5C93A

Histidine kinase with atp
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
239
structure length
235
Chain Sequence
VTEQQKIDNDRKQFVSNVSHELRTPLTSLRSYIEALSDGAWKDPEVAPGFLKVTQEETDRMIRMINELLSLSRMDSGTTRVDMELVNINEMFNYVLDRFDMILKKDDNPAKYYTIKREFTKRDLWVEIDTDKFTQVLDNIMNNAIKYSPDGGVVTCRLLETHNQVIISISDQGLGIPRADLGHVFDRFFRVDKAQGGTGLGLAISKEVVQMLGGRIWVDSVEGKGSTFYISLPYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Conformational dynamics of the essential sensor histidine kinase WalK.
pubmed doi rcsb
source organism Lactobacillus plantarum 16
molecule tags Transferase
molecule keywords Histidine kinase
total genus 82
structure length 235
sequence length 239
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2015-06-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5c93A01
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 5c93A02
2JKIA 3U2DA 3FT8A 3ZXOA 4FCRA 4GT8A 2VCIA 3A0ZA 3R4PA 4HXWA 4BIZA 4GEEA 4MPEA 2BU7A 4URNA 2JJCA 1YC4A 4ASBA 3B25A 5J6AA 4JAVA 1YT2A 3CGYA 5BODA 2O1VA 3A0RA 2WI4A 2XHRA 5CTYA 1S16A 3ZRVA 2XABA 4HZ5A 3HZ5A 1UYLA 1THNA 5CTUA 3GIGB 4UROA 1JOYA 3HZ1A 4EMVA 3BM9A 4MOTA 1TIDA 4YKQA 1UYFA 5CTXA 3G7EA 4PU9A 4LWGA 4CWPA 1UYMA 2E0AA 1Z5CA 1U0ZA 4ASFA 2BU8A 2HCHA 4ASGA 4BXIA 3ZRWB 4Q20A 4PL9A 1TILA 4HY6A 4XCJA 3U67A 2FWYA 4CWRA 1UY8A 3CGZA 1GKZA 4LWIA 2O1WA 4I5SA 2IORA 4XITA 4NH7A 4YKZA 3HYZA 1I59A 3OPDA 3EKRA 4H85A 4AWQA 1UYDA 3TZ4A 1YS3A 4WUCA 2Q8FA 2UWDA 4LWEA 4HYPA 4NH8A 1BKNA 4KFGA 1ZXNA 1OSFA 2WI6A 2WWWA 1KIJA 2YEHA 1BXDA 4GQTA 2QF6A 1F51A 1I5CA 4YKRA 4HXZA 2XJXA 2O1UA 4XD8A 2GFDA 4BIUA 2YJXA 4CWQA 1UYHA 4CWOA 2YEFA 4LWHA 4ZVIA 3BMYA 4LWFA 4CWTA 3A0XA 4V26A 2QM8A 4URLA 1YERA 4BAEA 3FV5A 2YEJA 4U7NA 3VADA 3EHGA 4R1FA 1YSZA 4GGLA 4W7TA 2ZDYA 3B28A 4MP2A 3LNUA 2YE7A 2CCUA 4XIRA 5CTWA 1UYKA 3T0HA 3ZRWA 3ZM7A 3RLQA 3PEJA 4L8ZA 2VCJA 1TBWA 4EGKA 4GT1A 2LFRA 3H80A 2YECA 4O07A 2BYHA 2PNRA 3ZXQA 3SL2A 4CE2A 2HG1A 3OWDA 3OW6A 1TC0A 4X9LA 3R92A 1MX0A 2VW5A 1ZXMA 4U7OA 1EI1A 3GIGA 4P8OA 3GIEA 1MU5A 3IEDA 2YK9A 4YKWA 3EKOA 2YKBA 4JASA 4KSHA 2WI7A 4O09A 4L91A 3A0YA 3TK1A 2WEQA 2ZBKB 3MNRP 2YE8A 2YI0A 2YEAA 2CCSA 2BYIA 1UYIA 5D7DA 1US7A 4CE3A 2YKCA 4XKKA 1BGQA 2BREA 3O6OA 4H81A 5CF0A 5IDMA 1IXMA 4O04A 1I5DA 4KP4A 3K98A 3A0WA 1UYGA 2LFSA 1YC3A 4FMTA 4B6CA 2YKIA 3HHUA 1I58A 1YETA 4XCLA 4I3HA 4KQVA 4XDMA 2VWCA 3R4OA 2YK2A 2ZKJA 2YEDA 2AKPA 1S14A 2IOPA 3B26A 5IN9A 3FT5A 4L93A 3R4MA 3G75A 2XHTA 1Y8OA 1EA6A 1UY7A 2XD6A 5M4EA 5B1OA 2BU5A 3EHHA 5F5RA 2YEGA 1I5BA 2YEEA 5CPHA 2YI7A 4EGIA 3LPSA 2EXLA 2BU2A 1I5AA 1TH8A 5M4PA 1Z5BA 2YGFA 4XKOA 4CWSA 2ESAA 5C93A 2XDKA 1AH6A 4CWNA 4YKXA 3P32A 5IDJA 3U2KA 1AMWA 4NH9A 4YKUA 4XIQA 2XDLA 1ID0A 4XIPA 5L3JA 3O2FA 5D6PA 3ZCCA 4V25A 3K60A 4URMA 3T2SA 4K4OA 1B63A 2YKEA 3TZ0A 3VHCA 1UYCA 3TUHA 2WI1A 4HZ0A 3T0ZA 2C2AA 4PRVA 1YT1A 1BYQA 1U2OA 5FNCA 3WQ9A 2CCTA 2XX4A 3B27A 5M4KA 1QY8A 4EFTA 1UY6A 3D2RA 2HKJA 2YI5A 2YI6A 2WI2A 1A4HA 5M4HA 4B7PA 1NHIA 1Y4SA 4WUDA 5M4NA 1Y8NA 3NXSA 4CE1A 1L0OA 3OWBA 3G7BA 2FYPA 1TC6A 5D7RA 3OMUA 4EEHA 3RLRA 2BU6A 1H7UA 3D0BA 4FCQA 2CG9A 2XJJA 5FNDA 4MPCA 2YE2A 1AH8A 2IWUA 3HYYA 2BRCA 1Y4UA 3K97A 3INXA 1QZRA 1GKXA 3A0TA 4R3MA 1B3QA 1Z59A 2WI5A 4DUHA 3EHFA 4QPJA 5FWKA 2H55A 3EHJA 3TZ5A 3C11A 4E01A 2XHXA 3ZRXA 1UY9A 4QPKA 2Q8GA 1Y8PA 2CGFA 4P7AA 4ASAA 2QG0A 3H4LA 3B24A 4XC0A 3D36A 1NHJA 2H8MA 1NHHA 2YE3A 3Q5KA 4GFNA 3NMQA 2QM7A 3INWA 3O0IA 4EM7A 2IWXA 4MBCA 3CRKA 4L94A 3RLPA 4WUBA 1GJVA 1B62A 1ZW9A 1KZNA 4DZYA 4LPBA 2BT0A 2QG2A 2YGAA 3C0EA 4XTJA 2Q2EB 4BQGA 4E00A 4AWOA 2FXSA 2WI3A 2XDUA 2YEBA 4U93A 4GCZA 3K99A 3ZKBA 4E02A 2P67A 2BTZA 3Q5LA 4H7QA 1YESA 4XE2A 3Q5JA 1R62A 2WEPA 2Q8HA 1PVGA 4MTXA 2YE4A 1ZWHA 4JYCA 4KSGA 5F3KA 4O05A 4KTNA 1AM1A 2XK2A 3PEHA 2CH4A 2YE6A 3QDDA 2IOQA 5J71A 1QYEA 2XDSA 4HY1A 3WHAA 3VHAA 5FNFA 4MPNA 4MT8A 4EGHA 2GQPA 2IWSA 3MD0A 4R3AA 4JQLA 3R4NA 5D6QA 4PRXA 3VHDA 4MP7A 2YJWA 2XX5A 3CRLA 4CWFA 1UYEA 2XDXA 3KE6A 4MB9A 3JZ3A 2BSMA 3T1KA 3ZKDA 3RKZA 5M4MA 3GIFA 2XX2A 3CWVA 4YKYA 5D7CA 4JAUA 4LP0A 3R91A 4JYBA 3TZ2A 4ZKIA 4EFUA 4L90A 2YKJA 4FPPA 1Z5AA 5B1NA 2Q8IA 2FWZA 4O0BA 2ZDXA 2BZ5A 4YKTA 4FCPA 4AWPA 1AJ6A 2K5BA 3QTFA 3DGEA 2YGEA 2YEIA 4BQJA 4HYMA 2YE9A 4AS9A 1YT0A 2YE5A 1YSRA 5BOCA 1YC1A 1H7SA 5GGZA 2FTKA 1JM6A 2WERA 2XJGA 4LC1A 4XKAA 3HEKA 2QFOA 3T10A 2XCMA 3TTZA
chains in the Genus database with same CATH superfamily
3FYIB 1EFRG 2DW4A 5KHKA 3U2DA 2HFEC 2P7TC 2KQXA 3JAWA 2XNDG 3APQA 2VCIA 4OPHA 5H5NA 4I4TB 2Z3YA 4BIZA 4I7ZB 1RPOA 4TQDA 4LF7O 4JYYA 3X2QC 4PA9A 1XILA 5HFMA 1YC4A 2E75B 1K3EA 2F23A 1SETA 2DYSB 4DW0A 5BODA 2WI4A 5D5PA 5CTYA 1S16A 4RWUA 1UYLA 2QWPB 4EB6B 3I5DA 2P4KA 1VIBA 5LOVB 2YIBD 1FXHA 3STZC 3CMAV 2XAHA 3GIGB 1DF5A 1JOYA 1BMFG 2CTRA 5IY5B 5B1BC 3BM9A 3OW2U 4MOTA 2A06H 1TIDA 1YJNV 1NTKH 1DGSA 4YKQA 3JASA 3JD3A 5CTXA 2EIKB 2LO1A 3GWKC 1ZUQA 3LDCA 2E0AA 1Z5CA 2FB5A 4BXIA 2DWDC 1L0LH 1Y76A 1EZVH 3Q4HB 4Q20A 1NVPD 1BQ0A 4HY6A 3OT7A 3E8BA 2FWYA 4E4EA 5B5EZ 2B5UA 3BCCH 1HNZO 1M57C 1BZKA 3H1KH 2BOCC 3HKEA 1WB7A 3IJ4A 2O1WA 1HR0B 5DEDA 3G80A 4U3FH 4DUYB 3SPIA 4NH7A 3HYZA 4AQYB 5IT9N 4FK5C 3RN4A 1KD1W 3EKRA 2GDSA 4PDMA 4B3RB 3I55V 4DV2B 2Q8FA 5JJNB 4F6RA 4PI0A 4LWEA 4NH8A 1GMGA 3AG2B 5CA1A 4KFGA 1ZXNA 4Z2WA 1OCCB 4YHHO 3W7UA 1Y67A 1EN4A 2KG7A 2Y4UA 2XJXA 4KXRA 2O1UA 1WP7A 2JIZG 3H1JH 4XD8A 2GFDA 1YDXA 4BIUA 1PNLA 4CWQA 3CWBH 1UYHA 2W6JG 4LWHA 2Y0IA 4LWFA 3WG7C 4GX0A 2OT5A 4X1IB 3MDSA 1K7DA 2QWOB 3MHSC 1RSOB 4DV7B 1ZAUA 3VADA 3CCRV 3U11A 3OGIB 3CD6V 3L9DA 4XBFA 3T1YB 1XMOO 1KP3A 1RP3B 4XIRA 3QNEA 3BFRA 3ZM7A 2VCJA 2CK3G 1TBWA 4EGKA 3FD9A 1EN6A 1SC5B 2LFRA 5FNVA 4O07A 1TVKA 3SL2A 1M4UA 5EK0A 4I50A 4X9LA 5F2VO 1MX0A 2Q7EA 1ZLZA 4QNHB 1ORQC 2Q4PA 1D2DA 3B77A 2BTQA 1HP8A 4MVUA 2YK9A 2RMKB 3QO5A 2UXCB 3JATA 4IYHA 1QVGU 2AHYA 1ZWIC 3TK1A 3FB5C 2ZBKB 2BE3A 3HKCA 4H33A 4K0KO 2CCSA 2YI0A 1KMIZ 3RWRD 4MVZA 5LXTB 2N74A 4LP8A 1P4RA 5CB4A 1AI5A 1VARA 2IJJA 1IXMA 4O04A 1SQPH 5GONB 3EFFK 4LF8O 3UT5B 4CH5A 2ZNIA 2RJZA 5H9CA 4DR3O 4XDMA 5LA6B 3R4OA 3LDEA 2O57A 1FXKA 3E8FA 1K34A 2YEDA 2AKPA 2IOPA 1E1QG 3FT5A 4JI2O 5BZBA 3IAYA 4I9WA 3R4MA 1FFTB 2XHTA 1EA6A 5LGTA 2EULA 1YVWA 4JV5B 2NNUA 3H1HH 3MAQA 1QLEB 3B2EE 2BU5A 3EHHA 5F5RA 5JWPA 2IM9A 5C8YA 4LWSA 4UVCA 4IL6Z 3BAAA 2DE0X 4DR4B 2YI7A 2JVDA 4OX9O 1X4TA 4RQFA 2EXLA 4RAIA 5M4PA 4G2KA 4DV4B 5LMNO 2OWOA 1FAFA 4K0KB 1XUQA 3T2MA 1Y66A 1AH6A 4DV5O 4NXNB 2E5LO 4UB6Z 3U2KA 3CHXA 2XHBA 3BHPA 3VQWA 3JATB 2XDLA 5EIBD 2ZR2A 4XIPA 2PY5A 5JVDB 5L3JA 3LSUA 2XT9A 3ZIAG 4ICGA 4JI5B 4UXNA 4URMA 2R9AA 3ETQA 1ZX3A 2XOKG 3IC7A 4UCSA 3MHHC 3WB1A 1GN2A 1N36B 2HHIA 2OTLV 3SPJA 3TUHA 4PA6A 1YT1A 1WA8B 4JI0B 1BYQA 1WPXA 1XL6A 1Q81W 3KKYA 2NLJC 2EIMC 4YJ3B 5JVDA 2UU9B 5IYBO 1V55B 4GYCB 4DV0B 1HNXO 4EFTA 3D2RA 3ABMB 3LDDA 2YI6A 1JR9A 2WI2A 1XREA 2BSKB 4DR1O 3JALA 1R1BA 1RSOA 2EINC 2EZOA 4NVPA 1KKCA 1BGYH 1F23A 1Y8NA 2WLIA 3FB7C 4KFMA 4CE1A 4FM1A 4DR5B 4YY3O 3CS5A 1RFYA 2AW9A 1Q86W 4NTXA 2ADPA 5D7RA 3OMUA 3RLRA 3B40A 3D0BA 4B3MB 3HB3B 3K3WA 1MZFA 5LBQA 2ZM6B 3SPGA 5CA0B 3J81N 4WFHA 4K35A 1Y4UA 3J80N 2V7QG 4GUNA 1QZRA 2CAZC 4J7ZA 3A0TA 3OUFA 3ZX6A 3CCQV 5JH7A 1Z59A 4DUHA 5E79Z 3AK1A 1RM1C 2WSSG 3EHJA 4UB8Z 3C11A 4NTWA 3BABA 3LNMB 2UXDB 4QPKA 4CH6A 2Q8GA 2CGFA 4P7AA 4DRXB 4H44B 4QGPA 4GLXA 3CCSV 2H8MA 1JCHA 5KHJA 1VEWA 5CB4B 2UUBB 1SKVA 4DV4O 1OCOB 3NMQA 2QM7A 2ZT9B 3INWA 3O0IA 2PGGA 2JS5A 1Q82W 4WBNB 3SJCC 5CBGA 3RLPA 2ZE6A 4LH7A 4DW1A 3DXRA 2C1IA 4DR6O 4LF4O 3ZMZA 4LPBA 2BT0A 3A0HZ 2C1GA 2ZNJA 2UXDO 4BQGA 4E00A 1X59A 2FXSA 2Q7GA 1IBLO 4B3TB 4LNUB 2YEBA 1Y76B 1YXBA 3K99A 3EVKA 1M56C 1R3KC 3CJHA 4B3SB 2CDYA 3ZHVA 1WJZA 4FZ1A 3OR7C 2Q8HA 3E8HA 4LCUC 1ZWHA 1QHTA 4GX2A 2DOSA 3ZHRA 2ZQMA 2XK2A 2CH4A 5J71A 3G67A 4LBEC 4P9OA 4NKGB 1N33O 3C3TA 1QLNA 2XDSA 4HY1A 3A8TA 3K59A 4MPNA 4EGHA 1R3JC 2IWSA 3LSQA 1R6KA 4IHJA 3F5TA 1B06A 5LHGA 2XASA 1PKXA 3D36C 3CMEV 2QJ1A 4MP7A 1US6A 3KG2A 4DV6O 3OEHG 2YIDA 4TWKA 4TSFG 1LUVA 3CRLA 4CWFA 1Y6XA 3K58A 5BR8O 3KE6A 3FAVB 1YJWV 1S76D 1GKFA 3EXAA 4OGQB 2QE7G 1UJWB 3AK3A 1FFXB 3CC2V 3RKZA 2OCHA 2RNBA 2FL4A 4CH4A 3K9SA 1DTOA 4JGSA 4ZKIA 3OFNG 4L90A 4DR6B 3ABTA 1A32A 2ATKC 3R66A 1V55C 4YHHB 2D2CB 2Q8IA 3ZN0A 4LWSB 4PA4A 5JCOA 1TAEA 4TV9A 4I55B 1V54B 1AJ6A 1M56B 2YEVB 1WPBA 4FLUA 3AG1B 2YGEA 2YEIA 5FLXN 4X62B 2UXBO 1W0JG 4WFBV 5B3SB 2YE9A 1YT0A 2YE5A 2R9RB 1YC1A 3FX7A 3ABKC 4AQYO 3E2EA 2RDCA 4G27B 4XKAA 3HEKA 3T10A 4LFBO 1OCZB 4FCRA 5L3EA 5A9GA 3R4PA 4HXWA 2YIBA 4UCRA 1SESA 2IH3C 5BY1A 1XOUA 4GEEA 4MPEA 1YCIA 1ZL8B 3H1LH 3RYIA 2JJCA 1VQ7V 5KAFZ 3JSLA 1N36O 1YT2A 3A0RA 2KSDA 2OIGA 1K4CC 3HZ5A 3D8CA 1GO3F 3Q4HA 3JCZA 5GTHZ 1BE3H 4LF5O 4CS2A 3T1HO 2OCCB 3A0BZ 2B1IA 4X1KA 4AILC 4X89A 4GKJB 4DV2O 4LR3A 4UFZA 1BHBA 2A9HA 1AJQA 2Q6AA 1F4NA 4EMVA 4L87A 4UV8A 1UYFA 4PU9A 1R3LC 2ZINA 1QU7A 4FM2A 5KUKA 1UYMA 2HJFC 2LP7A 2LW7A 2Q7HA 2VRZA 2AZ2A 2HCHA 4ASGA 3LUTB 4PD4F 3ZRWB 1YJ9V 4MTOA 1KB9F 1GH6A 3SYQA 1TILA 4XCJA 1WAZA 5JQGB 4CWRA 2PYJA 1UY8A 1Q43A 1I0HA 4QJFB 1ENVA 4LWIA 2VQEB 2PTMA 4XITA 2Q69A 5EIBC 5C8YB 4WFGA 1HNWO 4FLXA 4H0LB 2A79B 2HJDA 4DRXA 5JH7B 4H85A 1NH2D 2YICA 3TZ4A 1H2MA 1YS3A 1XEQA 4X1YA 2A0LA 3FYEB 2UWDA 4UCTA 1BKNA 3ZHQA 2DYRB 1AILA 4IIJB 1Q3EA 4O4IB 5LL6Y 2WWWA 1BXDA 1F51A 1EBOA 4ZHQB 1I5YA 3SPHA 4PDVA 1J95A 3K5OA 4DR7B 1Q6UA 2VQFB 1S5JA 3B4SA 5EC1C 2YJXA 3ZMUA 2WLIB 4CWOA 4MTFA 1B04A 3CC4V 3VBBA 1P7GA 3BMYA 1AI7A 2E76B 3OGCC 3APOA 1JPXA 1MSDA 1VF6C 4BAEA 4TV8A 1AJPA 5KHHA 5KLVH 3ZMVA 1Y74B 3EHGA 2DQ0A 4MP2A 3G6EV 1NTZH 3LNUA 2YE7A 2ITDC 4FIPC 2UUBO 2CCUA 1OHHG 2EILC 4FJCC 3ZRWA 2CTPA 4YXWG 4LF7B 2HHHO 4PJ0Z 4GT1A 2YECA 1FXVA 4LFCO 2PNRA 3OM3B 1V9PA 2CUGA 3UO3A 1Z2GA 1NH2B 2XAQA 1ZXMA 4U7OA 4B3SO 4P8OA 3J7AU 3GIEA 1MU5A 3IEDA 4IT5A 1BHAA 5GW7A 2JJ2G 1NTMH 4LNUA 2WI7A 4O09A 3A0YA 1AR5A 3ABUA 2BYIA 1UYIA 1AB3A 4DR2B 4F6EA 2YKCA 2F1MA 2W6IG 1BGQA 2BREA 3O6OA 4H81A 5CF0A 4JI3O 4K8ZA 3NR7A 4X8AA 4KP4A 5EC2C 3CCMV 2Q73A 3OTOO 1UYGA 2LFSA 5HFLA 1JQ0A 3O65A 1YC3A 4Q6GA 4KQVA 2KG7B 3L70H 1S0VA 3QF7A 2QGNA 1VMGA 5IN9A 3RFRA 1MMMA 4OPAA 2EIKC 1I94B 1L8DA 1SA0A 3ZHTA 2XD6A 1SQQH 5M4EA 5B1OA 2X6BA 5IWAB 4TOIA 2YEGA 4FLVA 3JAKA 1YSCA 4JTAB 1YTFD 1I5BA 5CPHA 4EGIA 3LPSA 3SYPA 1I5AA 1TH8A 2Z0AA 4KHPB 4CWSA 1K5SA 1I08A 3WG7B 2XDKA 1S5LZ 4EFBA 4NTYA 4CWNA 1TUBB 3RYCB 4YKXA 3P32A 1H2GA 3X2QB 2ZE5A 4J80A 1YITV 1HNWB 1AMWA 3UQ8A 2P6JA 1QBZA 2LW1A 5E1AC 5EZYA 4CS3A 4J41A 1LUWA 5FPOA 3K60A 4E72A 2F66C 2ADQB 3ETDA 1S3JA 3T1CA 1MA1A 3JASB 1B63A 1FXKC 2YKEA 3TZ0A 4YJ3A 1S77D 2HP8A 1UYCA 1BL8A 2WAMA 5KUMA 3CCEV 3T0ZA 2C2AA 3C90A 4PRVA 1FKAO 4O4HA 1P7BA 2RN9A 1U2OA 3WQ9A 1FPOA 3U10A 1Q8IA 5M4KA 5LMUB 1BS3A 1KECA 4JI8O 1S72V 4LH6A 4O4JB 4W4LA 5J2TA 4MVMA 4BAYA 1QNMA 1JJ2U 1NHIA 3DXRB 4FM0A 3CRAA 2WLHA 3E86A 2ZXWC 5M4NA 3D3QA 4JYAB 1K33A 1QVFU 3OWBA 3OTOB 2EX3A 2GSMB 1W2BU 2F4VB 2ZKOA 4CC5A 4JI3B 4FCQA 5AG2A 1AP6A 1LR1A 5FNDA 3RGBA 1YZBA 1IURA 4OXSA 3INXA 4LFAB 1NZ6A 4JI5O 1GKXA 4R3MA 1B3QA 2WI5A 1YF2A 4I0XA 5FWKA 1SQVH 1M5IA 1VQ5V 3TZ5A 1N32O 1SZXA 2QG0A 4MTGA 4XC0A 3JD0A 1NHJA 3ZS8C 2Z5UA 3Q5KA 4DK1A 4GFNA 5LGNA 3W7XA 2ZE8A 5B1AC 4QIWF 3BA8A 5IYZB 2X6CA 2QG2A 2YS8A 3SYCA 2YGAA 5CA3A 4NYKA 5A2QN 1I7FA 2XDUA 3DTUB 4U93A 3ZKBA 4E02A 1GK9A 3TXQA 4PV1B 1GTOA 1M1KW 5KX5B 1YEWA 1KU9A 3W7WA 3FB6C 4DUZO 2WEPA 2UU9O 2UUAO 2N04A 1PVGA 3SPCA 2YE4A 4JYCA 2HEPA 4O05A 1AM1A 4J11A 1KBHA 2WA3A 1HNZB 5JJEB 1PNMA 1BQZA 2JK5C 1CXZB 5FNFA 3RVYA 4X65O 2Q67A 5EZYB 4X65B 1MSWD 3MD0A 4R3AA 2QKAA 2X6AA 4B3RO 3T4DA 2YJWA 1N34B 3RYCA 2CTQA 3BY6A 3AG7A 4R50A 3SYAA 3JZ3A 1U97A 3N2KA 2YI8A 1S5HC 1G1XB 3HKBA 3VQXA 4I4TA 1SQFA 5M4MA 4TUYA 3CWVA 4PHZA 1URFA 3FKSG 4CH3A 4C7UA 3ML0A 4JYBA 3TZ2A 2M6YA 3K0GA 4JAAA 2VS0A 4HBNA 4LFCB 3VOUA 1Z5AA 5LP6C 2EIMB 2Q8VA 4O0BA 3E8GA 1U96A 2ZDXA 4YKTA 5CBHA 4ZIBA 2YEVA 3RYFA 4BQJA 4HYMA 5CA1B 4DUZB 3ASNB 4FFBA 2HR3A 1YSRA 5GGZA 1OCRB 2YXLA 2WERA 2KB1A 2V4DA 2XJGA 1XI1A 4LC1A 4TUYB 2QFOA 1VQ6V 5IE9A 4X88A 4NXMB 3EHBB 3HKBB 2JKIA 4MW3A 1IVSA 4GKJO 3UT5A 2ZDIC 4UCVA 3A0ZA 3JALB 4TQFA 4B3MO 3HKCB 1BSMA 2H94A 2Y48A 1LNQA 2BU7A 4URNA 4ASBA 3B8NA 4DR5O 1PV0A 3B25A 5J6AA 4JAVA 4U3JA 5J2UA 3CRRA 2O1VA 1THZA 3N27A 3THOA 3ZRVA 2XABA 4HZ5A 1NS1A 2Y0PA 4YIPA 1OJHA 4O4HB 4ZBMA 1HW7A 1THNA 4UROA 3TJTA 3P3PA 2QKSA 4F4LA 2EZPA 3JAMN 1KUQA 4EFEA 1NQTA 4R7CA 4MVOA 2ZE7A 4ZI7B 3OTFA 2Q9LA 4EEQA 5BMVA 3G7EA 2P4VA 4LWGA 1ROPA 4LFAO 2QTSA 1IBKO 1K4DC 1AJNA 3OMAB 2QKCA 2VQEO 4JI7B 4NB5A 1Y74A 2DMXA 3LMMA 3SDLA 2GTAA 5FL7G 4PI2A 2EIJC 3OAAG 2LGQA 3ASOB 1M90W 3H01A 2IU3A 3CGZA 3CXHF 1GKZA 3RT3C 2PZSA 2IU0A 2IORA 1JFFB 3VQYA 3W7SA 3W7TA 5KMGA 2Q0AA 5JENA 3JAKB 1I59A 1FJGB 3OPDA 1MOFA 3UKMA 4JTDB 3ZJZA 1UYDA 2EBOA 1BT8A 1H38A 1QR8A 3TGUH 3ABLB 3ETGA 3QG5A 2IJHA 1XQ8A 1OSFA 3N2GB 4FLWA 2WI6A 1GAXA 1KIJA 2YEHA 3AK2A 3CX5F 3VQVA 4HXZA 3E22B 1Z5WA 4O4LA 3U0ZA 2QM4A 4GX1A 5KA5A 2IJKA 5LHHA 4LF6B 4P30A 4NXMO 2YEFA 2Q0OC 4DR1B 4JZ2A 3BA9A 4MVSA 3SYOA 1WN7A 1GN3A 3GVMA 2X7RB 2JEXA 2QM8A 5GONA 4URLA 2WLLA 1SZTA 2GUZA 3K04A 3IFXA 4U7NA 4LF5B 4XDJA 4J9ZB 4W7TA 4FLZA 2ZDYA 5EYPA 4HZ3A 2HVJC 1QLEC 3K9AA 1QR9A 3BVOA 1GRJA 5IJ9A 5BMVB 2BCCH 2PUSA 3T0HA 3WFVA 5LP6A 2LQTA 4UUJC 1XNQB 2GTSA 3RLQA 4ABMA 5KHIA 4L8ZA 2DQ3A 1EM1A 4JI7O 3RBZA 5K1XA 2BYHA 3K57A 3ZXQA 3K08A 1UFIA 4CE2A 3JCUZ 2UUCB 3OW6A 1NR1A 1TC0A 3R92A 1NJIW 3AG2C 3HPLC 5FNVB 2VW5A 4LF9B 3ZHUA 1EI1A 3DC6A 2MK3A 1PNKA 2LGWA 4YKWA 2YKBA 4JASA 3GWOA 5LMUO 3FFQA 5EYPB 5BR8B 1IZ3A 4DV3B 4X1IA 2L6LA 1CPYA 3AEIA 2ZDIA 1US7A 4XKKA 2ZIMA 1L1FA 5IDMA 1I5DA 1VF6A 3CXCU 3A0WA 1EZJA 1M57B 3ASOC 4RQEA 4FMTA 2W0XA 4J9YB 5IYCO 2YKIA 1WNSA 1UPGA 4XCLA 4PA7A 4I3HA 3E22A 4DO2A 1BCCH 1XDCA 2VWCA 2YK2A 4J7JA 5EBWC 1E79G 2PF4E 4QE9A 1GM7A 2QWRB 3WB0A 4F6RB 4L93A 4O2AA 1DK1A 1MG1A 4CZZA 2V1DA 1OV9A 1KQSU 4ZOLB 4MW8A 1R6TA 3JARA 1N0NA 2ETNA 2YEEA 1XL4A 2OCCC 4WFEA 5KMGB 1H2NA 2N05A 2YDEA 5DECA 1W59A 2BU2A 1MZEA 1Z5VA 5LYJB 1Z5BA 3N2KB 4XKOA 4DYLA 4YIOA 4XDLA 1O9GA 3FAVA 5C93A 4WF9V 2ODMA 2HG5C 2W0FC 3F7YC 4NH9A 4WFFA 1VQ8V 3CRCA 4X66B 1ID0A 5CMUA 1VQNV 4DUYO 4X66O 3O2FA 4JI1O 5D6PA 4V25A 2QWQB 2E5LB 1TUEB 4K4OA 1OCCC 5IYDO 1ZSPA 3ABLC 1NBMG 3F5WC 3CE2A 3T4ZA 3OE7G 5B3SC 4HZ0A 3UO2A 2ZM6O 1I5XA 3AG1C 2ZR3A 4JYAO 2JS3A 3ICXA 4R8CA 1I94O 1JJOA 5J2UB 2CCTA 3B27A 5LP6B 3ETEA 1UY6A 1GN4A 1Q5OA 4JI6O 5M4HA 1A4HA 4P9PA 3CYOA 1JA8A 1OZ0A 3LSSA 4J7KA 1F4MA 4L8JA 2JEUA 4U3JB 2YIAA 2ZD9A 4UVAA 1TA8A 1QQCA 1AR1B 1Y4SA 3WB2A 4FLTA 4DV6B 5D5QA 3S3WA 4QE7A 4W4KA 1AROP 1AP5A 4KHPO 3G7BA 2FYPA 3JD2A 1NVPB 4HAMA 5LYJA 4UV9A 4EEHA 2BU6A 3C3SA 1R6NA 2CGOA 2XJJA 3AG4C 2M7WA 4O4IA 2IWUA 3HYYA 3K79A 5IWAO 4WFAV 1KYOF 4I55A 3K97A 2WLMA 2E3CA 3PN1A 3F7VC 5H6QA 5TISZ 3ZMTA 1RPRA 3EHFA 1M9NA 4QPJA 2OYQA 2YXHA 4E01A 2D3OW 1IBMB 1TGOA 2XAJA 1UY9A 1Y8PA 4ASAA 3E35A 5B66Z 5KHGA 1J5EO 2VQFO 2CTWA 4I9QA 1NHHA 4DV1B 4G28B 3K06A 3CSXA 3BPZA 1VQPV 4EKWA 4UVBA 4L94A 3HKEB 1B6QA 2WA4A 1B62A 4PA3A 1KZNA 2YSUB 4DZYA 1G4YB 4FLYA 5ITZB 4GKKO 3ABKB 4ASUG 1QCEA 1IBMO 2UUAB 4HNAA 2R72A 1EN5A 4CS4A 4AWOA 2WI3A 2JDIG 3O9OA 1MABG 2BTZA 4BR6A 3ZMSA 4H7QA 3CCLV 1YESA 4XE2A 4NXNO 1R62A 2LJ2A 2GBOA 2NN4A 1RM1B 3SGIA 4R6ZA 3UCSC 5F3KA 2G38A 4KTNA 4J10A 4CBCA 3QDDA 2YE6A 2WLKA 3G71V 4LF8B 2GQPA 5DN6G 4DV7O 4JQLA 4JPRA 3R4NA 5D6QA 4PRXA 1O9HA 4D7TA 2XAFA 3AG3C 2IJIA 1H2KA 5JJJB 1NT2B 3RYIB 2BSMA 3ZKDA 1COWG 2ZXWB 2K1EA 3CRQA 1WB8A 5L3DA 5GTIZ 3KCXA 5D7CA 5EBMC 4JAUA 3HKDB 3R91A 4N23A 4O4LB 3OEEG 5J9PC 4FPPA 4FZ0A 2PYLA 1VF7A 5B1NA 1SA0B 3CYGA 1XNRO 1D5NA 1VQ4V 2FWZA 4MVRA 1N33B 2IH1C 4DK0A 4DV1O 3QTFA 3T1YO 1N32B 4A5UB 4Z1VA 4AS9A 3P3NA 2HVKC 5BOCA 1SS3A 1H7SA 2FTKA 1HDJA 5IJ0A 3HKDA 1PM9A 3B8MA 2JGDB 1Q90D 1JFFA 2XCMA 3TTZA 1FFXA 1HR0O 2FYUH 3FT8A 3ZXOA 5B1AB 1IDSA 1Q6HA 4GT8A 5LXTA 1YI2V 1Q7YW 4J42A 3S5TA 4BW5A 1FS0G 1G8MA 3B09A 3CGYA 3TXSA 2XHRA 3RW0A 1FD9A 3SR2C 4ZI7A 4MSWC 5CTUA 1SERA 2RQ6A 1PL0A 4JI2B 4IYIA 3HZ1A 5LOVA 2OTJV 4I50B 3L71H 4X64B 2PI4A 3AG4B 4JI6B 4CWPA 4B7KA 1PL4A 5KA6A 4DV0O 1HNXB 2JRIA 4ASFA 4UCOA 1U0ZA 1WP8A 1VQ9V 2BU8A 2RCVA 5IJ9B 4OX9B 3KZIZ 4PL9A 4WBNA 1DF4A 3TCUA 3U67A 1PD3A 4B08A 1K5QA 1VF5B 2VWJA 4TV8B 4RUFA 2YXYA 2QSAA 5L3BA 5EBLC 4I5SA 3ABMC 3KCYA 2UXNA 4YJ2A 4YKZA 2L35A 3K0DA 2EJRA 3TETA 1R73A 3QO8A 1L0NH 3PJSK 2VWKA 4GKKB 2B9ZA 4AWQA 2H8PC 4WUCA 3JARB 4NR1A 3LNNA 4HYPA 4FFBB 4ZHQA 2YC0A 4DR7O 4X62O 1FXKB 1SQGA 4GQTA 4IIJA 1NKDA 1I5CA 2QF6A 2P06A 4YKRA 1VP7A 3M7MX 5BXZA 3E89A 2Y69C 1XHZA 4YJ2B 1XBLA 1KP2A 2EILB 4JTCB 4FFKA 3CP1A 3K5MA 4ZVIA 1IBLB 4CC6A 1AVMA 4B3TO 1VQLV 4CWTA 1K92A 4BW9A 3A0XA 4AI8A 2HLDG 4V26A 1YERA 1PPJH 2YEJA 3FV5A 2Y4TA 2UXBB 1K9MW 2AHZA 4O2BB 3OUSA 4R1FA 1YSZA 3CRMA 2P22C 4E2LA 2MW2B 4GGLA 3B28A 5LGUA 1K97A 1VQOV 4D6TH 5CTWA 1P84F 2Q5ZA 1UYKA 3SJBC 2P5OA 3PEJA 2Y69B 1IXBA 4PDLA 3H80A 2HG1A 4PDRA 3OWDA 1ZTEA 4JI4O 2DYRC 4FVMA 1IX9A 4X64O 3CC7V 2XTAA 3GIGA 4RO2A 5ITZA 2F95B 3EKOA 2DJVA 2AXTZ 4KSHA 4DXWA 1Y4MA 4L91A 3G6BA 3T1HB 2WEQA 3MNRP 2YE8A 3ZEDA 1XMQB 2YEAA 2GHYA 1TUBA 3GB7C 1PP9H 2F93B 3OMIB 2GV9A 5D7DA 4CE3A 2JJ1G 3I56V 1NU1H 1M93A 4H13B 1XNQO 3K98A 3WU2Z 4RUEA 3JD4A 1SF9A 2ITCC 4B6CA 2EIJB 3SJQC 1Q6IA 3HHUA 5IJ0B 1I58A 1YETA 2A7WA 1JVMA 2UXCO 2JGDA 2ZKJA 3ZBHA 1H8HG 4JI1B 1S14A 3B26A 5KAIZ 2EJ7A 3H9VA 3G75A 4JI8B 1Y8OA 2E74B 5LHIA 1UY7A 3STLC 5B1BB 2H3OA 2ZCEA 5LA6A 4KL1A 1GM8A 4X1YB 4X20A 3D3IA 2DWEC 5CA0A 2AGAA 3K5NA 1E1RG 2UXXA 4PELA 2YUAA 3L74H 1YHQV 2YGFA 2DN9A 2BTOA 1XMQO 1IBKB 2ESAA 4IGGA 4JV5O 5JQGA 2BOBC 4O4JA 5J2TB 5IDJA 2NR5A 3OMNB 3K03A 2JGUA 4YKUA 2ILMA 4XIQA 3DC5A 2QTOA 3ZCCA 1OCZC 2BTQB 1G6UA 1FJGO 2CGNA 3RYHB 5LMNB 5L3FA 3T2SA 2QDOA 1R3IC 1VQMV 3CEIA 3VHCA 2HKOA 2HHHB 1OCRC 1GN6A 3HR0A 3CPWU 4BIOA 3ASNC 2WI1A 3JD1A 3P30A 4JI0O 1P49A 1WA8A 2F4VO 4K3AA 1TVKB 1V54C 5FPRA 5FNCA 1JX9A 4DV3O 2B1GA 2KKWA 3RVZA 2IBZH 2QEXV 2XX4A 4B7EA 4X1KB 3K5LA 4O2BA 1QY8A 3L75H 2FKXA 2HKJA 3QTCA 2YI5A 3H1IH 1N8RW 4LFBB 3QO7A 4B7PA 1YIJV 3CCJV 1AR4A 3OD4A 2GUZB 1MNGA 3IC9A 2A3QA 1W0KG 1ZL8A 4DV5B 4WUDA 2WPDG 1N34O 4XDKA 2P90A 2QR4A 3NXSA 1L0OA 3JAWB 3OR6C 1TC6A 1CEZA 4KUMA 2CH7A 3BEHA 1H7UA 3ZN1A 2CG9A 1SRYA 4MPCA 1AI4A 1NR7A 3A2FA 4DR2O 3N2GA 5K1PA 1AH8A 2YE2A 5IY5C 2BRCA 1H2LA 1JMKC 3L73H 3E83A 1NI8A 3G4SV 3RYFB 3FB8C 4N21A 4BWAA 4GZRB 1N4CA 2H55A 2ZIOA 1WLEA 1FYJA 2Q68A 2XHXA 3ZRXA 2DYSC 3CCVV 2PI5A 4JZGA 2F43G 4JF3A 3H4LA 3B24A 2FMLA 5L3GA 3D36A 1H2SB 4AHCA 4D7SA 1KKDA 2YE3A 1N0JA 1T5EA 2X0LA 3ZHSA 3L72H 4DR4O 4H37A 4GX5A 5CN0A 4EM7A 4YY3B 2IWXA 4MBCA 3CRKA 1K8AW 2WLJA 2QWNB 4WUBA 3S3XA 1GJVA 1ZW9A 1VQKV 3JYCA 5CBFA 1OCOC 4IHJB 1AI6A 2BSKA 2R9IA 3C0EA 4XTJA 2Q2EB 1SQBH 3M8AA 2K9PA 5H6RA 4GCZA 1DLBA 4Z1MG 4LF6O 4P2ZA 2P67A 4JI4B 3Q5LA 5JCOC 3Q5JA 4DR3B 4LF9O 4MVQA 3CCUV 1SQXH 4MTXA 5KX5A 2UUCO 4KSGA 3CJHB 2YI9A 4HYOA 3PEHA 2IOQA 1QYEA 4EB6A 3ZRSA 3JSNA 3WHAA 3VHAA 3M99B 4MT8A 2AZ0A 3BRCA 1CP9A 5DM6V 4K8XA 3RYHA 4UCUA 1YTFB 4HNAB 3VHDA 2XX5A 1UYEA 2XDXA 2OIEA 4X9QA 5L3CA 4MB9A 5IYZA 2ARHA 2CE4A 3AG3B 3T1KA 2WLLB 1K73W 2EINB 3QVNA 1XHXA 3GIFA 3UM7A 2XX2A 4YKYA 4LF4B 4LP0A 3DSQA 4TT3G 4MS2A 2QA4V 4EFUA 3R65A 2YKJA 1HWYA 4ZOLA 5H2FZ 4X20B 3CB2A 1XMOB 1F7YA 1XNRB 4TV9B 2BZ5A 4FCPA 1H8EG 3IGAC 4AWPA 2R70A 4I0XB 3SJAC 2K5BA 2XUMA 1J5EB 2XAGA 3DGEA 4WCEV 2IW5A 4O2AB 2CH7B 1JM6A 1D5AA 1KC8W 2WLNA 1GM9A
chains in the Genus database with same CATH topology
3EHBB 3FYIB 2JKIA 1EFRG 2DW4A 3FT8A 4MW3A 3U2DA 3ZXOA 5B1AB 1OCZB 4FCRA 2HFEC 2P7TC 5L3EA 4GT8A 2XNDG 2ZDIC 2VCIA 3A0ZA 3R4PA 4HXWA 1SESA 2IH3C 2Z3YA 1YI2V 4BIZA 1Q7YW 4GEEA 1RPOA 2H94A 4MPEA 2Y48A 3X2QC 4PA9A 4BW5A 1LNQA 2BU7A 4URNA 2JJCA 1VQ7V 5HFMA 1YC4A 4ASBA 3B8NA 1K3EA 3B25A 1SETA 5J6AA 4JAVA 1FS0G 2DYSB 1G8MA 1YT2A 3CGYA 5BODA 2O1VA 1THZA 3A0RA 2WI4A 2XHRA 5CTYA 1S16A 3ZRVA 1K4CC 2XABA 3RW0A 3HZ5A 4HZ5A 1GO3F 3JCZA 1UYLA 4ZBMA 1THNA 2OCCB 2B1IA 4MSWC 5CTUA 4X89A 1FXHA 3STZC 3CMAV 2XAHA 3GIGB 1BHBA 4UROA 1SERA 2A9HA 1AJQA 1PL0A 1DF5A 1F4NA 2EZPA 2Q6AA 1BMFG 1NQTA 2QKSA 4F4LA 1JOYA 3HZ1A 4EMVA 4L87A 4UV8A 5B1BC 5IY5B 3OW2U 4R7CA 4MVOA 2OTJV 1TIDA 3BM9A 4MOTA 1YJNV 2PI4A 4YKQA 3AG4B 3JD3A 1UYFA 3G7EA 4PU9A 4LWGA 1R3LC 5CTXA 1ROPA 2EIKB 4CWPA 1K4DC 1AJNA 5KA6A 3OMAB 5KUKA 3LDCA 1UYMA 1Z5CA 1U0ZA 2HJFC 2LP7A 2E0AA 4ASFA 1VQ9V 2BU8A 2HCHA 4ASGA 2DWDC 4BXIA 3LUTB 3ZRWB 1YJ9V 4MTOA 4Q20A 1NVPD 3SYQA 4PL9A 1TILA 4HY6A 4XCJA 1DF4A 3E8BA 3TCUA 3U67A 5FL7G 2FWYA 2EIJC 1PD3A 3OAAG 2B5UA 4CWRA 1K5QA 3ASOB 1M90W 1UY8A 1M57C 3H01A 2IU3A 2BOCC 4QJFB 3CGZA 4RUFA 5L3BA 1ENVA 1GKZA 4LWIA 5EBLC 2O1WA 2IU0A 4I5SA 2IORA 3ABMC 3W7SA 3W7TA 4XITA 2UXNA 3SPIA 2Q69A 4NH7A 4YKZA 3HYZA 4WFGA 1I59A 2A79B 4FK5C 3OPDA 3K0DA 2EJRA 1MOFA 3TETA 1R73A 3QO8A 1KD1W 3EKRA 3PJSK 4PDMA 3UKMA 4H85A 4JTDB 1NH2D 3ZJZA 4AWQA 2H8PC 3I55V 1UYDA 1YS3A 4WUCA 2Q8FA 3TZ4A 2A0LA 2EBOA 3FYEB 2UWDA 4LWEA 4HYPA 4NH8A 1BKNA 1H38A 1GMGA 2DYRB 1QR8A 3AG2B 3ABLB 3ETGA 4KFGA 2IJHA 1ZXNA 1OSFA 2WI6A 2WWWA 1KIJA 1FXKB 1OCCB 2YEHA 4GQTA 1BXDA 2QF6A 1F51A 1NKDA 3W7UA 1I5CA 4YKRA 1EBOA 4HXZA 1I5YA 3SPHA 4PDVA 2XJXA 1J95A 3E89A 2Y69C 2O1UA 2JIZG 4XD8A 2GFDA 4BIUA 1KP2A 5EC1C 2EILB 4GX1A 1PNLA 2YJXA 3ZMUA 5KA5A 2WLIB 1UYHA 4CWOA 4CWQA 2IJKA 2W6JG 5LHHA 4MTFA 4JTCB 4P30A 3CC4V 2YEFA 3CP1A 3VBBA 4LWHA 4ZVIA 3BMYA 1AI7A 4LWFA 1VQLV 4CWTA 3OGCC 3WG7C 4MVSA 3SYOA 1K92A 4GX0A 2OT5A 3A0XA 2HLDG 2X7RB 1JPXA 2JEXA 4V26A 2QM8A 4URLA 2WLLA 1K7DA 1SZTA 1YERA 3K04A 2YEJA 3MHSC 3FV5A 1AJPA 3IFXA 4BAEA 4U7NA 3ZMVA 4XDJA 1K9MW 2AHZA 3VADA 3OUSA 3EHGA 4J9ZB 4R1FA 3CCRV 2DQ0A 1YSZA 4E2LA 4GGLA 4W7TA 2ZDYA 3B28A 3CD6V 4MP2A 4HZ3A 2HVJC 3G6EV 4XBFA 1QLEC 5LGUA 1K97A 3K9AA 1VQOV 3LNUA 1KP3A 1QR9A 2ITDC 4FIPC 2YE7A 2CCUA 1OHHG 2EILC 4FJCC 4XIRA 1UYKA 5CTWA 3T0HA 3ZRWA 3WFVA 3QNEA 4UUJC 3ZM7A 3RLQA 3PEJA 2Y69B 4YXWG 2VCJA 4L8ZA 2CK3G 2DQ3A 1TBWA 4EGKA 4PDLA 4GT1A 2LFRA 3H80A 3RBZA 2YECA 4O07A 1FXVA 2BYHA 2PNRA 3ZXQA 3SL2A 3OM3B 3K08A 4CE2A 5EK0A 4PDRA 2HG1A 3OWDA 3OW6A 1NR1A 1TC0A 4X9LA 3R92A 1NJIW 2DYRC 3AG2C 1MX0A 3HPLC 1NH2B 2XAQA 2VW5A 3CC7V 4QNHB 1ZXMA 1ORQC 4U7OA 1EI1A 2MK3A 3B77A 3GIGA 1PNKA 4RO2A 4P8OA 3GIEA 1MU5A 3IEDA 4MVUA 1BHAA 5GW7A 2YK9A 4YKWA 2JJ2G 3QO5A 2YKBA 4JASA 3EKOA 3GWOA 4KSHA 2WI7A 1QVGU 4DXWA 1Y4MA 1ZWIC 2AHYA 4L91A 4O09A 3A0YA 3TK1A 2WEQA 3FB5C 2ZBKB 3MNRP 4H33A 2YE8A 2YI0A 2YEAA 2CCSA 2GHYA 3ABUA 2BYIA 3GB7C 1CPYA 4MVZA 3OMIB 1UYIA 4LP8A 3AEIA 2ZDIA 1US7A 5D7DA 4CE3A 2YKCA 2JJ1G 4XKKA 2W6IG 1P4RA 3I56V 1BGQA 1AI5A 2BREA 3O6OA 4H81A 5CF0A 2IJJA 1L1FA 1IXMA 4O04A 1I5DA 5IDMA 3EFFK 4KP4A 4X8AA 5EC2C 3CXCU 3CCMV 3K98A 3A0WA 1EZJA 1M57B 4RUEA 3ASOC 3JD4A 2LFSA 5HFLA 1JQ0A 4FMTA 4J9YB 2ITCC 5IYCO 2EIJB 4RQEA 1YC3A 2YKIA 4B6CA 3SJQC 3HHUA 1I58A 1YETA 4XCLA 4PA7A 4I3HA 4DO2A 5H9CA 1JVMA 4KQVA 4XDMA 2VWCA 3R4OA 2YK2A 3LDEA 1S0VA 5EBWC 1E79G 1FXKA 3E8FA 2ZKJA 1K34A 1H8HG 4QE9A 2YEDA 1GM7A 2AKPA 1S14A 2IOPA 3B26A 1E1QG 5IN9A 3FT5A 5BZBA 2EIKC 3R4MA 4I9WA 1MG1A 1FFTB 3G75A 2XHTA 4L93A 1Y8OA 4CZZA 1EA6A 2V1DA 5LHIA 1UY7A 1KQSU 3STLC 2XD6A 5B1BB 5LGTA 2NNUA 5M4EA 4MW8A 5B1OA 4EEHA 2X6BA 1QLEB 2BU5A 3EHHA 1GM8A 1UYGA 2YEGA 5F5RA 4EM7A 1YSCA 4JTAB 4UVCA 1YTFD 3D3IA 2DWEC 1I5BA 2YEEA 5CPHA 1XL4A 2OCCC 4WFEA 2YI7A 1E1RG 4EGIA 3LPSA 4RQFA 2EXLA 2BU2A 2UXXA 4PELA 3SYPA 1I5AA 4RAIA 1TH8A 5M4PA 4G2KA 1Z5BA 1YHQV 2YGFA 4XKOA 4CWSA 1K5SA 3T2MA 4XDLA 2ESAA 5C93A 3WG7B 2XDKA 4WF9V 1Y66A 1AH6A 4CWNA 2BOBC 4YKXA 3P32A 1H2GA 2HG5C 3X2QB 5IDJA 2W0FC 3OMNB 3U2KA 1YITV 3K03A 3F7YC 1AMWA 4NH9A 4YKUA 2P6JA 4WFFA 1VQ8V 1QBZA 4XIQA 2XDLA 1ID0A 5CMUA 2ZR2A 5E1AC 1VQNV 4XIPA 2QTOA 5L3JA 3ZIAG 3O2FA 3ZCCA 1OCZC 4UXNA 5D6PA 4V25A 3K60A 4URMA 3ETDA 2XOKG 1S3JA 3IC7A 1TUEB 5L3FA 1R3IC 3T1CA 4K4OA 3MHHC 1VQMV 1FXKC 1OCCC 1B63A 2YKEA 3TZ0A 3VHCA 2HKOA 5IYDO 1S77D 1OCRC 3ABLC 1NBMG 2OTLV 3CPWU 3SPJA 3F5WC 1BL8A 1UYCA 3TUHA 3T4ZA 3OE7G 3ASNC 5B3SC 3JD1A 2WI1A 3P30A 2WAMA 5KUMA 3CCEV 4HZ0A 3T0ZA 1I5XA 2C2AA 4PA6A 4PRVA 3AG1C 1YT1A 1BYQA 2ZR3A 1P7BA 1V54C 1U2OA 5FNCA 3WQ9A 1WPXA 1JX9A 1XL6A 4R8CA 1Q81W 2B1GA 3RVZA 3T2SA 2QEXV 2NLJC 2EIMC 2CCTA 2XX4A 3B27A 5IYBO 5M4KA 3ETEA 1V55B 1QY8A 4EFTA 1UY6A 3D2RA 1KECA 3ABMB 2HKJA 3LDDA 1S72V 2YI6A 2YI5A 1N8RW 1A4HA 2WI2A 3CYOA 3LSSA 3QO7A 1OZ0A 4P9PA 5M4HA 1F4MA 2JEUA 4B7PA 1YIJV 4MVMA 4BAYA 1JJ2U 2ZD9A 4UVAA 1NHIA 3CCJV 2EINC 1AR1B 2EZOA 2WLHA 1Y4SA 3E86A 1W0KG 2ZXWC 4WUDA 5M4NA 1F23A 2WPDG 4XDKA 1Y8NA 2WLIA 2P90A 3FB7C 4KFMA 1K33A 4QE7A 3NXSA 4CE1A 1QVFU 1L0OA 3OWBA 1AROP 3G7BA 1Q86W 2FYPA 3JD2A 3OR6C 1TC6A 1NVPB 1CEZA 4HAMA 2GSMB 4KUMA 4UV9A 1W2BU 3OMUA 5D7RA 2BU6A 3BEHA 1H7UA 3D0BA 3ZN1A 1R6NA 4FCQA 3RLRA 2CG9A 3HB3B 3K3WA 2XJJA 5FNDA 3AG4C 1SRYA 5LBQA 4MPCA 1AI4A 1NR7A 3SPGA 2M7WA 2YE2A 1AH8A 2IWUA 5IY5C 3HYYA 3K79A 2BRCA 4WFAV 4OXSA 4WFHA 1Y4UA 3K97A 3INXA 2WLMA 2V7QG 1QZRA 3F7VC 3E83A 1GKXA 3A0TA 3G4SV 4R3MA 5H6QA 3OUFA 3ZMTA 1B3QA 3FB8C 3CCQV 4N21A 1RPRA 1Z59A 2WI5A 3EHFA 4AS9A 4DUHA 1M9NA 4QPJA 1RM1C 5FWKA 2WSSG 1VQ5V 2H55A 3EHJA 1WLEA 3TZ5A 2Q68A 3C11A 4E01A 3LNMB 2D3OW 2XHXA 3ZRXA 2XAJA 4QPKA 2DYSC 1UY9A 2Q8GA 3CCVV 2PI5A 1Y8PA 3E35A 2CGFA 4P7AA 4ASAA 2F43G 4JF3A 2QG0A 4MTGA 3H4LA 3B24A 4XC0A 3JD0A 5L3GA 3D36A 3CCSV 1NHJA 2H8MA 1KKDA 1JCHA 1NHHA 2YE3A 2Z5UA 4G28B 2X0LA 3K06A 3Q5KA 4GFNA 1OCOB 4H37A 5LGNA 3NMQA 4GX5A 3W7XA 1VQPV 2QM7A 5CN0A 4EKWA 3INWA 3O0IA 4UVBA 2IWXA 1Q82W 4MBCA 5B1AC 5CBGA 3CRKA 4L94A 1K8AW 3RLPA 2WLJA 4QIWF 4WUBA 1GJVA 1B6QA 1B62A 1ZW9A 4PA3A 2X6CA 1KZNA 2YSUB 1VQKV 3JYCA 5CBFA 4DZYA 1OCOC 1G4YB 1AI6A 3ZMZA 2BT0A 2QG2A 4LPBA 2R9IA 3SYCA 2YGAA 3ABKB 4ASUG 1QCEA 5CA3A 3C0EA 4XTJA 2Q2EB 4BQGA 4E00A 4AWOA 2FXSA 2WI3A 5H6RA 2XDUA 3DTUB 2YEBA 4U93A 4GCZA 3K99A 1DLBA 2JDIG 3ZKBA 4E02A 4Z1MG 1MABG 4P2ZA 1GK9A 2P67A 2BTZA 3Q5LA 3ZMSA 1M56C 1R3KC 1GTOA 3CCLV 1YESA 1M1KW 4H7QA 3Q5JA 4XE2A 1R62A 3W7WA 3FB6C 4MVQA 3CCUV 2WEPA 3OR7C 2Q8HA 3E8HA 1PVGA 4MTXA 3SPCA 1RM1B 4LCUC 4R6ZA 1ZWHA 4GX2A 4JYCA 2YE4A 4KSGA 5F3KA 4O05A 2ZQMA 4KTNA 4HYOA 1AM1A 2XK2A 4CBCA 2CH4A 2YE6A 3PEHA 2IOQA 3QDDA 4LBEC 1QYEA 5J71A 4P9OA 3ZRSA 1QLNA 1PNMA 2WLKA 2XDSA 4HY1A 2JK5C 3WHAA 3VHAA 5FNFA 3RVYA 4MPNA 3G71V 3M99B 4MT8A 2GQPA 4EGHA 1R3JC 2IWSA 2Q67A 3LSQA 1R6KA 5DN6G 1CP9A 5LHGA 1MSWD 2XASA 1PKXA 2X6AA 3MD0A 5DM6V 4R3AA 1YTFB 3CMEV 4JQLA 4JPRA 3R4NA 5D6QA 4PRXA 3VHDA 3T4DA 2YJWA 3KG2A 4MP7A 2XX5A 3OEHG 4TWKA 2XAFA 4TSFG 3CRLA 4CWFA 1UYEA 3AG3C 2IJIA 2XDXA 3KE6A 1YJWV 3BY6A 4R50A 3SYAA 1GKFA 5L3CA 1S76D 3JZ3A 4MB9A 2BSMA 3AG3B 3T1KA 3ZKDA 1COWG 1S5HC 2WLLB 2ZXWB 2K1EA 2QE7G 1UJWB 5L3DA 2EINB 1K73W 3CC2V 3RKZA 5M4MA 3GIFA 3UM7A 2XX2A 3CWVA 5EBMC 4JAUA 4YKYA 4LP0A 5D7CA 3R91A 4TT3G 3FKSG 4N23A 4MS2A 3ML0A 3OEEG 1DTOA 4JYBA 2QA4V 4JGSA 3K0GA 3OFNG 4ZKIA 3TZ2A 4EFUA 5J9PC 3R65A 2YKJA 4L90A 4FPPA 3ABTA 2ATKC 1HWYA 3VOUA 1V55C 1Z5AA 5B1NA 2Q8IA 2EIMB 3ZN0A 4PA4A 1VQ4V 2FWZA 4O0BA 3E8GA 2ZDXA 2BZ5A 4MVRA 4YKTA 4FCPA 5CBHA 1H8EG 3IGAC 1V54B 4AWPA 2IH1C 1AJ6A 2K5BA 1M56B 2YEVB 2XAGA 3QTFA 3AG1B 3DGEA 2YEVA 4WCEV 2YEIA 2YGEA 4BQJA 1W0JG 4HYMA 2IW5A 4WFBV 3ASNB 5B3SB 2YE9A 2HR3A 2HVKC 2R9RB 1YT0A 1YSRA 2YE5A 1YC1A 5BOCA 1H7SA 5GGZA 2FTKA 3ABKC 1JM6A 1OCRB 2WERA 1KC8W 3E2EA 2KB1A 2WLNA 4G27B 3B8MA 2XJGA 4LC1A 4XKAA 3HEKA 2QFOA 1GM9A 1VQ6V 3T10A 2XCMA 3TTZA 4X88A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JKI A;  3U2D A;  3FT8 A;  3ZXO A;  4FCR A;  4GT8 A;  2VCI A;  3A0Z A;  3R4P A;  4HXW A;  4BIZ A;  4GEE A;  4MPE A;  2BU7 A;  4URN A;  2JJC A;  1YC4 A;  4ASB A;  3B25 A;  5J6A A;  4JAV A;  1YT2 A;  3CGY A;  5BOD A;  2O1V A;  3A0R A;  2WI4 A;  2XHR A;  5CTY A;  1S16 A;  3ZRV A;  2XAB A;  4HZ5 A;  3HZ5 A;  1UYL A;  1THN A;  5CTU A;  3GIG B;  4URO A;  1JOY A;  3HZ1 A;  4EMV A;  3BM9 A;  4MOT A;  1TID A;  4YKQ A;  1UYF A;  5CTX A;  3G7E A;  4PU9 A;  4LWG A;  4CWP A;  1UYM A;  2E0A A;  1Z5C A;  1U0Z A;  4ASF A;  2BU8 A;  2HCH A;  4ASG A;  4BXI A;  3ZRW B;  4Q20 A;  4PL9 A;  1TIL A;  4HY6 A;  4XCJ A;  3U67 A;  2FWY A;  4CWR A;  1UY8 A;  3CGZ A;  1GKZ A;  4LWI A;  2O1W A;  4I5S A;  2IOR A;  4XIT A;  4NH7 A;  4YKZ A;  3HYZ A;  1I59 A;  3OPD A;  3EKR A;  4H85 A;  4AWQ A;  1UYD A;  3TZ4 A;  1YS3 A;  4WUC A;  2Q8F A;  2UWD A;  4LWE A;  4HYP A;  4NH8 A;  1BKN A;  4KFG A;  1ZXN A;  1OSF A;  2WI6 A;  2WWW A;  1KIJ A;  2YEH A;  1BXD A;  4GQT A;  2QF6 A;  1F51 A;  1I5C A;  4YKR A;  4HXZ A;  2XJX A;  2O1U A;  4XD8 A;  2GFD A;  4BIU A;  2YJX A;  4CWQ A;  1UYH A;  4CWO A;  2YEF A;  4LWH A;  4ZVI A;  3BMY A;  4LWF A;  4CWT A;  3A0X A;  4V26 A;  2QM8 A;  4URL A;  1YER A;  4BAE A;  3FV5 A;  2YEJ A;  4U7N A;  3VAD A;  3EHG A;  4R1F A;  1YSZ A;  4GGL A;  4W7T A;  2ZDY A;  3B28 A;  4MP2 A;  3LNU A;  2YE7 A;  2CCU A;  4XIR A;  5CTW A;  1UYK A;  3T0H A;  3ZRW A;  3ZM7 A;  3RLQ A;  3PEJ A;  4L8Z A;  2VCJ A;  1TBW A;  4EGK A;  4GT1 A;  2LFR A;  3H80 A;  2YEC A;  4O07 A;  2BYH A;  2PNR A;  3ZXQ A;  3SL2 A;  4CE2 A;  2HG1 A;  3OWD A;  3OW6 A;  1TC0 A;  4X9L A;  3R92 A;  1MX0 A;  2VW5 A;  1ZXM A;  4U7O A;  1EI1 A;  3GIG A;  4P8O A;  3GIE A;  1MU5 A;  3IED A;  2YK9 A;  4YKW A;  3EKO A;  2YKB A;  4JAS A;  4KSH A;  2WI7 A;  4O09 A;  4L91 A;  3A0Y A;  3TK1 A;  2WEQ A;  2ZBK B;  3MNR P;  2YE8 A;  2YI0 A;  2YEA A;  2CCS A;  2BYI A;  1UYI A;  5D7D A;  1US7 A;  4CE3 A;  2YKC A;  4XKK A;  1BGQ A;  2BRE A;  3O6O A;  4H81 A;  5CF0 A;  5IDM A;  1IXM A;  4O04 A;  1I5D A;  4KP4 A;  3K98 A;  3A0W A;  1UYG A;  2LFS A;  1YC3 A;  4FMT A;  4B6C A;  2YKI A;  3HHU A;  1I58 A;  1YET A;  4XCL A;  4I3H A;  4KQV A;  4XDM A;  2VWC A;  3R4O A;  2YK2 A;  2ZKJ A;  2YED A;  2AKP A;  1S14 A;  2IOP A;  3B26 A;  5IN9 A;  3FT5 A;  4L93 A;  3R4M A;  3G75 A;  2XHT A;  1Y8O A;  1EA6 A;  1UY7 A;  2XD6 A;  5M4E A;  5B1O A;  2BU5 A;  3EHH A;  5F5R A;  2YEG A;  1I5B A;  2YEE A;  5CPH A;  2YI7 A;  4EGI A;  3LPS A;  2EXL A;  2BU2 A;  1I5A A;  1TH8 A;  5M4P A;  1Z5B A;  2YGF A;  4XKO A;  4CWS A;  2ESA A;  5C93 A;  2XDK A;  1AH6 A;  4CWN A;  4YKX A;  3P32 A;  5IDJ A;  3U2K A;  1AMW A;  4NH9 A;  4YKU A;  4XIQ A;  2XDL A;  1ID0 A;  4XIP A;  5L3J A;  3O2F A;  5D6P A;  3ZCC A;  4V25 A;  3K60 A;  4URM A;  3T2S A;  4K4O A;  1B63 A;  2YKE A;  3TZ0 A;  3VHC A;  1UYC A;  3TUH A;  2WI1 A;  4HZ0 A;  3T0Z A;  2C2A A;  4PRV A;  1YT1 A;  1BYQ A;  1U2O A;  5FNC A;  3WQ9 A;  2CCT A;  2XX4 A;  3B27 A;  5M4K A;  1QY8 A;  4EFT A;  1UY6 A;  3D2R A;  2HKJ A;  2YI5 A;  2YI6 A;  2WI2 A;  1A4H A;  5M4H A;  4B7P A;  1NHI A;  1Y4S A;  4WUD A;  5M4N A;  1Y8N A;  3NXS A;  4CE1 A;  1L0O A;  3OWB A;  3G7B A;  2FYP A;  1TC6 A;  5D7R A;  3OMU A;  4EEH A;  3RLR A;  2BU6 A;  1H7U A;  3D0B A;  4FCQ A;  2CG9 A;  2XJJ A;  5FND A;  4MPC A;  2YE2 A;  1AH8 A;  2IWU A;  3HYY A;  2BRC A;  1Y4U A;  3K97 A;  3INX A;  1QZR A;  1GKX A;  3A0T A;  4R3M A;  1B3Q A;  1Z59 A;  2WI5 A;  4DUH A;  3EHF A;  4QPJ A;  5FWK A;  2H55 A;  3EHJ A;  3TZ5 A;  3C11 A;  4E01 A;  2XHX A;  3ZRX A;  1UY9 A;  4QPK A;  2Q8G A;  1Y8P A;  2CGF A;  4P7A A;  4ASA A;  2QG0 A;  3H4L A;  3B24 A;  4XC0 A;  3D36 A;  1NHJ A;  2H8M A;  1NHH A;  2YE3 A;  3Q5K A;  4GFN A;  3NMQ A;  2QM7 A;  3INW A;  3O0I A;  4EM7 A;  2IWX A;  4MBC A;  3CRK A;  4L94 A;  3RLP A;  4WUB A;  1GJV A;  1B62 A;  1ZW9 A;  1KZN A;  4DZY A;  4LPB A;  2BT0 A;  2QG2 A;  2YGA A;  3C0E A;  4XTJ A;  2Q2E B;  4BQG A;  4E00 A;  4AWO A;  2FXS A;  2WI3 A;  2XDU A;  2YEB A;  4U93 A;  4GCZ A;  3K99 A;  3ZKB A;  4E02 A;  2P67 A;  2BTZ A;  3Q5L A;  4H7Q A;  1YES A;  4XE2 A;  3Q5J A;  1R62 A;  2WEP A;  2Q8H A;  1PVG A;  4MTX A;  2YE4 A;  1ZWH A;  4JYC A;  4KSG A;  5F3K A;  4O05 A;  4KTN A;  1AM1 A;  2XK2 A;  3PEH A;  2CH4 A;  2YE6 A;  3QDD A;  2IOQ A;  5J71 A;  1QYE A;  2XDS A;  4HY1 A;  3WHA A;  3VHA A;  5FNF A;  4MPN A;  4MT8 A;  4EGH A;  2GQP A;  2IWS A;  3MD0 A;  4R3A A;  4JQL A;  3R4N A;  5D6Q A;  4PRX A;  3VHD A;  4MP7 A;  2YJW A;  2XX5 A;  3CRL A;  4CWF A;  1UYE A;  2XDX A;  3KE6 A;  4MB9 A;  3JZ3 A;  2BSM A;  3T1K A;  3ZKD A;  3RKZ A;  5M4M A;  3GIF A;  2XX2 A;  3CWV A;  4YKY A;  5D7C A;  4JAU A;  4LP0 A;  3R91 A;  4JYB A;  3TZ2 A;  4ZKI A;  4EFU A;  4L90 A;  2YKJ A;  4FPP A;  1Z5A A;  5B1N A;  2Q8I A;  2FWZ A;  4O0B A;  2ZDX A;  2BZ5 A;  4YKT A;  4FCP A;  4AWP A;  1AJ6 A;  2K5B A;  3QTF A;  3DGE A;  2YGE A;  2YEI A;  4BQJ A;  4HYM A;  2YE9 A;  4AS9 A;  1YT0 A;  2YE5 A;  1YSR A;  5BOC A;  1YC1 A;  1H7S A;  5GGZ A;  2FTK A;  1JM6 A;  2WER A;  2XJG A;  4LC1 A;  4XKA A;  3HEK A;  2QFO A;  3T10 A;  2XCM A;  3TTZ A; 
#chains in the Genus database with same CATH topology
 3FYI B;  1EFR G;  2DW4 A;  5KHK A;  3U2D A;  2HFE C;  2P7T C;  2KQX A;  3JAW A;  2XND G;  3APQ A;  2VCI A;  4OPH A;  5H5N A;  4I4T B;  2Z3Y A;  4BIZ A;  4I7Z B;  1RPO A;  4TQD A;  4LF7 O;  4JYY A;  3X2Q C;  4PA9 A;  1XIL A;  5HFM A;  1YC4 A;  2E75 B;  1K3E A;  2F23 A;  1SET A;  2DYS B;  4DW0 A;  5BOD A;  2WI4 A;  5D5P A;  5CTY A;  1S16 A;  4RWU A;  1UYL A;  2QWP B;  4EB6 B;  3I5D A;  2P4K A;  1VIB A;  5LOV B;  2YIB D;  1FXH A;  3STZ C;  3CMA V;  2XAH A;  3GIG B;  1DF5 A;  1JOY A;  1BMF G;  2CTR A;  5IY5 B;  5B1B C;  3BM9 A;  3OW2 U;  4MOT A;  2A06 H;  1TID A;  1YJN V;  1NTK H;  1DGS A;  4YKQ A;  3JAS A;  3JD3 A;  5CTX A;  2EIK B;  2LO1 A;  3GWK C;  1ZUQ A;  3LDC A;  2E0A A;  1Z5C A;  2FB5 A;  4BXI A;  2DWD C;  1L0L H;  1Y76 A;  1EZV H;  3Q4H B;  4Q20 A;  1NVP D;  1BQ0 A;  4HY6 A;  3OT7 A;  3E8B A;  2FWY A;  4E4E A;  5B5E Z;  2B5U A;  3BCC H;  1HNZ O;  1M57 C;  1BZK A;  3H1K H;  2BOC C;  3HKE A;  1WB7 A;  3IJ4 A;  2O1W A;  1HR0 B;  5DED A;  3G80 A;  4U3F H;  4DUY B;  3SPI A;  4NH7 A;  3HYZ A;  4AQY B;  5IT9 N;  4FK5 C;  3RN4 A;  1KD1 W;  3EKR A;  2GDS A;  4PDM A;  4B3R B;  3I55 V;  4DV2 B;  2Q8F A;  5JJN B;  4F6R A;  4PI0 A;  4LWE A;  4NH8 A;  1GMG A;  3AG2 B;  5CA1 A;  4KFG A;  1ZXN A;  4Z2W A;  1OCC B;  4YHH O;  3W7U A;  1Y67 A;  1EN4 A;  2KG7 A;  2Y4U A;  2XJX A;  4KXR A;  2O1U A;  1WP7 A;  2JIZ G;  3H1J H;  4XD8 A;  2GFD A;  1YDX A;  4BIU A;  1PNL A;  4CWQ A;  3CWB H;  1UYH A;  2W6J G;  4LWH A;  2Y0I A;  4LWF A;  3WG7 C;  4GX0 A;  2OT5 A;  4X1I B;  3MDS A;  1K7D A;  2QWO B;  3MHS C;  1RSO B;  4DV7 B;  1ZAU A;  3VAD A;  3CCR V;  3U11 A;  3OGI B;  3CD6 V;  3L9D A;  4XBF A;  3T1Y B;  1XMO O;  1KP3 A;  1RP3 B;  4XIR A;  3QNE A;  3BFR A;  3ZM7 A;  2VCJ A;  2CK3 G;  1TBW A;  4EGK A;  3FD9 A;  1EN6 A;  1SC5 B;  2LFR A;  5FNV A;  4O07 A;  1TVK A;  3SL2 A;  1M4U A;  5EK0 A;  4I50 A;  4X9L A;  5F2V O;  1MX0 A;  2Q7E A;  1ZLZ A;  4QNH B;  1ORQ C;  2Q4P A;  1D2D A;  3B77 A;  2BTQ A;  1HP8 A;  4MVU A;  2YK9 A;  2RMK B;  3QO5 A;  2UXC B;  3JAT A;  4IYH A;  1QVG U;  2AHY A;  1ZWI C;  3TK1 A;  3FB5 C;  2ZBK B;  2BE3 A;  3HKC A;  4H33 A;  4K0K O;  2CCS A;  2YI0 A;  1KMI Z;  3RWR D;  4MVZ A;  5LXT B;  2N74 A;  4LP8 A;  1P4R A;  5CB4 A;  1AI5 A;  1VAR A;  2IJJ A;  1IXM A;  4O04 A;  1SQP H;  5GON B;  3EFF K;  4LF8 O;  3UT5 B;  4CH5 A;  2ZNI A;  2RJZ A;  5H9C A;  4DR3 O;  4XDM A;  5LA6 B;  3R4O A;  3LDE A;  2O57 A;  1FXK A;  3E8F A;  1K34 A;  2YED A;  2AKP A;  2IOP A;  1E1Q G;  3FT5 A;  4JI2 O;  5BZB A;  3IAY A;  4I9W A;  3R4M A;  1FFT B;  2XHT A;  1EA6 A;  5LGT A;  2EUL A;  1YVW A;  4JV5 B;  2NNU A;  3H1H H;  3MAQ A;  1QLE B;  3B2E E;  2BU5 A;  3EHH A;  5F5R A;  5JWP A;  2IM9 A;  5C8Y A;  4LWS A;  4UVC A;  4IL6 Z;  3BAA A;  2DE0 X;  4DR4 B;  2YI7 A;  2JVD A;  4OX9 O;  1X4T A;  4RQF A;  2EXL A;  4RAI A;  5M4P A;  4G2K A;  4DV4 B;  5LMN O;  2OWO A;  1FAF A;  4K0K B;  1XUQ A;  3T2M A;  1Y66 A;  1AH6 A;  4DV5 O;  4NXN B;  2E5L O;  4UB6 Z;  3U2K A;  3CHX A;  2XHB A;  3BHP A;  3VQW A;  3JAT B;  2XDL A;  5EIB D;  2ZR2 A;  4XIP A;  2PY5 A;  5JVD B;  5L3J A;  3LSU A;  2XT9 A;  3ZIA G;  4ICG A;  4JI5 B;  4UXN A;  4URM A;  2R9A A;  3ETQ A;  1ZX3 A;  2XOK G;  3IC7 A;  4UCS A;  3MHH C;  3WB1 A;  1GN2 A;  1N36 B;  2HHI A;  2OTL V;  3SPJ A;  3TUH A;  4PA6 A;  1YT1 A;  1WA8 B;  4JI0 B;  1BYQ A;  1WPX A;  1XL6 A;  1Q81 W;  3KKY A;  2NLJ C;  2EIM C;  4YJ3 B;  5JVD A;  2UU9 B;  5IYB O;  1V55 B;  4GYC B;  4DV0 B;  1HNX O;  4EFT A;  3D2R A;  3ABM B;  3LDD A;  2YI6 A;  1JR9 A;  2WI2 A;  1XRE A;  2BSK B;  4DR1 O;  3JAL A;  1R1B A;  1RSO A;  2EIN C;  2EZO A;  4NVP A;  1KKC A;  1BGY H;  1F23 A;  1Y8N A;  2WLI A;  3FB7 C;  4KFM A;  4CE1 A;  4FM1 A;  4DR5 B;  4YY3 O;  3CS5 A;  1RFY A;  2AW9 A;  1Q86 W;  4NTX A;  2ADP A;  5D7R A;  3OMU A;  3RLR A;  3B40 A;  3D0B A;  4B3M B;  3HB3 B;  3K3W A;  1MZF A;  5LBQ A;  2ZM6 B;  3SPG A;  5CA0 B;  3J81 N;  4WFH A;  4K35 A;  1Y4U A;  3J80 N;  2V7Q G;  4GUN A;  1QZR A;  2CAZ C;  4J7Z A;  3A0T A;  3OUF A;  3ZX6 A;  3CCQ V;  5JH7 A;  1Z59 A;  4DUH A;  5E79 Z;  3AK1 A;  1RM1 C;  2WSS G;  3EHJ A;  4UB8 Z;  3C11 A;  4NTW A;  3BAB A;  3LNM B;  2UXD B;  4QPK A;  4CH6 A;  2Q8G A;  2CGF A;  4P7A A;  4DRX B;  4H44 B;  4QGP A;  4GLX A;  3CCS V;  2H8M A;  1JCH A;  5KHJ A;  1VEW A;  5CB4 B;  2UUB B;  1SKV A;  4DV4 O;  1OCO B;  3NMQ A;  2QM7 A;  2ZT9 B;  3INW A;  3O0I A;  2PGG A;  2JS5 A;  1Q82 W;  4WBN B;  3SJC C;  5CBG A;  3RLP A;  2ZE6 A;  4LH7 A;  4DW1 A;  3DXR A;  2C1I A;  4DR6 O;  4LF4 O;  3ZMZ A;  4LPB A;  2BT0 A;  3A0H Z;  2C1G A;  2ZNJ A;  2UXD O;  4BQG A;  4E00 A;  1X59 A;  2FXS A;  2Q7G A;  1IBL O;  4B3T B;  4LNU B;  2YEB A;  1Y76 B;  1YXB A;  3K99 A;  3EVK A;  1M56 C;  1R3K C;  3CJH A;  4B3S B;  2CDY A;  3ZHV A;  1WJZ A;  4FZ1 A;  3OR7 C;  2Q8H A;  3E8H A;  4LCU C;  1ZWH A;  1QHT A;  4GX2 A;  2DOS A;  3ZHR A;  2ZQM A;  2XK2 A;  2CH4 A;  5J71 A;  3G67 A;  4LBE C;  4P9O A;  4NKG B;  1N33 O;  3C3T A;  1QLN A;  2XDS A;  4HY1 A;  3A8T A;  3K59 A;  4MPN A;  4EGH A;  1R3J C;  2IWS A;  3LSQ A;  1R6K A;  4IHJ A;  3F5T A;  1B06 A;  5LHG A;  2XAS A;  1PKX A;  3D36 C;  3CME V;  2QJ1 A;  4MP7 A;  1US6 A;  3KG2 A;  4DV6 O;  3OEH G;  2YID A;  4TWK A;  4TSF G;  1LUV A;  3CRL A;  4CWF A;  1Y6X A;  3K58 A;  5BR8 O;  3KE6 A;  3FAV B;  1YJW V;  1S76 D;  1GKF A;  3EXA A;  4OGQ B;  2QE7 G;  1UJW B;  3AK3 A;  1FFX B;  3CC2 V;  3RKZ A;  2OCH A;  2RNB A;  2FL4 A;  4CH4 A;  3K9S A;  1DTO A;  4JGS A;  4ZKI A;  3OFN G;  4L90 A;  4DR6 B;  3ABT A;  1A32 A;  2ATK C;  3R66 A;  1V55 C;  4YHH B;  2D2C B;  2Q8I A;  3ZN0 A;  4LWS B;  4PA4 A;  5JCO A;  1TAE A;  4TV9 A;  4I55 B;  1V54 B;  1AJ6 A;  1M56 B;  2YEV B;  1WPB A;  4FLU A;  3AG1 B;  2YGE A;  2YEI A;  5FLX N;  4X62 B;  2UXB O;  1W0J G;  4WFB V;  5B3S B;  2YE9 A;  1YT0 A;  2YE5 A;  2R9R B;  1YC1 A;  3FX7 A;  3ABK C;  4AQY O;  3E2E A;  2RDC A;  4G27 B;  4XKA A;  3HEK A;  3T10 A;  4LFB O;  1OCZ B;  4FCR A;  5L3E A;  5A9G A;  3R4P A;  4HXW A;  2YIB A;  4UCR A;  1SES A;  2IH3 C;  5BY1 A;  1XOU A;  4GEE A;  4MPE A;  1YCI A;  1ZL8 B;  3H1L H;  3RYI A;  2JJC A;  1VQ7 V;  5KAF Z;  3JSL A;  1N36 O;  1YT2 A;  3A0R A;  2KSD A;  2OIG A;  1K4C C;  3HZ5 A;  3D8C A;  1GO3 F;  3Q4H A;  3JCZ A;  5GTH Z;  1BE3 H;  4LF5 O;  4CS2 A;  3T1H O;  2OCC B;  3A0B Z;  2B1I A;  4X1K A;  4AIL C;  4X89 A;  4GKJ B;  4DV2 O;  4LR3 A;  4UFZ A;  1BHB A;  2A9H A;  1AJQ A;  2Q6A A;  1F4N A;  4EMV A;  4L87 A;  4UV8 A;  1UYF A;  4PU9 A;  1R3L C;  2ZIN A;  1QU7 A;  4FM2 A;  5KUK A;  1UYM A;  2HJF C;  2LP7 A;  2LW7 A;  2Q7H A;  2VRZ A;  2AZ2 A;  2HCH A;  4ASG A;  3LUT B;  4PD4 F;  3ZRW B;  1YJ9 V;  4MTO A;  1KB9 F;  1GH6 A;  3SYQ A;  1TIL A;  4XCJ A;  1WAZ A;  5JQG B;  4CWR A;  2PYJ A;  1UY8 A;  1Q43 A;  1I0H A;  4QJF B;  1ENV A;  4LWI A;  2VQE B;  2PTM A;  4XIT A;  2Q69 A;  5EIB C;  5C8Y B;  4WFG A;  1HNW O;  4FLX A;  4H0L B;  2A79 B;  2HJD A;  4DRX A;  5JH7 B;  4H85 A;  1NH2 D;  2YIC A;  3TZ4 A;  1H2M A;  1YS3 A;  1XEQ A;  4X1Y A;  2A0L A;  3FYE B;  2UWD A;  4UCT A;  1BKN A;  3ZHQ A;  2DYR B;  1AIL A;  4IIJ B;  1Q3E A;  4O4I B;  5LL6 Y;  2WWW A;  1BXD A;  1F51 A;  1EBO A;  4ZHQ B;  1I5Y A;  3SPH A;  4PDV A;  1J95 A;  3K5O A;  4DR7 B;  1Q6U A;  2VQF B;  1S5J A;  3B4S A;  5EC1 C;  2YJX A;  3ZMU A;  2WLI B;  4CWO A;  4MTF A;  1B04 A;  3CC4 V;  3VBB A;  1P7G A;  3BMY A;  1AI7 A;  2E76 B;  3OGC C;  3APO A;  1JPX A;  1MSD A;  1VF6 C;  4BAE A;  4TV8 A;  1AJP A;  5KHH A;  5KLV H;  3ZMV A;  1Y74 B;  3EHG A;  2DQ0 A;  4MP2 A;  3G6E V;  1NTZ H;  3LNU A;  2YE7 A;  2ITD C;  4FIP C;  2UUB O;  2CCU A;  1OHH G;  2EIL C;  4FJC C;  3ZRW A;  2CTP A;  4YXW G;  4LF7 B;  2HHH O;  4PJ0 Z;  4GT1 A;  2YEC A;  1FXV A;  4LFC O;  2PNR A;  3OM3 B;  1V9P A;  2CUG A;  3UO3 A;  1Z2G A;  1NH2 B;  2XAQ A;  1ZXM A;  4U7O A;  4B3S O;  4P8O A;  3J7A U;  3GIE A;  1MU5 A;  3IED A;  4IT5 A;  1BHA A;  5GW7 A;  2JJ2 G;  1NTM H;  4LNU A;  2WI7 A;  4O09 A;  3A0Y A;  1AR5 A;  3ABU A;  2BYI A;  1UYI A;  1AB3 A;  4DR2 B;  4F6E A;  2YKC A;  2F1M A;  2W6I G;  1BGQ A;  2BRE A;  3O6O A;  4H81 A;  5CF0 A;  4JI3 O;  4K8Z A;  3NR7 A;  4X8A A;  4KP4 A;  5EC2 C;  3CCM V;  2Q73 A;  3OTO O;  1UYG A;  2LFS A;  5HFL A;  1JQ0 A;  3O65 A;  1YC3 A;  4Q6G A;  4KQV A;  2KG7 B;  3L70 H;  1S0V A;  3QF7 A;  2QGN A;  1VMG A;  5IN9 A;  3RFR A;  1MMM A;  4OPA A;  2EIK C;  1I94 B;  1L8D A;  1SA0 A;  3ZHT A;  2XD6 A;  1SQQ H;  5M4E A;  5B1O A;  2X6B A;  5IWA B;  4TOI A;  2YEG A;  4FLV A;  3JAK A;  1YSC A;  4JTA B;  1YTF D;  1I5B A;  5CPH A;  4EGI A;  3LPS A;  3SYP A;  1I5A A;  1TH8 A;  2Z0A A;  4KHP B;  4CWS A;  1K5S A;  1I08 A;  3WG7 B;  2XDK A;  1S5L Z;  4EFB A;  4NTY A;  4CWN A;  1TUB B;  3RYC B;  4YKX A;  3P32 A;  1H2G A;  3X2Q B;  2ZE5 A;  4J80 A;  1YIT V;  1HNW B;  1AMW A;  3UQ8 A;  2P6J A;  1QBZ A;  2LW1 A;  5E1A C;  5EZY A;  4CS3 A;  4J41 A;  1LUW A;  5FPO A;  3K60 A;  4E72 A;  2F66 C;  2ADQ B;  3ETD A;  1S3J A;  3T1C A;  1MA1 A;  3JAS B;  1B63 A;  1FXK C;  2YKE A;  3TZ0 A;  4YJ3 A;  1S77 D;  2HP8 A;  1UYC A;  1BL8 A;  2WAM A;  5KUM A;  3CCE V;  3T0Z A;  2C2A A;  3C90 A;  4PRV A;  1FKA O;  4O4H A;  1P7B A;  2RN9 A;  1U2O A;  3WQ9 A;  1FPO A;  3U10 A;  1Q8I A;  5M4K A;  5LMU B;  1BS3 A;  1KEC A;  4JI8 O;  1S72 V;  4LH6 A;  4O4J B;  4W4L A;  5J2T A;  4MVM A;  4BAY A;  1QNM A;  1JJ2 U;  1NHI A;  3DXR B;  4FM0 A;  3CRA A;  2WLH A;  3E86 A;  2ZXW C;  5M4N A;  3D3Q A;  4JYA B;  1K33 A;  1QVF U;  3OWB A;  3OTO B;  2EX3 A;  2GSM B;  1W2B U;  2F4V B;  2ZKO A;  4CC5 A;  4JI3 B;  4FCQ A;  5AG2 A;  1AP6 A;  1LR1 A;  5FND A;  3RGB A;  1YZB A;  1IUR A;  4OXS A;  3INX A;  4LFA B;  1NZ6 A;  4JI5 O;  1GKX A;  4R3M A;  1B3Q A;  2WI5 A;  1YF2 A;  4I0X A;  5FWK A;  1SQV H;  1M5I A;  1VQ5 V;  3TZ5 A;  1N32 O;  1SZX A;  2QG0 A;  4MTG A;  4XC0 A;  3JD0 A;  1NHJ A;  3ZS8 C;  2Z5U A;  3Q5K A;  4DK1 A;  4GFN A;  5LGN A;  3W7X A;  2ZE8 A;  5B1A C;  4QIW F;  3BA8 A;  5IYZ B;  2X6C A;  2QG2 A;  2YS8 A;  3SYC A;  2YGA A;  5CA3 A;  4NYK A;  5A2Q N;  1I7F A;  2XDU A;  3DTU B;  4U93 A;  3ZKB A;  4E02 A;  1GK9 A;  3TXQ A;  4PV1 B;  1GTO A;  1M1K W;  5KX5 B;  1YEW A;  1KU9 A;  3W7W A;  3FB6 C;  4DUZ O;  2WEP A;  2UU9 O;  2UUA O;  2N04 A;  1PVG A;  3SPC A;  2YE4 A;  4JYC A;  2HEP A;  4O05 A;  1AM1 A;  4J11 A;  1KBH A;  2WA3 A;  1HNZ B;  5JJE B;  1PNM A;  1BQZ A;  2JK5 C;  1CXZ B;  5FNF A;  3RVY A;  4X65 O;  2Q67 A;  5EZY B;  4X65 B;  1MSW D;  3MD0 A;  4R3A A;  2QKA A;  2X6A A;  4B3R O;  3T4D A;  2YJW A;  1N34 B;  3RYC A;  2CTQ A;  3BY6 A;  3AG7 A;  4R50 A;  3SYA A;  3JZ3 A;  1U97 A;  3N2K A;  2YI8 A;  1S5H C;  1G1X B;  3HKB A;  3VQX A;  4I4T A;  1SQF A;  5M4M A;  4TUY A;  3CWV A;  4PHZ A;  1URF A;  3FKS G;  4CH3 A;  4C7U A;  3ML0 A;  4JYB A;  3TZ2 A;  2M6Y A;  3K0G A;  4JAA A;  2VS0 A;  4HBN A;  4LFC B;  3VOU A;  1Z5A A;  5LP6 C;  2EIM B;  2Q8V A;  4O0B A;  3E8G A;  1U96 A;  2ZDX A;  4YKT A;  5CBH A;  4ZIB A;  2YEV A;  3RYF A;  4BQJ A;  4HYM A;  5CA1 B;  4DUZ B;  3ASN B;  4FFB A;  2HR3 A;  1YSR A;  5GGZ A;  1OCR B;  2YXL A;  2WER A;  2KB1 A;  2V4D A;  2XJG A;  1XI1 A;  4LC1 A;  4TUY B;  2QFO A;  1VQ6 V;  5IE9 A;  4X88 A;  4NXM B;  3EHB B;  3HKB B;  2JKI A;  4MW3 A;  1IVS A;  4GKJ O;  3UT5 A;  2ZDI C;  4UCV A;  3A0Z A;  3JAL B;  4TQF A;  4B3M O;  3HKC B;  1BSM A;  2H94 A;  2Y48 A;  1LNQ A;  2BU7 A;  4URN A;  4ASB A;  3B8N A;  4DR5 O;  1PV0 A;  3B25 A;  5J6A A;  4JAV A;  4U3J A;  5J2U A;  3CRR A;  2O1V A;  1THZ A;  3N27 A;  3THO A;  3ZRV A;  2XAB A;  4HZ5 A;  1NS1 A;  2Y0P A;  4YIP A;  1OJH A;  4O4H B;  4ZBM A;  1HW7 A;  1THN A;  4URO A;  3TJT A;  3P3P A;  2QKS A;  4F4L A;  2EZP A;  3JAM N;  1KUQ A;  4EFE A;  1NQT A;  4R7C A;  4MVO A;  2ZE7 A;  4ZI7 B;  3OTF A;  2Q9L A;  4EEQ A;  5BMV A;  3G7E A;  2P4V A;  4LWG A;  1ROP A;  4LFA O;  2QTS A;  1IBK O;  1K4D C;  1AJN A;  3OMA B;  2QKC A;  2VQE O;  4JI7 B;  4NB5 A;  1Y74 A;  2DMX A;  3LMM A;  3SDL A;  2GTA A;  5FL7 G;  4PI2 A;  2EIJ C;  3OAA G;  2LGQ A;  3ASO B;  1M90 W;  3H01 A;  2IU3 A;  3CGZ A;  3CXH F;  1GKZ A;  3RT3 C;  2PZS A;  2IU0 A;  2IOR A;  1JFF B;  3VQY A;  3W7S A;  3W7T A;  5KMG A;  2Q0A A;  5JEN A;  3JAK B;  1I59 A;  1FJG B;  3OPD A;  1MOF A;  3UKM A;  4JTD B;  3ZJZ A;  1UYD A;  2EBO A;  1BT8 A;  1H38 A;  1QR8 A;  3TGU H;  3ABL B;  3ETG A;  3QG5 A;  2IJH A;  1XQ8 A;  1OSF A;  3N2G B;  4FLW A;  2WI6 A;  1GAX A;  1KIJ A;  2YEH A;  3AK2 A;  3CX5 F;  3VQV A;  4HXZ A;  3E22 B;  1Z5W A;  4O4L A;  3U0Z A;  2QM4 A;  4GX1 A;  5KA5 A;  2IJK A;  5LHH A;  4LF6 B;  4P30 A;  4NXM O;  2YEF A;  2Q0O C;  4DR1 B;  4JZ2 A;  3BA9 A;  4MVS A;  3SYO A;  1WN7 A;  1GN3 A;  3GVM A;  2X7R B;  2JEX A;  2QM8 A;  5GON A;  4URL A;  2WLL A;  1SZT A;  2GUZ A;  3K04 A;  3IFX A;  4U7N A;  4LF5 B;  4XDJ A;  4J9Z B;  4W7T A;  4FLZ A;  2ZDY A;  5EYP A;  4HZ3 A;  2HVJ C;  1QLE C;  3K9A A;  1QR9 A;  3BVO A;  1GRJ A;  5IJ9 A;  5BMV B;  2BCC H;  2PUS A;  3T0H A;  3WFV A;  5LP6 A;  2LQT A;  4UUJ C;  1XNQ B;  2GTS A;  3RLQ A;  4ABM A;  5KHI A;  4L8Z A;  2DQ3 A;  1EM1 A;  4JI7 O;  3RBZ A;  5K1X A;  2BYH A;  3K57 A;  3ZXQ A;  3K08 A;  1UFI A;  4CE2 A;  3JCU Z;  2UUC B;  3OW6 A;  1NR1 A;  1TC0 A;  3R92 A;  1NJI W;  3AG2 C;  3HPL C;  5FNV B;  2VW5 A;  4LF9 B;  3ZHU A;  1EI1 A;  3DC6 A;  2MK3 A;  1PNK A;  2LGW A;  4YKW A;  2YKB A;  4JAS A;  3GWO A;  5LMU O;  3FFQ A;  5EYP B;  5BR8 B;  1IZ3 A;  4DV3 B;  4X1I A;  2L6L A;  1CPY A;  3AEI A;  2ZDI A;  1US7 A;  4XKK A;  2ZIM A;  1L1F A;  5IDM A;  1I5D A;  1VF6 A;  3CXC U;  3A0W A;  1EZJ A;  1M57 B;  3ASO C;  4RQE A;  4FMT A;  2W0X A;  4J9Y B;  5IYC O;  2YKI A;  1WNS A;  1UPG A;  4XCL A;  4PA7 A;  4I3H A;  3E22 A;  4DO2 A;  1BCC H;  1XDC A;  2VWC A;  2YK2 A;  4J7J A;  5EBW C;  1E79 G;  2PF4 E;  4QE9 A;  1GM7 A;  2QWR B;  3WB0 A;  4F6R B;  4L93 A;  4O2A A;  1DK1 A;  1MG1 A;  4CZZ A;  2V1D A;  1OV9 A;  1KQS U;  4ZOL B;  4MW8 A;  1R6T A;  3JAR A;  1N0N A;  2ETN A;  2YEE A;  1XL4 A;  2OCC C;  4WFE A;  5KMG B;  1H2N A;  2N05 A;  2YDE A;  5DEC A;  1W59 A;  2BU2 A;  1MZE A;  1Z5V A;  5LYJ B;  1Z5B A;  3N2K B;  4XKO A;  4DYL A;  4YIO A;  4XDL A;  1O9G A;  3FAV A;  5C93 A;  4WF9 V;  2ODM A;  2HG5 C;  2W0F C;  3F7Y C;  4NH9 A;  4WFF A;  1VQ8 V;  3CRC A;  4X66 B;  1ID0 A;  5CMU A;  1VQN V;  4DUY O;  4X66 O;  3O2F A;  4JI1 O;  5D6P A;  4V25 A;  2QWQ B;  2E5L B;  1TUE B;  4K4O A;  1OCC C;  5IYD O;  1ZSP A;  3ABL C;  1NBM G;  3F5W C;  3CE2 A;  3T4Z A;  3OE7 G;  5B3S C;  4HZ0 A;  3UO2 A;  2ZM6 O;  1I5X A;  3AG1 C;  2ZR3 A;  4JYA O;  2JS3 A;  3ICX A;  4R8C A;  1I94 O;  1JJO A;  5J2U B;  2CCT A;  3B27 A;  5LP6 B;  3ETE A;  1UY6 A;  1GN4 A;  1Q5O A;  4JI6 O;  5M4H A;  1A4H A;  4P9P A;  3CYO A;  1JA8 A;  1OZ0 A;  3LSS A;  4J7K A;  1F4M A;  4L8J A;  2JEU A;  4U3J B;  2YIA A;  2ZD9 A;  4UVA A;  1TA8 A;  1QQC A;  1AR1 B;  1Y4S A;  3WB2 A;  4FLT A;  4DV6 B;  5D5Q A;  3S3W A;  4QE7 A;  4W4K A;  1ARO P;  1AP5 A;  4KHP O;  3G7B A;  2FYP A;  3JD2 A;  1NVP B;  4HAM A;  5LYJ A;  4UV9 A;  4EEH A;  2BU6 A;  3C3S A;  1R6N A;  2CGO A;  2XJJ A;  3AG4 C;  2M7W A;  4O4I A;  2IWU A;  3HYY A;  3K79 A;  5IWA O;  4WFA V;  1KYO F;  4I55 A;  3K97 A;  2WLM A;  2E3C A;  3PN1 A;  3F7V C;  5H6Q A;  5TIS Z;  3ZMT A;  1RPR A;  3EHF A;  1M9N A;  4QPJ A;  2OYQ A;  2YXH A;  4E01 A;  2D3O W;  1IBM B;  1TGO A;  2XAJ A;  1UY9 A;  1Y8P A;  4ASA A;  3E35 A;  5B66 Z;  5KHG A;  1J5E O;  2VQF O;  2CTW A;  4I9Q A;  1NHH A;  4DV1 B;  4G28 B;  3K06 A;  3CSX A;  3BPZ A;  1VQP V;  4EKW A;  4UVB A;  4L94 A;  3HKE B;  1B6Q A;  2WA4 A;  1B62 A;  4PA3 A;  1KZN A;  2YSU B;  4DZY A;  1G4Y B;  4FLY A;  5ITZ B;  4GKK O;  3ABK B;  4ASU G;  1QCE A;  1IBM O;  2UUA B;  4HNA A;  2R72 A;  1EN5 A;  4CS4 A;  4AWO A;  2WI3 A;  2JDI G;  3O9O A;  1MAB G;  2BTZ A;  4BR6 A;  3ZMS A;  4H7Q A;  3CCL V;  1YES A;  4XE2 A;  4NXN O;  1R62 A;  2LJ2 A;  2GBO A;  2NN4 A;  1RM1 B;  3SGI A;  4R6Z A;  3UCS C;  5F3K A;  2G38 A;  4KTN A;  4J10 A;  4CBC A;  3QDD A;  2YE6 A;  2WLK A;  3G71 V;  4LF8 B;  2GQP A;  5DN6 G;  4DV7 O;  4JQL A;  4JPR A;  3R4N A;  5D6Q A;  4PRX A;  1O9H A;  4D7T A;  2XAF A;  3AG3 C;  2IJI A;  1H2K A;  5JJJ B;  1NT2 B;  3RYI B;  2BSM A;  3ZKD A;  1COW G;  2ZXW B;  2K1E A;  3CRQ A;  1WB8 A;  5L3D A;  5GTI Z;  3KCX A;  5D7C A;  5EBM C;  4JAU A;  3HKD B;  3R91 A;  4N23 A;  4O4L B;  3OEE G;  5J9P C;  4FPP A;  4FZ0 A;  2PYL A;  1VF7 A;  5B1N A;  1SA0 B;  3CYG A;  1XNR O;  1D5N A;  1VQ4 V;  2FWZ A;  4MVR A;  1N33 B;  2IH1 C;  4DK0 A;  4DV1 O;  3QTF A;  3T1Y O;  1N32 B;  4A5U B;  4Z1V A;  4AS9 A;  3P3N A;  2HVK C;  5BOC A;  1SS3 A;  1H7S A;  2FTK A;  1HDJ A;  5IJ0 A;  3HKD A;  1PM9 A;  3B8M A;  2JGD B;  1Q90 D;  1JFF A;  2XCM A;  3TTZ A;  1FFX A;  1HR0 O;  2FYU H;  3FT8 A;  3ZXO A;  5B1A B;  1IDS A;  1Q6H A;  4GT8 A;  5LXT A;  1YI2 V;  1Q7Y W;  4J42 A;  3S5T A;  4BW5 A;  1FS0 G;  1G8M A;  3B09 A;  3CGY A;  3TXS A;  2XHR A;  3RW0 A;  1FD9 A;  3SR2 C;  4ZI7 A;  4MSW C;  5CTU A;  1SER A;  2RQ6 A;  1PL0 A;  4JI2 B;  4IYI A;  3HZ1 A;  5LOV A;  2OTJ V;  4I50 B;  3L71 H;  4X64 B;  2PI4 A;  3AG4 B;  4JI6 B;  4CWP A;  4B7K A;  1PL4 A;  5KA6 A;  4DV0 O;  1HNX B;  2JRI A;  4ASF A;  4UCO A;  1U0Z A;  1WP8 A;  1VQ9 V;  2BU8 A;  2RCV A;  5IJ9 B;  4OX9 B;  3KZI Z;  4PL9 A;  4WBN A;  1DF4 A;  3TCU A;  3U67 A;  1PD3 A;  4B08 A;  1K5Q A;  1VF5 B;  2VWJ A;  4TV8 B;  4RUF A;  2YXY A;  2QSA A;  5L3B A;  5EBL C;  4I5S A;  3ABM C;  3KCY A;  2UXN A;  4YJ2 A;  4YKZ A;  2L35 A;  3K0D A;  2EJR A;  3TET A;  1R73 A;  3QO8 A;  1L0N H;  3PJS K;  2VWK A;  4GKK B;  2B9Z A;  4AWQ A;  2H8P C;  4WUC A;  3JAR B;  4NR1 A;  3LNN A;  4HYP A;  4FFB B;  4ZHQ A;  2YC0 A;  4DR7 O;  4X62 O;  1FXK B;  1SQG A;  4GQT A;  4IIJ A;  1NKD A;  1I5C A;  2QF6 A;  2P06 A;  4YKR A;  1VP7 A;  3M7M X;  5BXZ A;  3E89 A;  2Y69 C;  1XHZ A;  4YJ2 B;  1XBL A;  1KP2 A;  2EIL B;  4JTC B;  4FFK A;  3CP1 A;  3K5M A;  4ZVI A;  1IBL B;  4CC6 A;  1AVM A;  4B3T O;  1VQL V;  4CWT A;  1K92 A;  4BW9 A;  3A0X A;  4AI8 A;  2HLD G;  4V26 A;  1YER A;  1PPJ H;  2YEJ A;  3FV5 A;  2Y4T A;  2UXB B;  1K9M W;  2AHZ A;  4O2B B;  3OUS A;  4R1F A;  1YSZ A;  3CRM A;  2P22 C;  4E2L A;  2MW2 B;  4GGL A;  3B28 A;  5LGU A;  1K97 A;  1VQO V;  4D6T H;  5CTW A;  1P84 F;  2Q5Z A;  1UYK A;  3SJB C;  2P5O A;  3PEJ A;  2Y69 B;  1IXB A;  4PDL A;  3H80 A;  2HG1 A;  4PDR A;  3OWD A;  1ZTE A;  4JI4 O;  2DYR C;  4FVM A;  1IX9 A;  4X64 O;  3CC7 V;  2XTA A;  3GIG A;  4RO2 A;  5ITZ A;  2F95 B;  3EKO A;  2DJV A;  2AXT Z;  4KSH A;  4DXW A;  1Y4M A;  4L91 A;  3G6B A;  3T1H B;  2WEQ A;  3MNR P;  2YE8 A;  3ZED A;  1XMQ B;  2YEA A;  2GHY A;  1TUB A;  3GB7 C;  1PP9 H;  2F93 B;  3OMI B;  2GV9 A;  5D7D A;  4CE3 A;  2JJ1 G;  3I56 V;  1NU1 H;  1M93 A;  4H13 B;  1XNQ O;  3K98 A;  3WU2 Z;  4RUE A;  3JD4 A;  1SF9 A;  2ITC C;  4B6C A;  2EIJ B;  3SJQ C;  1Q6I A;  3HHU A;  5IJ0 B;  1I58 A;  1YET A;  2A7W A;  1JVM A;  2UXC O;  2JGD A;  2ZKJ A;  3ZBH A;  1H8H G;  4JI1 B;  1S14 A;  3B26 A;  5KAI Z;  2EJ7 A;  3H9V A;  3G75 A;  4JI8 B;  1Y8O A;  2E74 B;  5LHI A;  1UY7 A;  3STL C;  5B1B B;  2H3O A;  2ZCE A;  5LA6 A;  4KL1 A;  1GM8 A;  4X1Y B;  4X20 A;  3D3I A;  2DWE C;  5CA0 A;  2AGA A;  3K5N A;  1E1R G;  2UXX A;  4PEL A;  2YUA A;  3L74 H;  1YHQ V;  2YGF A;  2DN9 A;  2BTO A;  1XMQ O;  1IBK B;  2ESA A;  4IGG A;  4JV5 O;  5JQG A;  2BOB C;  4O4J A;  5J2T B;  5IDJ A;  2NR5 A;  3OMN B;  3K03 A;  2JGU A;  4YKU A;  2ILM A;  4XIQ A;  3DC5 A;  2QTO A;  3ZCC A;  1OCZ C;  2BTQ B;  1G6U A;  1FJG O;  2CGN A;  3RYH B;  5LMN B;  5L3F A;  3T2S A;  2QDO A;  1R3I C;  1VQM V;  3CEI A;  3VHC A;  2HKO A;  2HHH B;  1OCR C;  1GN6 A;  3HR0 A;  3CPW U;  4BIO A;  3ASN C;  2WI1 A;  3JD1 A;  3P30 A;  4JI0 O;  1P49 A;  1WA8 A;  2F4V O;  4K3A A;  1TVK B;  1V54 C;  5FPR A;  5FNC A;  1JX9 A;  4DV3 O;  2B1G A;  2KKW A;  3RVZ A;  2IBZ H;  2QEX V;  2XX4 A;  4B7E A;  4X1K B;  3K5L A;  4O2B A;  1QY8 A;  3L75 H;  2FKX A;  2HKJ A;  3QTC A;  2YI5 A;  3H1I H;  1N8R W;  4LFB B;  3QO7 A;  4B7P A;  1YIJ V;  3CCJ V;  1AR4 A;  3OD4 A;  2GUZ B;  1MNG A;  3IC9 A;  2A3Q A;  1W0K G;  1ZL8 A;  4DV5 B;  4WUD A;  2WPD G;  1N34 O;  4XDK A;  2P90 A;  2QR4 A;  3NXS A;  1L0O A;  3JAW B;  3OR6 C;  1TC6 A;  1CEZ A;  4KUM A;  2CH7 A;  3BEH A;  1H7U A;  3ZN1 A;  2CG9 A;  1SRY A;  4MPC A;  1AI4 A;  1NR7 A;  3A2F A;  4DR2 O;  3N2G A;  5K1P A;  1AH8 A;  2YE2 A;  5IY5 C;  2BRC A;  1H2L A;  1JMK C;  3L73 H;  3E83 A;  1NI8 A;  3G4S V;  3RYF B;  3FB8 C;  4N21 A;  4BWA A;  4GZR B;  1N4C A;  2H55 A;  2ZIO A;  1WLE A;  1FYJ A;  2Q68 A;  2XHX A;  3ZRX A;  2DYS C;  3CCV V;  2PI5 A;  4JZG A;  2F43 G;  4JF3 A;  3H4L A;  3B24 A;  2FML A;  5L3G A;  3D36 A;  1H2S B;  4AHC A;  4D7S A;  1KKD A;  2YE3 A;  1N0J A;  1T5E A;  2X0L A;  3ZHS A;  3L72 H;  4DR4 O;  4H37 A;  4GX5 A;  5CN0 A;  4EM7 A;  4YY3 B;  2IWX A;  4MBC A;  3CRK A;  1K8A W;  2WLJ A;  2QWN B;  4WUB A;  3S3X A;  1GJV A;  1ZW9 A;  1VQK V;  3JYC A;  5CBF A;  1OCO C;  4IHJ B;  1AI6 A;  2BSK A;  2R9I A;  3C0E A;  4XTJ A;  2Q2E B;  1SQB H;  3M8A A;  2K9P A;  5H6R A;  4GCZ A;  1DLB A;  4Z1M G;  4LF6 O;  4P2Z A;  2P67 A;  4JI4 B;  3Q5L A;  5JCO C;  3Q5J A;  4DR3 B;  4LF9 O;  4MVQ A;  3CCU V;  1SQX H;  4MTX A;  5KX5 A;  2UUC O;  4KSG A;  3CJH B;  2YI9 A;  4HYO A;  3PEH A;  2IOQ A;  1QYE A;  4EB6 A;  3ZRS A;  3JSN A;  3WHA A;  3VHA A;  3M99 B;  4MT8 A;  2AZ0 A;  3BRC A;  1CP9 A;  5DM6 V;  4K8X A;  3RYH A;  4UCU A;  1YTF B;  4HNA B;  3VHD A;  2XX5 A;  1UYE A;  2XDX A;  2OIE A;  4X9Q A;  5L3C A;  4MB9 A;  5IYZ A;  2ARH A;  2CE4 A;  3AG3 B;  3T1K A;  2WLL B;  1K73 W;  2EIN B;  3QVN A;  1XHX A;  3GIF A;  3UM7 A;  2XX2 A;  4YKY A;  4LF4 B;  4LP0 A;  3DSQ A;  4TT3 G;  4MS2 A;  2QA4 V;  4EFU A;  3R65 A;  2YKJ A;  1HWY A;  4ZOL A;  5H2F Z;  4X20 B;  3CB2 A;  1XMO B;  1F7Y A;  1XNR B;  4TV9 B;  2BZ5 A;  4FCP A;  1H8E G;  3IGA C;  4AWP A;  2R70 A;  4I0X B;  3SJA C;  2K5B A;  2XUM A;  1J5E B;  2XAG A;  3DGE A;  4WCE V;  2IW5 A;  4O2A B;  2CH7 B;  1JM6 A;  1D5A A;  1KC8 W;  2WLN A;  1GM9 A; 
#chains in the Genus database with same CATH homology
 3EHB B;  3FYI B;  2JKI A;  1EFR G;  2DW4 A;  3FT8 A;  4MW3 A;  3U2D A;  3ZXO A;  5B1A B;  1OCZ B;  4FCR A;  2HFE C;  2P7T C;  5L3E A;  4GT8 A;  2XND G;  2ZDI C;  2VCI A;  3A0Z A;  3R4P A;  4HXW A;  1SES A;  2IH3 C;  2Z3Y A;  1YI2 V;  4BIZ A;  1Q7Y W;  4GEE A;  1RPO A;  2H94 A;  4MPE A;  2Y48 A;  3X2Q C;  4PA9 A;  4BW5 A;  1LNQ A;  2BU7 A;  4URN A;  2JJC A;  1VQ7 V;  5HFM A;  1YC4 A;  4ASB A;  3B8N A;  1K3E A;  3B25 A;  1SET A;  5J6A A;  4JAV A;  1FS0 G;  2DYS B;  1G8M A;  1YT2 A;  3CGY A;  5BOD A;  2O1V A;  1THZ A;  3A0R A;  2WI4 A;  2XHR A;  5CTY A;  1S16 A;  3ZRV A;  1K4C C;  2XAB A;  3RW0 A;  3HZ5 A;  4HZ5 A;  1GO3 F;  3JCZ A;  1UYL A;  4ZBM A;  1THN A;  2OCC B;  2B1I A;  4MSW C;  5CTU A;  4X89 A;  1FXH A;  3STZ C;  3CMA V;  2XAH A;  3GIG B;  1BHB A;  4URO A;  1SER A;  2A9H A;  1AJQ A;  1PL0 A;  1DF5 A;  1F4N A;  2EZP A;  2Q6A A;  1BMF G;  1NQT A;  2QKS A;  4F4L A;  1JOY A;  3HZ1 A;  4EMV A;  4L87 A;  4UV8 A;  5B1B C;  5IY5 B;  3OW2 U;  4R7C A;  4MVO A;  2OTJ V;  1TID A;  3BM9 A;  4MOT A;  1YJN V;  2PI4 A;  4YKQ A;  3AG4 B;  3JD3 A;  1UYF A;  3G7E A;  4PU9 A;  4LWG A;  1R3L C;  5CTX A;  1ROP A;  2EIK B;  4CWP A;  1K4D C;  1AJN A;  5KA6 A;  3OMA B;  5KUK A;  3LDC A;  1UYM A;  1Z5C A;  1U0Z A;  2HJF C;  2LP7 A;  2E0A A;  4ASF A;  1VQ9 V;  2BU8 A;  2HCH A;  4ASG A;  2DWD C;  4BXI A;  3LUT B;  3ZRW B;  1YJ9 V;  4MTO A;  4Q20 A;  1NVP D;  3SYQ A;  4PL9 A;  1TIL A;  4HY6 A;  4XCJ A;  1DF4 A;  3E8B A;  3TCU A;  3U67 A;  5FL7 G;  2FWY A;  2EIJ C;  1PD3 A;  3OAA G;  2B5U A;  4CWR A;  1K5Q A;  3ASO B;  1M90 W;  1UY8 A;  1M57 C;  3H01 A;  2IU3 A;  2BOC C;  4QJF B;  3CGZ A;  4RUF A;  5L3B A;  1ENV A;  1GKZ A;  4LWI A;  5EBL C;  2O1W A;  2IU0 A;  4I5S A;  2IOR A;  3ABM C;  3W7S A;  3W7T A;  4XIT A;  2UXN A;  3SPI A;  2Q69 A;  4NH7 A;  4YKZ A;  3HYZ A;  4WFG A;  1I59 A;  2A79 B;  4FK5 C;  3OPD A;  3K0D A;  2EJR A;  1MOF A;  3TET A;  1R73 A;  3QO8 A;  1KD1 W;  3EKR A;  3PJS K;  4PDM A;  3UKM A;  4H85 A;  4JTD B;  1NH2 D;  3ZJZ A;  4AWQ A;  2H8P C;  3I55 V;  1UYD A;  1YS3 A;  4WUC A;  2Q8F A;  3TZ4 A;  2A0L A;  2EBO A;  3FYE B;  2UWD A;  4LWE A;  4HYP A;  4NH8 A;  1BKN A;  1H38 A;  1GMG A;  2DYR B;  1QR8 A;  3AG2 B;  3ABL B;  3ETG A;  4KFG A;  2IJH A;  1ZXN A;  1OSF A;  2WI6 A;  2WWW A;  1KIJ A;  1FXK B;  1OCC B;  2YEH A;  4GQT A;  1BXD A;  2QF6 A;  1F51 A;  1NKD A;  3W7U A;  1I5C A;  4YKR A;  1EBO A;  4HXZ A;  1I5Y A;  3SPH A;  4PDV A;  2XJX A;  1J95 A;  3E89 A;  2Y69 C;  2O1U A;  2JIZ G;  4XD8 A;  2GFD A;  4BIU A;  1KP2 A;  5EC1 C;  2EIL B;  4GX1 A;  1PNL A;  2YJX A;  3ZMU A;  5KA5 A;  2WLI B;  1UYH A;  4CWO A;  4CWQ A;  2IJK A;  2W6J G;  5LHH A;  4MTF A;  4JTC B;  4P30 A;  3CC4 V;  2YEF A;  3CP1 A;  3VBB A;  4LWH A;  4ZVI A;  3BMY A;  1AI7 A;  4LWF A;  1VQL V;  4CWT A;  3OGC C;  3WG7 C;  4MVS A;  3SYO A;  1K92 A;  4GX0 A;  2OT5 A;  3A0X A;  2HLD G;  2X7R B;  1JPX A;  2JEX A;  4V26 A;  2QM8 A;  4URL A;  2WLL A;  1K7D A;  1SZT A;  1YER A;  3K04 A;  2YEJ A;  3MHS C;  3FV5 A;  1AJP A;  3IFX A;  4BAE A;  4U7N A;  3ZMV A;  4XDJ A;  1K9M W;  2AHZ A;  3VAD A;  3OUS A;  3EHG A;  4J9Z B;  4R1F A;  3CCR V;  2DQ0 A;  1YSZ A;  4E2L A;  4GGL A;  4W7T A;  2ZDY A;  3B28 A;  3CD6 V;  4MP2 A;  4HZ3 A;  2HVJ C;  3G6E V;  4XBF A;  1QLE C;  5LGU A;  1K97 A;  3K9A A;  1VQO V;  3LNU A;  1KP3 A;  1QR9 A;  2ITD C;  4FIP C;  2YE7 A;  2CCU A;  1OHH G;  2EIL C;  4FJC C;  4XIR A;  1UYK A;  5CTW A;  3T0H A;  3ZRW A;  3WFV A;  3QNE A;  4UUJ C;  3ZM7 A;  3RLQ A;  3PEJ A;  2Y69 B;  4YXW G;  2VCJ A;  4L8Z A;  2CK3 G;  2DQ3 A;  1TBW A;  4EGK A;  4PDL A;  4GT1 A;  2LFR A;  3H80 A;  3RBZ A;  2YEC A;  4O07 A;  1FXV A;  2BYH A;  2PNR A;  3ZXQ A;  3SL2 A;  3OM3 B;  3K08 A;  4CE2 A;  5EK0 A;  4PDR A;  2HG1 A;  3OWD A;  3OW6 A;  1NR1 A;  1TC0 A;  4X9L A;  3R92 A;  1NJI W;  2DYR C;  3AG2 C;  1MX0 A;  3HPL C;  1NH2 B;  2XAQ A;  2VW5 A;  3CC7 V;  4QNH B;  1ZXM A;  1ORQ C;  4U7O A;  1EI1 A;  2MK3 A;  3B77 A;  3GIG A;  1PNK A;  4RO2 A;  4P8O A;  3GIE A;  1MU5 A;  3IED A;  4MVU A;  1BHA A;  5GW7 A;  2YK9 A;  4YKW A;  2JJ2 G;  3QO5 A;  2YKB A;  4JAS A;  3EKO A;  3GWO A;  4KSH A;  2WI7 A;  1QVG U;  4DXW A;  1Y4M A;  1ZWI C;  2AHY A;  4L91 A;  4O09 A;  3A0Y A;  3TK1 A;  2WEQ A;  3FB5 C;  2ZBK B;  3MNR P;  4H33 A;  2YE8 A;  2YI0 A;  2YEA A;  2CCS A;  2GHY A;  3ABU A;  2BYI A;  3GB7 C;  1CPY A;  4MVZ A;  3OMI B;  1UYI A;  4LP8 A;  3AEI A;  2ZDI A;  1US7 A;  5D7D A;  4CE3 A;  2YKC A;  2JJ1 G;  4XKK A;  2W6I G;  1P4R A;  3I56 V;  1BGQ A;  1AI5 A;  2BRE A;  3O6O A;  4H81 A;  5CF0 A;  2IJJ A;  1L1F A;  1IXM A;  4O04 A;  1I5D A;  5IDM A;  3EFF K;  4KP4 A;  4X8A A;  5EC2 C;  3CXC U;  3CCM V;  3K98 A;  3A0W A;  1EZJ A;  1M57 B;  4RUE A;  3ASO C;  3JD4 A;  2LFS A;  5HFL A;  1JQ0 A;  4FMT A;  4J9Y B;  2ITC C;  5IYC O;  2EIJ B;  4RQE A;  1YC3 A;  2YKI A;  4B6C A;  3SJQ C;  3HHU A;  1I58 A;  1YET A;  4XCL A;  4PA7 A;  4I3H A;  4DO2 A;  5H9C A;  1JVM A;  4KQV A;  4XDM A;  2VWC A;  3R4O A;  2YK2 A;  3LDE A;  1S0V A;  5EBW C;  1E79 G;  1FXK A;  3E8F A;  2ZKJ A;  1K34 A;  1H8H G;  4QE9 A;  2YED A;  1GM7 A;  2AKP A;  1S14 A;  2IOP A;  3B26 A;  1E1Q G;  5IN9 A;  3FT5 A;  5BZB A;  2EIK C;  3R4M A;  4I9W A;  1MG1 A;  1FFT B;  3G75 A;  2XHT A;  4L93 A;  1Y8O A;  4CZZ A;  1EA6 A;  2V1D A;  5LHI A;  1UY7 A;  1KQS U;  3STL C;  2XD6 A;  5B1B B;  5LGT A;  2NNU A;  5M4E A;  4MW8 A;  5B1O A;  4EEH A;  2X6B A;  1QLE B;  2BU5 A;  3EHH A;  1GM8 A;  1UYG A;  2YEG A;  5F5R A;  4EM7 A;  1YSC A;  4JTA B;  4UVC A;  1YTF D;  3D3I A;  2DWE C;  1I5B A;  2YEE A;  5CPH A;  1XL4 A;  2OCC C;  4WFE A;  2YI7 A;  1E1R G;  4EGI A;  3LPS A;  4RQF A;  2EXL A;  2BU2 A;  2UXX A;  4PEL A;  3SYP A;  1I5A A;  4RAI A;  1TH8 A;  5M4P A;  4G2K A;  1Z5B A;  1YHQ V;  2YGF A;  4XKO A;  4CWS A;  1K5S A;  3T2M A;  4XDL A;  2ESA A;  5C93 A;  3WG7 B;  2XDK A;  4WF9 V;  1Y66 A;  1AH6 A;  4CWN A;  2BOB C;  4YKX A;  3P32 A;  1H2G A;  2HG5 C;  3X2Q B;  5IDJ A;  2W0F C;  3OMN B;  3U2K A;  1YIT V;  3K03 A;  3F7Y C;  1AMW A;  4NH9 A;  4YKU A;  2P6J A;  4WFF A;  1VQ8 V;  1QBZ A;  4XIQ A;  2XDL A;  1ID0 A;  5CMU A;  2ZR2 A;  5E1A C;  1VQN V;  4XIP A;  2QTO A;  5L3J A;  3ZIA G;  3O2F A;  3ZCC A;  1OCZ C;  4UXN A;  5D6P A;  4V25 A;  3K60 A;  4URM A;  3ETD A;  2XOK G;  1S3J A;  3IC7 A;  1TUE B;  5L3F A;  1R3I C;  3T1C A;  4K4O A;  3MHH C;  1VQM V;  1FXK C;  1OCC C;  1B63 A;  2YKE A;  3TZ0 A;  3VHC A;  2HKO A;  5IYD O;  1S77 D;  1OCR C;  3ABL C;  1NBM G;  2OTL V;  3CPW U;  3SPJ A;  3F5W C;  1BL8 A;  1UYC A;  3TUH A;  3T4Z A;  3OE7 G;  3ASN C;  5B3S C;  3JD1 A;  2WI1 A;  3P30 A;  2WAM A;  5KUM A;  3CCE V;  4HZ0 A;  3T0Z A;  1I5X A;  2C2A A;  4PA6 A;  4PRV A;  3AG1 C;  1YT1 A;  1BYQ A;  2ZR3 A;  1P7B A;  1V54 C;  1U2O A;  5FNC A;  3WQ9 A;  1WPX A;  1JX9 A;  1XL6 A;  4R8C A;  1Q81 W;  2B1G A;  3RVZ A;  3T2S A;  2QEX V;  2NLJ C;  2EIM C;  2CCT A;  2XX4 A;  3B27 A;  5IYB O;  5M4K A;  3ETE A;  1V55 B;  1QY8 A;  4EFT A;  1UY6 A;  3D2R A;  1KEC A;  3ABM B;  2HKJ A;  3LDD A;  1S72 V;  2YI6 A;  2YI5 A;  1N8R W;  1A4H A;  2WI2 A;  3CYO A;  3LSS A;  3QO7 A;  1OZ0 A;  4P9P A;  5M4H A;  1F4M A;  2JEU A;  4B7P A;  1YIJ V;  4MVM A;  4BAY A;  1JJ2 U;  2ZD9 A;  4UVA A;  1NHI A;  3CCJ V;  2EIN C;  1AR1 B;  2EZO A;  2WLH A;  1Y4S A;  3E86 A;  1W0K G;  2ZXW C;  4WUD A;  5M4N A;  1F23 A;  2WPD G;  4XDK A;  1Y8N A;  2WLI A;  2P90 A;  3FB7 C;  4KFM A;  1K33 A;  4QE7 A;  3NXS A;  4CE1 A;  1QVF U;  1L0O A;  3OWB A;  1ARO P;  3G7B A;  1Q86 W;  2FYP A;  3JD2 A;  3OR6 C;  1TC6 A;  1NVP B;  1CEZ A;  4HAM A;  2GSM B;  4KUM A;  4UV9 A;  1W2B U;  3OMU A;  5D7R A;  2BU6 A;  3BEH A;  1H7U A;  3D0B A;  3ZN1 A;  1R6N A;  4FCQ A;  3RLR A;  2CG9 A;  3HB3 B;  3K3W A;  2XJJ A;  5FND A;  3AG4 C;  1SRY A;  5LBQ A;  4MPC A;  1AI4 A;  1NR7 A;  3SPG A;  2M7W A;  2YE2 A;  1AH8 A;  2IWU A;  5IY5 C;  3HYY A;  3K79 A;  2BRC A;  4WFA V;  4OXS A;  4WFH A;  1Y4U A;  3K97 A;  3INX A;  2WLM A;  2V7Q G;  1QZR A;  3F7V C;  3E83 A;  1GKX A;  3A0T A;  3G4S V;  4R3M A;  5H6Q A;  3OUF A;  3ZMT A;  1B3Q A;  3FB8 C;  3CCQ V;  4N21 A;  1RPR A;  1Z59 A;  2WI5 A;  3EHF A;  4AS9 A;  4DUH A;  1M9N A;  4QPJ A;  1RM1 C;  5FWK A;  2WSS G;  1VQ5 V;  2H55 A;  3EHJ A;  1WLE A;  3TZ5 A;  2Q68 A;  3C11 A;  4E01 A;  3LNM B;  2D3O W;  2XHX A;  3ZRX A;  2XAJ A;  4QPK A;  2DYS C;  1UY9 A;  2Q8G A;  3CCV V;  2PI5 A;  1Y8P A;  3E35 A;  2CGF A;  4P7A A;  4ASA A;  2F43 G;  4JF3 A;  2QG0 A;  4MTG A;  3H4L A;  3B24 A;  4XC0 A;  3JD0 A;  5L3G A;  3D36 A;  3CCS V;  1NHJ A;  2H8M A;  1KKD A;  1JCH A;  1NHH A;  2YE3 A;  2Z5U A;  4G28 B;  2X0L A;  3K06 A;  3Q5K A;  4GFN A;  1OCO B;  4H37 A;  5LGN A;  3NMQ A;  4GX5 A;  3W7X A;  1VQP V;  2QM7 A;  5CN0 A;  4EKW A;  3INW A;  3O0I A;  4UVB A;  2IWX A;  1Q82 W;  4MBC A;  5B1A C;  5CBG A;  3CRK A;  4L94 A;  1K8A W;  3RLP A;  2WLJ A;  4QIW F;  4WUB A;  1GJV A;  1B6Q A;  1B62 A;  1ZW9 A;  4PA3 A;  2X6C A;  1KZN A;  2YSU B;  1VQK V;  3JYC A;  5CBF A;  4DZY A;  1OCO C;  1G4Y B;  1AI6 A;  3ZMZ A;  2BT0 A;  2QG2 A;  4LPB A;  2R9I A;  3SYC A;  2YGA A;  3ABK B;  4ASU G;  1QCE A;  5CA3 A;  3C0E A;  4XTJ A;  2Q2E B;  4BQG A;  4E00 A;  4AWO A;  2FXS A;  2WI3 A;  5H6R A;  2XDU A;  3DTU B;  2YEB A;  4U93 A;  4GCZ A;  3K99 A;  1DLB A;  2JDI G;  3ZKB A;  4E02 A;  4Z1M G;  1MAB G;  4P2Z A;  1GK9 A;  2P67 A;  2BTZ A;  3Q5L A;  3ZMS A;  1M56 C;  1R3K C;  1GTO A;  3CCL V;  1YES A;  1M1K W;  4H7Q A;  3Q5J A;  4XE2 A;  1R62 A;  3W7W A;  3FB6 C;  4MVQ A;  3CCU V;  2WEP A;  3OR7 C;  2Q8H A;  3E8H A;  1PVG A;  4MTX A;  3SPC A;  1RM1 B;  4LCU C;  4R6Z A;  1ZWH A;  4GX2 A;  4JYC A;  2YE4 A;  4KSG A;  5F3K A;  4O05 A;  2ZQM A;  4KTN A;  4HYO A;  1AM1 A;  2XK2 A;  4CBC A;  2CH4 A;  2YE6 A;  3PEH A;  2IOQ A;  3QDD A;  4LBE C;  1QYE A;  5J71 A;  4P9O A;  3ZRS A;  1QLN A;  1PNM A;  2WLK A;  2XDS A;  4HY1 A;  2JK5 C;  3WHA A;  3VHA A;  5FNF A;  3RVY A;  4MPN A;  3G71 V;  3M99 B;  4MT8 A;  2GQP A;  4EGH A;  1R3J C;  2IWS A;  2Q67 A;  3LSQ A;  1R6K A;  5DN6 G;  1CP9 A;  5LHG A;  1MSW D;  2XAS A;  1PKX A;  2X6A A;  3MD0 A;  5DM6 V;  4R3A A;  1YTF B;  3CME V;  4JQL A;  4JPR A;  3R4N A;  5D6Q A;  4PRX A;  3VHD A;  3T4D A;  2YJW A;  3KG2 A;  4MP7 A;  2XX5 A;  3OEH G;  4TWK A;  2XAF A;  4TSF G;  3CRL A;  4CWF A;  1UYE A;  3AG3 C;  2IJI A;  2XDX A;  3KE6 A;  1YJW V;  3BY6 A;  4R50 A;  3SYA A;  1GKF A;  5L3C A;  1S76 D;  3JZ3 A;  4MB9 A;  2BSM A;  3AG3 B;  3T1K A;  3ZKD A;  1COW G;  1S5H C;  2WLL B;  2ZXW B;  2K1E A;  2QE7 G;  1UJW B;  5L3D A;  2EIN B;  1K73 W;  3CC2 V;  3RKZ A;  5M4M A;  3GIF A;  3UM7 A;  2XX2 A;  3CWV A;  5EBM C;  4JAU A;  4YKY A;  4LP0 A;  5D7C A;  3R91 A;  4TT3 G;  3FKS G;  4N23 A;  4MS2 A;  3ML0 A;  3OEE G;  1DTO A;  4JYB A;  2QA4 V;  4JGS A;  3K0G A;  3OFN G;  4ZKI A;  3TZ2 A;  4EFU A;  5J9P C;  3R65 A;  2YKJ A;  4L90 A;  4FPP A;  3ABT A;  2ATK C;  1HWY A;  3VOU A;  1V55 C;  1Z5A A;  5B1N A;  2Q8I A;  2EIM B;  3ZN0 A;  4PA4 A;  1VQ4 V;  2FWZ A;  4O0B A;  3E8G A;  2ZDX A;  2BZ5 A;  4MVR A;  4YKT A;  4FCP A;  5CBH A;  1H8E G;  3IGA C;  1V54 B;  4AWP A;  2IH1 C;  1AJ6 A;  2K5B A;  1M56 B;  2YEV B;  2XAG A;  3QTF A;  3AG1 B;  3DGE A;  2YEV A;  4WCE V;  2YEI A;  2YGE A;  4BQJ A;  1W0J G;  4HYM A;  2IW5 A;  4WFB V;  3ASN B;  5B3S B;  2YE9 A;  2HR3 A;  2HVK C;  2R9R B;  1YT0 A;  1YSR A;  2YE5 A;  1YC1 A;  5BOC A;  1H7S A;  5GGZ A;  2FTK A;  3ABK C;  1JM6 A;  1OCR B;  2WER A;  1KC8 W;  3E2E A;  2KB1 A;  2WLN A;  4G27 B;  3B8M A;  2XJG A;  4LC1 A;  4XKA A;  3HEK A;  2QFO A;  1GM9 A;  1VQ6 V;  3T10 A;  2XCM A;  3TTZ A;  4X88 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...