5C93A

Histidine kinase with atp
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
239
structure length
235
Chain Sequence
VTEQQKIDNDRKQFVSNVSHELRTPLTSLRSYIEALSDGAWKDPEVAPGFLKVTQEETDRMIRMINELLSLSRMDSGTTRVDMELVNINEMFNYVLDRFDMILKKDDNPAKYYTIKREFTKRDLWVEIDTDKFTQVLDNIMNNAIKYSPDGGVVTCRLLETHNQVIISISDQGLGIPRADLGHVFDRFFRVDKAQGGTGLGLAISKEVVQMLGGRIWVDSVEGKGSTFYISLPYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histidine kinase
publication title Conformational dynamics of the essential sensor histidine kinase WalK.
pubmed doi rcsb
source organism Lactobacillus plantarum 16
molecule tags Transferase
total genus 82
structure length 235
sequence length 239
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2015-06-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5c93A01
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 5c93A02
5CTUA 1YT2A 3CWVA 3RLPA 1BGQA 3OPDA 2YEIA 4HZ0A 3A0WA 4GFNA 4H81A 4JYCA 1B62A 4B6CA 2FTKA 1KIJA 5IN9A 3R4OA 2YECA 2YK9A 1YESA 1TILA 2BYHA 3R91A 2AKPA 2GQPA 3H4LA 2O1UA 2ZDYA 3B24A 3U2DA 3D0BA 3H80A 2HKJA 2QM7A 4MB9A 2BU7A 2WEPA 2XX2A 2WI5A 1R62A 5FWKA 5J71A 1H7SA 3IEDA 1YC4A 4URMA 1IXMA 5M4EA 3R92A 4FCQA 4K4OA 2YI5A 2YEJA 3G7BA 2H55A 2K5BA 3P32A 1BXDA 1YSZA 2HCHA 1YERA 4NH9A 2JJCA 2BZ5A 4FMTA 2C2AA 1Z5CA 2XJXA 4XCLA 5CTXA 1EI1A 3ZRXA 2XJJA 2FXSA 3EHGA 3ZRWB 4UROA 5D6PA 2YEEA 1NHIA 4R3MA 4ASBA 4ASGA 4I5SA 3PEJA 1ZWHA 4L91A 4YKZA 4ZKIA 4BQGA 4O07A 5IDMA 4KP4A 3PEHA 1UYKA 4E00A 4XD8A 3HYZA 4YKWA 4YKXA 1AJ6A 2GFDA 4O09A 4JASA 1AH8A 3HZ5A 4XKKA 1UY6A 3ZXQA 4URLA 2CCTA 2WI4A 2YE5A 3ZXOA 1YSRA 2BT0A 5M4KA 3A0XA 3BMYA 4XIQA 4CE2A 4LC1A 2QFOA 4ASFA 3U2KA 3A0YA 2XD6A 1TH8A 1UYCA 4L90A 4HXZA 3TZ4A 4I3HA 2QM8A 5D7CA 4CWPA 5M4HA 2Q8IA 1THNA 2QG2A 2YEHA 3WHAA 5BODA 5J6AA 1QY8A 1EA6A 1U0ZA 3R4NA 1H7UA 1Y4UA 5F5RA 3TUHA 2IWXA 4MTXA 2XX5A 4WUBA 3ZKDA 4BAEA 2QF6A 2BU8A 1TC0A 4NH8A 4PRVA 2Q8GA 5FNFA 1YETA 3TTZA 3DGEA 4KSGA 5GGZA 1ZW9A 2WI7A 1YC1A 2YE6A 3B26A 3TZ0A 2YE2A 3TZ5A 3CRLA 3VHCA 2BSMA 4H85A 2FWYA 1Y8NA 4HY6A 2WI2A 1UYHA 2ZDXA 2VW5A 4HZ5A 3ZM7A 5D6QA 5CF0A 1UYMA 5FNDA 3HHUA 2YI0A 3C11A 1ID0A 3OW6A 4LP0A 1ZXNA 4XTJA 3JZ3A 2Q8HA 1Y8PA 1UYGA 4GT8A 3CGYA 4V25A 1UYIA 2QG0A 4YKQA 4HXWA 5M4MA 3K99A 2YKJA 1YS3A 4V26A 2YKEA 1Z5BA 1UY8A 4DUHA 1OSFA 5BOCA 3G75A 3EHFA 1ZXMA 3C0EA 1MX0A 2CG9A 3K97A 4CWQA 4LWFA 3HEKA 5B1NA 1B3QA 2WEQA 3EHJA 2BRCA 4LWGA 3Q5LA 2XX4A 2ZKJA 2Q8FA 3Q5JA 3ZRVA 3INXA 1I58A 4H7QA 4O05A 2XDKA 4KTNA 4R1FA 1YC3A 4R3AA 3RKZA 4O0BA 2YGEA 2YEBA 3EHHA 3VHAA 4XIPA 1AM1A 3CRKA 3MNRP 1UYFA 4XIRA 2IOPA 1JOYA 2E0AA 3ZCCA 2YI6A 4YKTA 5IDJA 2XJGA 4FCRA 2YJWA 3T0HA 2IORA 4LWHA 3U67A 1UYDA 1GKZA 1I5BA 4XITA 3EKOA 2CCSA 1KZNA 3Q5KA 3EKRA 4LWIA 1A4HA 4PU9A 4AWPA 2P67A 4HYPA 3A0ZA 3T0ZA 1I5AA 3A0RA 3O6OA 4MP2A 3INWA 4AWQA 1GKXA 4CWOA 3FT8A 3OWBA 4PL9A 4U93A 1TIDA 5C93A 4GGLA 2CGFA 2BU2A 3WQ9A 3LNUA 4P7AA 3CGZA 3QTFA 4WUCA 4YKUA 3FV5A 2YEAA 2BU6A 2WI1A 4YKRA 4MPEA 1UY9A 4U7OA 4CWFA 4QPKA 2XHTA 1Y8OA 1S16A 4E01A 4XKOA 4XC0A 3FT5A 2CH4A 4GEEA 4EGKA 3TZ2A 2WI6A 4QPJA 3T1KA 2XK2A 4CWSA 4HY1A 1US7A 4URNA 3R4MA 1I5CA 5F3KA 5B1OA 2XCMA 3K98A 2YJXA 1PVGA 4EFTA 2YKCA 4XCJA 4CE3A 3TK1A 3O2FA 3LPSA 3T2SA 2YE3A 4BIUA 4GQTA 2HG1A 2XHRA 3B27A 4CWRA 2VCIA 4CE1A 3VADA 4LWEA 2WWWA 4MP7A 1QZRA 4WUDA 2O1WA 2ZBKB 3D2RA 4EMVA 2YEDA 4EGIA 4AWOA 2UWDA 3GIGA 1NHJA 2YK2A 4U7NA 4DZYA 2XDSA 4NH7A 2XDXA 2BREA 4XKAA 2YKBA 1F51A 3KE6A 4BIZA 3NMQA 4KSHA 1TC6A 2EXLA 3SL2A 2BU5A 1L0OA 3GIEA 2CCUA 3RLQA 4YKYA 1UY7A 4LPBA 2VWCA 3BM9A 2XABA 1TBWA 4HYMA 3B28A 1U2OA 2BYIA 2YEGA 2XHXA 3G7EA 2O1VA 2FYPA 5CTYA 3HZ1A 1BKNA 4EEHA 3OWDA 1Z5AA 4L93A 1AH6A 4ZVIA 5M4NA 1MU5A 4MT8A 2YEFA 2YE8A 1I5DA 4JQLA 2JKIA 4XE2A 2YE7A 4BQJA 1NHHA 3GIFA 3VHDA 4XDMA 3A0TA 3HYYA 3ZKBA 4GT1A 3K60A 5M4PA 1B63A 4L8ZA 4FCPA 1JM6A 3MD0A 2YGAA 1YT0A 3O0IA 4KQVA 1UYLA 2FWZA 2XDLA 2YE4A 2IWSA 2WI3A 2YI7A 1GJVA 1YT1A 1Y4SA 4Q20A 4MBCA 3OMUA 3B25A 3D36A 1S14A 1Z59A 3QDDA 4O04A 3R4PA 4MOTA 4FPPA 2IOQA 1BYQA 1I59A 5D7DA 4E02A 4MPCA 5CPHA 4EFUA 3NXSA 1AMWA 1UYEA 5CTWA 3ZRWA 4ASAA 4B7PA 2XDUA 4L94A 2LFSA 2WERA 4GCZA 4EGHA 1QYEA 4AS9A 2YE9A 3T10A 2BTZA 2YKIA 5FNCA 4CWNA 2Q2EB 2IWUA 4KFGA 5L3JA 4JYBA 4JAUA 2H8MA 2PNRA 4EM7A 4BXIA 2ESAA 2YGFA 4X9LA 5D7RA 4JAVA 4PRXA 3GIGB 3RLRA 4P8OA 4W7TA 2LFRA 2VCJA 4CWTA 4MPNA
chains in the Genus database with same CATH superfamily
2LW1A 1YT2A 1FXKC 1B04A 3B4SA 4DV7B 1SC5B 4J7JA 1MZEA 2YEIA 2EX3A 3N2GB 3J81N 3A0WA 4GFNA 1B62A 1K5SA 1BMFG 2FTKA 1WPXA 1Q3EA 1Q90D 1RFYA 3F7VC 5HFLA 5IN9A 1G6UA 3BEHA 3TXQA 1BSMA 1VQPV 1AVMA 2JDIG 2YK9A 1OCZC 4MSWC 3CJHA 3K0DA 3H1JH 3IC7A 3AG1C 3R66A 5JVDA 3H4LA 2L35A 1ROPA 4GUNA 2N74A 2P4VA 3RYFA 1XMOO 3RN4A 4RWUA 1FJGO 2CGOA 5LXTA 1Q86W 2XX2A 5ITZA 2Y69C 4GX1A 1M9NA 4DR3B 5GTIZ 1H7SA 3IEDA 4URMA 2HG5C 2HVJC 1X59A 4IYIA 4FCQA 4LF9B 2K5BA 4Z2WA 3OR7C 4X64B 1BXDA 1Z5VA 3ABLC 4UUJC 2DWEC 3VBBA 5CBGA 1Q82W 3KZIZ 4E4EA 4MVOA 2ZXWB 1GN4A 2BZ5A 2C2AA 3EXAA 1Z5CA 2JJ1G 4U3FH 4LFAO 5JJEB 1KECA 3EHGA 5IY5B 3ZRWB 5D6PA 2X6CA 4ASBA 3B2EE 4ASGA 4JI6B 5L3EA 1ZWHA 1PD3A 4L91A 4YKZA 4WBNA 2WLMA 4EFEA 1J5EB 4DV4B 3PEHA 1UYKA 2NN4A 4EEQA 4XD8A 1AJ6A 5H2FZ 4CBCA 2GFDA 3WB0A 5H5NA 1YZBA 1F7YA 3W7UA 5EZYB 4JI3B 3HZ5A 4XKKA 1AP6A 2ATKC 1FS0G 3FAVB 1XHXA 2YE5A 3ZXOA 1YSRA 1R3JC 3A0XA 1S3JA 2HP8A 3JALB 4LC1A 2QFOA 3OMIB 1XL6A 2C1IA 3DTUB 3A0YA 4DV3B 3QNEA 3OMNB 3QVNA 3SYOA 4IT5A 1QLEC 1THNA 2QG2A 4FLXA 4P30A 4LF5B 1EA6A 3CPWU 1U0ZA 1H7UA 1I5YA 1IBLO 4IYHA 2IWXA 2XX5A 2ETNA 2Q7HA 3U0ZA 1EFRG 4JYAB 2QF6A 4PA4A 1G8MA 2Q8GA 3AG3C 1Y76B 3CXCU 2RNBA 4DYLA 1FYJA 3GWOA 4CS3A 1ZW9A 4RAIA 3SJCC 1KB9F 1MNGA 3CEIA 3VHCA 4XBFA 1LR1A 2BSMA 1QR9A 4HNAB 1JR9A 5CA0B 2EIMC 2FWYA 3K04A 2VW5A 3K03A 1R6TA 1I7FA 2M7WA 1Y74B 4P9PA 4CH5A 3AEIA 3H1KH 1XBLA 3BY6A 3K5MA 3QO8A 3OW6A 1VQ7V 4LP0A 4DK1A 4L8JA 3E22B 4FLYA 2HEPA 1SQPH 1Y8PA 4YJ2A 2JVDA 4V25A 3G6EV 1KD1W 4YKQA 2HFEC 3PN1A 2LO1A 3ZMZA 3CRCA 2JGDB 4O2BB 4DUHA 1GK9A 1I0HA 1JJ2U 4YHHO 1RP3B 2IH1C 3BVOA 2QA4V 3TCUA 3C0EA 3JAKA 3RYIA 4O4JB 2CG9A 2RDCA 1FXHA 3E89A 4UB8Z 1QCEA 1VF6A 4NXMO 1IX9A 1WPBA 1HNZB 4LWFA 2Q73A 1B3QA 3FB5C 4NTWA 2ZKJA 3Q5JA 5L3DA 3H01A 2XAFA 3INXA 5H9CA 1AR5A 2CE4A 4TUYA 4O05A 4KTNA 1YC3A 1HW7A 4D7TA 2GV9A 3IGAC 4O0BA 2YGEA 2XAGA 4FLTA 4I4TA 3EHHA 2JGUA 3VQWA 2EIJB 4CH4A 3MNRP 1YEWA 1K92A 4BW5A 4JI4B 2F4VO 1PL0A 1K33A 1SQFA 1VP7A 2YI6A 3HB3B 1OCZB 1OCOC 5IDJA 2XJGA 1Y4MA 3CB2A 3MHSC 2EIKC 4ZI7A 3LSUA 4MTFA 3RYCA 1MZFA 4LNUA 5LA6B 4OX9O 1KZNA 4NYKA 4JI7B 4K35A 4B7EA 2Y4UA 4ZHQB 1NTMH 4TSFG 4X88A 4WCEV 3C3TA 1SA0A 3O6OA 1M93A 3INWA 4AWQA 4WFEA 3FT8A 2HHHB 3S5TA 2UUCB 1BHAA 4TWKA 4GGLA 1AI7A 4TV9A 4P7AA 2QJ1A 1YDXA 5BZBA 1HWYA 2WLNA 1TA8A 1GN3A 2QWNB 3F7YC 1O9HA 4YKRA 2F43G 3SJBC 2W6IG 1E79G 1Q8IA 2ADPA 2P22C 4HAMA 1CPYA 1UY9A 1S16A 1KP2A 4E01A 3HKDB 2D2CB 2P4KA 2CDYA 4XC0A 1SZTA 3FT5A 2CH4A 4GEEA 2YICA 2WI6A 3T1KA 1R3IC 4MW3A 4DRXB 4G27B 1R6KA 4CWSA 1GM8A 2EJ7A 5LMUO 3ETQA 4URNA 2ZQMA 3R4MA 2OT5A 5J2UA 3L75H 5F3KA 2QKAA 2W0XA 4DUYB 3TETA 4R50A 1QNMA 1PVGA 1AR1B 3TK1A 1SETA 2DW4A 3T2SA 2YE3A 4GQTA 3CC4V 2XAHA 3B27A 3L72H 2CTPA 3VADA 4B3SO 2WWWA 2EZPA 4WUDA 1SQXH 3VQXA 4I0XA 1NH2B 3KG2A 3ZMVA 3ZHVA 5IT9N 2YXLA 4QIWF 4DR5O 3T1HB 4EMVA 1K73W 3GIGA 1EZVH 2ARHA 5JENA 5EIBD 4NH7A 5IYDO 2ZIOA 4KXRA 5CB4A 4DUZB 3UQ8A 2FB5A 2F95B 2YI8A 2YSUB 2XASA 3JD4A 5BY1A 4DR7O 5KMGA 3O9OA 1XHZA 1TC6A 4LFAB 1L0OA 3LUTB 3RLQA 3OM3B 1N0JA 3CSXA 1UY7A 5DECA 2EINC 4CS4A 1AB3A 4FZ1A 1R1BA 1XEQA 1Q7YW 4XDLA 2EBOA 1ZL8B 5FNVA 4JI5B 5CTYA 2ILMA 3OWDA 2BCCH 3CXHF 5B3SB 2ITCC 1M5IA 1N33O 3BHPA 1K5QA 4UCRA 3SPGA 4TQFA 4L87A 5IYZA 1NHHA 3VHDA 2BSKA 5KAIZ 4RQEA 4LWSB 1NR7A 2YI9A 5LGTA 4GT1A 2FYUH 3K60A 4UCSA 4L8ZA 5BMVB 1PNLA 2WLJA 3ETEA 4RQFA 2HJDA 3MD0A 2BTQB 3O0IA 2QGNA 3OTOO 3RVZA 1M57B 3K0GA 1IBMO 2IWSA 1HP8A 2VQEB 4I9WA 3HKCA 4R6ZA 3E8GA 2GTAA 4MVRA 4PDVA 3RBZA 2DE0X 4F6RA 4IIJB 1U97A 5CA1A 3QDDA 4O04A 4X1IA 4FPPA 2IOQA 2ZM6O 2JEUA 4AQYB 1BYQA 1XL4A 4QNHB 2UU9B 1I59A 5KX5A 4FIPC 4JI8B 4ASAA 4W4LA 1K4CC 3OUSA 4L94A 4XDJA 4X62B 3ZHRA 5GONA 5FNCA 1GN2A 5LOVB 1P84F 3ML0A 4KFGA 3G71V 3CCRV 3JD0A 2IU3A 3A0BZ 4J11A 4JAUA 1XUQA 1HR0O 2UUBB 2GSMB 1FKAO 3L9DA 5F2VO 2A79B 4P8OA 2CH7B 1XMQO 2XTAA 3PJSK 3JAMN 2VCJA 4CWTA 4MVSA 5CTUA 5A2QN 1MOFA 3FX7A 4I50B 4CC6A 4HZ0A 2P90A 4ABMA 4JYCA 5LGNA 2GUZA 1N8RW 1K9MW 3E8BA 4B3TB 3R4OA 1S5JA 2QE7G 1D5AA 5C8YB 5B1AB 1VQMV 1WB8A 3RGBA 3IJ4A 1O9GA 2RCVA 5GW7A 1TILA 4LR3A 2BYHA 4B7KA 2GQPA 5K1XA 1YHQV 2O1UA 1W59A 3KKYA 3B24A 2O57A 2Y0PA 4JI1O 4DR2B 2A7WA 3SYQA 5LYJB 4ICGA 3AG4C 2WEPA 2PYLA 4FFBA 3ASOB 2OYQA 2F4VB 3MDSA 4YY3B 4X1YB 2YDEA 4JZGA 5DN6G 2VQFB 3ETGA 4QE7A 1VQ4V 4K4OA 1Q81W 3FFQA 5EC2C 2ZE7A 3G7BA 2H55A 1VQ9V 1YCIA 1YXBA 2HCHA 5D5PA 4PDLA 2IH3C 1GMGA 3OW2U 3UO2A 2QWOB 1S5HC 3RYHA 2XJXA 5CTXA 1EI1A 1KUQA 1TGOA 2XJJA 3ZMSA 2FXSA 1BGYH 1VQLV 4UROA 2YEEA 2R9RB 1NHIA 3S3XA 2FKXA 1Q6UA 1NI8A 3G6BA 4LF7B 1JQ0A 4PHZA 4BQGA 4O07A 4X1KB 3CRRA 4K3AA 5IDMA 4IHJB 4DV6O 2QDOA 4E00A 2Q0OC 4RUEA 1VF6C 3B40A 3UT5A 1ORQC 1NQTA 2DYRB 5AG2A 3O65A 2CCTA 1K7DA 4GX5A 3I55V 3UCSC 1BS3A 1M56B 3HKEA 1H38A 3SYCA 4CC5A 2W0FC 4N21A 1YI2V 3GB7C 2XD6A 2YIBA 4I55B 5EC1C 3T1YO 1ZSPA 3X2QB 4ZIBA 3JCUZ 4AILC 2YEHA 1LNQA 3WHAA 5L3FA 2UXDO 1GO3F 1V9PA 1QY8A 1AROP 3R4NA 1M90W 1ENVA 1GKFA 4KUMA 2OCCC 4U3JB 2BOBC 4BAEA 3JD3A 2BU8A 1KU9A 2YIDA 3P3PA 1HDJA 1YETA 3CJHB 4DV5O 3DC5A 4H37A 5GGZA 5B1BC 1FFTB 2ZINA 3STLC 5JVDB 2YE6A 3CD6V 3TZ0A 3TZ5A 5LHGA 1JJOA 3RYFB 2X0LA 4HY6A 4A5UB 2LGQA 4GKKO 1UYHA 1MABG 1VIBA 1OHHG 2IJJA 4HZ5A 1XILA 2BTOA 4B3MO 3LNNA 4GKJO 2Q8VA 4PA6A 4DR7B 5KA6A 3ZS8C 4XTJA 1OCCB 2QKCA 1D2DA 2ZNJA 2CTWA 1QBZA 1Z2GA 5LMNB 4FM0A 3CS5A 1UYIA 2QG0A 5M4MA 3DC6A 3OR6C 2YKJA 5LGUA 3N2KA 1YS3A 4PA7A 1JMKC 5GTHZ 1UY8A 2ZE5A 3CWBH 2E74B 2Q7EA 5JWPA 1N34O 2LJ2A 4MVZA 2WLIB 4NR1A 1AJNA 4ZOLA 3CYOA 1R73A 3K97A 4DR6B 2KG7A 1YTFB 2P5OA 3E83A 4LWGA 2QM4A 5FPOA 2WLHA 1F23A 1J95A 1V54C 3EVKA 4O4LA 1K8AW 4F6EA 1QHTA 3N2GA 3GVMA 4H7QA 1H2MA 1AR4A 2H8PC 4LP8A 4J10A 2PI4A 3VHAA 1RSOA 1IBMB 2ZKOA 2FMLA 1EBOA 5LL6Y 1YTFD 4JPRA 2E0AA 4HYOA 4J41A 3HR0A 3AG2B 4NVPA 1ZWIC 4LWHA 4Q6GA 3CCJV 3U67A 4JI2B 3HKBA 1N36B 4XITA 2B1IA 3SJAC 3EKOA 2HJFC 2XHBA 4LWIA 1M4UA 1YJ9V 4AWPA 1I5AA 2B9ZA 3P3NA 3VQYA 1RM1B 3ASNB 3ZHSA 1HR0B 3BPZA 3K57A 4U93A 1IBKB 3H1LH 2CGFA 2BU2A 1SZXA 2ZIMA 3WQ9A 4JZ2A 3LNUA 2IM9A 3CGZA 4JAAA 4GX2A 2DYSB 2IBZH 2L6LA 4WUCA 3FV5A 1JCHA 2OWOA 2AHZA 3OT7A 3I56V 4YJ2B 4U7OA 4RO2A 2XHTA 1Y8OA 4FJCC 4O2AB 1EN5A 4H0LB 1YF2A 4BIOA 1NTZH 4XKOA 5J2TB 4UV9A 1BT8A 4LFBO 4QPJA 5HFMA 2KB1A 1GH6A 1PL4A 2DWDC 5EZYA 3FYEB 1US7A 3ABMC 1XNQO 2IJKA 3JAKB 1LUVA 3APOA 3FAVA 3RYIB 2XCMA 3K98A 2BE3A 1GRJA 2LW7A 2YKCA 4EFTA 4NXNO 2RJZA 4JGSA 3JALA 2HG1A 3ZHUA 4CWRA 4J7ZA 1IURA 3CCMV 2UXBO 4PV1B 4E72A 4DV2O 2O1WA 2VWKA 4TUYB 3OFNG 3D2RA 2YEDA 2UWDA 1H2LA 1NHJA 1BL8A 4JI0O 2PYJA 5IWAB 4XKAA 4DV1O 1JX9A 2HLDG 4DR4B 4KSHA 3NMQA 1IXBA 3SL2A 2BU5A 4FFKA 1XREA 5B1BB 3W7XA 2PGGA 5EYPB 3H1IH 3SDLA 4ZI7B 4X20A 1R3LC 3RYCB 1FXKB 4LNUB 4MVQA 4LPBA 4X65B 1Q43A 2VWCA 2XABA 1Y74A 1TBWA 4HYMA 1VF7A 1KMIZ 2YEGA 4B3RB 5BR8B 2O1VA 1HNWB 2UUAO 1YSCA 1SA0B 3HZ1A 3D3IA 3JSNA 2G38A 3JCZA 3TGUH 2WLLB 4IGGA 2P7TC 2WLKA 1DF4A 3SYAA 5M4NA 2WA3A 1ZLZA 2EULA 1MU5A 1TUBB 4JQLA 4TV9B 4R7CA 1NBMG 3JAWA 3AG1B 3ZN0A 1XNRO 1PKXA 2P06A 4KHPO 3JATB 1DK1A 3A0TA 1WAZA 3GWKC 3HYYA 3BA8A 5B5EZ 2KSDA 3T1YB 4FZ0A 1V55C 1H2KA 5M4PA 1B63A 1BQ0A 5L3GA 4FCPA 4LF6O 1TVKB 2JS5A 2YGAA 2Y69B 4UCOA 1YT0A 4KQVA 5LHHA 1IDSA 1UYLA 2FWZA 2EILC 1NVPB 2XDLA 2WI3A 2YI7A 1GJVA 1YT1A 1Y4SA 4Q20A 4MBCA 1YITV 2F1MA 3B25A 3OMUA 1N32O 3ZMTA 3TXSA 2WA4A 5J2UB 3CMEV 3L71H 3SJQC 3ABLB 4E02A 2AGAA 4EFUA 2XDUA 1MG1A 5EBMC 1IVSA 2XAQA 2WERA 5JH7A 2AZ0A 1I08A 4GCZA 2Y4TA 1ZAUA 4XDKA 2ZNIA 1QYEA 3CYGA 4X66O 5CMUA 4CWNA 4DV0O 4AHCA 2UXCO 1Y66A 5IE9A 1HNXO 3ZJZA 4I0XB 1WA8A 4B3MB 1NVPD 3CCSV 2H8MA 5KA5A 4PRXA 1DGSA 1BQZA 3GIGB 2B5UA 1VF5B 3WG7C 4O4HB 4W7TA 2LFRA 3JASA 2JRIA 4ZHQA 5LBQA 4LCUC 2IJHA 3J7AU 3RLPA 1XMOB 1JFFA 1VQNV 4UCVA 2EZOA 2ITDC 2RN9A 1FJGB 1BGQA 3K9AA 3OPDA 5E1AC 1B06A 4LBEC 1N34B 1MSDA 4H81A 1YIJV 4DK0A 3E8FA 3A0HZ 3CCQV 5FL7G 1FAFA 1KIJA 1QLEB 3CX5F 4FM2A 2ZCEA 1S76D 1M1KW 3ETDA 4KFMA 5FLXN 1NT2B 2ZDYA 3AG3B 3HKDA 3T2MA 4N23A 1XDCA 5IJ9B 3U2DA 1KKCA 4H33A 3D0BA 3A8TA 4DV7O 5IYZB 2QM7A 2BU7A 2WI5A 5J71A 2EIMB 1YC4A 1IXMA 5L3CA 3R92A 2IW5A 2PZSA 1H2GA 2QR4A 1L8DA 3DXRB 1AI4A 4EFBA 3ICXA 3KCYA 5JJNB 3HKCB 2QTSA 4F6RB 4RUFA 4NH9A 4JTDB 3D8CA 5CA1B 4X1IB 4FMTA 4XCLA 3ZRXA 2K9PA 5E79Z 2ZR3A 4AI8A 5LP6C 2JJ2G 2YUAA 3P30A 1PNMA 3NR7A 4R3MA 3CRQA 3Q4HA 2ZR2A 4I7ZB 4PDMA 5GONB 2NR5A 3OEHG 4DR3O 4ZKIA 1KBHA 3B09A 3OAAG 3MAQA 1XOUA 4KP4A 1P7GA 2YXHA 2CK3G 1I5XA 1IBLB 4YKWA 5KHJA 3TJTA 4X64O 3SPIA 4JASA 1Y67A 2C1GA 1AH8A 3ZXQA 4URLA 2WI4A 5IYCO 5KAFZ 3LDEA 2BT0A 4K8XA 1EM1A 1TAEA 2YIAA 2ZDIA 5IJ0A 3SGIA 3U2KA 1S77D 1SRYA 1W0JG 2Q9LA 1AILA 1UYCA 4L90A 4JI6O 3TZ4A 1WB7A 2QM8A 3ZN1A 3IAYA 3MHHC 2Q8IA 4PI0A 2PF4E 1GM9A 1QQCA 3IC9A 4DV4O 1J5EO 3THOA 4MVUA 4TOIA 3TUHA 5LHIA 3SPCA 3FYIB 4WUBA 3ZKDA 1OCOB 1TC0A 1NZ6A 2V4DA 4UVAA 4NH8A 4PRVA 4J7KA 5FNFA 3TTZA 2QTOA 3DGEA 4EB6B 4JI3O 5JQGA 4KSGA 2EIKB 5BMVA 2WI7A 1YC1A 2BTQA 2XT9A 2YEVA 1WP8A 4H85A 2N05A 4YHHB 2WI2A 1Q6HA 4TT3G 1Z5WA 4IIJA 2H94A 5D6QA 5CF0A 2ZE6A 1CEZA 1BHBA 1UYMA 1EZJA 2VS0A 4NXMB 3HHUA 2YI0A 2R9IA 3BRCA 4TV8A 4LF5O 4Z1MG 1ZXNA 3JZ3A 2Q8HA 1GAXA 2ZXWC 4GT8A 3CGYA 2YC0A 2FL4A 5LOVA 2F66C 5IY5C 4EKWA 4O4IA 3ZRSA 4V26A 3RYHB 3ABKC 1OSFA 2P6JA 5BOCA 4JTCB 5CA3A 3G75A 1I94O 1ZXMA 1VEWA 3E35A 2JEXA 2XOKG 3RWRD 2DQ0A 2F93B 1YVWA 4LF8O 2HR3A 3HEKA 5B1NA 1B6QA 3N27A 4G2KA 2WEQA 2OIGA 1VQOV 3EHJA 3Q5LA 2XX4A 2Q8FA 5JCOA 3ZRVA 3ZIAG 4OX9B 2A9HA 1JVMA 2RMKB 4R8CA 2VWJA 3RFRA 2XDKA 4R1FA 3K06A 1GTOA 3FKSG 3JSLA 3OMAB 4LF6B 3RKZA 1SQGA 1VMGA 2YEBA 5C8YA 3ZHQA 3RT3C 4J80A 3U11A 1QR8A 2IOPA 1JA8A 4YKTA 1NU1H 1VQKV 3SPHA 1UYDA 4H13B 3ABUA 1GKZA 4G28B 3EKRA 1A4HA 2ZE8A 2EINB 3UKMA 3C90A 4OPHA 4NTYA 1GKXA 2YIBD 1F4MA 5LMUB 3OWBA 1TIDA 5L3BA 3BA9A 5C93A 4DXWA 3AG7A 3CHXA 4X8AA 4JF3A 5DEDA 3EFFK 3J80N 1VQ5V 1SESA 4JYYA 2YEAA 2V1DA 2BU6A 3QO7A 1EN6A 3K5LA 4B3SB 2DJVA 5B66Z 1FFXA 2X6AA 2YS8A 2A06H 4QPKA 4JI7O 4CWFA 4X1KA 2B1GA 4DR5B 4IHJA 4YJ3A 3QO5A 3M8AA 3S3WA 3JARA 4EGKA 3CCLV 1H2NA 1P4RA 5LXTB 2XK2A 1N0NA 2HHHO 5ITZB 2UUCO 2WSSG 5B1OA 3G80A 4ZOLB 1S0VA 2YJXA 2GHYA 2KG7B 4E2LA 4XCJA 3O2FA 4C7UA 3FB6C 4FLUA 4UXNA 3LPSA 2A0LA 4BIUA 4UCTA 2XNDG 3OE7G 4I55A 4O4LB 5LP6A 4LWEA 1XQ8A 4UV8A 2EIJC 2X7RB 1R6NA 4EGIA 4U3JA 4AWOA 1RSOB 4OGQB 4WFAV 2E3CA 3UM7A 4J9YB 2QWPB 4DZYA 2XDSA 2E75B 4LFCO 1OCRC 2XDXA 4WBNB 2BREA 1N33B 3BFRA 1F51A 2QWQB 4DUYO 3KE6A 4BIZA 2IU0A 2EXLA 1ZTEA 4HBNA 4YKYA 3HKBB 5KHIA 1UPGA 1URFA 3L70H 3BM9A 2E5LO 3B28A 1U2OA 2BYIA 2GBOA 2JK5C 3OTOB 2XHXA 1AI5A 4I9QA 3T1HO 2JIZG 2FYPA 1QU7A 3SYPA 1SQQH 4ZBMA 1BKNA 4OPAA 1Z5AA 4L93A 1AH6A 1N4CA 1OV9A 4DUZO 2YE8A 4MT8A 4PA3A 2AHYA 3RVYA 2ZM6B 1I5DA 1THZA 4XE2A 3CP1A 3H9VA 2CTRA 3GIFA 1KC8W 3EHBB 3K58A 4XDMA 4UFZA 1PPJH 1CP9A 2Y0IA 3LDCA 1FD9A 2WLIA 3ABKB 2MK3A 3AG4B 2Y48A 1SERA 1JM6A 2QWRB 4WFFA 4JI5O 5EIBC 5KUKA 1S5LZ 4CH3A 4OXSA 4WFGA 1L0NH 3D36A 1S14A 1XMQB 1OZ0A 4MOTA 4CH6A 1WP7A 3SR2C 4MPCA 5CPHA 3M99B 1UYEA 1AMWA 5CTWA 3ZRWA 4B7PA 3F5TA 2LFSA 3QF7A 1GN6A 1SF9A 2PI5A 3JYCA 2IWUA 3APQA 2Q7GA 4JV5O 4JYBA 2PY5A 2CUGA 4LH6A 4BXIA 4X9LA 2YGFA 4JAVA 2VQEO 3RLRA 1U96A 4JTAB 2OTJV 1NTKH 2AZ2A 5CBHA 5KHHA 4AQYO 1P49A 2UU9O 3LMMA 3CCUV 4JI1B 4JI8O 3DSQA 1AJPA 3L73H 3CWVA 1NJIW 3JD2A 4CS2A 4X62O 3I5DA 4X20B 4BWAA 1I94B 1H2SB 4B6CA 2ZT9B 3OTFA 5KHKA 2ZDIC 4BAYA 1T5EA 1ZUQA 2DMXA 4LF8B 1YJWV 2EJRA 4LH7A 1LUWA 4I4TB 3ZMUA 5B3SC 2ZD9A 2YECA 1WLEA 1Q5OA 2UUBO 1Y76A 1YESA 3FB7C 2OCCB 1DLBA 3WFVA 3R91A 2AKPA 1GM7A 4O2AA 4YIPA 2UXNA 3JAWB 5J2TA 4HNAA 5CA0A 1VQ8V 3H80A 2HKJA 4MB9A 3BAAA 3WB1A 1R62A 1K3EA 5FWKA 1M57C 4WFBV 5M4EA 2XAJA 3CC2V 3FB8C 3WB2A 4QJFB 4DV6B 4B3TO 1RPRA 3E22A 4QGPA 3T1CA 3CMAV 4WFHA 2YEJA 2YI5A 1CXZB 1KYOF 4TQDA 3P32A 1TUEB 1YSZA 1YERA 1K97A 2JJCA 1S72V 2OIEA 1WN7A 5CBFA 2JGDA 3SPJA 2QSAA 4O2BA 2PUSA 4MTGA 4DW0A 5KLVH 3AK1A 4DR2O 1L1FA 5JH7B 5D5QA 4I5SA 3PEJA 1RPOA 4O4JA 4YY3O 2JS3A 2NLJC 2VQFO 2UXDB 1WA8B 3CRMA 1OCRB 3CCVV 3CE2A 3HYZA 4YKXA 2OTLV 4FLVA 5EYPA 4O09A 3W7TA 4DV5B 1FXKA 1UY6A 1SQVH 1V54B 3JASB 5M4KA 2AXTZ 1EN4A 5JCOC 2DOSA 3BMYA 2BOCC 4XIQA 2GTSA 3FD9A 4X89A 4CE2A 4ASFA 1G4YB 1JFFB 4GKKB 1FXVA 3ZX6A 1TH8A 4HXZA 4GYCB 4I3HA 5D7CA 2WLLA 4CWPA 5M4HA 2AW9A 3K5NA 4LF7O 2QEXV 1TUBA 5B1AC 1R3KC 4GKJB 5BODA 5J6AA 2Q5ZA 4P9OA 1Y4UA 5K1PA 5F5RA 2V7QG 2HKOA 3E86A 4MTXA 3JATA 3H1HH 5LA6A 4MTOA 4K8ZA 4X9QA 2ODMA 1VARA 3RW0A 5CB4B 1DF5A 3W7WA 4D7SA 2CAZC 1JPXA 1TVKA 1AJQA 5KMGB 3B26A 3T4DA 5JJJB 2D3OW 3ASOC 2YE2A 4UVBA 3CRLA 4FVMA 1QLNA 1Y8NA 2Q69A 4J9ZB 2ZDXA 2IJIA 1QVGU 3ZM7A 4H44B 3CC7V 4LFCB 2YXYA 4LF4O 3A2FA 3KCXA 5FNDA 1BE3H 3C11A 1ID0A 3K3WA 3HPLC 3JD1A 3K59A 5FNVB 2XUMA 1OJHA 1UYGA 2GDSA 4PI2A 4DR1O 4HXWA 1Q6IA 3K99A 2E5LB 4DW1A 4K0KO 4FLZA 3E8HA 3AK3A 2YKEA 1Z5BA 2BSKB 2NNUA 4DRXA 1XI1A 5CN0A 3C3SA 3EHFA 4O4HA 2H3OA 3Q4HB 3M7MX 5DM6V 1MX0A 1D5NA 4UCUA 1F4NA 1MMMA 4CWQA 4BW9A 3OUFA 3ABMB 1P7BA 4CZZA 2BRCA 2DYRC 3ABTA 4BR6A 1PP9H 3W7SA 3F5WC 3CRAA 3T4ZA 1NH2D 5LMNO 1I58A 1M56C 3VQVA 2F23A 4GZRB 3LDDA 5KX5B 4R3AA 3QG5A 5IYBO 3X2QC 2LQTA 4XIPA 4W4KA 1AM1A 3AK2A 5IJ0B 3CRKA 1L0LH 2E76B 1UYFA 2K1EA 4XIRA 1FPOA 5H6QA 2Q67A 3K08A 2Z0AA 1JOYA 3BABA 4GX0A 3ZCCA 4DR6O 4FCRA 4LF9O 4MVMA 2YJWA 2W6JG 3T0HA 5IJ9A 2IORA 3K79A 1COWG 1I5BA 2CCSA 3Q5KA 4PU9A 5JQGB 4KL1A 2P67A 4HYPA 3A0ZA 3T0ZA 3OGCC 4NB5A 1AI6A 1A32A 4JV5B 3A0RA 1ZL8A 3DXRA 2YEVB 4MP2A 4LFBB 4CWOA 4PDRA 4PL9A 4PELA 4WF9V 5BXZA 1XNQB 2DN9A 2GUZB 2LGWA 1H8HG 1ZX3A 1VQ6V 2Z5UA 2Q0AA 1OCCC 3LSQA 1Y6XA 3B8MA 3OGIB 4NXNB 4TV8B 3QTFA 4YKUA 4FLWA 1KQSU 2A3QA 4LWSA 4JI2O 2WI1A 1N36O 1DTOA 4MPEA 4QE9A 2M6YA 2UXBB 4YIOA 2KQXA 3L74H 4PD4F 5EBLC 4DV2B 1K4DC 3OD4A 2DQ3A 4O4IB 1K34A 5H6RA 2Z3YA 1W2BU 1V55B 4PA9A 3E2EA 3TZ2A 1BCCH 2OCHA 4DV3O 1UJWB 4JI0B 2R9AA 2EILB 4FFBB 4HY1A 1IBKO 4DV1B 3IFXA 1I5CA 2HVKC 1SQBH 4FK5C 4J42A 4D6TH 5FPRA 4CE3A 3D36C 5A9GA 4JYAO 2PTMA 4IL6Z 3VOUA 2Q6AA 2XHRA 1NKDA 4YXWG 5J9PC 2N04A 2VCIA 4CE1A 4MP7A 4PJ0Z 1QZRA 1G1XB 2WPDG 1E1RG 1KKDA 3K9SA 3OEEG 3B8NA 2ZBKB 1AP5A 2UUAB 2LP7A 2YK2A 4U7NA 2CH7A 4EB6A 1WNSA 3AG2C 3B77A 1BZKA 3WG7B 2YKBA 3STZC 3ZEDA 3LSSA 1NS1A 1XNRB 3K5OA 3GIEA 4I50A 4KHPB 2CCUA 4ASUG 4UVCA 3UT5B 2VRZA 2HHIA 3WU2Z 1RM1C 3ASNC 3G67A 2QKSA 3G4SV 1PNKA 3G7EA 1YJNV 1NR1A 3HKEB 1US6A 4EEHA 4FM1A 5KUMA 3LNMB 5IWAO 1X4TA 1N32B 1MA1A 2DYSC 5TISZ 4ZVIA 2CGNA 2YEFA 1HNZO 2JKIA 4DR4O 4NKGB 1E1QG 2YE7A 5LYJA 4BQJA 4MW8A 4X66B 3ZKBA 4DV0B 4NTXA 4X1YA 2UXCB 4X65O 2KKWA 1HNXB 2CTQA 3UO3A 1FFXB 2R72A 1QVFU 4B3RO 4MS2A 4YJ3B 5BR8O 4P2ZA 2X6BA 1HNWO 1PM9A 3R65A 2YE4A 3JARB 4JI4O 3CCEV 1PV0A 4UB6Z 1Z59A 3R4PA 2Q68A 1WJZA 4B08A 1IZ3A 5D7DA 1W0KG 1SKVA 3NXSA 2MW2B 4GLXA 2Q4PA 4F4LA 3U10A 4EGHA 1SS3A 1MSWD 4AS9A 2YE9A 3T10A 2BTZA 2YKIA 3BCCH 5EK0A 5LP6B 2Q2EB 2WAMA 3ZBHA 4HZ3A 2UXXA 4LF4B 5L3JA 5EBWC 3N2KB 2R70A 5KHGA 2PNRA 4EM7A 2ESAA 5D7RA 4Z1VA 3ZHTA 4DO2A 1UFIA 2ADQB 1H8EG 3D3QA 4DR1B 2RQ6A 3QTCA 4MPNA 4K0KB 1KP3A
chains in the Genus database with same CATH topology
1YT2A 1FXKC 2YEIA 3A0WA 4GFNA 1B62A 1K5SA 1BMFG 2FTKA 1WPXA 3F7VC 5HFLA 5IN9A 3BEHA 1VQPV 2JDIG 2YK9A 1OCZC 4MSWC 3K0DA 3IC7A 3AG1C 3H4LA 1ROPA 1Q86W 2XX2A 2Y69C 4GX1A 1M9NA 1H7SA 3IEDA 4URMA 2HG5C 2HVJC 4FCQA 2K5BA 3OR7C 1BXDA 3ABLC 4UUJC 2DWEC 3VBBA 5CBGA 1Q82W 4MVOA 2ZXWB 2BZ5A 2C2AA 1Z5CA 2JJ1G 1KECA 3EHGA 5IY5B 3ZRWB 5D6PA 2X6CA 4ASBA 4ASGA 5L3EA 1ZWHA 1PD3A 4L91A 4YKZA 2WLMA 3PEHA 1UYKA 4XD8A 1AJ6A 4CBCA 2GFDA 3W7UA 3HZ5A 4XKKA 2ATKC 1FS0G 2YE5A 3ZXOA 1YSRA 1R3JC 3A0XA 1S3JA 4LC1A 2QFOA 3OMIB 1XL6A 3A0YA 3DTUB 3QNEA 3OMNB 3SYOA 1QLEC 1THNA 2QG2A 4P30A 1EA6A 3CPWU 1U0ZA 1H7UA 1I5YA 2IWXA 2XX5A 1EFRG 2QF6A 4PA4A 1G8MA 2Q8GA 3AG3C 3CXCU 3GWOA 1ZW9A 4RAIA 3VHCA 4XBFA 2BSMA 1QR9A 2EIMC 2FWYA 3K04A 2VW5A 3K03A 2M7WA 4P9PA 3AEIA 3BY6A 3QO8A 3OW6A 1VQ7V 4LP0A 1Y8PA 4V25A 3G6EV 1KD1W 4YKQA 2HFEC 3ZMZA 4DUHA 1GK9A 1JJ2U 2IH1C 2QA4V 3C0EA 3TCUA 2CG9A 1FXHA 3E89A 1QCEA 4LWFA 1B3QA 3FB5C 2ZKJA 3Q5JA 5L3DA 3H01A 2XAFA 3INXA 5H9CA 4O05A 4KTNA 1YC3A 4O0BA 3IGAC 2YGEA 2XAGA 3EHHA 2EIJB 3MNRP 4BW5A 1K92A 1PL0A 1K33A 2YI6A 3HB3B 1OCZB 1OCOC 5IDJA 2XJGA 1Y4MA 3MHSC 2EIKC 4MTFA 1KZNA 4TSFG 4X88A 4WCEV 3O6OA 3INWA 4AWQA 4WFEA 3FT8A 1BHAA 4TWKA 4GGLA 1AI7A 4P7AA 5BZBA 1HWYA 2WLNA 3F7YC 4YKRA 2F43G 2W6IG 1E79G 4HAMA 1CPYA 1UY9A 1S16A 1KP2A 4E01A 4XC0A 1SZTA 3FT5A 2CH4A 4GEEA 2WI6A 3T1KA 1R3IC 4MW3A 4G27B 1R6KA 4CWSA 1GM8A 4URNA 2ZQMA 3R4MA 2OT5A 5F3KA 3TETA 4R50A 1PVGA 1AR1B 3TK1A 1SETA 2DW4A 3T2SA 2YE3A 4GQTA 3CC4V 2XAHA 3B27A 3VADA 2WWWA 2EZPA 4WUDA 1NH2B 3KG2A 3ZMVA 4QIWF 4EMVA 1K73W 3GIGA 4NH7A 5IYDO 2YSUB 2XASA 3JD4A 1TC6A 1L0OA 3LUTB 3RLQA 3OM3B 1UY7A 2EINC 1Q7YW 4XDLA 2EBOA 5CTYA 3OWDA 5B3SB 2ITCC 1K5QA 3SPGA 4L87A 1NHHA 3VHDA 4RQEA 1NR7A 5LGTA 4GT1A 3K60A 4L8ZA 1PNLA 2WLJA 3ETEA 4RQFA 3MD0A 3O0IA 3RVZA 1M57B 3K0GA 2IWSA 4I9WA 4R6ZA 3E8GA 4PDVA 4MVRA 3RBZA 3QDDA 4O04A 4FPPA 2IOQA 2JEUA 1BYQA 1XL4A 4QNHB 1I59A 4FIPC 4ASAA 4L94A 1K4CC 3OUSA 4XDJA 5FNCA 3ML0A 4KFGA 3G71V 3CCRV 3JD0A 2IU3A 4JAUA 2GSMB 2A79B 4P8OA 3PJSK 2VCJA 4CWTA 4MVSA 5CTUA 1MOFA 4HZ0A 2P90A 4JYCA 5LGNA 1N8RW 1K9MW 3E8BA 3R4OA 2QE7G 5B1AB 1VQMV 5GW7A 1TILA 2BYHA 2GQPA 1YHQV 2O1UA 3B24A 3SYQA 3AG4C 2WEPA 3ASOB 5DN6G 3ETGA 4QE7A 1VQ4V 4K4OA 1Q81W 5EC2C 3G7BA 2H55A 1VQ9V 2HCHA 4PDLA 2IH3C 1GMGA 3OW2U 1S5HC 2XJXA 5CTXA 1EI1A 2XJJA 3ZMSA 2FXSA 1VQLV 4UROA 2YEEA 2R9RB 1NHIA 1JQ0A 4BQGA 4O07A 5IDMA 4E00A 4RUEA 1ORQC 1NQTA 2DYRB 2CCTA 1K7DA 4GX5A 3I55V 1M56B 1H38A 3SYCA 2W0FC 4N21A 1YI2V 3GB7C 2XD6A 5EC1C 3X2QB 2YEHA 1LNQA 3WHAA 5L3FA 1GO3F 1QY8A 1AROP 3R4NA 1M90W 1ENVA 1GKFA 4KUMA 2OCCC 2BOBC 4BAEA 3JD3A 2BU8A 1YETA 4H37A 5GGZA 5B1BC 1FFTB 3STLC 2YE6A 3CD6V 3TZ0A 3TZ5A 5LHGA 2X0LA 4HY6A 1UYHA 1MABG 1OHHG 2IJJA 4HZ5A 4PA6A 5KA6A 4XTJA 1OCCB 1QBZA 1UYIA 2QG0A 5M4MA 3OR6C 2YKJA 5LGUA 1YS3A 4PA7A 1UY8A 4MVZA 2WLIB 1AJNA 3K97A 3CYOA 1R73A 1YTFB 3E83A 4LWGA 2WLHA 1F23A 1J95A 1V54C 1K8AW 4H7QA 2H8PC 4LP8A 2PI4A 3VHAA 1EBOA 1YTFD 4JPRA 2E0AA 4HYOA 3AG2B 1ZWIC 4LWHA 3CCJV 3U67A 4XITA 2B1IA 3EKOA 2HJFC 4LWIA 1YJ9V 4AWPA 1I5AA 1RM1B 3ASNB 4U93A 2CGFA 2BU2A 3WQ9A 3LNUA 3CGZA 4GX2A 2DYSB 4WUCA 3FV5A 1JCHA 2AHZA 3I56V 4U7OA 4RO2A 2XHTA 1Y8OA 4FJCC 4XKOA 4UV9A 4QPJA 5HFMA 2KB1A 2DWDC 3FYEB 1US7A 3ABMC 2IJKA 2XCMA 3K98A 4EFTA 2YKCA 4JGSA 2HG1A 4CWRA 3CCMV 2O1WA 3OFNG 3D2RA 2YEDA 2UWDA 1NHJA 1BL8A 4XKAA 1JX9A 2HLDG 4KSHA 3NMQA 3SL2A 2BU5A 5B1BB 3W7XA 1R3LC 1FXKB 4MVQA 4LPBA 2VWCA 2XABA 1TBWA 4HYMA 2YEGA 2O1VA 1YSCA 3HZ1A 3D3IA 3JCZA 2WLLB 2WLKA 2P7TC 1DF4A 3SYAA 5M4NA 1MU5A 4JQLA 4R7CA 1NBMG 3AG1B 3ZN0A 1PKXA 3A0TA 3HYYA 1V55C 5M4PA 1B63A 5L3GA 4FCPA 2YGAA 2Y69B 1YT0A 4KQVA 5LHHA 1UYLA 2FWZA 2EILC 1NVPB 2XDLA 2WI3A 2YI7A 1GJVA 1YT1A 1Y4SA 4Q20A 4MBCA 1YITV 3OMUA 3B25A 3ZMTA 3CMEV 3SJQC 4E02A 3ABLB 4EFUA 2XDUA 1MG1A 5EBMC 2XAQA 2WERA 4GCZA 4XDKA 1QYEA 5CMUA 4CWNA 1Y66A 3ZJZA 1NVPD 3CCSV 2H8MA 5KA5A 4PRXA 3GIGB 2B5UA 3WG7C 4W7TA 2LFRA 5LBQA 4LCUC 2IJHA 3RLPA 1VQNV 2EZOA 2ITDC 1BGQA 3K9AA 3OPDA 5E1AC 4LBEC 4H81A 1YIJV 3E8FA 3CCQV 5FL7G 1KIJA 1QLEB 1S76D 1M1KW 3ETDA 4KFMA 2ZDYA 3AG3B 3T2MA 4N23A 3U2DA 4H33A 3D0BA 2QM7A 2BU7A 2WI5A 5J71A 2EIMB 1YC4A 1IXMA 5L3CA 3R92A 2IW5A 1H2GA 1AI4A 4RUFA 4NH9A 4JTDB 4FMTA 4XCLA 3ZRXA 2ZR3A 2JJ2G 3P30A 1PNMA 4R3MA 2ZR2A 4PDMA 3OEHG 4ZKIA 3OAAG 4KP4A 2CK3G 1I5XA 4YKWA 3SPIA 4JASA 1AH8A 3ZXQA 4URLA 2WI4A 5IYCO 3LDEA 2BT0A 2ZDIA 3U2KA 1S77D 1SRYA 1W0JG 4L90A 1UYCA 3TZ4A 2QM8A 3ZN1A 3MHHC 2Q8IA 1GM9A 4MVUA 3TUHA 5LHIA 3SPCA 3FYIB 4WUBA 3ZKDA 1OCOB 1TC0A 4NH8A 4UVAA 4PRVA 5FNFA 3TTZA 2QTOA 3DGEA 4KSGA 2EIKB 2WI7A 1YC1A 2YEVA 4H85A 2WI2A 4TT3G 2H94A 5D6QA 5CF0A 1CEZA 1BHBA 1UYMA 1EZJA 3HHUA 2YI0A 2R9IA 4Z1MG 1ZXNA 3JZ3A 2Q8HA 2ZXWC 4GT8A 3CGYA 5IY5C 4EKWA 3ZRSA 4V26A 3ABKC 1OSFA 2P6JA 5BOCA 4JTCB 5CA3A 3G75A 1ZXMA 3E35A 2JEXA 2XOKG 2DQ0A 2HR3A 3HEKA 5B1NA 1B6QA 4G2KA 2WEQA 1VQOV 3EHJA 3Q5LA 2XX4A 2Q8FA 3ZRVA 3ZIAG 2A9HA 1JVMA 4R8CA 2XDKA 4R1FA 3K06A 1GTOA 3FKSG 3OMAB 3RKZA 2YEBA 1QR8A 2IOPA 4YKTA 1VQKV 3SPHA 1UYDA 3ABUA 1GKZA 4G28B 3EKRA 1A4HA 2EINB 3UKMA 1GKXA 1F4MA 3OWBA 1TIDA 5L3BA 5C93A 4DXWA 4X8AA 4JF3A 3EFFK 1VQ5V 1SESA 2YEAA 2V1DA 2BU6A 3QO7A 4CWFA 2X6AA 4QPKA 2B1GA 3QO5A 4EGKA 3CCLV 1P4RA 2XK2A 2WSSG 5B1OA 1S0VA 2YJXA 2GHYA 4E2LA 4XCJA 3O2FA 3FB6C 3LPSA 4UXNA 2A0LA 4BIUA 2XNDG 3OE7G 4LWEA 4UV8A 2EIJC 2X7RB 1R6NA 4EGIA 4AWOA 4WFAV 3UM7A 4J9YB 4DZYA 2XDSA 1OCRC 2XDXA 2BREA 1F51A 3KE6A 4BIZA 2IU0A 2EXLA 4YKYA 3BM9A 3B28A 1U2OA 2BYIA 2JK5C 2XHXA 1AI5A 2JIZG 2FYPA 3SYPA 4ZBMA 1BKNA 1Z5AA 4L93A 1AH6A 2YE8A 4MT8A 4PA3A 2AHYA 3RVYA 1I5DA 1THZA 4XE2A 3CP1A 3GIFA 1KC8W 3EHBB 4XDMA 1CP9A 3LDCA 2WLIA 3ABKB 2MK3A 3AG4B 2Y48A 1SERA 1JM6A 4WFFA 5KUKA 4OXSA 4WFGA 3D36A 1S14A 1OZ0A 4MOTA 4MPCA 5CPHA 3M99B 1UYEA 1AMWA 5CTWA 3ZRWA 4B7PA 2LFSA 2PI5A 3JYCA 2IWUA 4JYBA 4BXIA 4X9LA 2YGFA 4JAVA 3RLRA 4JTAB 2OTJV 5CBHA 3CCUV 1AJPA 3CWVA 1NJIW 3JD2A 4B6CA 2ZDIC 4BAYA 1YJWV 2EJRA 2YECA 3ZMUA 5B3SC 2ZD9A 1WLEA 1YESA 3FB7C 2OCCB 1DLBA 3WFVA 3R91A 2AKPA 1GM7A 2UXNA 1VQ8V 3H80A 2HKJA 4MB9A 1R62A 1K3EA 5FWKA 1M57C 4WFBV 5M4EA 2XAJA 3CC2V 3FB8C 4QJFB 1RPRA 3T1CA 3CMAV 4WFHA 2YEJA 2YI5A 3P32A 1TUEB 1YSZA 1YERA 1K97A 2JJCA 1S72V 5CBFA 3SPJA 4MTGA 1L1FA 4I5SA 3PEJA 1RPOA 2NLJC 1OCRB 3CCVV 3HYZA 4YKXA 2OTLV 4O09A 3W7TA 1FXKA 1UY6A 1V54B 5M4KA 3BMYA 2BOCC 4XIQA 4X89A 4CE2A 4ASFA 1G4YB 1FXVA 1TH8A 4HXZA 4I3HA 5D7CA 2WLLA 4CWPA 5M4HA 2QEXV 5B1AC 1R3KC 5BODA 5J6AA 4P9OA 1Y4UA 5F5RA 2V7QG 2HKOA 3E86A 4MTXA 4MTOA 3RW0A 3W7WA 1DF5A 1JPXA 1AJQA 3B26A 3T4DA 2D3OW 3ASOC 2YE2A 4UVBA 3CRLA 1QLNA 1Y8NA 2Q69A 4J9ZB 2ZDXA 2IJIA 1QVGU 3ZM7A 3CC7V 5FNDA 3C11A 1ID0A 3K3WA 3HPLC 3JD1A 1UYGA 4HXWA 3K99A 3E8HA 2YKEA 1Z5BA 2NNUA 5CN0A 3EHFA 5DM6V 1MX0A 1F4NA 4CWQA 3OUFA 3ABMB 1P7BA 4CZZA 2BRCA 2DYRC 3ABTA 3W7SA 3F5WC 3T4ZA 1NH2D 1I58A 1M56C 3LDDA 4R3AA 3X2QC 5IYBO 4XIPA 1AM1A 3CRKA 1UYFA 2K1EA 4XIRA 5H6QA 2Q67A 3K08A 1JOYA 4GX0A 3ZCCA 4FCRA 2YJWA 4MVMA 2W6JG 3T0HA 2IORA 3K79A 1COWG 1I5BA 2CCSA 3Q5KA 4PU9A 2P67A 4HYPA 3A0ZA 3T0ZA 3OGCC 1AI6A 3A0RA 2YEVB 4MP2A 4CWOA 4PDRA 4PL9A 4PELA 4WF9V 1H8HG 1VQ6V 2Z5UA 1OCCC 3LSQA 3B8MA 3QTFA 4YKUA 1KQSU 2WI1A 1DTOA 4MPEA 4QE9A 5EBLC 1K4DC 2DQ3A 1K34A 5H6RA 2Z3YA 1W2BU 1V55B 4PA9A 3E2EA 3TZ2A 1UJWB 2EILB 4HY1A 1I5CA 3IFXA 2HVKC 4FK5C 4CE3A 3VOUA 2Q6AA 2XHRA 1NKDA 4YXWG 5J9PC 2VCIA 4CE1A 4MP7A 1QZRA 2WPDG 1E1RG 1KKDA 3OEEG 3B8NA 2ZBKB 2LP7A 2YK2A 4U7NA 3AG2C 3B77A 3WG7B 2YKBA 3STZC 3LSSA 3GIEA 2CCUA 4ASUG 4UVCA 1RM1C 3ASNC 2QKSA 3G4SV 1PNKA 3G7EA 1YJNV 1NR1A 4EEHA 5KUMA 3LNMB 2DYSC 4ZVIA 2YEFA 2JKIA 1E1QG 2YE7A 4BQJA 4MW8A 3ZKBA 1QVFU 4MS2A 4P2ZA 2X6BA 3R65A 2YE4A 3CCEV 1Z59A 3R4PA 2Q68A 5D7DA 1W0KG 3NXSA 4F4LA 4EGHA 1MSWD 4AS9A 2YE9A 3T10A 2BTZA 2YKIA 5EK0A 2Q2EB 2WAMA 4HZ3A 2UXXA 5L3JA 5EBWC 2PNRA 4EM7A 2ESAA 5D7RA 4DO2A 1H8EG 4MPNA 1KP3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CTU A;  1YT2 A;  3CWV A;  3RLP A;  1BGQ A;  3OPD A;  2YEI A;  4HZ0 A;  3A0W A;  4GFN A;  4H81 A;  4JYC A;  1B62 A;  4B6C A;  2FTK A;  1KIJ A;  5IN9 A;  3R4O A;  2YEC A;  2YK9 A;  1YES A;  1TIL A;  2BYH A;  3R91 A;  2AKP A;  2GQP A;  3H4L A;  2O1U A;  2ZDY A;  3B24 A;  3U2D A;  3D0B A;  3H80 A;  2HKJ A;  2QM7 A;  4MB9 A;  2BU7 A;  2WEP A;  2XX2 A;  2WI5 A;  1R62 A;  5FWK A;  5J71 A;  1H7S A;  3IED A;  1YC4 A;  4URM A;  1IXM A;  5M4E A;  3R92 A;  4FCQ A;  4K4O A;  2YI5 A;  2YEJ A;  3G7B A;  2H55 A;  2K5B A;  3P32 A;  1BXD A;  1YSZ A;  2HCH A;  1YER A;  4NH9 A;  2JJC A;  2BZ5 A;  4FMT A;  2C2A A;  1Z5C A;  2XJX A;  4XCL A;  5CTX A;  1EI1 A;  3ZRX A;  2XJJ A;  2FXS A;  3EHG A;  3ZRW B;  4URO A;  5D6P A;  2YEE A;  1NHI A;  4R3M A;  4ASB A;  4ASG A;  4I5S A;  3PEJ A;  1ZWH A;  4L91 A;  4YKZ A;  4ZKI A;  4BQG A;  4O07 A;  5IDM A;  4KP4 A;  3PEH A;  1UYK A;  4E00 A;  4XD8 A;  3HYZ A;  4YKW A;  4YKX A;  1AJ6 A;  2GFD A;  4O09 A;  4JAS A;  1AH8 A;  3HZ5 A;  4XKK A;  1UY6 A;  3ZXQ A;  4URL A;  2CCT A;  2WI4 A;  2YE5 A;  3ZXO A;  1YSR A;  2BT0 A;  5M4K A;  3A0X A;  3BMY A;  4XIQ A;  4CE2 A;  4LC1 A;  2QFO A;  4ASF A;  3U2K A;  3A0Y A;  2XD6 A;  1TH8 A;  1UYC A;  4L90 A;  4HXZ A;  3TZ4 A;  4I3H A;  2QM8 A;  5D7C A;  4CWP A;  5M4H A;  2Q8I A;  1THN A;  2QG2 A;  2YEH A;  3WHA A;  5BOD A;  5J6A A;  1QY8 A;  1EA6 A;  1U0Z A;  3R4N A;  1H7U A;  1Y4U A;  5F5R A;  3TUH A;  2IWX A;  4MTX A;  2XX5 A;  4WUB A;  3ZKD A;  4BAE A;  2QF6 A;  2BU8 A;  1TC0 A;  4NH8 A;  4PRV A;  2Q8G A;  5FNF A;  1YET A;  3TTZ A;  3DGE A;  4KSG A;  5GGZ A;  1ZW9 A;  2WI7 A;  1YC1 A;  2YE6 A;  3B26 A;  3TZ0 A;  2YE2 A;  3TZ5 A;  3CRL A;  3VHC A;  2BSM A;  4H85 A;  2FWY A;  1Y8N A;  4HY6 A;  2WI2 A;  1UYH A;  2ZDX A;  2VW5 A;  4HZ5 A;  3ZM7 A;  5D6Q A;  5CF0 A;  1UYM A;  5FND A;  3HHU A;  2YI0 A;  3C11 A;  1ID0 A;  3OW6 A;  4LP0 A;  1ZXN A;  4XTJ A;  3JZ3 A;  2Q8H A;  1Y8P A;  1UYG A;  4GT8 A;  3CGY A;  4V25 A;  1UYI A;  2QG0 A;  4YKQ A;  4HXW A;  5M4M A;  3K99 A;  2YKJ A;  1YS3 A;  4V26 A;  2YKE A;  1Z5B A;  1UY8 A;  4DUH A;  1OSF A;  5BOC A;  3G75 A;  3EHF A;  1ZXM A;  3C0E A;  1MX0 A;  2CG9 A;  3K97 A;  4CWQ A;  4LWF A;  3HEK A;  5B1N A;  1B3Q A;  2WEQ A;  3EHJ A;  2BRC A;  4LWG A;  3Q5L A;  2XX4 A;  2ZKJ A;  2Q8F A;  3Q5J A;  3ZRV A;  3INX A;  1I58 A;  4H7Q A;  4O05 A;  2XDK A;  4KTN A;  4R1F A;  1YC3 A;  4R3A A;  3RKZ A;  4O0B A;  2YGE A;  2YEB A;  3EHH A;  3VHA A;  4XIP A;  1AM1 A;  3CRK A;  3MNR P;  1UYF A;  4XIR A;  2IOP A;  1JOY A;  2E0A A;  3ZCC A;  2YI6 A;  4YKT A;  5IDJ A;  2XJG A;  4FCR A;  2YJW A;  3T0H A;  2IOR A;  4LWH A;  3U67 A;  1UYD A;  1GKZ A;  1I5B A;  4XIT A;  3EKO A;  2CCS A;  1KZN A;  3Q5K A;  3EKR A;  4LWI A;  1A4H A;  4PU9 A;  4AWP A;  2P67 A;  4HYP A;  3A0Z A;  3T0Z A;  1I5A A;  3A0R A;  3O6O A;  4MP2 A;  3INW A;  4AWQ A;  1GKX A;  4CWO A;  3FT8 A;  3OWB A;  4PL9 A;  4U93 A;  1TID A;  5C93 A;  4GGL A;  2CGF A;  2BU2 A;  3WQ9 A;  3LNU A;  4P7A A;  3CGZ A;  3QTF A;  4WUC A;  4YKU A;  3FV5 A;  2YEA A;  2BU6 A;  2WI1 A;  4YKR A;  4MPE A;  1UY9 A;  4U7O A;  4CWF A;  4QPK A;  2XHT A;  1Y8O A;  1S16 A;  4E01 A;  4XKO A;  4XC0 A;  3FT5 A;  2CH4 A;  4GEE A;  4EGK A;  3TZ2 A;  2WI6 A;  4QPJ A;  3T1K A;  2XK2 A;  4CWS A;  4HY1 A;  1US7 A;  4URN A;  3R4M A;  1I5C A;  5F3K A;  5B1O A;  2XCM A;  3K98 A;  2YJX A;  1PVG A;  4EFT A;  2YKC A;  4XCJ A;  4CE3 A;  3TK1 A;  3O2F A;  3LPS A;  3T2S A;  2YE3 A;  4BIU A;  4GQT A;  2HG1 A;  2XHR A;  3B27 A;  4CWR A;  2VCI A;  4CE1 A;  3VAD A;  4LWE A;  2WWW A;  4MP7 A;  1QZR A;  4WUD A;  2O1W A;  2ZBK B;  3D2R A;  4EMV A;  2YED A;  4EGI A;  4AWO A;  2UWD A;  3GIG A;  1NHJ A;  2YK2 A;  4U7N A;  4DZY A;  2XDS A;  4NH7 A;  2XDX A;  2BRE A;  4XKA A;  2YKB A;  1F51 A;  3KE6 A;  4BIZ A;  3NMQ A;  4KSH A;  1TC6 A;  2EXL A;  3SL2 A;  2BU5 A;  1L0O A;  3GIE A;  2CCU A;  3RLQ A;  4YKY A;  1UY7 A;  4LPB A;  2VWC A;  3BM9 A;  2XAB A;  1TBW A;  4HYM A;  3B28 A;  1U2O A;  2BYI A;  2YEG A;  2XHX A;  3G7E A;  2O1V A;  2FYP A;  5CTY A;  3HZ1 A;  1BKN A;  4EEH A;  3OWD A;  1Z5A A;  4L93 A;  1AH6 A;  4ZVI A;  5M4N A;  1MU5 A;  4MT8 A;  2YEF A;  2YE8 A;  1I5D A;  4JQL A;  2JKI A;  4XE2 A;  2YE7 A;  4BQJ A;  1NHH A;  3GIF A;  3VHD A;  4XDM A;  3A0T A;  3HYY A;  3ZKB A;  4GT1 A;  3K60 A;  5M4P A;  1B63 A;  4L8Z A;  4FCP A;  1JM6 A;  3MD0 A;  2YGA A;  1YT0 A;  3O0I A;  4KQV A;  1UYL A;  2FWZ A;  2XDL A;  2YE4 A;  2IWS A;  2WI3 A;  2YI7 A;  1GJV A;  1YT1 A;  1Y4S A;  4Q20 A;  4MBC A;  3OMU A;  3B25 A;  3D36 A;  1S14 A;  1Z59 A;  3QDD A;  4O04 A;  3R4P A;  4MOT A;  4FPP A;  2IOQ A;  1BYQ A;  1I59 A;  5D7D A;  4E02 A;  4MPC A;  5CPH A;  4EFU A;  3NXS A;  1AMW A;  1UYE A;  5CTW A;  3ZRW A;  4ASA A;  4B7P A;  2XDU A;  4L94 A;  2LFS A;  2WER A;  4GCZ A;  4EGH A;  1QYE A;  4AS9 A;  2YE9 A;  3T10 A;  2BTZ A;  2YKI A;  5FNC A;  4CWN A;  2Q2E B;  2IWU A;  4KFG A;  5L3J A;  4JYB A;  4JAU A;  2H8M A;  2PNR A;  4EM7 A;  4BXI A;  2ESA A;  2YGF A;  4X9L A;  5D7R A;  4JAV A;  4PRX A;  3GIG B;  3RLR A;  4P8O A;  4W7T A;  2LFR A;  2VCJ A;  4CWT A;  4MPN A; 
#chains in the Genus database with same CATH topology
 2LW1 A;  1YT2 A;  1FXK C;  1B04 A;  3B4S A;  4DV7 B;  1SC5 B;  4J7J A;  1MZE A;  2YEI A;  2EX3 A;  3N2G B;  3J81 N;  3A0W A;  4GFN A;  1B62 A;  1K5S A;  1BMF G;  2FTK A;  1WPX A;  1Q3E A;  1Q90 D;  1RFY A;  3F7V C;  5HFL A;  5IN9 A;  1G6U A;  3BEH A;  3TXQ A;  1BSM A;  1VQP V;  1AVM A;  2JDI G;  2YK9 A;  1OCZ C;  4MSW C;  3CJH A;  3K0D A;  3H1J H;  3IC7 A;  3AG1 C;  3R66 A;  5JVD A;  3H4L A;  2L35 A;  1ROP A;  4GUN A;  2N74 A;  2P4V A;  3RYF A;  1XMO O;  3RN4 A;  4RWU A;  1FJG O;  2CGO A;  5LXT A;  1Q86 W;  2XX2 A;  5ITZ A;  2Y69 C;  4GX1 A;  1M9N A;  4DR3 B;  5GTI Z;  1H7S A;  3IED A;  4URM A;  2HG5 C;  2HVJ C;  1X59 A;  4IYI A;  4FCQ A;  4LF9 B;  2K5B A;  4Z2W A;  3OR7 C;  4X64 B;  1BXD A;  1Z5V A;  3ABL C;  4UUJ C;  2DWE C;  3VBB A;  5CBG A;  1Q82 W;  3KZI Z;  4E4E A;  4MVO A;  2ZXW B;  1GN4 A;  2BZ5 A;  2C2A A;  3EXA A;  1Z5C A;  2JJ1 G;  4U3F H;  4LFA O;  5JJE B;  1KEC A;  3EHG A;  5IY5 B;  3ZRW B;  5D6P A;  2X6C A;  4ASB A;  3B2E E;  4ASG A;  4JI6 B;  5L3E A;  1ZWH A;  1PD3 A;  4L91 A;  4YKZ A;  4WBN A;  2WLM A;  4EFE A;  1J5E B;  4DV4 B;  3PEH A;  1UYK A;  2NN4 A;  4EEQ A;  4XD8 A;  1AJ6 A;  5H2F Z;  4CBC A;  2GFD A;  3WB0 A;  5H5N A;  1YZB A;  1F7Y A;  3W7U A;  5EZY B;  4JI3 B;  3HZ5 A;  4XKK A;  1AP6 A;  2ATK C;  1FS0 G;  3FAV B;  1XHX A;  2YE5 A;  3ZXO A;  1YSR A;  1R3J C;  3A0X A;  1S3J A;  2HP8 A;  3JAL B;  4LC1 A;  2QFO A;  3OMI B;  1XL6 A;  2C1I A;  3DTU B;  3A0Y A;  4DV3 B;  3QNE A;  3OMN B;  3QVN A;  3SYO A;  4IT5 A;  1QLE C;  1THN A;  2QG2 A;  4FLX A;  4P30 A;  4LF5 B;  1EA6 A;  3CPW U;  1U0Z A;  1H7U A;  1I5Y A;  1IBL O;  4IYH A;  2IWX A;  2XX5 A;  2ETN A;  2Q7H A;  3U0Z A;  1EFR G;  4JYA B;  2QF6 A;  4PA4 A;  1G8M A;  2Q8G A;  3AG3 C;  1Y76 B;  3CXC U;  2RNB A;  4DYL A;  1FYJ A;  3GWO A;  4CS3 A;  1ZW9 A;  4RAI A;  3SJC C;  1KB9 F;  1MNG A;  3CEI A;  3VHC A;  4XBF A;  1LR1 A;  2BSM A;  1QR9 A;  4HNA B;  1JR9 A;  5CA0 B;  2EIM C;  2FWY A;  3K04 A;  2VW5 A;  3K03 A;  1R6T A;  1I7F A;  2M7W A;  1Y74 B;  4P9P A;  4CH5 A;  3AEI A;  3H1K H;  1XBL A;  3BY6 A;  3K5M A;  3QO8 A;  3OW6 A;  1VQ7 V;  4LP0 A;  4DK1 A;  4L8J A;  3E22 B;  4FLY A;  2HEP A;  1SQP H;  1Y8P A;  4YJ2 A;  2JVD A;  4V25 A;  3G6E V;  1KD1 W;  4YKQ A;  2HFE C;  3PN1 A;  2LO1 A;  3ZMZ A;  3CRC A;  2JGD B;  4O2B B;  4DUH A;  1GK9 A;  1I0H A;  1JJ2 U;  4YHH O;  1RP3 B;  2IH1 C;  3BVO A;  2QA4 V;  3TCU A;  3C0E A;  3JAK A;  3RYI A;  4O4J B;  2CG9 A;  2RDC A;  1FXH A;  3E89 A;  4UB8 Z;  1QCE A;  1VF6 A;  4NXM O;  1IX9 A;  1WPB A;  1HNZ B;  4LWF A;  2Q73 A;  1B3Q A;  3FB5 C;  4NTW A;  2ZKJ A;  3Q5J A;  5L3D A;  3H01 A;  2XAF A;  3INX A;  5H9C A;  1AR5 A;  2CE4 A;  4TUY A;  4O05 A;  4KTN A;  1YC3 A;  1HW7 A;  4D7T A;  2GV9 A;  3IGA C;  4O0B A;  2YGE A;  2XAG A;  4FLT A;  4I4T A;  3EHH A;  2JGU A;  3VQW A;  2EIJ B;  4CH4 A;  3MNR P;  1YEW A;  1K92 A;  4BW5 A;  4JI4 B;  2F4V O;  1PL0 A;  1K33 A;  1SQF A;  1VP7 A;  2YI6 A;  3HB3 B;  1OCZ B;  1OCO C;  5IDJ A;  2XJG A;  1Y4M A;  3CB2 A;  3MHS C;  2EIK C;  4ZI7 A;  3LSU A;  4MTF A;  3RYC A;  1MZF A;  4LNU A;  5LA6 B;  4OX9 O;  1KZN A;  4NYK A;  4JI7 B;  4K35 A;  4B7E A;  2Y4U A;  4ZHQ B;  1NTM H;  4TSF G;  4X88 A;  4WCE V;  3C3T A;  1SA0 A;  3O6O A;  1M93 A;  3INW A;  4AWQ A;  4WFE A;  3FT8 A;  2HHH B;  3S5T A;  2UUC B;  1BHA A;  4TWK A;  4GGL A;  1AI7 A;  4TV9 A;  4P7A A;  2QJ1 A;  1YDX A;  5BZB A;  1HWY A;  2WLN A;  1TA8 A;  1GN3 A;  2QWN B;  3F7Y C;  1O9H A;  4YKR A;  2F43 G;  3SJB C;  2W6I G;  1E79 G;  1Q8I A;  2ADP A;  2P22 C;  4HAM A;  1CPY A;  1UY9 A;  1S16 A;  1KP2 A;  4E01 A;  3HKD B;  2D2C B;  2P4K A;  2CDY A;  4XC0 A;  1SZT A;  3FT5 A;  2CH4 A;  4GEE A;  2YIC A;  2WI6 A;  3T1K A;  1R3I C;  4MW3 A;  4DRX B;  4G27 B;  1R6K A;  4CWS A;  1GM8 A;  2EJ7 A;  5LMU O;  3ETQ A;  4URN A;  2ZQM A;  3R4M A;  2OT5 A;  5J2U A;  3L75 H;  5F3K A;  2QKA A;  2W0X A;  4DUY B;  3TET A;  4R50 A;  1QNM A;  1PVG A;  1AR1 B;  3TK1 A;  1SET A;  2DW4 A;  3T2S A;  2YE3 A;  4GQT A;  3CC4 V;  2XAH A;  3B27 A;  3L72 H;  2CTP A;  3VAD A;  4B3S O;  2WWW A;  2EZP A;  4WUD A;  1SQX H;  3VQX A;  4I0X A;  1NH2 B;  3KG2 A;  3ZMV A;  3ZHV A;  5IT9 N;  2YXL A;  4QIW F;  4DR5 O;  3T1H B;  4EMV A;  1K73 W;  3GIG A;  1EZV H;  2ARH A;  5JEN A;  5EIB D;  4NH7 A;  5IYD O;  2ZIO A;  4KXR A;  5CB4 A;  4DUZ B;  3UQ8 A;  2FB5 A;  2F95 B;  2YI8 A;  2YSU B;  2XAS A;  3JD4 A;  5BY1 A;  4DR7 O;  5KMG A;  3O9O A;  1XHZ A;  1TC6 A;  4LFA B;  1L0O A;  3LUT B;  3RLQ A;  3OM3 B;  1N0J A;  3CSX A;  1UY7 A;  5DEC A;  2EIN C;  4CS4 A;  1AB3 A;  4FZ1 A;  1R1B A;  1XEQ A;  1Q7Y W;  4XDL A;  2EBO A;  1ZL8 B;  5FNV A;  4JI5 B;  5CTY A;  2ILM A;  3OWD A;  2BCC H;  3CXH F;  5B3S B;  2ITC C;  1M5I A;  1N33 O;  3BHP A;  1K5Q A;  4UCR A;  3SPG A;  4TQF A;  4L87 A;  5IYZ A;  1NHH A;  3VHD A;  2BSK A;  5KAI Z;  4RQE A;  4LWS B;  1NR7 A;  2YI9 A;  5LGT A;  4GT1 A;  2FYU H;  3K60 A;  4UCS A;  4L8Z A;  5BMV B;  1PNL A;  2WLJ A;  3ETE A;  4RQF A;  2HJD A;  3MD0 A;  2BTQ B;  3O0I A;  2QGN A;  3OTO O;  3RVZ A;  1M57 B;  3K0G A;  1IBM O;  2IWS A;  1HP8 A;  2VQE B;  4I9W A;  3HKC A;  4R6Z A;  3E8G A;  2GTA A;  4MVR A;  4PDV A;  3RBZ A;  2DE0 X;  4F6R A;  4IIJ B;  1U97 A;  5CA1 A;  3QDD A;  4O04 A;  4X1I A;  4FPP A;  2IOQ A;  2ZM6 O;  2JEU A;  4AQY B;  1BYQ A;  1XL4 A;  4QNH B;  2UU9 B;  1I59 A;  5KX5 A;  4FIP C;  4JI8 B;  4ASA A;  4W4L A;  1K4C C;  3OUS A;  4L94 A;  4XDJ A;  4X62 B;  3ZHR A;  5GON A;  5FNC A;  1GN2 A;  5LOV B;  1P84 F;  3ML0 A;  4KFG A;  3G71 V;  3CCR V;  3JD0 A;  2IU3 A;  3A0B Z;  4J11 A;  4JAU A;  1XUQ A;  1HR0 O;  2UUB B;  2GSM B;  1FKA O;  3L9D A;  5F2V O;  2A79 B;  4P8O A;  2CH7 B;  1XMQ O;  2XTA A;  3PJS K;  3JAM N;  2VCJ A;  4CWT A;  4MVS A;  5CTU A;  5A2Q N;  1MOF A;  3FX7 A;  4I50 B;  4CC6 A;  4HZ0 A;  2P90 A;  4ABM A;  4JYC A;  5LGN A;  2GUZ A;  1N8R W;  1K9M W;  3E8B A;  4B3T B;  3R4O A;  1S5J A;  2QE7 G;  1D5A A;  5C8Y B;  5B1A B;  1VQM V;  1WB8 A;  3RGB A;  3IJ4 A;  1O9G A;  2RCV A;  5GW7 A;  1TIL A;  4LR3 A;  2BYH A;  4B7K A;  2GQP A;  5K1X A;  1YHQ V;  2O1U A;  1W59 A;  3KKY A;  3B24 A;  2O57 A;  2Y0P A;  4JI1 O;  4DR2 B;  2A7W A;  3SYQ A;  5LYJ B;  4ICG A;  3AG4 C;  2WEP A;  2PYL A;  4FFB A;  3ASO B;  2OYQ A;  2F4V B;  3MDS A;  4YY3 B;  4X1Y B;  2YDE A;  4JZG A;  5DN6 G;  2VQF B;  3ETG A;  4QE7 A;  1VQ4 V;  4K4O A;  1Q81 W;  3FFQ A;  5EC2 C;  2ZE7 A;  3G7B A;  2H55 A;  1VQ9 V;  1YCI A;  1YXB A;  2HCH A;  5D5P A;  4PDL A;  2IH3 C;  1GMG A;  3OW2 U;  3UO2 A;  2QWO B;  1S5H C;  3RYH A;  2XJX A;  5CTX A;  1EI1 A;  1KUQ A;  1TGO A;  2XJJ A;  3ZMS A;  2FXS A;  1BGY H;  1VQL V;  4URO A;  2YEE A;  2R9R B;  1NHI A;  3S3X A;  2FKX A;  1Q6U A;  1NI8 A;  3G6B A;  4LF7 B;  1JQ0 A;  4PHZ A;  4BQG A;  4O07 A;  4X1K B;  3CRR A;  4K3A A;  5IDM A;  4IHJ B;  4DV6 O;  2QDO A;  4E00 A;  2Q0O C;  4RUE A;  1VF6 C;  3B40 A;  3UT5 A;  1ORQ C;  1NQT A;  2DYR B;  5AG2 A;  3O65 A;  2CCT A;  1K7D A;  4GX5 A;  3I55 V;  3UCS C;  1BS3 A;  1M56 B;  3HKE A;  1H38 A;  3SYC A;  4CC5 A;  2W0F C;  4N21 A;  1YI2 V;  3GB7 C;  2XD6 A;  2YIB A;  4I55 B;  5EC1 C;  3T1Y O;  1ZSP A;  3X2Q B;  4ZIB A;  3JCU Z;  4AIL C;  2YEH A;  1LNQ A;  3WHA A;  5L3F A;  2UXD O;  1GO3 F;  1V9P A;  1QY8 A;  1ARO P;  3R4N A;  1M90 W;  1ENV A;  1GKF A;  4KUM A;  2OCC C;  4U3J B;  2BOB C;  4BAE A;  3JD3 A;  2BU8 A;  1KU9 A;  2YID A;  3P3P A;  1HDJ A;  1YET A;  3CJH B;  4DV5 O;  3DC5 A;  4H37 A;  5GGZ A;  5B1B C;  1FFT B;  2ZIN A;  3STL C;  5JVD B;  2YE6 A;  3CD6 V;  3TZ0 A;  3TZ5 A;  5LHG A;  1JJO A;  3RYF B;  2X0L A;  4HY6 A;  4A5U B;  2LGQ A;  4GKK O;  1UYH A;  1MAB G;  1VIB A;  1OHH G;  2IJJ A;  4HZ5 A;  1XIL A;  2BTO A;  4B3M O;  3LNN A;  4GKJ O;  2Q8V A;  4PA6 A;  4DR7 B;  5KA6 A;  3ZS8 C;  4XTJ A;  1OCC B;  2QKC A;  1D2D A;  2ZNJ A;  2CTW A;  1QBZ A;  1Z2G A;  5LMN B;  4FM0 A;  3CS5 A;  1UYI A;  2QG0 A;  5M4M A;  3DC6 A;  3OR6 C;  2YKJ A;  5LGU A;  3N2K A;  1YS3 A;  4PA7 A;  1JMK C;  5GTH Z;  1UY8 A;  2ZE5 A;  3CWB H;  2E74 B;  2Q7E A;  5JWP A;  1N34 O;  2LJ2 A;  4MVZ A;  2WLI B;  4NR1 A;  1AJN A;  4ZOL A;  3CYO A;  1R73 A;  3K97 A;  4DR6 B;  2KG7 A;  1YTF B;  2P5O A;  3E83 A;  4LWG A;  2QM4 A;  5FPO A;  2WLH A;  1F23 A;  1J95 A;  1V54 C;  3EVK A;  4O4L A;  1K8A W;  4F6E A;  1QHT A;  3N2G A;  3GVM A;  4H7Q A;  1H2M A;  1AR4 A;  2H8P C;  4LP8 A;  4J10 A;  2PI4 A;  3VHA A;  1RSO A;  1IBM B;  2ZKO A;  2FML A;  1EBO A;  5LL6 Y;  1YTF D;  4JPR A;  2E0A A;  4HYO A;  4J41 A;  3HR0 A;  3AG2 B;  4NVP A;  1ZWI C;  4LWH A;  4Q6G A;  3CCJ V;  3U67 A;  4JI2 B;  3HKB A;  1N36 B;  4XIT A;  2B1I A;  3SJA C;  3EKO A;  2HJF C;  2XHB A;  4LWI A;  1M4U A;  1YJ9 V;  4AWP A;  1I5A A;  2B9Z A;  3P3N A;  3VQY A;  1RM1 B;  3ASN B;  3ZHS A;  1HR0 B;  3BPZ A;  3K57 A;  4U93 A;  1IBK B;  3H1L H;  2CGF A;  2BU2 A;  1SZX A;  2ZIM A;  3WQ9 A;  4JZ2 A;  3LNU A;  2IM9 A;  3CGZ A;  4JAA A;  4GX2 A;  2DYS B;  2IBZ H;  2L6L A;  4WUC A;  3FV5 A;  1JCH A;  2OWO A;  2AHZ A;  3OT7 A;  3I56 V;  4YJ2 B;  4U7O A;  4RO2 A;  2XHT A;  1Y8O A;  4FJC C;  4O2A B;  1EN5 A;  4H0L B;  1YF2 A;  4BIO A;  1NTZ H;  4XKO A;  5J2T B;  4UV9 A;  1BT8 A;  4LFB O;  4QPJ A;  5HFM A;  2KB1 A;  1GH6 A;  1PL4 A;  2DWD C;  5EZY A;  3FYE B;  1US7 A;  3ABM C;  1XNQ O;  2IJK A;  3JAK B;  1LUV A;  3APO A;  3FAV A;  3RYI B;  2XCM A;  3K98 A;  2BE3 A;  1GRJ A;  2LW7 A;  2YKC A;  4EFT A;  4NXN O;  2RJZ A;  4JGS A;  3JAL A;  2HG1 A;  3ZHU A;  4CWR A;  4J7Z A;  1IUR A;  3CCM V;  2UXB O;  4PV1 B;  4E72 A;  4DV2 O;  2O1W A;  2VWK A;  4TUY B;  3OFN G;  3D2R A;  2YED A;  2UWD A;  1H2L A;  1NHJ A;  1BL8 A;  4JI0 O;  2PYJ A;  5IWA B;  4XKA A;  4DV1 O;  1JX9 A;  2HLD G;  4DR4 B;  4KSH A;  3NMQ A;  1IXB A;  3SL2 A;  2BU5 A;  4FFK A;  1XRE A;  5B1B B;  3W7X A;  2PGG A;  5EYP B;  3H1I H;  3SDL A;  4ZI7 B;  4X20 A;  1R3L C;  3RYC B;  1FXK B;  4LNU B;  4MVQ A;  4LPB A;  4X65 B;  1Q43 A;  2VWC A;  2XAB A;  1Y74 A;  1TBW A;  4HYM A;  1VF7 A;  1KMI Z;  2YEG A;  4B3R B;  5BR8 B;  2O1V A;  1HNW B;  2UUA O;  1YSC A;  1SA0 B;  3HZ1 A;  3D3I A;  3JSN A;  2G38 A;  3JCZ A;  3TGU H;  2WLL B;  4IGG A;  2P7T C;  2WLK A;  1DF4 A;  3SYA A;  5M4N A;  2WA3 A;  1ZLZ A;  2EUL A;  1MU5 A;  1TUB B;  4JQL A;  4TV9 B;  4R7C A;  1NBM G;  3JAW A;  3AG1 B;  3ZN0 A;  1XNR O;  1PKX A;  2P06 A;  4KHP O;  3JAT B;  1DK1 A;  3A0T A;  1WAZ A;  3GWK C;  3HYY A;  3BA8 A;  5B5E Z;  2KSD A;  3T1Y B;  4FZ0 A;  1V55 C;  1H2K A;  5M4P A;  1B63 A;  1BQ0 A;  5L3G A;  4FCP A;  4LF6 O;  1TVK B;  2JS5 A;  2YGA A;  2Y69 B;  4UCO A;  1YT0 A;  4KQV A;  5LHH A;  1IDS A;  1UYL A;  2FWZ A;  2EIL C;  1NVP B;  2XDL A;  2WI3 A;  2YI7 A;  1GJV A;  1YT1 A;  1Y4S A;  4Q20 A;  4MBC A;  1YIT V;  2F1M A;  3B25 A;  3OMU A;  1N32 O;  3ZMT A;  3TXS A;  2WA4 A;  5J2U B;  3CME V;  3L71 H;  3SJQ C;  3ABL B;  4E02 A;  2AGA A;  4EFU A;  2XDU A;  1MG1 A;  5EBM C;  1IVS A;  2XAQ A;  2WER A;  5JH7 A;  2AZ0 A;  1I08 A;  4GCZ A;  2Y4T A;  1ZAU A;  4XDK A;  2ZNI A;  1QYE A;  3CYG A;  4X66 O;  5CMU A;  4CWN A;  4DV0 O;  4AHC A;  2UXC O;  1Y66 A;  5IE9 A;  1HNX O;  3ZJZ A;  4I0X B;  1WA8 A;  4B3M B;  1NVP D;  3CCS V;  2H8M A;  5KA5 A;  4PRX A;  1DGS A;  1BQZ A;  3GIG B;  2B5U A;  1VF5 B;  3WG7 C;  4O4H B;  4W7T A;  2LFR A;  3JAS A;  2JRI A;  4ZHQ A;  5LBQ A;  4LCU C;  2IJH A;  3J7A U;  3RLP A;  1XMO B;  1JFF A;  1VQN V;  4UCV A;  2EZO A;  2ITD C;  2RN9 A;  1FJG B;  1BGQ A;  3K9A A;  3OPD A;  5E1A C;  1B06 A;  4LBE C;  1N34 B;  1MSD A;  4H81 A;  1YIJ V;  4DK0 A;  3E8F A;  3A0H Z;  3CCQ V;  5FL7 G;  1FAF A;  1KIJ A;  1QLE B;  3CX5 F;  4FM2 A;  2ZCE A;  1S76 D;  1M1K W;  3ETD A;  4KFM A;  5FLX N;  1NT2 B;  2ZDY A;  3AG3 B;  3HKD A;  3T2M A;  4N23 A;  1XDC A;  5IJ9 B;  3U2D A;  1KKC A;  4H33 A;  3D0B A;  3A8T A;  4DV7 O;  5IYZ B;  2QM7 A;  2BU7 A;  2WI5 A;  5J71 A;  2EIM B;  1YC4 A;  1IXM A;  5L3C A;  3R92 A;  2IW5 A;  2PZS A;  1H2G A;  2QR4 A;  1L8D A;  3DXR B;  1AI4 A;  4EFB A;  3ICX A;  3KCY A;  5JJN B;  3HKC B;  2QTS A;  4F6R B;  4RUF A;  4NH9 A;  4JTD B;  3D8C A;  5CA1 B;  4X1I B;  4FMT A;  4XCL A;  3ZRX A;  2K9P A;  5E79 Z;  2ZR3 A;  4AI8 A;  5LP6 C;  2JJ2 G;  2YUA A;  3P30 A;  1PNM A;  3NR7 A;  4R3M A;  3CRQ A;  3Q4H A;  2ZR2 A;  4I7Z B;  4PDM A;  5GON B;  2NR5 A;  3OEH G;  4DR3 O;  4ZKI A;  1KBH A;  3B09 A;  3OAA G;  3MAQ A;  1XOU A;  4KP4 A;  1P7G A;  2YXH A;  2CK3 G;  1I5X A;  1IBL B;  4YKW A;  5KHJ A;  3TJT A;  4X64 O;  3SPI A;  4JAS A;  1Y67 A;  2C1G A;  1AH8 A;  3ZXQ A;  4URL A;  2WI4 A;  5IYC O;  5KAF Z;  3LDE A;  2BT0 A;  4K8X A;  1EM1 A;  1TAE A;  2YIA A;  2ZDI A;  5IJ0 A;  3SGI A;  3U2K A;  1S77 D;  1SRY A;  1W0J G;  2Q9L A;  1AIL A;  1UYC A;  4L90 A;  4JI6 O;  3TZ4 A;  1WB7 A;  2QM8 A;  3ZN1 A;  3IAY A;  3MHH C;  2Q8I A;  4PI0 A;  2PF4 E;  1GM9 A;  1QQC A;  3IC9 A;  4DV4 O;  1J5E O;  3THO A;  4MVU A;  4TOI A;  3TUH A;  5LHI A;  3SPC A;  3FYI B;  4WUB A;  3ZKD A;  1OCO B;  1TC0 A;  1NZ6 A;  2V4D A;  4UVA A;  4NH8 A;  4PRV A;  4J7K A;  5FNF A;  3TTZ A;  2QTO A;  3DGE A;  4EB6 B;  4JI3 O;  5JQG A;  4KSG A;  2EIK B;  5BMV A;  2WI7 A;  1YC1 A;  2BTQ A;  2XT9 A;  2YEV A;  1WP8 A;  4H85 A;  2N05 A;  4YHH B;  2WI2 A;  1Q6H A;  4TT3 G;  1Z5W A;  4IIJ A;  2H94 A;  5D6Q A;  5CF0 A;  2ZE6 A;  1CEZ A;  1BHB A;  1UYM A;  1EZJ A;  2VS0 A;  4NXM B;  3HHU A;  2YI0 A;  2R9I A;  3BRC A;  4TV8 A;  4LF5 O;  4Z1M G;  1ZXN A;  3JZ3 A;  2Q8H A;  1GAX A;  2ZXW C;  4GT8 A;  3CGY A;  2YC0 A;  2FL4 A;  5LOV A;  2F66 C;  5IY5 C;  4EKW A;  4O4I A;  3ZRS A;  4V26 A;  3RYH B;  3ABK C;  1OSF A;  2P6J A;  5BOC A;  4JTC B;  5CA3 A;  3G75 A;  1I94 O;  1ZXM A;  1VEW A;  3E35 A;  2JEX A;  2XOK G;  3RWR D;  2DQ0 A;  2F93 B;  1YVW A;  4LF8 O;  2HR3 A;  3HEK A;  5B1N A;  1B6Q A;  3N27 A;  4G2K A;  2WEQ A;  2OIG A;  1VQO V;  3EHJ A;  3Q5L A;  2XX4 A;  2Q8F A;  5JCO A;  3ZRV A;  3ZIA G;  4OX9 B;  2A9H A;  1JVM A;  2RMK B;  4R8C A;  2VWJ A;  3RFR A;  2XDK A;  4R1F A;  3K06 A;  1GTO A;  3FKS G;  3JSL A;  3OMA B;  4LF6 B;  3RKZ A;  1SQG A;  1VMG A;  2YEB A;  5C8Y A;  3ZHQ A;  3RT3 C;  4J80 A;  3U11 A;  1QR8 A;  2IOP A;  1JA8 A;  4YKT A;  1NU1 H;  1VQK V;  3SPH A;  1UYD A;  4H13 B;  3ABU A;  1GKZ A;  4G28 B;  3EKR A;  1A4H A;  2ZE8 A;  2EIN B;  3UKM A;  3C90 A;  4OPH A;  4NTY A;  1GKX A;  2YIB D;  1F4M A;  5LMU B;  3OWB A;  1TID A;  5L3B A;  3BA9 A;  5C93 A;  4DXW A;  3AG7 A;  3CHX A;  4X8A A;  4JF3 A;  5DED A;  3EFF K;  3J80 N;  1VQ5 V;  1SES A;  4JYY A;  2YEA A;  2V1D A;  2BU6 A;  3QO7 A;  1EN6 A;  3K5L A;  4B3S B;  2DJV A;  5B66 Z;  1FFX A;  2X6A A;  2YS8 A;  2A06 H;  4QPK A;  4JI7 O;  4CWF A;  4X1K A;  2B1G A;  4DR5 B;  4IHJ A;  4YJ3 A;  3QO5 A;  3M8A A;  3S3W A;  3JAR A;  4EGK A;  3CCL V;  1H2N A;  1P4R A;  5LXT B;  2XK2 A;  1N0N A;  2HHH O;  5ITZ B;  2UUC O;  2WSS G;  5B1O A;  3G80 A;  4ZOL B;  1S0V A;  2YJX A;  2GHY A;  2KG7 B;  4E2L A;  4XCJ A;  3O2F A;  4C7U A;  3FB6 C;  4FLU A;  4UXN A;  3LPS A;  2A0L A;  4BIU A;  4UCT A;  2XND G;  3OE7 G;  4I55 A;  4O4L B;  5LP6 A;  4LWE A;  1XQ8 A;  4UV8 A;  2EIJ C;  2X7R B;  1R6N A;  4EGI A;  4U3J A;  4AWO A;  1RSO B;  4OGQ B;  4WFA V;  2E3C A;  3UM7 A;  4J9Y B;  2QWP B;  4DZY A;  2XDS A;  2E75 B;  4LFC O;  1OCR C;  2XDX A;  4WBN B;  2BRE A;  1N33 B;  3BFR A;  1F51 A;  2QWQ B;  4DUY O;  3KE6 A;  4BIZ A;  2IU0 A;  2EXL A;  1ZTE A;  4HBN A;  4YKY A;  3HKB B;  5KHI A;  1UPG A;  1URF A;  3L70 H;  3BM9 A;  2E5L O;  3B28 A;  1U2O A;  2BYI A;  2GBO A;  2JK5 C;  3OTO B;  2XHX A;  1AI5 A;  4I9Q A;  3T1H O;  2JIZ G;  2FYP A;  1QU7 A;  3SYP A;  1SQQ H;  4ZBM A;  1BKN A;  4OPA A;  1Z5A A;  4L93 A;  1AH6 A;  1N4C A;  1OV9 A;  4DUZ O;  2YE8 A;  4MT8 A;  4PA3 A;  2AHY A;  3RVY A;  2ZM6 B;  1I5D A;  1THZ A;  4XE2 A;  3CP1 A;  3H9V A;  2CTR A;  3GIF A;  1KC8 W;  3EHB B;  3K58 A;  4XDM A;  4UFZ A;  1PPJ H;  1CP9 A;  2Y0I A;  3LDC A;  1FD9 A;  2WLI A;  3ABK B;  2MK3 A;  3AG4 B;  2Y48 A;  1SER A;  1JM6 A;  2QWR B;  4WFF A;  4JI5 O;  5EIB C;  5KUK A;  1S5L Z;  4CH3 A;  4OXS A;  4WFG A;  1L0N H;  3D36 A;  1S14 A;  1XMQ B;  1OZ0 A;  4MOT A;  4CH6 A;  1WP7 A;  3SR2 C;  4MPC A;  5CPH A;  3M99 B;  1UYE A;  1AMW A;  5CTW A;  3ZRW A;  4B7P A;  3F5T A;  2LFS A;  3QF7 A;  1GN6 A;  1SF9 A;  2PI5 A;  3JYC A;  2IWU A;  3APQ A;  2Q7G A;  4JV5 O;  4JYB A;  2PY5 A;  2CUG A;  4LH6 A;  4BXI A;  4X9L A;  2YGF A;  4JAV A;  2VQE O;  3RLR A;  1U96 A;  4JTA B;  2OTJ V;  1NTK H;  2AZ2 A;  5CBH A;  5KHH A;  4AQY O;  1P49 A;  2UU9 O;  3LMM A;  3CCU V;  4JI1 B;  4JI8 O;  3DSQ A;  1AJP A;  3L73 H;  3CWV A;  1NJI W;  3JD2 A;  4CS2 A;  4X62 O;  3I5D A;  4X20 B;  4BWA A;  1I94 B;  1H2S B;  4B6C A;  2ZT9 B;  3OTF A;  5KHK A;  2ZDI C;  4BAY A;  1T5E A;  1ZUQ A;  2DMX A;  4LF8 B;  1YJW V;  2EJR A;  4LH7 A;  1LUW A;  4I4T B;  3ZMU A;  5B3S C;  2ZD9 A;  2YEC A;  1WLE A;  1Q5O A;  2UUB O;  1Y76 A;  1YES A;  3FB7 C;  2OCC B;  1DLB A;  3WFV A;  3R91 A;  2AKP A;  1GM7 A;  4O2A A;  4YIP A;  2UXN A;  3JAW B;  5J2T A;  4HNA A;  5CA0 A;  1VQ8 V;  3H80 A;  2HKJ A;  4MB9 A;  3BAA A;  3WB1 A;  1R62 A;  1K3E A;  5FWK A;  1M57 C;  4WFB V;  5M4E A;  2XAJ A;  3CC2 V;  3FB8 C;  3WB2 A;  4QJF B;  4DV6 B;  4B3T O;  1RPR A;  3E22 A;  4QGP A;  3T1C A;  3CMA V;  4WFH A;  2YEJ A;  2YI5 A;  1CXZ B;  1KYO F;  4TQD A;  3P32 A;  1TUE B;  1YSZ A;  1YER A;  1K97 A;  2JJC A;  1S72 V;  2OIE A;  1WN7 A;  5CBF A;  2JGD A;  3SPJ A;  2QSA A;  4O2B A;  2PUS A;  4MTG A;  4DW0 A;  5KLV H;  3AK1 A;  4DR2 O;  1L1F A;  5JH7 B;  5D5Q A;  4I5S A;  3PEJ A;  1RPO A;  4O4J A;  4YY3 O;  2JS3 A;  2NLJ C;  2VQF O;  2UXD B;  1WA8 B;  3CRM A;  1OCR B;  3CCV V;  3CE2 A;  3HYZ A;  4YKX A;  2OTL V;  4FLV A;  5EYP A;  4O09 A;  3W7T A;  4DV5 B;  1FXK A;  1UY6 A;  1SQV H;  1V54 B;  3JAS B;  5M4K A;  2AXT Z;  1EN4 A;  5JCO C;  2DOS A;  3BMY A;  2BOC C;  4XIQ A;  2GTS A;  3FD9 A;  4X89 A;  4CE2 A;  4ASF A;  1G4Y B;  1JFF B;  4GKK B;  1FXV A;  3ZX6 A;  1TH8 A;  4HXZ A;  4GYC B;  4I3H A;  5D7C A;  2WLL A;  4CWP A;  5M4H A;  2AW9 A;  3K5N A;  4LF7 O;  2QEX V;  1TUB A;  5B1A C;  1R3K C;  4GKJ B;  5BOD A;  5J6A A;  2Q5Z A;  4P9O A;  1Y4U A;  5K1P A;  5F5R A;  2V7Q G;  2HKO A;  3E86 A;  4MTX A;  3JAT A;  3H1H H;  5LA6 A;  4MTO A;  4K8Z A;  4X9Q A;  2ODM A;  1VAR A;  3RW0 A;  5CB4 B;  1DF5 A;  3W7W A;  4D7S A;  2CAZ C;  1JPX A;  1TVK A;  1AJQ A;  5KMG B;  3B26 A;  3T4D A;  5JJJ B;  2D3O W;  3ASO C;  2YE2 A;  4UVB A;  3CRL A;  4FVM A;  1QLN A;  1Y8N A;  2Q69 A;  4J9Z B;  2ZDX A;  2IJI A;  1QVG U;  3ZM7 A;  4H44 B;  3CC7 V;  4LFC B;  2YXY A;  4LF4 O;  3A2F A;  3KCX A;  5FND A;  1BE3 H;  3C11 A;  1ID0 A;  3K3W A;  3HPL C;  3JD1 A;  3K59 A;  5FNV B;  2XUM A;  1OJH A;  1UYG A;  2GDS A;  4PI2 A;  4DR1 O;  4HXW A;  1Q6I A;  3K99 A;  2E5L B;  4DW1 A;  4K0K O;  4FLZ A;  3E8H A;  3AK3 A;  2YKE A;  1Z5B A;  2BSK B;  2NNU A;  4DRX A;  1XI1 A;  5CN0 A;  3C3S A;  3EHF A;  4O4H A;  2H3O A;  3Q4H B;  3M7M X;  5DM6 V;  1MX0 A;  1D5N A;  4UCU A;  1F4N A;  1MMM A;  4CWQ A;  4BW9 A;  3OUF A;  3ABM B;  1P7B A;  4CZZ A;  2BRC A;  2DYR C;  3ABT A;  4BR6 A;  1PP9 H;  3W7S A;  3F5W C;  3CRA A;  3T4Z A;  1NH2 D;  5LMN O;  1I58 A;  1M56 C;  3VQV A;  2F23 A;  4GZR B;  3LDD A;  5KX5 B;  4R3A A;  3QG5 A;  5IYB O;  3X2Q C;  2LQT A;  4XIP A;  4W4K A;  1AM1 A;  3AK2 A;  5IJ0 B;  3CRK A;  1L0L H;  2E76 B;  1UYF A;  2K1E A;  4XIR A;  1FPO A;  5H6Q A;  2Q67 A;  3K08 A;  2Z0A A;  1JOY A;  3BAB A;  4GX0 A;  3ZCC A;  4DR6 O;  4FCR A;  4LF9 O;  4MVM A;  2YJW A;  2W6J G;  3T0H A;  5IJ9 A;  2IOR A;  3K79 A;  1COW G;  1I5B A;  2CCS A;  3Q5K A;  4PU9 A;  5JQG B;  4KL1 A;  2P67 A;  4HYP A;  3A0Z A;  3T0Z A;  3OGC C;  4NB5 A;  1AI6 A;  1A32 A;  4JV5 B;  3A0R A;  1ZL8 A;  3DXR A;  2YEV B;  4MP2 A;  4LFB B;  4CWO A;  4PDR A;  4PL9 A;  4PEL A;  4WF9 V;  5BXZ A;  1XNQ B;  2DN9 A;  2GUZ B;  2LGW A;  1H8H G;  1ZX3 A;  1VQ6 V;  2Z5U A;  2Q0A A;  1OCC C;  3LSQ A;  1Y6X A;  3B8M A;  3OGI B;  4NXN B;  4TV8 B;  3QTF A;  4YKU A;  4FLW A;  1KQS U;  2A3Q A;  4LWS A;  4JI2 O;  2WI1 A;  1N36 O;  1DTO A;  4MPE A;  4QE9 A;  2M6Y A;  2UXB B;  4YIO A;  2KQX A;  3L74 H;  4PD4 F;  5EBL C;  4DV2 B;  1K4D C;  3OD4 A;  2DQ3 A;  4O4I B;  1K34 A;  5H6R A;  2Z3Y A;  1W2B U;  1V55 B;  4PA9 A;  3E2E A;  3TZ2 A;  1BCC H;  2OCH A;  4DV3 O;  1UJW B;  4JI0 B;  2R9A A;  2EIL B;  4FFB B;  4HY1 A;  1IBK O;  4DV1 B;  3IFX A;  1I5C A;  2HVK C;  1SQB H;  4FK5 C;  4J42 A;  4D6T H;  5FPR A;  4CE3 A;  3D36 C;  5A9G A;  4JYA O;  2PTM A;  4IL6 Z;  3VOU A;  2Q6A A;  2XHR A;  1NKD A;  4YXW G;  5J9P C;  2N04 A;  2VCI A;  4CE1 A;  4MP7 A;  4PJ0 Z;  1QZR A;  1G1X B;  2WPD G;  1E1R G;  1KKD A;  3K9S A;  3OEE G;  3B8N A;  2ZBK B;  1AP5 A;  2UUA B;  2LP7 A;  2YK2 A;  4U7N A;  2CH7 A;  4EB6 A;  1WNS A;  3AG2 C;  3B77 A;  1BZK A;  3WG7 B;  2YKB A;  3STZ C;  3ZED A;  3LSS A;  1NS1 A;  1XNR B;  3K5O A;  3GIE A;  4I50 A;  4KHP B;  2CCU A;  4ASU G;  4UVC A;  3UT5 B;  2VRZ A;  2HHI A;  3WU2 Z;  1RM1 C;  3ASN C;  3G67 A;  2QKS A;  3G4S V;  1PNK A;  3G7E A;  1YJN V;  1NR1 A;  3HKE B;  1US6 A;  4EEH A;  4FM1 A;  5KUM A;  3LNM B;  5IWA O;  1X4T A;  1N32 B;  1MA1 A;  2DYS C;  5TIS Z;  4ZVI A;  2CGN A;  2YEF A;  1HNZ O;  2JKI A;  4DR4 O;  4NKG B;  1E1Q G;  2YE7 A;  5LYJ A;  4BQJ A;  4MW8 A;  4X66 B;  3ZKB A;  4DV0 B;  4NTX A;  4X1Y A;  2UXC B;  4X65 O;  2KKW A;  1HNX B;  2CTQ A;  3UO3 A;  1FFX B;  2R72 A;  1QVF U;  4B3R O;  4MS2 A;  4YJ3 B;  5BR8 O;  4P2Z A;  2X6B A;  1HNW O;  1PM9 A;  3R65 A;  2YE4 A;  3JAR B;  4JI4 O;  3CCE V;  1PV0 A;  4UB6 Z;  1Z59 A;  3R4P A;  2Q68 A;  1WJZ A;  4B08 A;  1IZ3 A;  5D7D A;  1W0K G;  1SKV A;  3NXS A;  2MW2 B;  4GLX A;  2Q4P A;  4F4L A;  3U10 A;  4EGH A;  1SS3 A;  1MSW D;  4AS9 A;  2YE9 A;  3T10 A;  2BTZ A;  2YKI A;  3BCC H;  5EK0 A;  5LP6 B;  2Q2E B;  2WAM A;  3ZBH A;  4HZ3 A;  2UXX A;  4LF4 B;  5L3J A;  5EBW C;  3N2K B;  2R70 A;  5KHG A;  2PNR A;  4EM7 A;  2ESA A;  5D7R A;  4Z1V A;  3ZHT A;  4DO2 A;  1UFI A;  2ADQ B;  1H8E G;  3D3Q A;  4DR1 B;  2RQ6 A;  3QTC A;  4MPN A;  4K0K B;  1KP3 A; 
#chains in the Genus database with same CATH homology
 1YT2 A;  1FXK C;  2YEI A;  3A0W A;  4GFN A;  1B62 A;  1K5S A;  1BMF G;  2FTK A;  1WPX A;  3F7V C;  5HFL A;  5IN9 A;  3BEH A;  1VQP V;  2JDI G;  2YK9 A;  1OCZ C;  4MSW C;  3K0D A;  3IC7 A;  3AG1 C;  3H4L A;  1ROP A;  1Q86 W;  2XX2 A;  2Y69 C;  4GX1 A;  1M9N A;  1H7S A;  3IED A;  4URM A;  2HG5 C;  2HVJ C;  4FCQ A;  2K5B A;  3OR7 C;  1BXD A;  3ABL C;  4UUJ C;  2DWE C;  3VBB A;  5CBG A;  1Q82 W;  4MVO A;  2ZXW B;  2BZ5 A;  2C2A A;  1Z5C A;  2JJ1 G;  1KEC A;  3EHG A;  5IY5 B;  3ZRW B;  5D6P A;  2X6C A;  4ASB A;  4ASG A;  5L3E A;  1ZWH A;  1PD3 A;  4L91 A;  4YKZ A;  2WLM A;  3PEH A;  1UYK A;  4XD8 A;  1AJ6 A;  4CBC A;  2GFD A;  3W7U A;  3HZ5 A;  4XKK A;  2ATK C;  1FS0 G;  2YE5 A;  3ZXO A;  1YSR A;  1R3J C;  3A0X A;  1S3J A;  4LC1 A;  2QFO A;  3OMI B;  1XL6 A;  3A0Y A;  3DTU B;  3QNE A;  3OMN B;  3SYO A;  1QLE C;  1THN A;  2QG2 A;  4P30 A;  1EA6 A;  3CPW U;  1U0Z A;  1H7U A;  1I5Y A;  2IWX A;  2XX5 A;  1EFR G;  2QF6 A;  4PA4 A;  1G8M A;  2Q8G A;  3AG3 C;  3CXC U;  3GWO A;  1ZW9 A;  4RAI A;  3VHC A;  4XBF A;  2BSM A;  1QR9 A;  2EIM C;  2FWY A;  3K04 A;  2VW5 A;  3K03 A;  2M7W A;  4P9P A;  3AEI A;  3BY6 A;  3QO8 A;  3OW6 A;  1VQ7 V;  4LP0 A;  1Y8P A;  4V25 A;  3G6E V;  1KD1 W;  4YKQ A;  2HFE C;  3ZMZ A;  4DUH A;  1GK9 A;  1JJ2 U;  2IH1 C;  2QA4 V;  3C0E A;  3TCU A;  2CG9 A;  1FXH A;  3E89 A;  1QCE A;  4LWF A;  1B3Q A;  3FB5 C;  2ZKJ A;  3Q5J A;  5L3D A;  3H01 A;  2XAF A;  3INX A;  5H9C A;  4O05 A;  4KTN A;  1YC3 A;  4O0B A;  3IGA C;  2YGE A;  2XAG A;  3EHH A;  2EIJ B;  3MNR P;  4BW5 A;  1K92 A;  1PL0 A;  1K33 A;  2YI6 A;  3HB3 B;  1OCZ B;  1OCO C;  5IDJ A;  2XJG A;  1Y4M A;  3MHS C;  2EIK C;  4MTF A;  1KZN A;  4TSF G;  4X88 A;  4WCE V;  3O6O A;  3INW A;  4AWQ A;  4WFE A;  3FT8 A;  1BHA A;  4TWK A;  4GGL A;  1AI7 A;  4P7A A;  5BZB A;  1HWY A;  2WLN A;  3F7Y C;  4YKR A;  2F43 G;  2W6I G;  1E79 G;  4HAM A;  1CPY A;  1UY9 A;  1S16 A;  1KP2 A;  4E01 A;  4XC0 A;  1SZT A;  3FT5 A;  2CH4 A;  4GEE A;  2WI6 A;  3T1K A;  1R3I C;  4MW3 A;  4G27 B;  1R6K A;  4CWS A;  1GM8 A;  4URN A;  2ZQM A;  3R4M A;  2OT5 A;  5F3K A;  3TET A;  4R50 A;  1PVG A;  1AR1 B;  3TK1 A;  1SET A;  2DW4 A;  3T2S A;  2YE3 A;  4GQT A;  3CC4 V;  2XAH A;  3B27 A;  3VAD A;  2WWW A;  2EZP A;  4WUD A;  1NH2 B;  3KG2 A;  3ZMV A;  4QIW F;  4EMV A;  1K73 W;  3GIG A;  4NH7 A;  5IYD O;  2YSU B;  2XAS A;  3JD4 A;  1TC6 A;  1L0O A;  3LUT B;  3RLQ A;  3OM3 B;  1UY7 A;  2EIN C;  1Q7Y W;  4XDL A;  2EBO A;  5CTY A;  3OWD A;  5B3S B;  2ITC C;  1K5Q A;  3SPG A;  4L87 A;  1NHH A;  3VHD A;  4RQE A;  1NR7 A;  5LGT A;  4GT1 A;  3K60 A;  4L8Z A;  1PNL A;  2WLJ A;  3ETE A;  4RQF A;  3MD0 A;  3O0I A;  3RVZ A;  1M57 B;  3K0G A;  2IWS A;  4I9W A;  4R6Z A;  3E8G A;  4PDV A;  4MVR A;  3RBZ A;  3QDD A;  4O04 A;  4FPP A;  2IOQ A;  2JEU A;  1BYQ A;  1XL4 A;  4QNH B;  1I59 A;  4FIP C;  4ASA A;  4L94 A;  1K4C C;  3OUS A;  4XDJ A;  5FNC A;  3ML0 A;  4KFG A;  3G71 V;  3CCR V;  3JD0 A;  2IU3 A;  4JAU A;  2GSM B;  2A79 B;  4P8O A;  3PJS K;  2VCJ A;  4CWT A;  4MVS A;  5CTU A;  1MOF A;  4HZ0 A;  2P90 A;  4JYC A;  5LGN A;  1N8R W;  1K9M W;  3E8B A;  3R4O A;  2QE7 G;  5B1A B;  1VQM V;  5GW7 A;  1TIL A;  2BYH A;  2GQP A;  1YHQ V;  2O1U A;  3B24 A;  3SYQ A;  3AG4 C;  2WEP A;  3ASO B;  5DN6 G;  3ETG A;  4QE7 A;  1VQ4 V;  4K4O A;  1Q81 W;  5EC2 C;  3G7B A;  2H55 A;  1VQ9 V;  2HCH A;  4PDL A;  2IH3 C;  1GMG A;  3OW2 U;  1S5H C;  2XJX A;  5CTX A;  1EI1 A;  2XJJ A;  3ZMS A;  2FXS A;  1VQL V;  4URO A;  2YEE A;  2R9R B;  1NHI A;  1JQ0 A;  4BQG A;  4O07 A;  5IDM A;  4E00 A;  4RUE A;  1ORQ C;  1NQT A;  2DYR B;  2CCT A;  1K7D A;  4GX5 A;  3I55 V;  1M56 B;  1H38 A;  3SYC A;  2W0F C;  4N21 A;  1YI2 V;  3GB7 C;  2XD6 A;  5EC1 C;  3X2Q B;  2YEH A;  1LNQ A;  3WHA A;  5L3F A;  1GO3 F;  1QY8 A;  1ARO P;  3R4N A;  1M90 W;  1ENV A;  1GKF A;  4KUM A;  2OCC C;  2BOB C;  4BAE A;  3JD3 A;  2BU8 A;  1YET A;  4H37 A;  5GGZ A;  5B1B C;  1FFT B;  3STL C;  2YE6 A;  3CD6 V;  3TZ0 A;  3TZ5 A;  5LHG A;  2X0L A;  4HY6 A;  1UYH A;  1MAB G;  1OHH G;  2IJJ A;  4HZ5 A;  4PA6 A;  5KA6 A;  4XTJ A;  1OCC B;  1QBZ A;  1UYI A;  2QG0 A;  5M4M A;  3OR6 C;  2YKJ A;  5LGU A;  1YS3 A;  4PA7 A;  1UY8 A;  4MVZ A;  2WLI B;  1AJN A;  3K97 A;  3CYO A;  1R73 A;  1YTF B;  3E83 A;  4LWG A;  2WLH A;  1F23 A;  1J95 A;  1V54 C;  1K8A W;  4H7Q A;  2H8P C;  4LP8 A;  2PI4 A;  3VHA A;  1EBO A;  1YTF D;  4JPR A;  2E0A A;  4HYO A;  3AG2 B;  1ZWI C;  4LWH A;  3CCJ V;  3U67 A;  4XIT A;  2B1I A;  3EKO A;  2HJF C;  4LWI A;  1YJ9 V;  4AWP A;  1I5A A;  1RM1 B;  3ASN B;  4U93 A;  2CGF A;  2BU2 A;  3WQ9 A;  3LNU A;  3CGZ A;  4GX2 A;  2DYS B;  4WUC A;  3FV5 A;  1JCH A;  2AHZ A;  3I56 V;  4U7O A;  4RO2 A;  2XHT A;  1Y8O A;  4FJC C;  4XKO A;  4UV9 A;  4QPJ A;  5HFM A;  2KB1 A;  2DWD C;  3FYE B;  1US7 A;  3ABM C;  2IJK A;  2XCM A;  3K98 A;  4EFT A;  2YKC A;  4JGS A;  2HG1 A;  4CWR A;  3CCM V;  2O1W A;  3OFN G;  3D2R A;  2YED A;  2UWD A;  1NHJ A;  1BL8 A;  4XKA A;  1JX9 A;  2HLD G;  4KSH A;  3NMQ A;  3SL2 A;  2BU5 A;  5B1B B;  3W7X A;  1R3L C;  1FXK B;  4MVQ A;  4LPB A;  2VWC A;  2XAB A;  1TBW A;  4HYM A;  2YEG A;  2O1V A;  1YSC A;  3HZ1 A;  3D3I A;  3JCZ A;  2WLL B;  2WLK A;  2P7T C;  1DF4 A;  3SYA A;  5M4N A;  1MU5 A;  4JQL A;  4R7C A;  1NBM G;  3AG1 B;  3ZN0 A;  1PKX A;  3A0T A;  3HYY A;  1V55 C;  5M4P A;  1B63 A;  5L3G A;  4FCP A;  2YGA A;  2Y69 B;  1YT0 A;  4KQV A;  5LHH A;  1UYL A;  2FWZ A;  2EIL C;  1NVP B;  2XDL A;  2WI3 A;  2YI7 A;  1GJV A;  1YT1 A;  1Y4S A;  4Q20 A;  4MBC A;  1YIT V;  3OMU A;  3B25 A;  3ZMT A;  3CME V;  3SJQ C;  4E02 A;  3ABL B;  4EFU A;  2XDU A;  1MG1 A;  5EBM C;  2XAQ A;  2WER A;  4GCZ A;  4XDK A;  1QYE A;  5CMU A;  4CWN A;  1Y66 A;  3ZJZ A;  1NVP D;  3CCS V;  2H8M A;  5KA5 A;  4PRX A;  3GIG B;  2B5U A;  3WG7 C;  4W7T A;  2LFR A;  5LBQ A;  4LCU C;  2IJH A;  3RLP A;  1VQN V;  2EZO A;  2ITD C;  1BGQ A;  3K9A A;  3OPD A;  5E1A C;  4LBE C;  4H81 A;  1YIJ V;  3E8F A;  3CCQ V;  5FL7 G;  1KIJ A;  1QLE B;  1S76 D;  1M1K W;  3ETD A;  4KFM A;  2ZDY A;  3AG3 B;  3T2M A;  4N23 A;  3U2D A;  4H33 A;  3D0B A;  2QM7 A;  2BU7 A;  2WI5 A;  5J71 A;  2EIM B;  1YC4 A;  1IXM A;  5L3C A;  3R92 A;  2IW5 A;  1H2G A;  1AI4 A;  4RUF A;  4NH9 A;  4JTD B;  4FMT A;  4XCL A;  3ZRX A;  2ZR3 A;  2JJ2 G;  3P30 A;  1PNM A;  4R3M A;  2ZR2 A;  4PDM A;  3OEH G;  4ZKI A;  3OAA G;  4KP4 A;  2CK3 G;  1I5X A;  4YKW A;  3SPI A;  4JAS A;  1AH8 A;  3ZXQ A;  4URL A;  2WI4 A;  5IYC O;  3LDE A;  2BT0 A;  2ZDI A;  3U2K A;  1S77 D;  1SRY A;  1W0J G;  4L90 A;  1UYC A;  3TZ4 A;  2QM8 A;  3ZN1 A;  3MHH C;  2Q8I A;  1GM9 A;  4MVU A;  3TUH A;  5LHI A;  3SPC A;  3FYI B;  4WUB A;  3ZKD A;  1OCO B;  1TC0 A;  4NH8 A;  4UVA A;  4PRV A;  5FNF A;  3TTZ A;  2QTO A;  3DGE A;  4KSG A;  2EIK B;  2WI7 A;  1YC1 A;  2YEV A;  4H85 A;  2WI2 A;  4TT3 G;  2H94 A;  5D6Q A;  5CF0 A;  1CEZ A;  1BHB A;  1UYM A;  1EZJ A;  3HHU A;  2YI0 A;  2R9I A;  4Z1M G;  1ZXN A;  3JZ3 A;  2Q8H A;  2ZXW C;  4GT8 A;  3CGY A;  5IY5 C;  4EKW A;  3ZRS A;  4V26 A;  3ABK C;  1OSF A;  2P6J A;  5BOC A;  4JTC B;  5CA3 A;  3G75 A;  1ZXM A;  3E35 A;  2JEX A;  2XOK G;  2DQ0 A;  2HR3 A;  3HEK A;  5B1N A;  1B6Q A;  4G2K A;  2WEQ A;  1VQO V;  3EHJ A;  3Q5L A;  2XX4 A;  2Q8F A;  3ZRV A;  3ZIA G;  2A9H A;  1JVM A;  4R8C A;  2XDK A;  4R1F A;  3K06 A;  1GTO A;  3FKS G;  3OMA B;  3RKZ A;  2YEB A;  1QR8 A;  2IOP A;  4YKT A;  1VQK V;  3SPH A;  1UYD A;  3ABU A;  1GKZ A;  4G28 B;  3EKR A;  1A4H A;  2EIN B;  3UKM A;  1GKX A;  1F4M A;  3OWB A;  1TID A;  5L3B A;  5C93 A;  4DXW A;  4X8A A;  4JF3 A;  3EFF K;  1VQ5 V;  1SES A;  2YEA A;  2V1D A;  2BU6 A;  3QO7 A;  4CWF A;  2X6A A;  4QPK A;  2B1G A;  3QO5 A;  4EGK A;  3CCL V;  1P4R A;  2XK2 A;  2WSS G;  5B1O A;  1S0V A;  2YJX A;  2GHY A;  4E2L A;  4XCJ A;  3O2F A;  3FB6 C;  3LPS A;  4UXN A;  2A0L A;  4BIU A;  2XND G;  3OE7 G;  4LWE A;  4UV8 A;  2EIJ C;  2X7R B;  1R6N A;  4EGI A;  4AWO A;  4WFA V;  3UM7 A;  4J9Y B;  4DZY A;  2XDS A;  1OCR C;  2XDX A;  2BRE A;  1F51 A;  3KE6 A;  4BIZ A;  2IU0 A;  2EXL A;  4YKY A;  3BM9 A;  3B28 A;  1U2O A;  2BYI A;  2JK5 C;  2XHX A;  1AI5 A;  2JIZ G;  2FYP A;  3SYP A;  4ZBM A;  1BKN A;  1Z5A A;  4L93 A;  1AH6 A;  2YE8 A;  4MT8 A;  4PA3 A;  2AHY A;  3RVY A;  1I5D A;  1THZ A;  4XE2 A;  3CP1 A;  3GIF A;  1KC8 W;  3EHB B;  4XDM A;  1CP9 A;  3LDC A;  2WLI A;  3ABK B;  2MK3 A;  3AG4 B;  2Y48 A;  1SER A;  1JM6 A;  4WFF A;  5KUK A;  4OXS A;  4WFG A;  3D36 A;  1S14 A;  1OZ0 A;  4MOT A;  4MPC A;  5CPH A;  3M99 B;  1UYE A;  1AMW A;  5CTW A;  3ZRW A;  4B7P A;  2LFS A;  2PI5 A;  3JYC A;  2IWU A;  4JYB A;  4BXI A;  4X9L A;  2YGF A;  4JAV A;  3RLR A;  4JTA B;  2OTJ V;  5CBH A;  3CCU V;  1AJP A;  3CWV A;  1NJI W;  3JD2 A;  4B6C A;  2ZDI C;  4BAY A;  1YJW V;  2EJR A;  2YEC A;  3ZMU A;  5B3S C;  2ZD9 A;  1WLE A;  1YES A;  3FB7 C;  2OCC B;  1DLB A;  3WFV A;  3R91 A;  2AKP A;  1GM7 A;  2UXN A;  1VQ8 V;  3H80 A;  2HKJ A;  4MB9 A;  1R62 A;  1K3E A;  5FWK A;  1M57 C;  4WFB V;  5M4E A;  2XAJ A;  3CC2 V;  3FB8 C;  4QJF B;  1RPR A;  3T1C A;  3CMA V;  4WFH A;  2YEJ A;  2YI5 A;  3P32 A;  1TUE B;  1YSZ A;  1YER A;  1K97 A;  2JJC A;  1S72 V;  5CBF A;  3SPJ A;  4MTG A;  1L1F A;  4I5S A;  3PEJ A;  1RPO A;  2NLJ C;  1OCR B;  3CCV V;  3HYZ A;  4YKX A;  2OTL V;  4O09 A;  3W7T A;  1FXK A;  1UY6 A;  1V54 B;  5M4K A;  3BMY A;  2BOC C;  4XIQ A;  4X89 A;  4CE2 A;  4ASF A;  1G4Y B;  1FXV A;  1TH8 A;  4HXZ A;  4I3H A;  5D7C A;  2WLL A;  4CWP A;  5M4H A;  2QEX V;  5B1A C;  1R3K C;  5BOD A;  5J6A A;  4P9O A;  1Y4U A;  5F5R A;  2V7Q G;  2HKO A;  3E86 A;  4MTX A;  4MTO A;  3RW0 A;  3W7W A;  1DF5 A;  1JPX A;  1AJQ A;  3B26 A;  3T4D A;  2D3O W;  3ASO C;  2YE2 A;  4UVB A;  3CRL A;  1QLN A;  1Y8N A;  2Q69 A;  4J9Z B;  2ZDX A;  2IJI A;  1QVG U;  3ZM7 A;  3CC7 V;  5FND A;  3C11 A;  1ID0 A;  3K3W A;  3HPL C;  3JD1 A;  1UYG A;  4HXW A;  3K99 A;  3E8H A;  2YKE A;  1Z5B A;  2NNU A;  5CN0 A;  3EHF A;  5DM6 V;  1MX0 A;  1F4N A;  4CWQ A;  3OUF A;  3ABM B;  1P7B A;  4CZZ A;  2BRC A;  2DYR C;  3ABT A;  3W7S A;  3F5W C;  3T4Z A;  1NH2 D;  1I58 A;  1M56 C;  3LDD A;  4R3A A;  3X2Q C;  5IYB O;  4XIP A;  1AM1 A;  3CRK A;  1UYF A;  2K1E A;  4XIR A;  5H6Q A;  2Q67 A;  3K08 A;  1JOY A;  4GX0 A;  3ZCC A;  4FCR A;  2YJW A;  4MVM A;  2W6J G;  3T0H A;  2IOR A;  3K79 A;  1COW G;  1I5B A;  2CCS A;  3Q5K A;  4PU9 A;  2P67 A;  4HYP A;  3A0Z A;  3T0Z A;  3OGC C;  1AI6 A;  3A0R A;  2YEV B;  4MP2 A;  4CWO A;  4PDR A;  4PL9 A;  4PEL A;  4WF9 V;  1H8H G;  1VQ6 V;  2Z5U A;  1OCC C;  3LSQ A;  3B8M A;  3QTF A;  4YKU A;  1KQS U;  2WI1 A;  1DTO A;  4MPE A;  4QE9 A;  5EBL C;  1K4D C;  2DQ3 A;  1K34 A;  5H6R A;  2Z3Y A;  1W2B U;  1V55 B;  4PA9 A;  3E2E A;  3TZ2 A;  1UJW B;  2EIL B;  4HY1 A;  1I5C A;  3IFX A;  2HVK C;  4FK5 C;  4CE3 A;  3VOU A;  2Q6A A;  2XHR A;  1NKD A;  4YXW G;  5J9P C;  2VCI A;  4CE1 A;  4MP7 A;  1QZR A;  2WPD G;  1E1R G;  1KKD A;  3OEE G;  3B8N A;  2ZBK B;  2LP7 A;  2YK2 A;  4U7N A;  3AG2 C;  3B77 A;  3WG7 B;  2YKB A;  3STZ C;  3LSS A;  3GIE A;  2CCU A;  4ASU G;  4UVC A;  1RM1 C;  3ASN C;  2QKS A;  3G4S V;  1PNK A;  3G7E A;  1YJN V;  1NR1 A;  4EEH A;  5KUM A;  3LNM B;  2DYS C;  4ZVI A;  2YEF A;  2JKI A;  1E1Q G;  2YE7 A;  4BQJ A;  4MW8 A;  3ZKB A;  1QVF U;  4MS2 A;  4P2Z A;  2X6B A;  3R65 A;  2YE4 A;  3CCE V;  1Z59 A;  3R4P A;  2Q68 A;  5D7D A;  1W0K G;  3NXS A;  4F4L A;  4EGH A;  1MSW D;  4AS9 A;  2YE9 A;  3T10 A;  2BTZ A;  2YKI A;  5EK0 A;  2Q2E B;  2WAM A;  4HZ3 A;  2UXX A;  5L3J A;  5EBW C;  2PNR A;  4EM7 A;  2ESA A;  5D7R A;  4DO2 A;  1H8E G;  4MPN A;  1KP3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...