q B;  4PDV A;  2EBO A;  2ZKJ A;  3CCE V;  2BU7 A;  2IU0 A;  2CGF A;  3O2F A;  3CCU V;  4BAE A;  1VQL V;  3E86 A;  3K99 A;  4YKQ A;  1OCO C;  2YE3 A;  2BOC C;  4UVA A;  2X6C A;  1V54 B;  4PA7 A;  3K06 A;  4P8O A;  3CC4 V;  5BOC A;  1VQP V;  1Y4M A;  3M99 B;  1NJI W;  2Y48 A;  1Y8P A;  3B25 A;  5M4N A;  1R3K C;  2HKO A;  3JD2 A;  1MU5 A;  3SYP A;  1YSR A;  2LFS A;  3C11 A;  3ZXQ A;  2WLM A;  2Q67 A;  3W7X A;  5C93 A;  4R3M A;  5FNF A;  3U67 A;  1JQ0 A;  5IY5 B;  4P9P A;  3A0R A;  3E8H A;  4WFF A;  4CWO A;  5LGN A;  2WLI A;  5EBM C;  3ZJZ A;  4MW8 A;  1S0V A;  3ML0 A;  2DQ3 A;  3BM9 A;  1Z5C A;  1TH8 A;  2DYR C;  3CMA V;  2XJG A;  1PKX A;  3ABU A;  5HFM A;  1OCO B;  1YTF D;  2HCH A;  4KSH A;  1KKD A;  1M9N A;  2BU5 A;  3CWV A;  1YSZ A;  5CTY A;  1YIJ V;  3R4O A;  2QM8 A;  1ARO P;  1YC3 A;  1S76 D;  3AG1 B;  4XBF A;  4KFG A;  2P90 A;  4X88 A;  5B1N A;  5M4K A;  4XKO A;  3MNR P;  4RUF A;  1VQ6 V;  4H37 A;  1QYE A;  4FJC C;  2ZDI A;  2IWS A;  2YEF A;  5LGT A;  5CMU A;  1B63 A;  1JPX A;  4CBC A;  2XOK G;  3TZ0 A;  1FS0 G;  4FPP A;  3LUT B;  3RLP A;  1L0O A;  4LBE C;  5EBW C;  3ZMU A;  1SET A;  3H4L A;  2ESA A;  3ZMT A;  3HPL C;  3GIE A;  1L1F A;  3TCU A;  4ASA A;  1EFR G;  1GKF A;  2YI5 A;  4BIZ A;  1K4C C;  3KE6 A;  4FCP A;  2HLD G;  3ZRS A;  5KUK A;  1MOF A;  2HVJ C;  3A0Z A;  1OCR B;  2YE4 A;  3OMU A;  1AI5 A;  4MPC A;  3ZRV A;  1YER A;  4BIU A;  2YE2 A;  3HYY A;  4GX5 A;  5KA6 A;  1KP2 A;  3B8M A;  2QTO A;  1NVP B;  1PD3 A;  1TBW A;  4MOT A;  2DW4 A;  2WEP A;  3IGA C;  2ZXW B;  3CXC U;  3E2E A;  5L3D A;  4I9W A;  1I58 A;  1WPX A;  4PDM A;  3HZ5 A;  4CWQ A;  2WI5 A;  2EIL C;  4ASB A;  3ABT A;  1KD1 W;  1ORQ C;  4KSG A;  4TWK A;  2DYS C;  4MVQ A;  5EC1 C;  4B7P A;  2IH3 C;  2JEU A;  1AJP A;  3ZKD A;  3CCL V;  2MK3 A;  5HFL A;  1K92 A;  3RVZ A;  2YEI A;  5D6P A;  3JYC A;  2YEE A;  5FNC A;  3VHC A;  3BMY A;  2IOP A;  4CE3 A;  2EIM C;  3MD0 A;  5KA5 A;  5IY5 C;  3GIG A;  1R6N A;  2DQ0 A;  4MVZ A;  4MVR A;  3G6E V;  2BRC A;  1QLE C;  1GKX A;  3EHB B;  1IXM A;  3E8G A;  1UY6 A;  2XAH A;  3E83 A;  4FMT A;  5L3E A;  1Y8N A;  3DGE A;  2QA4 V;  1KZN A;  2M7W A;  2E0A A;  5M4H A;  1A4H A;  1R3J C;  4KP4 A;  2BRE A;  3VBB A;  4HZ3 A;  3NMQ A;  4U93 A;  1YJN V;  2EXL A;  2YKE A;  3RW0 A;  2Z3Y A;  3EHG A;  3OEE G;  5F5R A;  2OCC B;  1NVP D;  2Q6A A;  3D3I A;  1Y4S A;  4BW5 A;  1DLB A;  3JD0 A;  2CCU A;  1AI7 A;  3JD3 A;  2GQP A;  1UYH A;  4O04 A;  4R1F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...