5C93A

Histidine kinase with atp
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
239
structure length
235
Chain Sequence
VTEQQKIDNDRKQFVSNVSHELRTPLTSLRSYIEALSDGAWKDPEVAPGFLKVTQEETDRMIRMINELLSLSRMDSGTTRVDMELVNINEMFNYVLDRFDMILKKDDNPAKYYTIKREFTKRDLWVEIDTDKFTQVLDNIMNNAIKYSPDGGVVTCRLLETHNQVIISISDQGLGIPRADLGHVFDRFFRVDKAQGGTGLGLAISKEVVQMLGGRIWVDSVEGKGSTFYISLPYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Histidine kinase
publication title Conformational dynamics of the essential sensor histidine kinase WalK.
pubmed doi rcsb
source organism Lactobacillus plantarum 16
total genus 82
structure length 235
sequence length 239
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2015-06-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5c93A01
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 5c93A02
1H7UA 1Y8NA 1UYIA 3HYZA 3QDDA 2K5BA 1UY7A 2BYHA 1JOYA 3ZRWB 1Z5BA 3ZKBA 3BM9A 1I5BA 2YEBA 3FT5A 1ZXMA 3GIFA 1QYEA 4HY1A 3VHCA 2YE9A 3HHUA 3K97A 3CGYA 2BSMA 4HY6A 1AJ6A 4XE2A 4L90A 2FXSA 2XJJA 1YC3A 3C0EA 4XIRA 4MP2A 4BXIA 1BKNA 3OWBA 2YJXA 1YESA 1ZWHA 4YKTA 1UY8A 3HEKA 4EFTA 1Y8PA 2WI3A 4BQGA 4DZYA 2Q2EB 1Y4SA 1TC0A 3TZ5A 2CH4A 4EM7A 4GFNA 3VHDA 2Q8HA 3CRLA 2VCIA 1YSZA 5CF0A 2BU7A 4MOTA 1MU5A 3T0ZA 4NH9A 2YE2A 2H55A 2QG0A 2YE8A 3A0TA 2XJXA 2GQPA 2BU6A 2Q8FA 2XX4A 4LPBA 1JM6A 3O0IA 1AH6A 3D2RA 1YT0A 4GEEA 4O09A 5FNFA 2YEEA 3SL2A 1QZRA 3EHGA 4BIZA 5M4NA 1U0ZA 4FCQA 2FWZA 4GT1A 3K99A 3TUHA 4BIUA 4MPNA 2QM8A 4H85A 1S14A 4FCPA 1UY6A 4MPCA 4WUDA 1BGQA 4MTXA 5J71A 2ZBKB 4XIQA 2YE6A 5IN9A 2WWWA 1UYMA 3MNRP 1TC6A 2WI6A 4CWNA 4HZ0A 3OW6A 5F5RA 4CWQA 4MPEA 3IEDA 4HXWA 4XCLA 4JAUA 3P32A 1S16A 2YEDA 3EHJA 4UROA 4KSGA 2ZDYA 3ZKDA 3RKZA 3PEHA 2XDXA 3WQ9A 4O04A 1GJVA 1H7SA 4WUBA 2YKBA 2P67A 5IDMA 3KE6A 4X9LA 2FYPA 1B3QA 4O05A 5B1OA 4LWGA 2XD6A 1US7A 2CGFA 5GGZA 2Q8GA 4XCJA 1YERA 3EHFA 1MX0A 3A0ZA 3ZCCA 4U7NA 4ASGA 2XX2A 3ZXOA 1UYLA 5BOCA 3MD0A 1KZNA 3ZM7A 2YKCA 2JKIA 2QF6A 4LWHA 2XJGA 2HG1A 4H81A 1I5CA 3O2FA 3HYYA 3T1KA 3B28A 3O6OA 5M4MA 4AWOA 2YK9A 4R1FA 3ZXQA 5M4PA 3RLPA 1NHJA 2ESAA 4KQVA 4ASBA 1EI1A 2YEHA 2LFRA 4CE3A 3GIGB 4CWSA 4XKAA 1I5DA 2XCMA 3R92A 1QY8A 2WI4A 5D6PA 3U67A 4KSHA 5L3JA 2QG2A 1U2OA 1I5AA 1TH8A 4CWTA 1PVGA 2YEJA 2PNRA 3G75A 4L91A 5BODA 4JYBA 1OSFA 2BZ5A 5FWKA 3EKOA 1UYDA 5D7RA 4HZ5A 5J6AA 3ZRXA 2C2AA 4WUCA 2WEQA 4AWQA 2HCHA 2YGEA 2BRCA 1YSRA 4KP4A 4YKXA 4U93A 3OPDA 1AMWA 2XX5A 3NXSA 3ZRWA 3T2SA 1ZW9A 2Q8IA 4PU9A 3QTFA 2YEAA 4PL9A 1Y4UA 4V26A 1Z5AA 3LPSA 3RLQA 2GFDA 4BQJA 2IWUA 4I3HA 2O1UA 2IWXA 4ZVIA 5CTUA 3PEJA 4GT8A 2EXLA 2YE4A 2O1VA 1BYQA 3FT8A 4PRXA 4B6CA 4JYCA 1UY9A 3A0YA 2YI7A 2QM7A 4NH7A 2VCJA 4L94A 5CTYA 1I58A 2YE3A 4E00A 2IORA 5FNCA 1YC4A 2LFSA 2YKIA 3OMUA 4XDMA 2WERA 1UYKA 4FPPA 4P8OA 1TBWA 3B25A 4LWFA 2VWCA 4GQTA 1EA6A 4EGKA 2E0AA 3A0XA 2HKJA 2WI1A 2CCUA 3INWA 4K4OA 2ZDXA 3K98A 2BT0A 5CPHA 4EGHA 5M4KA 3HZ1A 5M4EA 3RLRA 2BTZA 4XITA 3CWVA 4FMTA 5D7DA 4O07A 2YEGA 2BREA 2YE5A 2YEFA 1Y8OA 4HXZA 4EGIA 2H8MA 2YI6A 4V25A 4AS9A 3R4OA 4LP0A 2BU8A 4JQLA 3WHAA 4BAEA 1R62A 4YKUA 2XABA 2ZKJA 1YETA 2XK2A 3LNUA 3CRKA 1GKXA 4XIPA 4JAVA 4YKQA 4GCZA 1UYEA 4L8ZA 4YKZA 1NHHA 4MT8A 4P7AA 4B7PA 4XD8A 4EMVA 4MB9A 1AH8A 4CWOA 3OWDA 4CWRA 1Z59A 4AWPA 5D6QA 3JZ3A 2XHRA 3R4MA 4LC1A 3K60A 3EKRA 4XKOA 4URNA 3R4PA 4LWEA 4U7OA 1UYFA 3TZ0A 3ZRVA 4YKWA 1TIDA 4E01A 4ZKIA 3T10A 2JJCA 2FTKA 1KIJA 4O0BA 2YI5A 1ID0A 4URLA 4R3MA 1YS3A 2YEIA 2YJWA 2CCSA 4E02A 4H7QA 1YT2A 2XDKA 2YE7A 5D7CA 3T0HA 3DGEA 4QPKA 4DUHA 1ZXNA 2XDSA 2WI5A 2YECA 4HYMA 3Q5JA 4R3AA 3GIEA 3INXA 3CGZA 2IWSA 4MP7A 2WI2A 1YT1A 5B1NA 3C11A 4ASFA 4NH8A 4XC0A 5CTWA 2IOPA 4L93A 3GIGA 4KTNA 2FWYA 1UYHA 2YGAA 3B24A 3R91A 4EFUA 4MBCA 3TTZA 3A0RA 5M4HA 4I5SA 4JASA 3G7BA 3FV5A 2YGFA 4PRVA 2BYIA 5CTXA 1A4HA 5FNDA 4CWFA 2BU2A 1GKZA 4YKRA 2QFOA 1I59A 3A0WA 3U2DA 1Z5CA 2CCTA 3U2KA 2CG9A 2VW5A 5C93A 3VHAA 1AM1A 4Q20A 4LWIA 4HYPA 1F51A 3H4LA 1B62A 4XKKA 3B26A 1TILA 4XTJA 3B27A 4CE2A 2AKPA 3Q5LA 1UYGA 3Q5KA 2WEPA 3R4NA 3VADA 4CWPA 4URMA 3HZ5A 2XHTA 2YK2A 2YKJA 4FCRA 4YKYA 4CE1A 1IXMA 2UWDA 2O1WA 4EEHA 4ASAA 5IDJA 2XHXA 3EHHA 3D36A 2YI0A 4GGLA 1UYCA 2XDLA 1BXDA 4W7TA 3TZ2A 2WI7A 5F3KA 3BMYA 4KFGA 1YC1A 2YKEA 3H80A 3G7EA 1NHIA 2IOQA 3D0BA 3TZ4A 3NMQA 1THNA 2BU5A 2XDUA 1B63A 4QPJA 1L0OA 3TK1A
chains in the Genus database with same CATH superfamily
3HYZA 1UYIA 1XBLA 2JGDA 2ZIMA 2ZE7A 3CCSV 3FAVB 2BYHA 5EK0A 1JOYA 1RPRA 4DR5B 2B1IA 1BHBA 3ZKBA 3BM9A 2YEBA 2LGQA 1ZXMA 3CRMA 3FT5A 5D5QA 1P7GA 4HY1A 4ICGA 2KKWA 1OCRC 4EFBA 4K35A 2YE9A 3CGYA 1SQPH 3ABLC 3ZMUA 1AJ6A 3E8FA 4FFBB 4IYHA 1IBKO 2UXDB 4NKGB 4WFFA 5CB4A 2LQTA 5JENA 4JV5O 2YIBD 2JK5C 4HNAA 5BMVA 4J10A 4FM1A 4FM2A 4XIRA 1XI1A 5KLVH 1UJWB 4BXIA 5IY5C 2DYRC 2RQ6A 3HKBA 4H0LB 2WI3A 4BQGA 4DZYA 1XMOB 2ZKOA 4GLXA 1VQ9V 2Q2EB 2Q0OC 2ZXWB 4LF6B 4BIOA 1P84F 3E35A 3CRLA 1F4NA 3CC7V 3WG7B 2BU7A 4ZBMA 4IL6Z 5ITZA 4MOTA 2YE2A 2H55A 2YE8A 3UQ8A 3RVZA 2XJXA 2GQPA 1HNXB 2BU6A 1JM6A 3NR7A 4O09A 5FNFA 3W7UA 4DRXA 2HHHB 2XAFA 3SL2A 3FYEB 4FLWA 2AHYA 3L74H 1R3IC 2IBZH 1GTOA 2FWZA 3ZN0A 4GT1A 4BIUA 1NH2D 4MPNA 4H85A 2H94A 2Z0AA 1IX9A 1UY6A 1AR5A 1OJHA 4XIQA 2Q6AA 4AQYB 3RYFA 1K97A 1YJNV 1N32O 4NVPA 1TC6A 2UU9B 4LFAO 4JI2B 4HZ0A 2AXTZ 3OW6A 1GO3F 1JMKC 5L3GA 1R3KC 4LF5B 1P49A 4F6EA 2HR3A 1S5HC 4JGSA 4PJ0Z 4J9YB 3K57A 5EZYB 2QKCA 1I7FA 2XDXA 1QQCA 4WUBA 2YICA 1N8RW 2P67A 1YZBA 1JR9A 3W7WA 1HDJA 3STLC 4WFEA 1XL6A 3AG4B 4X9LA 4O05A 2DWEC 1TVKB 4FK5C 5B1OA 1Z2GA 4B3MB 5H6RA 3TXQA 4LWGA 4O4IA 3SDLA 2Q8GA 4YJ3A 2D3OW 4RUEA 2QWPB 1YERA 1MX0A 4FZ0A 5IY5B 2OIGA 2DYRB 1K8AW 4U7NA 4JI3O 4FLYA 4DV7B 2X7RB 2WLMA 5IJ9B 3ZXOA 4WBNB 4O2BB 1AVMA 2R72A 4LF4O 1FJGB 4J7KA 5BOCA 1B04A 3ABUA 3KG2A 2AGAA 3OTFA 2YKCA 3P30A 4H81A 3WFVA 3B8MA 3C3SA 4UCSA 3AG1B 2EZOA 3B28A 1N0NA 1TA8A 5EBMC 5LMUO 3UO2A 1M56C 2DWDC 1LUVA 5M4MA 2WLIB 4BWAA 5EC1C 2EZPA 2Q67A 4H44B 3CCQV 2A7WA 2XOKG 1NHJA 1MOFA 1WNSA 5H6QA 2UUBO 5KHGA 2YEHA 4UV8A 3RFRA 1XUQA 2LFRA 4CE3A 3GIGB 3ZHQA 2GTSA 2YEVB 4XKAA 4PA4A 1NZ6A 3K04A 3K0GA 3R92A 5EC2C 4F6RA 5BZBA 2E74B 5KUMA 3SYPA 1TH8A 2YI8A 1SZTA 1PVGA 2PNRA 1GM7A 2Z5UA 2OCHA 1K7DA 5D7RA 1J95A 1XMQB 4UB8Z 4WUCA 4AWQA 2X6CA 1KBHA 1YSRA 4KP4A 1CPYA 3SYAA 4YKXA 5BY1A 2P5OA 2L6LA 5LGUA 1H38A 3FAVA 4DR4B 4MVRA 2XX5A 5LGTA 2Q8IA 1ZX3A 3DC5A 4BAYA 2X6AA 4OXSA 1XHXA 3P3PA 1V55B 3LPSA 3LSSA 4V26A 1FFTB 4FFBA 4J11A 4LBEC 1YTFD 2IWUA 5FPOA 1SQVH 5AG2A 2IWXA 2N74A 4GT8A 2EXLA 4I4TB 1XDCA 3VQWA 2ZDIA 2OCCB 2XASA 2Q7HA 2QDOA 4B6CA 4JYCA 5H2FZ 5TISZ 3SPJA 3ZHUA 2YI7A 2QM7A 2VCJA 3CWBH 4L94A 5CTYA 3ZEDA 1QU7A 1BSMA 5B3SB 5JJJB 5FNCA 1YC4A 4XDMA 3ABKC 3OMUA 2WERA 3ETGA 2GBOA 2Y4UA 2ILMA 4DR3B 3CCVV 5LMNO 1FXKC 1PNLA 3A0XA 1QLEC 2WI1A 2YUAA 4C7UA 2ZDXA 2BT0A 1COWG 4JI6B 4EGHA 5M4KA 1YCIA 4IIJB 1I94B 5M4EA 1ZLZA 2BTZA 5D7DA 3CWVA 5EBWC 1I5XA 2RDCA 1Y76B 3OMIB 1HNWB 4E4EA 2YEFA 4EB6B 2H8MA 1GM9A 3K58A 4X20B 4V25A 4AS9A 1IBMO 3R4OA 2YDEA 1K9MW 5A9GA 5E79Z 3OMNB 3AK2A 4JI0O 3OTOO 4J42A 4BAEA 1TGOA 2PGGA 1S3JA 2HVJC 1GRJA 1QVFU 2DMXA 5FNVB 3AG2C 4X65B 5EIBD 2QE7G 5BR8B 4L8ZA 4P7AA 1SQXH 2ZQMA 1VF6C 1AH8A 5B1AC 3OWDA 1S0VA 3ZIAG 5KHHA 1K4CC 2YC0A 1KUQA 1OCZB 1N36B 2Z3YA 2EIMB 5EZYA 3GB7C 3D3IA 1AP5A 5LXTB 2JRIA 5LBQA 4LWEA 4U7OA 1IBKB 2F43G 3JCZA 3ZRVA 1JFFB 1ROPA 4O4HB 1TVKA 4CC6A 5LOVB 4E01A 2HKOA 1RSOB 3ZX6A 2IU3A 2D2CB 2WLKA 4DV5B 2CE4A 3UO3A 4O0BA 4DK0A 3RGBA 1VQ6V 2YJWA 1KYOF 5IJ9A 1YHQV 4WBNA 4O2BA 1ZL8B 2XAGA 1WP7A 1Y6XA 4HZ3A 4PHZA 2XDKA 5D7CA 1BT8A 3ZMSA 4JI5O 4PD4F 2WI5A 1RFYA 4DR1B 2YECA 1SF9A 5IJ0B 4R3AA 3EVKA 1HWYA 4FJCC 4MP7A 2WLIA 3ZN1A 2VQFB 2YS8A 1K33A 1VQ7V 4ASFA 4K0KO 1K5SA 1DF4A 1LUWA 4RQEA 4E72A 5JJEB 2LGWA 4L93A 3GIGA 1YIJV 4ZOLB 2FWYA 1UYHA 2YEVA 4KHPB 3B24A 4MBCA 4DUZO 3TTZA 4I7ZB 1V54C 2QSAA 3K9SA 1M1KW 3TJTA 3JD3A 4I5SA 1MZEA 2F1MA 4JASA 3G7BA 2CTRA 3BEHA 5CTXA 4J9ZB 3OMAB 2AW9A 4B7KA 4YKRA 2QFOA 1I59A 1Y4MA 3ZMTA 3U2DA 1URFA 3EHBB 1HW7A 3W7TA 3ZHVA 2CCTA 1NI8A 4MS2A 3VHAA 1AM1A 4DV0O 1XILA 4P9OA 4XKKA 3A8TA 1W0KG 2Y69B 5GONB 2YXYA 3B40A 3H1HH 5B66Z 2C1IA 1UYGA 3Q5KA 2WEPA 5HFMA 3OM3B 4YHHO 1Q8IA 1W2BU 2KSDA 2XT9A 2XHTA 1OCCC 2EIKB 2O1WA 3EHHA 4XDKA 1GN6A 2BCCH 2IJJA 1VP7A 2CDYA 4X66O 3HB3B 4I4TA 4ZHQB 1T5EA 1JX9A 3M7MX 1JQ0A 3EXAA 3VBBA 3G7EA 4GZRB 1VF7A 1VQ5V 1NHIA 3G4SV 1OHHG 3BAAA 3CE2A 2XDUA 2DYSB 1IBLB 4QPJA 3CMEV 3B09A 4O2AB 1MMMA 4LF9B 3E22B 1Y8NA 2F4VB 2CK3G 5KAFZ 4TWKA 3STZC 4Q6GA 4IIJA 2Q69A 3L9DA 3CCRV 3J81N 5KHKA 4LF8B 1Y76A 1JA8A 4EB6A 3HHUA 3K97A 5IYDO 2BSMA 4HY6A 1VQMV 4X20A 3VOUA 1HNZO 4XE2A 1G6UA 1RM1B 4L90A 3VQXA 1PL4A 4ABMA 3JALB 2ZM6B 4MSWC 1WB7A 2FXSA 3ETQA 3JD1A 3C0EA 3FB8C 1XL4A 3VQVA 1HR0B 4LH6A 3T2MA 4FLUA 5FNVA 3OWBA 4YKTA 1UY8A 4EFTA 4QIWF 2A9HA 4LF7B 3TZ5A 4LFBO 3K59A 2Q8HA 4X64O 4GKJO 2CH7B 2VCIA 4OX9O 2B5UA 1MU5A 1SRYA 2ARHA 5LXTA 2Q8FA 1B6QA 3D2RA 1PKXA 1BE3H 1ORQC 2DQ3A 4HBNA 1JFFA 2IH1C 4O4HA 4BIZA 1WLEA 5LOVA 1WJZA 1RSOA 2GSMB 1BL8A 4FCQA 1S77D 3FB7C 2EJRA 1JCHA 1Y66A 2PZSA 4B3SO 4FCPA 2E5LB 4WUDA 4MPCA 4OPHA 2UXBO 4YIOA 1BGQA 4TQDA 1N0JA 3IJ4A 1ZL8A 1NT2B 2ZDIC 4CBCA 2FYUH 3BABA 3MNRP 2HJFC 1VEWA 4L87A 3I5DA 4ZIBA 4DR6O 4MPEA 5GW7A 4LFCB 4JAUA 2ZXWC 3P32A 2CGNA 5IJ0A 5CBGA 2CAZC 4UROA 3WG7C 2OTJV 1WPBA 5H9CA 2NNUA 3PEHA 2AZ2A 1EM1A 4DR7B 2YKBA 1CXZB 1MG1A 5FPRA 4JTDB 2RNBA 5JJNB 3L71H 5IDMA 3KE6A 1FAFA 2FYPA 1B3QA 4ZOLA 4NYKA 1NVPB 3G80A 4UCUA 4JI7O 4K8XA 1FKAO 3LDEA 3EHFA 3RT3C 3A0ZA 3K06A 4PA6A 5BXZA 3ZCCA 1QR9A 1H2NA 4WCEV 4X88A 4YXWG 2EULA 4MVZA 1R6NA 1E1RG 2Q0AA 1UYLA 3FD9A 1SETA 1L8DA 2JS3A 2A3QA 5IYBO 3ZM7A 2XJGA 1NTMH 3K79A 1KU9A 1I5CA 4KXRA 2WLJA 3O2FA 5KA5A 3L72H 4DV6O 1AROP 2ETNA 4HYOA 5GONA 2LW1A 5HFLA 4FLZA 1JJOA 2E3CA 4B08A 3ASOB 3ZXQA 4JI4B 5M4PA 1IXBA 3RLPA 1O9GA 1N33O 4KQVA 2K9PA 2QWOB 3AG4C 3ASNB 2P4KA 4CWSA 2Q7GA 1PP9H 4R7CA 1I5DA 4FZ1A 4UVBA 4QGPA 3CRCA 1IDSA 3N2GB 1QY8A 2QJ1A 3U67A 4ZHQA 4JYAO 4UVAA 4CC5A 2XAJA 1LR1A 4CZZA 1ZAUA 3THOA 4X62B 4CWTA 4L8JA 3G75A 4L91A 5BODA 2F95B 4DUYB 1OSFA 2ZR2A 4YY3O 2IM9A 3CJHB 4WFHA 4D7TA 1SQBH 4O2AA 1SS3A 3E22A 5L3DA 2HCHA 3AG1C 2R9AA 3ABTA 3B77A 1RPOA 3ZJZA 3OPDA 3T1HO 3NXSA 1N34O 2CTPA 2FKXA 3AK1A 3QTFA 3RYIB 1K92A 3E86A 1D5NA 4YJ2B 1Z5AA 3J80N 3RLQA 2YIAA 1Z5VA 3H1IH 3QNEA 1GN3A 5KA6A 5IWAB 3JALA 4B7EA 4I3HA 4ZVIA 1YXBA 1YF2A 4DV4O 1XEQA 2RJZA 2O1VA 1S76D 3CRAA 3JAKB 4X1IB 5DECA 1KKDA 1Q3EA 5GTHZ 5DM6V 4NH7A 4JI8B 4NXMB 4N23A 4E00A 1R3JC 3PJSK 2CH7A 2VWCA 3WB2A 1EA6A 4GQTA 1MSDA 4YHHB 3QO8A 5JVDB 3UCSC 2HLDG 1QCEA 2HKJA 2BSKB 2CCUA 3INWA 1KP2A 3F5TA 3K98A 1BGYH 4GKKB 3HZ1A 1R1BA 3BFRA 4LR3A 1TUBB 4XITA 4FMTA 4IGGA 3CC2V 3CHXA 2YEGA 2BREA 1V55C 4UCTA 2M6YA 2QM4A 1M93A 3B2EE 2YI6A 1L1FA 4LP0A 4QJFB 3WHAA 1PV0A 4LP8A 4NTXA 1FYJA 1R62A 5KHIA 5IT9N 2XABA 1J5EB 2HJDA 2OCCC 1EFRG 4DV3O 1Q5OA 2XK2A 3ETEA 4XIPA 4TV8B 4GCZA 1UYEA 5B3SC 3CRRA 1GMGA 4EMVA 4BR6A 2R9IA 4CWOA 1OV9A 4JI1B 1Z59A 3SJBC 4AWPA 1E1QG 2ZR3A 3R4MA 1M90W 2R70A 1EZVH 5CBHA 4URNA 1QNMA 2Q73A 3TZ0A 3ZMZA 3JAMN 3DXRB 1AI5A 4H37A 4ZKIA 1Q43A 2QR4A 2XUMA 3H9VA 4DR2O 4URLA 2YI5A 1ID0A 2DOSA 4N21A 1YS3A 2HFEC 3Q4HB 4H7QA 2EIJB 1XNRO 3FB5C 3FB6C 2YXHA 1S5JA 1F4MA 1GH6A 2IW5A 1ZXNA 2XDSA 5IYCO 4DV2O 1VQ4V 4O4LB 1XNQB 1OCZC 2IWSA 2UXCB 2EIMC 3APOA 2ZE6A 3SJAC 4DV1B 3C11A 2VQEO 3OGCC 3BPZA 3T1YB 4NH8A 3ZHRA 1FS0G 2N04A 4RO2A 1IURA 2W0XA 1AJNA 2FMLA 2IOPA 4UV9A 1ZUQA 2ZIOA 4EFUA 5LL6Y 1V9PA 1AI6A 2PUSA 3N2GA 3AEIA 3UM7A 1Q82W 4JZ2A 3CYOA 2LW7A 4MTOA 2BYIA 5FNDA 1A4HA 1SA0B 3C90A 1VQPV 3A0WA 2YXLA 1G8MA 3PN1A 1Q81W 3CJHA 4NXNO 1Z5CA 2VW5A 3N2KA 1K34A 4Q20A 3BA8A 4LWIA 4JPRA 2EINB 4P9PA 1TILA 5K1XA 3MAQA 4B3TO 4R50A 3Q5LA 2UUAB 4FFKA 3R4NA 3RYIA 4CWPA 3B4SA 4YJ2A 2YK2A 4FCRA 4YKYA 1KKCA 1XQ8A 1X4TA 1IXMA 2P06A 1PPJH 2Y0IA 3AG3B 5IDJA 4ASAA 3F7VC 3CCMV 3D36A 4GGLA 2F23A 2ZCEA 3ICXA 1UYCA 1NR7A 4I55B 3JAKA 1FXHA 4X1IA 1EN5A 2QKSA 3S3XA 3HKDB 3FFQA 3LSQA 2BTOA 2VS0A 2DJVA 3ZMVA 2V1DA 3D0BA 2ZNIA 2UUCO 1SQQH 3QF7A 3HR0A 5KHJA 3NMQA 1THNA 2EBOA 2QKAA 1B63A 3N27A 5JVDA 3TK1A 4HZ5A 4NTYA 1H7UA 4LNUB 3QDDA 2R9RB 2BSKA 2X0LA 1H2LA 5LHHA 2K5BA 1UY7A 2Y69C 4JV5B 1NBMG 1ENVA 2IJIA 3ZRWB 1TUBA 1Z5BA 4WFGA 3GIFA 3A0BZ 2ADQB 2EIKC 1WA8B 4B3RO 1ZTEA 1R6TA 3E8GA 3WU2Z 2XTAA 3M8AA 4QE9A 1HP8A 2IJHA 2QTOA 2XJJA 2Y4TA 1H8HG 1UFIA 4CH6A 1OZ0A 5F2VO 1BKNA 3GVMA 3SGIA 4TV8A 1ZWHA 1KMIZ 2L35A 3HEKA 1PD3A 4G2KA 3FKSG 2P4VA 1Y4SA 2CH4A 2DYSC 4EM7A 1PM9A 1NVPD 4GFNA 2UXDO 1YSZA 3T0ZA 2P22C 4NH9A 4LPBA 3O0IA 1YT0A 4PDVA 5JWPA 3K08A 3ZRSA 3OEHG 1XMOO 5CN0A 1QZRA 1ZWIC 1N32B 3DXRA 3EHGA 1U96A 1U0ZA 5M4NA 4LFAB 2XHBA 2NLJC 3SYCA 3TUHA 4I9QA 1RM1C 4MVMA 1S14A 2QTSA 2JJ1G 1HNXO 2HEPA 3BVOA 4TSFG 3SJCC 5J71A 2HHHO 2YE6A 5IN9A 4XDLA 3Q4HA 2A06H 1UYMA 1QVGU 3CX5F 3ZS8C 2WI6A 1S5LZ 4CWNA 5F5RA 2XAQA 1PNKA 3IEDA 4HXWA 1EZJA 4EFEA 2YEDA 4O4LA 3EHJA 1THZA 4KL1A 2ZDYA 2V4DA 3ZKDA 1BHAA 4AQYO 3RKZA 4G27B 4O04A 5EIBC 3AK3A 1H7SA 4JI3B 2UU9O 4JI2O 3ZHSA 2C1GA 5CA3A 4LF4B 3UKMA 3VQYA 3JYCA 4FM0A 3E89A 3K9AA 5J2UB 1I0HA 3I55V 3IGAC 4EKWA 2CGFA 5GGZA 4KFMA 5LMUB 1Q6HA 4ASGA 1SA0A 3O9OA 5J2TB 5CA1B 3MD0A 4JTAB 4FLXA 4B3MO 3SPGA 2JKIA 2QF6A 2HG1A 2UUBB 3OD4A 3BHPA 2ZNJA 3HYYA 3T1KA 4MVQA 1GN2A 1GAXA 4I50B 4DV7O 5D5PA 2UXXA 4X9QA 5FLXN 4AWOA 3KKYA 1YVWA 1FJGO 4R1FA 1OCOB 2JVDA 4Z1MG 4DR2B 2ESAA 3X2QB 5CA0B 2N05A 4I55A 2WI4A 2W6IG 4YIPA 1GM8A 5D6PA 5L3JA 1AB3A 2QG2A 3WB0A 3HKDA 1Q7YW 3RYHB 3UT5B 1G1XB 3ZRXA 2C2AA 4LNUA 2YGEA 2DQ0A 4CS3A 2WPDG 2QEXV 1YJ9V 1AMWA 1R3LC 1VIBA 3DTUB 2VWKA 3ZRWA 1ZW9A 3ASOC 4Z2WA 4XDJA 3E8BA 4RQFA 3K5NA 4KUMA 2JIZG 2YEAA 4U3FH 4PL9A 1WA8A 3ASNC 1VARA 1XMQO 3SPCA 1NTKH 3JARB 2GFDA 1Y74B 4PI0A 4TV9B 2KB1A 5LP6B 3W7XA 4WF9V 4CH3A 1M57B 4W4KA 4DR4O 3PEJA 1KB9F 3BRCA 3JCUZ 5LMNB 2YE4A 5B1BB 1QBZA 4ASUG 1BQZA 1DTOA 2YE3A 2AHZA 2LFSA 2YKIA 1F23A 1UYKA 4FPPA 4X89A 3BY6A 1BZKA 3CXHF 1VMGA 1IBMB 5LA6B 2IH3C 3OTOB 4JI0B 4LWSB 1AR1B 1RP3B 3RLRA 2O57A 2EJ7A 4O07A 4I0XB 3OR7C 2YE5A 2OIEA 1Y8OA 4DR3O 1ZSPA 4J7JA 3D36C 2F66C 4GX5A 2BU8A 3CB2A 2UUCB 1I94O 4YKUA 3ZHTA 2HHIA 4P30A 3FX7A 2KQXA 4CS4A 3CRKA 2OT5A 4NTWA 1NS1A 3HKCB 5E1AC 1HNWO 4JAVA 4YKQA 1NHHA 4B7PA 4XD8A 4DK1A 2LO1A 4MB9A 3BCCH 4DW0A 4Z1VA 3D8CA 5K1PA 1N4CA 1W0JG 4FVMA 2G38A 3H01A 1VQNV 1DLBA 2ZE8A 3IC9A 3EKRA 4TUYB 4MW8A 4X65O 5BR8O 3R4PA 3CCEV 3A2FA 1UYFA 1H2GA 2DE0X 5J2UA 2MW2B 1TIDA 1TAEA 3LDCA 3I56V 3OUFA 3T10A 1N36O 2NN4A 4JI5B 2FTKA 1SERA 1KC8W 1LNQA 1EBOA 2ZD9A 3TCUA 2Q4PA 4D6TH 5J2TA 3A0HZ 2CCSA 4QNHB 5CA1A 3LDDA 4K0KB 3N2KB 1Q86W 1E79G 2MK3A 4H33A 2YE7A 3R66A 4K3AA 3DGEA 3T0HA 4DV5O 2X6BA 4DUHA 2GUZB 3K3WA 2QWQB 4DUZB 4I50A 5LHIA 2WI2A 2PYJA 1YT1A 2E75B 5B1NA 2A0LA 4GX0A 3RYCB 1YEWA 4XC0A 2P7TC 4FIPC 1IVSA 4D7SA 4LCUC 4UCRA 2YI9A 4X1KB 4O4JB 2ITCC 5CA0A 4DR1O 1Q6UA 1D5AA 2RCVA 3R91A 2OWOA 1FFXB 3A0RA 4IHJB 4DV0B 3MHSC 3ETDA 2VQFO 5M4HA 2XNDG 2EX3A 1AILA 1SC5B 3OR6C 2IJKA 3LUTB 3MHHC 4A5UB 2YGFA 2KG7B 2BU2A 3GWOA 2GHYA 4BW5A 2EIJC 4R8CA 2EILB 1Q6IA 3RYHA 1YI2V 4KHPO 3UT5A 3DC6A 1NTZH 4P2ZA 2GV9A 3KCXA 3CMAV 4TQFA 3ABMB 4CH4A 1DGSA 1B62A 5JQGB 3B27A 1Y67A 4X66B 4J80A 2PTMA 5KUKA 2B9ZA 1AI7A 5JH7B 3B8NA 4URMA 3HZ5A 2YKJA 1CEZA 1OCRB 3JARA 1Y74A 2UWDA 3ABLB 4TV9A 2Y48A 3H1JH 1KD1W 2XHXA 5LP6A 2YI0A 3T4DA 1SQGA 5LYJB 3OT7A 4W7TA 3TZ2A 3FYIB 4KFGA 1YC1A 2JS5A 5KAIZ 1BCCH 3JASB 3H80A 1WP8A 2WLLB 1K3EA 2Q68A 1GK9A 3TZ4A 3LNNA 4UVCA 2BU5A 1K5QA 5LHGA 1NJIW 1L0OA 2EINC 1WB8A 3TXSA 1HNZB 3SPIA 2V7QG 2WSSG 4PELA 5LA6A 4LWSA 4WFAV 1AR4A 2ATKC 3K5LA 1I5BA 4UB6Z 5L3CA 4I0XA 3LNMB 1XHZA 2DW4A 1QYEA 3TGUH 1IBLO 3VHCA 3JD2A 1XREA 3JAWA 4LF9O 3K5MA 3AG3C 3ZBHA 3CYGA 2E76B 1R73A 2F4VO 4LFBB 4TOIA 1WAZA 4X64B 4GKJB 1JVMA 3CCJV 1P4RA 2BTQB 4OX9B 1YC3A 4LF8O 4MP2A 4TT3G 2YJXA 3HKCA 5DEDA 1YESA 3S5TA 2YSUB 3D3QA 4DO2A 1YJWV 4I9WA 1Y8PA 3OEEG 3OAAG 4NB5A 4RUFA 1TC0A 3J7AU 3VHDA 1PL0A 2ZM6O 5CF0A 4QE7A 2ITDC 2QG0A 3A0TA 4B3SB 2JEUA 1HR0O 2QWNB 4TUYA 2UXBB 2XX4A 1AH6A 1K4DC 4GEEA 2YEEA 4FLTA 3DSQA 4LF7O 5IE9A 2Q8VA 4DR6B 4PA3A 4GX2A 3SYQA 1NKDA 3K99A 3KCYA 5CBFA 1YDXA 2QM8A 1W59A 5B5EZ 5EYPB 2VWJA 4MTXA 4CS2A 2ZBKB 5J9PC 1DF5A 4MVSA 2Q5ZA 2WWWA 4G28B 4PV1B 1FD9A 2A79B 4CH5A 2H8PC 4J41A 4CWQA 5FL7G 4XCLA 5KMGB 2GUZA 3APQA 1S16A 3E83A 3SPHA 4E2LA 2E5LO 4W4LA 4KSGA 1PNMA 1M56B 3L70H 4JI7B 1R6KA 1US6A 1MABG 1AJPA 1O9HA 1BS3A 3WQ9A 3RYCA 1GJVA 1IZ3A 5JCOA 1H2KA 1VQOV 2Q7EA 4X1KA 1S72V 4O4JA 4LFCO 1XOUA 3CCUV 3G71V 2ADPA 3U11A 3BA9A 4GUNA 4X1YB 1FFXA 4PDLA 2XD6A 4IHJA 1US7A 5DN6G 4XCJA 1Z5WA 4DV6B 4U3JB 4DR7O 1QHTA 2KG7A 2XAHA 2XX2A 4PDMA 3AG7A 1MZFA 3P3NA 2W6JG 3JATB 1KZNA 1N33B 4LWHA 1D2DA 3OW2U 1P7BA 3F7YC 4AI8A 3CS5A 3LSUA 1JPXA 1NH2B 5JQGA 4PA9A 3O6OA 3CEIA 2BOBC 2DN9A 2YK9A 4DXWA 4JYAB 5IYZB 5JH7A 2Y0PA 3JSLA 1GKFA 4ASBA 1EI1A 4MW3A 3OUSA 3QO7A 3HKEB 4MTFA 3RWRD 4YY3B 3T4ZA 2CTWA 4DR5O 4JAAA 5LYJA 2XCMA 4LH7A 1EN4A 5LGNA 1QLNA 2OTLV 4KSHA 4PA7A 3S3WA 4JI4O 1U2OA 1Q90D 3JASA 4WFBV 3T1HB 1I5AA 1N34B 2WLLA 2YEJA 2LJ2A 4JYBA 2BZ5A 5FWKA 3EKOA 1UYDA 3ABKB 4JF3A 3SYOA 4NR1A 2YIDA 5J6AA 4OPAA 2WEQA 2PI5A 2BRCA 1FXKB 2NR5A 3H1LH 4U93A 1QLEB 2QGNA 4RAIA 3H1KH 4DV4B 4X62O 4LF6O 3T2SA 1OCOC 4ZI7B 4R6ZA 3K03A 3R65A 4PU9A 3OE7G 4DUYO 1MA1A 3IC7A 3E2EA 2BE3A 1Y4UA 1H2MA 3X2QC 2Q9LA 2OYQA 2P6JA 3GWKC 5KX5B 1A32A 1MSWD 4JZGA 4BQJA 1G4YB 4PDRA 3MDSA 2M7WA 2O1UA 2BTQA 5CTUA 3CP1A 3JD0A 4UXNA 1BYQA 4HAMA 1X59A 4XBFA 3FT8A 4PRXA 1UY9A 3AG2B 3A0YA 1VQ8V 3CC4V 2IU0A 1I58A 2PY5A 2IORA 3CD6V 5B1AB 5IWAO 5C8YB 3QG5A 4H13B 2W0FC 3SJQC 1TBWA 3B25A 2UXNA 4LWFA 4P8OA 3CCLV 2PF4E 2HP8A 4EGKA 2E0AA 2JGDB 3ML0A 4K4OA 4LF5O 5CPHA 4JI8O 2CUGA 4X8AA 2RMKB 4NXMO 2ZT9B 4DV3B 3JSNA 1VQKV 1F7YA 2H3OA 4HXZA 3IAYA 4EGIA 1DK1A 3LMMA 4DW1A 1QR8A 5LP6C 1M57C 5EYPA 1VQLV 3CPWU 4JQLA 4GKKO 5CB4B 2JJ2G 5B1BC 4HNAB 5BMVB 2ZKJA 1YETA 3U10A 2ZE5A 3LNUA 2JEXA 1WN7A 3W7SA 1GKXA 5L3BA 4YKZA 3HKBB 4MT8A 2FB5A 5KMGA 1JJ2U 3WB1A 4CWRA 3T1CA 3IFXA 1YTFB 3EFFK 4UUJC 5ITZB 5D6QA 1TUEB 3JZ3A 2B1GA 2XHRA 2YIBA 4LC1A 2F93B 2CGOA 4AILC 1J5EO 2PI4A 3K60A 1FXVA 3K5OA 4XKOA 4BW9A 4DRXB 1AJQA 3QO5A 2RN9A 1XNRB 4YKWA 1YSCA 4X1YA 4JI1O 2K1EA 1NU1H 4DYLA 1KECA 2QWRB 1V54B 2JGUA 3OGIB 2JJCA 4K8ZA 4JYYA 1KIJA 4DV2B 4RWUA 4U3JA 1SKVA 2ODMA 3TETA 4R3MA 2YEIA 2LP7A 3RYFB 2VQEB 4E02A 2GTAA 2HG5C 1SESA 3JATA 2BOCC 5H5NA 1YT2A 4QPKA 1YITV 1SQFA 4HYMA 3Q5JA 3L73H 3GIEA 3INXA 3CGZA 1U97A 3KZIZ 4UCOA 3SR2C 2WA4A 3U0ZA 4GYCB 1M5IA 5L3FA 2WLHA 1L0LH 2P90A 5IYZA 3CRQA 4F4LA 3HPLC 3RW0A 3F5WC 1I08A 5CTWA 2FL4A 2WA3A 1OCCB 1KP3A 3JD4A 3HKEA 4KTNA 4MVOA 2YGAA 3E8HA 4NXNB 1XNQO 4O4IB 4GX1A 2UXCO 4YJ3B 4DV1O 2ZINA 1AP6A 3CXCU 4UFZA 3FV5A 4PRVA 3T1YO 4CWFA 3QTCA 4PI2A 4B3TB 1I5YA 1GKZA 3K0DA 3QVNA 1B06A 2JDIG 2CTQA 4EEQA 3U2KA 2CG9A 5C93A 1VF5B 3RN4A 4OGQB 4J7ZA 2PYLA 1NR1A 2AZ0A 1FXKA 4HYPA 1F51A 3H4LA 1WPXA 1H2SB 3G6EV 5CMUA 3B26A 1H8EG 1L0NH 4XTJA 5GTIZ 4CE2A 5A2QN 3G6BA 2AKPA 5EBLC 1CP9A 4ZI7A 4JTCB 5JCOC 2GDSA 1K73W 1BQ0A 3VADA 3OFNG 3JAWB 1KQSU 4CE1A 1M9NA 5KX5A 3O65A 2VRZA 4FLVA 4EEHA 1FPOA 4JI6O 1M4UA 2QA4V 1AI4A 3RVYA 2XDLA 3G67A 1BXDA 1BMFG 1EN6A 2UUAO 4F6RB 2WI7A 5F3KA 3L75H 3BMYA 4MTGA 1MNGA 3CSXA 2YKEA 3RBZA 4IT5A 2WLNA 4MVUA 3C3TA 1NQTA 2WAMA 5L3EA 2EILC 2IOQA 1VF6A 1GN4A 3M99B 5C8YA 4IYIA 4AHCA 2HVKC 1UPGA 4B3RB 1SZXA 4UCVA 3ABMC
chains in the Genus database with same CATH topology
3HYZA 1UYIA 3CCSV 2BYHA 5EK0A 1JOYA 1RPRA 2B1IA 1BHBA 3ZKBA 3BM9A 2YEBA 3FT5A 1ZXMA 4HY1A 1OCRC 2YE9A 3CGYA 3ABLC 3ZMUA 1AJ6A 3E8FA 4WFFA 2JK5C 4XIRA 1UJWB 4BXIA 5IY5C 2DYRC 2WI3A 4BQGA 4DZYA 2Q2EB 1VQ9V 2ZXWB 3E35A 3CRLA 1F4NA 3CC7V 3WG7B 2BU7A 4ZBMA 4MOTA 2YE2A 2H55A 2YE8A 3RVZA 2XJXA 2GQPA 2BU6A 1JM6A 4O09A 5FNFA 3W7UA 2XAFA 3SL2A 3FYEB 2AHYA 1R3IC 1GTOA 2FWZA 3ZN0A 4GT1A 4BIUA 1NH2D 4MPNA 4H85A 2H94A 1UY6A 4XIQA 2Q6AA 1K97A 1YJNV 1TC6A 4HZ0A 3OW6A 1GO3F 5L3GA 1R3KC 2HR3A 1S5HC 4JGSA 4J9YB 2XDXA 4WUBA 1N8RW 2P67A 3W7WA 3STLC 4WFEA 1XL6A 3AG4B 4X9LA 4O05A 2DWEC 4FK5C 5B1OA 5H6RA 4LWGA 2Q8GA 2D3OW 4RUEA 1YERA 1MX0A 5IY5B 2DYRB 1K8AW 4U7NA 2X7RB 2WLMA 3ZXOA 5BOCA 3ABUA 3KG2A 2YKCA 3P30A 4H81A 3WFVA 3B8MA 3AG1B 2EZOA 3B28A 5EBMC 1M56C 2DWDC 5M4MA 2WLIB 5EC1C 2EZPA 2Q67A 1NHJA 3CCQV 2XOKG 1MOFA 5H6QA 2YEHA 4UV8A 2LFRA 4CE3A 3GIGB 2YEVB 4XKAA 4PA4A 3K04A 3K0GA 3R92A 5EC2C 5BZBA 5KUMA 3SYPA 1TH8A 1SZTA 1PVGA 2PNRA 1GM7A 2Z5UA 1K7DA 5D7RA 1J95A 4WUCA 4AWQA 2X6CA 1YSRA 4KP4A 1CPYA 3SYAA 4YKXA 5LGUA 1H38A 4MVRA 2XX5A 5LGTA 2Q8IA 4BAYA 2X6AA 4OXSA 4V26A 1V55B 3LPSA 3LSSA 1FFTB 4LBEC 1YTFD 2IWUA 2IWXA 4GT8A 2EXLA 2ZDIA 2OCCB 2XASA 4B6CA 4JYCA 3SPJA 2YI7A 2QM7A 2VCJA 4L94A 5CTYA 5B3SB 5FNCA 1YC4A 4XDMA 3ABKC 3OMUA 2WERA 3ETGA 3CCVV 1FXKC 1PNLA 3A0XA 1QLEC 2WI1A 2ZDXA 2BT0A 1COWG 4EGHA 5M4KA 5M4EA 2BTZA 5D7DA 3CWVA 5EBWC 1I5XA 3OMIB 2YEFA 2H8MA 1GM9A 4V25A 4AS9A 3R4OA 1K9MW 3OMNB 4BAEA 1S3JA 2HVJC 1QVFU 3AG2C 2QE7G 4L8ZA 4P7AA 2ZQMA 1AH8A 5B1AC 3OWDA 1S0VA 3ZIAG 1K4CC 1OCZB 2Z3YA 2EIMB 3GB7C 3D3IA 5LBQA 4LWEA 4U7OA 2F43G 3JCZA 3ZRVA 1ROPA 4E01A 2HKOA 2IU3A 2WLKA 4O0BA 1VQ6V 2YJWA 1YHQV 2XAGA 4HZ3A 2XDKA 5D7CA 3ZMSA 2WI5A 2YECA 4R3AA 1HWYA 4FJCC 4MP7A 2WLIA 3ZN1A 1K33A 1VQ7V 4ASFA 1K5SA 1DF4A 4RQEA 4L93A 3GIGA 1YIJV 2FWYA 1UYHA 2YEVA 3B24A 4MBCA 3TTZA 1V54C 1M1KW 3JD3A 4I5SA 4JASA 3G7BA 3BEHA 5CTXA 4J9ZB 3OMAB 4YKRA 2QFOA 1I59A 1Y4MA 3ZMTA 3U2DA 3EHBB 3W7TA 2CCTA 4MS2A 3VHAA 1AM1A 4P9OA 4XKKA 1W0KG 2Y69B 1UYGA 3Q5KA 2WEPA 5HFMA 3OM3B 1W2BU 2XHTA 1OCCC 2EIKB 2O1WA 3EHHA 4XDKA 2IJJA 3HB3B 1JX9A 1JQ0A 3VBBA 3G7EA 1VQ5V 1NHIA 3G4SV 1OHHG 2XDUA 2DYSB 4QPJA 3CMEV 1Y8NA 2CK3G 4TWKA 3STZC 2Q69A 3CCRV 3K97A 3HHUA 5IYDO 2BSMA 4HY6A 1VQMV 3VOUA 4XE2A 1RM1B 4L90A 4MSWC 2FXSA 3JD1A 3C0EA 3FB8C 1XL4A 3T2MA 3OWBA 4YKTA 1UY8A 4EFTA 4QIWF 2A9HA 3TZ5A 2Q8HA 2VCIA 2B5UA 1MU5A 1SRYA 2Q8FA 1B6QA 3D2RA 1PKXA 1ORQC 2DQ3A 2IH1C 4BIZA 1WLEA 2GSMB 1BL8A 4FCQA 1S77D 3FB7C 2EJRA 1JCHA 1Y66A 4FCPA 4WUDA 4MPCA 1BGQA 2ZDIC 4CBCA 3MNRP 2HJFC 4L87A 4MPEA 5GW7A 4JAUA 2ZXWC 3P32A 5CBGA 4UROA 3WG7C 2OTJV 5H9CA 2NNUA 3PEHA 2YKBA 1MG1A 4JTDB 5IDMA 3KE6A 2FYPA 1B3QA 1NVPB 3LDEA 3EHFA 3A0ZA 3K06A 4PA6A 3ZCCA 1QR9A 4WCEV 4X88A 4YXWG 4MVZA 1R6NA 1E1RG 1UYLA 1SETA 3ZM7A 5IYBO 2XJGA 3K79A 1I5CA 2WLJA 3O2FA 5KA5A 1AROP 4HYOA 5HFLA 3ASOB 3ZXQA 5M4PA 3RLPA 4KQVA 3AG4C 3ASNB 4CWSA 4R7CA 1I5DA 4UVBA 1QY8A 3U67A 4UVAA 2XAJA 4CZZA 4CWTA 3G75A 4L91A 5BODA 1OSFA 2ZR2A 4WFHA 5L3DA 2HCHA 3AG1C 3ABTA 3B77A 1RPOA 3ZJZA 3OPDA 3NXSA 3QTFA 1K92A 3E86A 1Z5AA 3RLQA 3QNEA 5KA6A 4I3HA 4ZVIA 2O1VA 1S76D 1KKDA 5DM6V 4NH7A 4N23A 4E00A 1R3JC 3PJSK 2VWCA 4GQTA 1EA6A 3QO8A 2HLDG 1QCEA 2HKJA 2CCUA 3INWA 1KP2A 3K98A 3HZ1A 4XITA 4FMTA 3CC2V 2YEGA 2BREA 1V55C 2YI6A 1L1FA 4LP0A 4QJFB 3WHAA 4LP8A 1R62A 2XABA 2OCCC 1EFRG 2XK2A 3ETEA 4XIPA 4GCZA 1UYEA 5B3SC 1GMGA 4EMVA 2R9IA 4CWOA 1Z59A 4AWPA 1E1QG 2ZR3A 3R4MA 1M90W 5CBHA 4URNA 3TZ0A 3ZMZA 1AI5A 4H37A 4ZKIA 4URLA 2YI5A 1ID0A 4N21A 1YS3A 2HFEC 4H7QA 2EIJB 3FB5C 3FB6C 1ZXNA 1F4MA 2IW5A 2XDSA 5IYCO 1VQ4V 1OCZC 2IWSA 2EIMC 3C11A 3OGCC 4NH8A 1FS0G 4RO2A 1AJNA 2IOPA 4UV9A 4EFUA 1AI6A 3UM7A 3AEIA 1Q82W 3CYOA 4MTOA 2BYIA 5FNDA 1A4HA 1VQPV 3A0WA 1G8MA 1Q81W 1Z5CA 2VW5A 1K34A 4Q20A 4LWIA 4JPRA 2EINB 4P9PA 1TILA 4R50A 3Q5LA 3R4NA 4CWPA 2YK2A 4FCRA 4YKYA 1IXMA 3AG3B 4ASAA 5IDJA 3F7VC 3CCMV 3D36A 4GGLA 1UYCA 1NR7A 1FXHA 2QKSA 3LSQA 3ZMVA 2V1DA 3D0BA 3NMQA 1THNA 2EBOA 1B63A 3TK1A 4HZ5A 1H7UA 3QDDA 2R9RB 2X0LA 5LHHA 2K5BA 1UY7A 2Y69C 1NBMG 1ENVA 2IJIA 3ZRWB 1Z5BA 4WFGA 3GIFA 2EIKC 3E8GA 4QE9A 2IJHA 2QTOA 2XJJA 1H8HG 1OZ0A 1BKNA 1ZWHA 3HEKA 1PD3A 4G2KA 3FKSG 1Y4SA 4EM7A 2CH4A 2DYSC 1NVPD 4GFNA 1YSZA 3T0ZA 4NH9A 4LPBA 3O0IA 1YT0A 4PDVA 3K08A 3ZRSA 3OEHG 5CN0A 1QZRA 1ZWIC 3EHGA 5M4NA 1U0ZA 2NLJC 3SYCA 3TUHA 1RM1C 4MVMA 1S14A 2JJ1G 4TSFG 5J71A 2YE6A 5IN9A 4XDLA 1UYMA 1QVGU 2WI6A 4CWNA 5F5RA 2XAQA 1PNKA 3IEDA 4HXWA 1EZJA 2YEDA 3EHJA 1THZA 2ZDYA 3ZKDA 1BHAA 3RKZA 4G27B 4O04A 1H7SA 5CA3A 3UKMA 3JYCA 3E89A 3K9AA 3I55V 3IGAC 4EKWA 2CGFA 5GGZA 4KFMA 4ASGA 3MD0A 4JTAB 3SPGA 2JKIA 2QF6A 2HG1A 3HYYA 3T1KA 4MVQA 2UXXA 4AWOA 4R1FA 1OCOB 4Z1MG 2ESAA 3X2QB 2WI4A 2W6IG 1GM8A 5D6PA 5L3JA 2QG2A 1Q7YW 3ZRXA 2C2AA 2YGEA 2DQ0A 2WPDG 2QEXV 1YJ9V 1AMWA 1R3LC 3DTUB 3ZRWA 1ZW9A 3ASOC 4XDJA 3E8BA 4RQFA 4KUMA 2JIZG 2YEAA 4PL9A 3ASNC 3SPCA 2GFDA 2KB1A 3W7XA 4WF9V 1M57B 3PEJA 2YE4A 5B1BB 1QBZA 4ASUG 1DTOA 2YE3A 2AHZA 2LFSA 2YKIA 1F23A 1UYKA 4FPPA 4X89A 3BY6A 2IH3C 1AR1B 3RLRA 4O07A 3OR7C 2YE5A 1Y8OA 4GX5A 2BU8A 4YKUA 4P30A 3CRKA 2OT5A 5E1AC 4JAVA 4YKQA 1NHHA 4B7PA 4XD8A 4MB9A 1W0JG 3H01A 1VQNV 1DLBA 3EKRA 4MW8A 3R4PA 3CCEV 1UYFA 1H2GA 1TIDA 3LDCA 3I56V 3OUFA 3T10A 2FTKA 1SERA 1KC8W 1LNQA 1EBOA 2ZD9A 3TCUA 2CCSA 4QNHB 3LDDA 1Q86W 1E79G 2MK3A 4H33A 2YE7A 3T0HA 3DGEA 4DUHA 2X6BA 3K3WA 5LHIA 2WI2A 1YT1A 5B1NA 2A0LA 4GX0A 4XC0A 2P7TC 4FIPC 4LCUC 2ITCC 3R91A 3A0RA 3MHSC 3ETDA 5M4HA 2XNDG 3OR6C 2IJKA 3LUTB 3MHHC 2YGFA 2BU2A 3GWOA 2GHYA 4BW5A 2EIJC 4R8CA 2EILB 1YI2V 4P2ZA 3CMAV 3ABMB 1B62A 3B27A 5KUKA 1AI7A 3B8NA 4URMA 3HZ5A 2YKJA 1CEZA 1OCRB 2UWDA 3ABLB 2Y48A 1KD1W 2XHXA 2YI0A 3T4DA 4W7TA 3TZ2A 3FYIB 4KFGA 1YC1A 3H80A 2WLLB 1K3EA 2Q68A 1GK9A 3TZ4A 4UVCA 2BU5A 1K5QA 5LHGA 1NJIW 1L0OA 2EINC 3SPIA 2V7QG 2WSSG 4PELA 4WFAV 2ATKC 1I5BA 5L3CA 3LNMB 2DW4A 1QYEA 3VHCA 3JD2A 3AG3C 1R73A 1JVMA 3CCJV 1P4RA 1YC3A 4MP2A 4TT3G 2YJXA 1YESA 2YSUB 4DO2A 1YJWV 4I9WA 1Y8PA 3OEEG 3OAAG 4RUFA 1TC0A 3VHDA 1PL0A 5CF0A 4QE7A 2ITDC 2QG0A 3A0TA 2JEUA 2XX4A 1AH6A 1K4DC 4GEEA 2YEEA 4PA3A 4GX2A 3SYQA 1NKDA 3K99A 5CBFA 2QM8A 4MTXA 2ZBKB 5J9PC 1DF5A 4MVSA 2WWWA 4G28B 2A79B 2H8PC 4CWQA 5FL7G 4XCLA 1S16A 3E83A 3SPHA 4E2LA 4KSGA 1PNMA 1M56B 1R6KA 1MABG 1AJPA 3WQ9A 1GJVA 1VQOV 1S72V 3CCUV 3G71V 4PDLA 2XD6A 1US7A 5DN6G 4XCJA 2XAHA 2XX2A 4PDMA 2W6JG 1KZNA 4LWHA 3OW2U 1P7BA 3F7YC 1JPXA 1NH2B 4PA9A 3O6OA 2BOBC 2YK9A 4DXWA 1GKFA 4ASBA 1EI1A 4MW3A 3OUSA 3QO7A 4MTFA 3T4ZA 2XCMA 5LGNA 1QLNA 2OTLV 4KSHA 4PA7A 1U2OA 4WFBV 1I5AA 2WLLA 2YEJA 4JYBA 2BZ5A 5FWKA 3EKOA 1UYDA 3ABKB 4JF3A 3SYOA 5J6AA 2WEQA 2PI5A 2BRCA 1FXKB 4U93A 1QLEB 4RAIA 3T2SA 1OCOC 4R6ZA 3K03A 3R65A 4PU9A 3OE7G 3IC7A 3E2EA 1Y4UA 3X2QC 2P6JA 1MSWD 4BQJA 1G4YB 4PDRA 2M7WA 2O1UA 5CTUA 3CP1A 3JD0A 4UXNA 1BYQA 4HAMA 3FT8A 4XBFA 4PRXA 1UY9A 3AG2B 3A0YA 1VQ8V 3CC4V 2IU0A 1I58A 2IORA 3CD6V 5B1AB 4P8OA 3SJQC 2W0FC 1TBWA 3B25A 4LWFA 2UXNA 3CCLV 4EGKA 2E0AA 3ML0A 4K4OA 5CPHA 4X8AA 1VQKV 4HXZA 4EGIA 1QR8A 1M57C 1VQLV 3CPWU 4JQLA 2JJ2G 5B1BC 2ZKJA 1YETA 3LNUA 2JEXA 3W7SA 1GKXA 5L3BA 4YKZA 4MT8A 1JJ2U 4CWRA 3T1CA 3IFXA 1YTFB 3EFFK 4UUJC 5D6QA 1TUEB 3JZ3A 2B1GA 2XHRA 4LC1A 2PI4A 3K60A 1FXVA 4XKOA 1AJQA 3QO5A 4YKWA 1YSCA 2K1EA 1KECA 1V54B 2JJCA 1KIJA 3TETA 4R3MA 2YEIA 2LP7A 4E02A 2HG5C 1SESA 2BOCC 1YT2A 4QPKA 1YITV 4HYMA 3Q5JA 3GIEA 3INXA 3CGZA 5L3FA 2WLHA 2P90A 4F4LA 3HPLC 3RW0A 3F5WC 5CTWA 1OCCB 1KP3A 3JD4A 4KTNA 4MVOA 2YGAA 3E8HA 4GX1A 3CXCU 3FV5A 4PRVA 4CWFA 1I5YA 1GKZA 3K0DA 2JDIG 3U2KA 2CG9A 5C93A 1NR1A 1FXKA 4HYPA 1F51A 3H4LA 1WPXA 3G6EV 5CMUA 3B26A 1H8EG 4XTJA 4CE2A 2AKPA 5EBLC 1CP9A 4JTCB 1K73W 3VADA 3OFNG 1KQSU 4CE1A 1M9NA 4EEHA 2QA4V 1AI4A 3RVYA 2XDLA 1BXDA 1BMFG 2WI7A 5F3KA 3BMYA 4MTGA 2YKEA 3RBZA 2WLNA 4MVUA 5L3EA 1NQTA 2WAMA 2EILC 2IOQA 3M99B 2HVKC 3ABMC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H7U A;  1Y8N A;  1UYI A;  3HYZ A;  3QDD A;  2K5B A;  1UY7 A;  2BYH A;  1JOY A;  3ZRW B;  1Z5B A;  3ZKB A;  3BM9 A;  1I5B A;  2YEB A;  3FT5 A;  1ZXM A;  3GIF A;  1QYE A;  4HY1 A;  3VHC A;  2YE9 A;  3HHU A;  3K97 A;  3CGY A;  2BSM A;  4HY6 A;  1AJ6 A;  4XE2 A;  4L90 A;  2FXS A;  2XJJ A;  1YC3 A;  3C0E A;  4XIR A;  4MP2 A;  4BXI A;  1BKN A;  3OWB A;  2YJX A;  1YES A;  1ZWH A;  4YKT A;  1UY8 A;  3HEK A;  4EFT A;  1Y8P A;  2WI3 A;  4BQG A;  4DZY A;  2Q2E B;  1Y4S A;  1TC0 A;  3TZ5 A;  2CH4 A;  4EM7 A;  4GFN A;  3VHD A;  2Q8H A;  3CRL A;  2VCI A;  1YSZ A;  5CF0 A;  2BU7 A;  4MOT A;  1MU5 A;  3T0Z A;  4NH9 A;  2YE2 A;  2H55 A;  2QG0 A;  2YE8 A;  3A0T A;  2XJX A;  2GQP A;  2BU6 A;  2Q8F A;  2XX4 A;  4LPB A;  1JM6 A;  3O0I A;  1AH6 A;  3D2R A;  1YT0 A;  4GEE A;  4O09 A;  5FNF A;  2YEE A;  3SL2 A;  1QZR A;  3EHG A;  4BIZ A;  5M4N A;  1U0Z A;  4FCQ A;  2FWZ A;  4GT1 A;  3K99 A;  3TUH A;  4BIU A;  4MPN A;  2QM8 A;  4H85 A;  1S14 A;  4FCP A;  1UY6 A;  4MPC A;  4WUD A;  1BGQ A;  4MTX A;  5J71 A;  2ZBK B;  4XIQ A;  2YE6 A;  5IN9 A;  2WWW A;  1UYM A;  3MNR P;  1TC6 A;  2WI6 A;  4CWN A;  4HZ0 A;  3OW6 A;  5F5R A;  4CWQ A;  4MPE A;  3IED A;  4HXW A;  4XCL A;  4JAU A;  3P32 A;  1S16 A;  2YED A;  3EHJ A;  4URO A;  4KSG A;  2ZDY A;  3ZKD A;  3RKZ A;  3PEH A;  2XDX A;  3WQ9 A;  4O04 A;  1GJV A;  1H7S A;  4WUB A;  2YKB A;  2P67 A;  5IDM A;  3KE6 A;  4X9L A;  2FYP A;  1B3Q A;  4O05 A;  5B1O A;  4LWG A;  2XD6 A;  1US7 A;  2CGF A;  5GGZ A;  2Q8G A;  4XCJ A;  1YER A;  3EHF A;  1MX0 A;  3A0Z A;  3ZCC A;  4U7N A;  4ASG A;  2XX2 A;  3ZXO A;  1UYL A;  5BOC A;  3MD0 A;  1KZN A;  3ZM7 A;  2YKC A;  2JKI A;  2QF6 A;  4LWH A;  2XJG A;  2HG1 A;  4H81 A;  1I5C A;  3O2F A;  3HYY A;  3T1K A;  3B28 A;  3O6O A;  5M4M A;  4AWO A;  2YK9 A;  4R1F A;  3ZXQ A;  5M4P A;  3RLP A;  1NHJ A;  2ESA A;  4KQV A;  4ASB A;  1EI1 A;  2YEH A;  2LFR A;  4CE3 A;  3GIG B;  4CWS A;  4XKA A;  1I5D A;  2XCM A;  3R92 A;  1QY8 A;  2WI4 A;  5D6P A;  3U67 A;  4KSH A;  5L3J A;  2QG2 A;  1U2O A;  1I5A A;  1TH8 A;  4CWT A;  1PVG A;  2YEJ A;  2PNR A;  3G75 A;  4L91 A;  5BOD A;  4JYB A;  1OSF A;  2BZ5 A;  5FWK A;  3EKO A;  1UYD A;  5D7R A;  4HZ5 A;  5J6A A;  3ZRX A;  2C2A A;  4WUC A;  2WEQ A;  4AWQ A;  2HCH A;  2YGE A;  2BRC A;  1YSR A;  4KP4 A;  4YKX A;  4U93 A;  3OPD A;  1AMW A;  2XX5 A;  3NXS A;  3ZRW A;  3T2S A;  1ZW9 A;  2Q8I A;  4PU9 A;  3QTF A;  2YEA A;  4PL9 A;  1Y4U A;  4V26 A;  1Z5A A;  3LPS A;  3RLQ A;  2GFD A;  4BQJ A;  2IWU A;  4I3H A;  2O1U A;  2IWX A;  4ZVI A;  5CTU A;  3PEJ A;  4GT8 A;  2EXL A;  2YE4 A;  2O1V A;  1BYQ A;  3FT8 A;  4PRX A;  4B6C A;  4JYC A;  1UY9 A;  3A0Y A;  2YI7 A;  2QM7 A;  4NH7 A;  2VCJ A;  4L94 A;  5CTY A;  1I58 A;  2YE3 A;  4E00 A;  2IOR A;  5FNC A;  1YC4 A;  2LFS A;  2YKI A;  3OMU A;  4XDM A;  2WER A;  1UYK A;  4FPP A;  4P8O A;  1TBW A;  3B25 A;  4LWF A;  2VWC A;  4GQT A;  1EA6 A;  4EGK A;  2E0A A;  3A0X A;  2HKJ A;  2WI1 A;  2CCU A;  3INW A;  4K4O A;  2ZDX A;  3K98 A;  2BT0 A;  5CPH A;  4EGH A;  5M4K A;  3HZ1 A;  5M4E A;  3RLR A;  2BTZ A;  4XIT A;  3CWV A;  4FMT A;  5D7D A;  4O07 A;  2YEG A;  2BRE A;  2YE5 A;  2YEF A;  1Y8O A;  4HXZ A;  4EGI A;  2H8M A;  2YI6 A;  4V25 A;  4AS9 A;  3R4O A;  4LP0 A;  2BU8 A;  4JQL A;  3WHA A;  4BAE A;  1R62 A;  4YKU A;  2XAB A;  2ZKJ A;  1YET A;  2XK2 A;  3LNU A;  3CRK A;  1GKX A;  4XIP A;  4JAV A;  4YKQ A;  4GCZ A;  1UYE A;  4L8Z A;  4YKZ A;  1NHH A;  4MT8 A;  4P7A A;  4B7P A;  4XD8 A;  4EMV A;  4MB9 A;  1AH8 A;  4CWO A;  3OWD A;  4CWR A;  1Z59 A;  4AWP A;  5D6Q A;  3JZ3 A;  2XHR A;  3R4M A;  4LC1 A;  3K60 A;  3EKR A;  4XKO A;  4URN A;  3R4P A;  4LWE A;  4U7O A;  1UYF A;  3TZ0 A;  3ZRV A;  4YKW A;  1TID A;  4E01 A;  4ZKI A;  3T10 A;  2JJC A;  2FTK A;  1KIJ A;  4O0B A;  2YI5 A;  1ID0 A;  4URL A;  4R3M A;  1YS3 A;  2YEI A;  2YJW A;  2CCS A;  4E02 A;  4H7Q A;  1YT2 A;  2XDK A;  2YE7 A;  5D7C A;  3T0H A;  3DGE A;  4QPK A;  4DUH A;  1ZXN A;  2XDS A;  2WI5 A;  2YEC A;  4HYM A;  3Q5J A;  4R3A A;  3GIE A;  3INX A;  3CGZ A;  2IWS A;  4MP7 A;  2WI2 A;  1YT1 A;  5B1N A;  3C11 A;  4ASF A;  4NH8 A;  4XC0 A;  5CTW A;  2IOP A;  4L93 A;  3GIG A;  4KTN A;  2FWY A;  1UYH A;  2YGA A;  3B24 A;  3R91 A;  4EFU A;  4MBC A;  3TTZ A;  3A0R A;  5M4H A;  4I5S A;  4JAS A;  3G7B A;  3FV5 A;  2YGF A;  4PRV A;  2BYI A;  5CTX A;  1A4H A;  5FND A;  4CWF A;  2BU2 A;  1GKZ A;  4YKR A;  2QFO A;  1I59 A;  3A0W A;  3U2D A;  1Z5C A;  2CCT A;  3U2K A;  2CG9 A;  2VW5 A;  5C93 A;  3VHA A;  1AM1 A;  4Q20 A;  4LWI A;  4HYP A;  1F51 A;  3H4L A;  1B62 A;  4XKK A;  3B26 A;  1TIL A;  4XTJ A;  3B27 A;  4CE2 A;  2AKP A;  3Q5L A;  1UYG A;  3Q5K A;  2WEP A;  3R4N A;  3VAD A;  4CWP A;  4URM A;  3HZ5 A;  2XHT A;  2YK2 A;  2YKJ A;  4FCR A;  4YKY A;  4CE1 A;  1IXM A;  2UWD A;  2O1W A;  4EEH A;  4ASA A;  5IDJ A;  2XHX A;  3EHH A;  3D36 A;  2YI0 A;  4GGL A;  1UYC A;  2XDL A;  1BXD A;  4W7T A;  3TZ2 A;  2WI7 A;  5F3K A;  3BMY A;  4KFG A;  1YC1 A;  2YKE A;  3H80 A;  3G7E A;  1NHI A;  2IOQ A;  3D0B A;  3TZ4 A;  3NMQ A;  1THN A;  2BU5 A;  2XDU A;  1B63 A;  4QPJ A;  1L0O A;  3TK1 A; 
#chains in the Genus database with same CATH topology
 3HYZ A;  1UYI A;  1XBL A;  2JGD A;  2ZIM A;  2ZE7 A;  3CCS V;  3FAV B;  2BYH A;  5EK0 A;  1JOY A;  1RPR A;  4DR5 B;  2B1I A;  1BHB A;  3ZKB A;  3BM9 A;  2YEB A;  2LGQ A;  1ZXM A;  3CRM A;  3FT5 A;  5D5Q A;  1P7G A;  4HY1 A;  4ICG A;  2KKW A;  1OCR C;  4EFB A;  4K35 A;  2YE9 A;  3CGY A;  1SQP H;  3ABL C;  3ZMU A;  1AJ6 A;  3E8F A;  4FFB B;  4IYH A;  1IBK O;  2UXD B;  4NKG B;  4WFF A;  5CB4 A;  2LQT A;  5JEN A;  4JV5 O;  2YIB D;  2JK5 C;  4HNA A;  5BMV A;  4J10 A;  4FM1 A;  4FM2 A;  4XIR A;  1XI1 A;  5KLV H;  1UJW B;  4BXI A;  5IY5 C;  2DYR C;  2RQ6 A;  3HKB A;  4H0L B;  2WI3 A;  4BQG A;  4DZY A;  1XMO B;  2ZKO A;  4GLX A;  1VQ9 V;  2Q2E B;  2Q0O C;  2ZXW B;  4LF6 B;  4BIO A;  1P84 F;  3E35 A;  3CRL A;  1F4N A;  3CC7 V;  3WG7 B;  2BU7 A;  4ZBM A;  4IL6 Z;  5ITZ A;  4MOT A;  2YE2 A;  2H55 A;  2YE8 A;  3UQ8 A;  3RVZ A;  2XJX A;  2GQP A;  1HNX B;  2BU6 A;  1JM6 A;  3NR7 A;  4O09 A;  5FNF A;  3W7U A;  4DRX A;  2HHH B;  2XAF A;  3SL2 A;  3FYE B;  4FLW A;  2AHY A;  3L74 H;  1R3I C;  2IBZ H;  1GTO A;  2FWZ A;  3ZN0 A;  4GT1 A;  4BIU A;  1NH2 D;  4MPN A;  4H85 A;  2H94 A;  2Z0A A;  1IX9 A;  1UY6 A;  1AR5 A;  1OJH A;  4XIQ A;  2Q6A A;  4AQY B;  3RYF A;  1K97 A;  1YJN V;  1N32 O;  4NVP A;  1TC6 A;  2UU9 B;  4LFA O;  4JI2 B;  4HZ0 A;  2AXT Z;  3OW6 A;  1GO3 F;  1JMK C;  5L3G A;  1R3K C;  4LF5 B;  1P49 A;  4F6E A;  2HR3 A;  1S5H C;  4JGS A;  4PJ0 Z;  4J9Y B;  3K57 A;  5EZY B;  2QKC A;  1I7F A;  2XDX A;  1QQC A;  4WUB A;  2YIC A;  1N8R W;  2P67 A;  1YZB A;  1JR9 A;  3W7W A;  1HDJ A;  3STL C;  4WFE A;  1XL6 A;  3AG4 B;  4X9L A;  4O05 A;  2DWE C;  1TVK B;  4FK5 C;  5B1O A;  1Z2G A;  4B3M B;  5H6R A;  3TXQ A;  4LWG A;  4O4I A;  3SDL A;  2Q8G A;  4YJ3 A;  2D3O W;  4RUE A;  2QWP B;  1YER A;  1MX0 A;  4FZ0 A;  5IY5 B;  2OIG A;  2DYR B;  1K8A W;  4U7N A;  4JI3 O;  4FLY A;  4DV7 B;  2X7R B;  2WLM A;  5IJ9 B;  3ZXO A;  4WBN B;  4O2B B;  1AVM A;  2R72 A;  4LF4 O;  1FJG B;  4J7K A;  5BOC A;  1B04 A;  3ABU A;  3KG2 A;  2AGA A;  3OTF A;  2YKC A;  3P30 A;  4H81 A;  3WFV A;  3B8M A;  3C3S A;  4UCS A;  3AG1 B;  2EZO A;  3B28 A;  1N0N A;  1TA8 A;  5EBM C;  5LMU O;  3UO2 A;  1M56 C;  2DWD C;  1LUV A;  5M4M A;  2WLI B;  4BWA A;  5EC1 C;  2EZP A;  2Q67 A;  4H44 B;  3CCQ V;  2A7W A;  2XOK G;  1NHJ A;  1MOF A;  1WNS A;  5H6Q A;  2UUB O;  5KHG A;  2YEH A;  4UV8 A;  3RFR A;  1XUQ A;  2LFR A;  4CE3 A;  3GIG B;  3ZHQ A;  2GTS A;  2YEV B;  4XKA A;  4PA4 A;  1NZ6 A;  3K04 A;  3K0G A;  3R92 A;  5EC2 C;  4F6R A;  5BZB A;  2E74 B;  5KUM A;  3SYP A;  1TH8 A;  2YI8 A;  1SZT A;  1PVG A;  2PNR A;  1GM7 A;  2Z5U A;  2OCH A;  1K7D A;  5D7R A;  1J95 A;  1XMQ B;  4UB8 Z;  4WUC A;  4AWQ A;  2X6C A;  1KBH A;  1YSR A;  4KP4 A;  1CPY A;  3SYA A;  4YKX A;  5BY1 A;  2P5O A;  2L6L A;  5LGU A;  1H38 A;  3FAV A;  4DR4 B;  4MVR A;  2XX5 A;  5LGT A;  2Q8I A;  1ZX3 A;  3DC5 A;  4BAY A;  2X6A A;  4OXS A;  1XHX A;  3P3P A;  1V55 B;  3LPS A;  3LSS A;  4V26 A;  1FFT B;  4FFB A;  4J11 A;  4LBE C;  1YTF D;  2IWU A;  5FPO A;  1SQV H;  5AG2 A;  2IWX A;  2N74 A;  4GT8 A;  2EXL A;  4I4T B;  1XDC A;  3VQW A;  2ZDI A;  2OCC B;  2XAS A;  2Q7H A;  2QDO A;  4B6C A;  4JYC A;  5H2F Z;  5TIS Z;  3SPJ A;  3ZHU A;  2YI7 A;  2QM7 A;  2VCJ A;  3CWB H;  4L94 A;  5CTY A;  3ZED A;  1QU7 A;  1BSM A;  5B3S B;  5JJJ B;  5FNC A;  1YC4 A;  4XDM A;  3ABK C;  3OMU A;  2WER A;  3ETG A;  2GBO A;  2Y4U A;  2ILM A;  4DR3 B;  3CCV V;  5LMN O;  1FXK C;  1PNL A;  3A0X A;  1QLE C;  2WI1 A;  2YUA A;  4C7U A;  2ZDX A;  2BT0 A;  1COW G;  4JI6 B;  4EGH A;  5M4K A;  1YCI A;  4IIJ B;  1I94 B;  5M4E A;  1ZLZ A;  2BTZ A;  5D7D A;  3CWV A;  5EBW C;  1I5X A;  2RDC A;  1Y76 B;  3OMI B;  1HNW B;  4E4E A;  2YEF A;  4EB6 B;  2H8M A;  1GM9 A;  3K58 A;  4X20 B;  4V25 A;  4AS9 A;  1IBM O;  3R4O A;  2YDE A;  1K9M W;  5A9G A;  5E79 Z;  3OMN B;  3AK2 A;  4JI0 O;  3OTO O;  4J42 A;  4BAE A;  1TGO A;  2PGG A;  1S3J A;  2HVJ C;  1GRJ A;  1QVF U;  2DMX A;  5FNV B;  3AG2 C;  4X65 B;  5EIB D;  2QE7 G;  5BR8 B;  4L8Z A;  4P7A A;  1SQX H;  2ZQM A;  1VF6 C;  1AH8 A;  5B1A C;  3OWD A;  1S0V A;  3ZIA G;  5KHH A;  1K4C C;  2YC0 A;  1KUQ A;  1OCZ B;  1N36 B;  2Z3Y A;  2EIM B;  5EZY A;  3GB7 C;  3D3I A;  1AP5 A;  5LXT B;  2JRI A;  5LBQ A;  4LWE A;  4U7O A;  1IBK B;  2F43 G;  3JCZ A;  3ZRV A;  1JFF B;  1ROP A;  4O4H B;  1TVK A;  4CC6 A;  5LOV B;  4E01 A;  2HKO A;  1RSO B;  3ZX6 A;  2IU3 A;  2D2C B;  2WLK A;  4DV5 B;  2CE4 A;  3UO3 A;  4O0B A;  4DK0 A;  3RGB A;  1VQ6 V;  2YJW A;  1KYO F;  5IJ9 A;  1YHQ V;  4WBN A;  4O2B A;  1ZL8 B;  2XAG A;  1WP7 A;  1Y6X A;  4HZ3 A;  4PHZ A;  2XDK A;  5D7C A;  1BT8 A;  3ZMS A;  4JI5 O;  4PD4 F;  2WI5 A;  1RFY A;  4DR1 B;  2YEC A;  1SF9 A;  5IJ0 B;  4R3A A;  3EVK A;  1HWY A;  4FJC C;  4MP7 A;  2WLI A;  3ZN1 A;  2VQF B;  2YS8 A;  1K33 A;  1VQ7 V;  4ASF A;  4K0K O;  1K5S A;  1DF4 A;  1LUW A;  4RQE A;  4E72 A;  5JJE B;  2LGW A;  4L93 A;  3GIG A;  1YIJ V;  4ZOL B;  2FWY A;  1UYH A;  2YEV A;  4KHP B;  3B24 A;  4MBC A;  4DUZ O;  3TTZ A;  4I7Z B;  1V54 C;  2QSA A;  3K9S A;  1M1K W;  3TJT A;  3JD3 A;  4I5S A;  1MZE A;  2F1M A;  4JAS A;  3G7B A;  2CTR A;  3BEH A;  5CTX A;  4J9Z B;  3OMA B;  2AW9 A;  4B7K A;  4YKR A;  2QFO A;  1I59 A;  1Y4M A;  3ZMT A;  3U2D A;  1URF A;  3EHB B;  1HW7 A;  3W7T A;  3ZHV A;  2CCT A;  1NI8 A;  4MS2 A;  3VHA A;  1AM1 A;  4DV0 O;  1XIL A;  4P9O A;  4XKK A;  3A8T A;  1W0K G;  2Y69 B;  5GON B;  2YXY A;  3B40 A;  3H1H H;  5B66 Z;  2C1I A;  1UYG A;  3Q5K A;  2WEP A;  5HFM A;  3OM3 B;  4YHH O;  1Q8I A;  1W2B U;  2KSD A;  2XT9 A;  2XHT A;  1OCC C;  2EIK B;  2O1W A;  3EHH A;  4XDK A;  1GN6 A;  2BCC H;  2IJJ A;  1VP7 A;  2CDY A;  4X66 O;  3HB3 B;  4I4T A;  4ZHQ B;  1T5E A;  1JX9 A;  3M7M X;  1JQ0 A;  3EXA A;  3VBB A;  3G7E A;  4GZR B;  1VF7 A;  1VQ5 V;  1NHI A;  3G4S V;  1OHH G;  3BAA A;  3CE2 A;  2XDU A;  2DYS B;  1IBL B;  4QPJ A;  3CME V;  3B09 A;  4O2A B;  1MMM A;  4LF9 B;  3E22 B;  1Y8N A;  2F4V B;  2CK3 G;  5KAF Z;  4TWK A;  3STZ C;  4Q6G A;  4IIJ A;  2Q69 A;  3L9D A;  3CCR V;  3J81 N;  5KHK A;  4LF8 B;  1Y76 A;  1JA8 A;  4EB6 A;  3HHU A;  3K97 A;  5IYD O;  2BSM A;  4HY6 A;  1VQM V;  4X20 A;  3VOU A;  1HNZ O;  4XE2 A;  1G6U A;  1RM1 B;  4L90 A;  3VQX A;  1PL4 A;  4ABM A;  3JAL B;  2ZM6 B;  4MSW C;  1WB7 A;  2FXS A;  3ETQ A;  3JD1 A;  3C0E A;  3FB8 C;  1XL4 A;  3VQV A;  1HR0 B;  4LH6 A;  3T2M A;  4FLU A;  5FNV A;  3OWB A;  4YKT A;  1UY8 A;  4EFT A;  4QIW F;  2A9H A;  4LF7 B;  3TZ5 A;  4LFB O;  3K59 A;  2Q8H A;  4X64 O;  4GKJ O;  2CH7 B;  2VCI A;  4OX9 O;  2B5U A;  1MU5 A;  1SRY A;  2ARH A;  5LXT A;  2Q8F A;  1B6Q A;  3D2R A;  1PKX A;  1BE3 H;  1ORQ C;  2DQ3 A;  4HBN A;  1JFF A;  2IH1 C;  4O4H A;  4BIZ A;  1WLE A;  5LOV A;  1WJZ A;  1RSO A;  2GSM B;  1BL8 A;  4FCQ A;  1S77 D;  3FB7 C;  2EJR A;  1JCH A;  1Y66 A;  2PZS A;  4B3S O;  4FCP A;  2E5L B;  4WUD A;  4MPC A;  4OPH A;  2UXB O;  4YIO A;  1BGQ A;  4TQD A;  1N0J A;  3IJ4 A;  1ZL8 A;  1NT2 B;  2ZDI C;  4CBC A;  2FYU H;  3BAB A;  3MNR P;  2HJF C;  1VEW A;  4L87 A;  3I5D A;  4ZIB A;  4DR6 O;  4MPE A;  5GW7 A;  4LFC B;  4JAU A;  2ZXW C;  3P32 A;  2CGN A;  5IJ0 A;  5CBG A;  2CAZ C;  4URO A;  3WG7 C;  2OTJ V;  1WPB A;  5H9C A;  2NNU A;  3PEH A;  2AZ2 A;  1EM1 A;  4DR7 B;  2YKB A;  1CXZ B;  1MG1 A;  5FPR A;  4JTD B;  2RNB A;  5JJN B;  3L71 H;  5IDM A;  3KE6 A;  1FAF A;  2FYP A;  1B3Q A;  4ZOL A;  4NYK A;  1NVP B;  3G80 A;  4UCU A;  4JI7 O;  4K8X A;  1FKA O;  3LDE A;  3EHF A;  3RT3 C;  3A0Z A;  3K06 A;  4PA6 A;  5BXZ A;  3ZCC A;  1QR9 A;  1H2N A;  4WCE V;  4X88 A;  4YXW G;  2EUL A;  4MVZ A;  1R6N A;  1E1R G;  2Q0A A;  1UYL A;  3FD9 A;  1SET A;  1L8D A;  2JS3 A;  2A3Q A;  5IYB O;  3ZM7 A;  2XJG A;  1NTM H;  3K79 A;  1KU9 A;  1I5C A;  4KXR A;  2WLJ A;  3O2F A;  5KA5 A;  3L72 H;  4DV6 O;  1ARO P;  2ETN A;  4HYO A;  5GON A;  2LW1 A;  5HFL A;  4FLZ A;  1JJO A;  2E3C A;  4B08 A;  3ASO B;  3ZXQ A;  4JI4 B;  5M4P A;  1IXB A;  3RLP A;  1O9G A;  1N33 O;  4KQV A;  2K9P A;  2QWO B;  3AG4 C;  3ASN B;  2P4K A;  4CWS A;  2Q7G A;  1PP9 H;  4R7C A;  1I5D A;  4FZ1 A;  4UVB A;  4QGP A;  3CRC A;  1IDS A;  3N2G B;  1QY8 A;  2QJ1 A;  3U67 A;  4ZHQ A;  4JYA O;  4UVA A;  4CC5 A;  2XAJ A;  1LR1 A;  4CZZ A;  1ZAU A;  3THO A;  4X62 B;  4CWT A;  4L8J A;  3G75 A;  4L91 A;  5BOD A;  2F95 B;  4DUY B;  1OSF A;  2ZR2 A;  4YY3 O;  2IM9 A;  3CJH B;  4WFH A;  4D7T A;  1SQB H;  4O2A A;  1SS3 A;  3E22 A;  5L3D A;  2HCH A;  3AG1 C;  2R9A A;  3ABT A;  3B77 A;  1RPO A;  3ZJZ A;  3OPD A;  3T1H O;  3NXS A;  1N34 O;  2CTP A;  2FKX A;  3AK1 A;  3QTF A;  3RYI B;  1K92 A;  3E86 A;  1D5N A;  4YJ2 B;  1Z5A A;  3J80 N;  3RLQ A;  2YIA A;  1Z5V A;  3H1I H;  3QNE A;  1GN3 A;  5KA6 A;  5IWA B;  3JAL A;  4B7E A;  4I3H A;  4ZVI A;  1YXB A;  1YF2 A;  4DV4 O;  1XEQ A;  2RJZ A;  2O1V A;  1S76 D;  3CRA A;  3JAK B;  4X1I B;  5DEC A;  1KKD A;  1Q3E A;  5GTH Z;  5DM6 V;  4NH7 A;  4JI8 B;  4NXM B;  4N23 A;  4E00 A;  1R3J C;  3PJS K;  2CH7 A;  2VWC A;  3WB2 A;  1EA6 A;  4GQT A;  1MSD A;  4YHH B;  3QO8 A;  5JVD B;  3UCS C;  2HLD G;  1QCE A;  2HKJ A;  2BSK B;  2CCU A;  3INW A;  1KP2 A;  3F5T A;  3K98 A;  1BGY H;  4GKK B;  3HZ1 A;  1R1B A;  3BFR A;  4LR3 A;  1TUB B;  4XIT A;  4FMT A;  4IGG A;  3CC2 V;  3CHX A;  2YEG A;  2BRE A;  1V55 C;  4UCT A;  2M6Y A;  2QM4 A;  1M93 A;  3B2E E;  2YI6 A;  1L1F A;  4LP0 A;  4QJF B;  3WHA A;  1PV0 A;  4LP8 A;  4NTX A;  1FYJ A;  1R62 A;  5KHI A;  5IT9 N;  2XAB A;  1J5E B;  2HJD A;  2OCC C;  1EFR G;  4DV3 O;  1Q5O A;  2XK2 A;  3ETE A;  4XIP A;  4TV8 B;  4GCZ A;  1UYE A;  5B3S C;  3CRR A;  1GMG A;  4EMV A;  4BR6 A;  2R9I A;  4CWO A;  1OV9 A;  4JI1 B;  1Z59 A;  3SJB C;  4AWP A;  1E1Q G;  2ZR3 A;  3R4M A;  1M90 W;  2R70 A;  1EZV H;  5CBH A;  4URN A;  1QNM A;  2Q73 A;  3TZ0 A;  3ZMZ A;  3JAM N;  3DXR B;  1AI5 A;  4H37 A;  4ZKI A;  1Q43 A;  2QR4 A;  2XUM A;  3H9V A;  4DR2 O;  4URL A;  2YI5 A;  1ID0 A;  2DOS A;  4N21 A;  1YS3 A;  2HFE C;  3Q4H B;  4H7Q A;  2EIJ B;  1XNR O;  3FB5 C;  3FB6 C;  2YXH A;  1S5J A;  1F4M A;  1GH6 A;  2IW5 A;  1ZXN A;  2XDS A;  5IYC O;  4DV2 O;  1VQ4 V;  4O4L B;  1XNQ B;  1OCZ C;  2IWS A;  2UXC B;  2EIM C;  3APO A;  2ZE6 A;  3SJA C;  4DV1 B;  3C11 A;  2VQE O;  3OGC C;  3BPZ A;  3T1Y B;  4NH8 A;  3ZHR A;  1FS0 G;  2N04 A;  4RO2 A;  1IUR A;  2W0X A;  1AJN A;  2FML A;  2IOP A;  4UV9 A;  1ZUQ A;  2ZIO A;  4EFU A;  5LL6 Y;  1V9P A;  1AI6 A;  2PUS A;  3N2G A;  3AEI A;  3UM7 A;  1Q82 W;  4JZ2 A;  3CYO A;  2LW7 A;  4MTO A;  2BYI A;  5FND A;  1A4H A;  1SA0 B;  3C90 A;  1VQP V;  3A0W A;  2YXL A;  1G8M A;  3PN1 A;  1Q81 W;  3CJH A;  4NXN O;  1Z5C A;  2VW5 A;  3N2K A;  1K34 A;  4Q20 A;  3BA8 A;  4LWI A;  4JPR A;  2EIN B;  4P9P A;  1TIL A;  5K1X A;  3MAQ A;  4B3T O;  4R50 A;  3Q5L A;  2UUA B;  4FFK A;  3R4N A;  3RYI A;  4CWP A;  3B4S A;  4YJ2 A;  2YK2 A;  4FCR A;  4YKY A;  1KKC A;  1XQ8 A;  1X4T A;  1IXM A;  2P06 A;  1PPJ H;  2Y0I A;  3AG3 B;  5IDJ A;  4ASA A;  3F7V C;  3CCM V;  3D36 A;  4GGL A;  2F23 A;  2ZCE A;  3ICX A;  1UYC A;  1NR7 A;  4I55 B;  3JAK A;  1FXH A;  4X1I A;  1EN5 A;  2QKS A;  3S3X A;  3HKD B;  3FFQ A;  3LSQ A;  2BTO A;  2VS0 A;  2DJV A;  3ZMV A;  2V1D A;  3D0B A;  2ZNI A;  2UUC O;  1SQQ H;  3QF7 A;  3HR0 A;  5KHJ A;  3NMQ A;  1THN A;  2EBO A;  2QKA A;  1B63 A;  3N27 A;  5JVD A;  3TK1 A;  4HZ5 A;  4NTY A;  1H7U A;  4LNU B;  3QDD A;  2R9R B;  2BSK A;  2X0L A;  1H2L A;  5LHH A;  2K5B A;  1UY7 A;  2Y69 C;  4JV5 B;  1NBM G;  1ENV A;  2IJI A;  3ZRW B;  1TUB A;  1Z5B A;  4WFG A;  3GIF A;  3A0B Z;  2ADQ B;  2EIK C;  1WA8 B;  4B3R O;  1ZTE A;  1R6T A;  3E8G A;  3WU2 Z;  2XTA A;  3M8A A;  4QE9 A;  1HP8 A;  2IJH A;  2QTO A;  2XJJ A;  2Y4T A;  1H8H G;  1UFI A;  4CH6 A;  1OZ0 A;  5F2V O;  1BKN A;  3GVM A;  3SGI A;  4TV8 A;  1ZWH A;  1KMI Z;  2L35 A;  3HEK A;  1PD3 A;  4G2K A;  3FKS G;  2P4V A;  1Y4S A;  2CH4 A;  2DYS C;  4EM7 A;  1PM9 A;  1NVP D;  4GFN A;  2UXD O;  1YSZ A;  3T0Z A;  2P22 C;  4NH9 A;  4LPB A;  3O0I A;  1YT0 A;  4PDV A;  5JWP A;  3K08 A;  3ZRS A;  3OEH G;  1XMO O;  5CN0 A;  1QZR A;  1ZWI C;  1N32 B;  3DXR A;  3EHG A;  1U96 A;  1U0Z A;  5M4N A;  4LFA B;  2XHB A;  2NLJ C;  3SYC A;  3TUH A;  4I9Q A;  1RM1 C;  4MVM A;  1S14 A;  2QTS A;  2JJ1 G;  1HNX O;  2HEP A;  3BVO A;  4TSF G;  3SJC C;  5J71 A;  2HHH O;  2YE6 A;  5IN9 A;  4XDL A;  3Q4H A;  2A06 H;  1UYM A;  1QVG U;  3CX5 F;  3ZS8 C;  2WI6 A;  1S5L Z;  4CWN A;  5F5R A;  2XAQ A;  1PNK A;  3IED A;  4HXW A;  1EZJ A;  4EFE A;  2YED A;  4O4L A;  3EHJ A;  1THZ A;  4KL1 A;  2ZDY A;  2V4D A;  3ZKD A;  1BHA A;  4AQY O;  3RKZ A;  4G27 B;  4O04 A;  5EIB C;  3AK3 A;  1H7S A;  4JI3 B;  2UU9 O;  4JI2 O;  3ZHS A;  2C1G A;  5CA3 A;  4LF4 B;  3UKM A;  3VQY A;  3JYC A;  4FM0 A;  3E89 A;  3K9A A;  5J2U B;  1I0H A;  3I55 V;  3IGA C;  4EKW A;  2CGF A;  5GGZ A;  4KFM A;  5LMU B;  1Q6H A;  4ASG A;  1SA0 A;  3O9O A;  5J2T B;  5CA1 B;  3MD0 A;  4JTA B;  4FLX A;  4B3M O;  3SPG A;  2JKI A;  2QF6 A;  2HG1 A;  2UUB B;  3OD4 A;  3BHP A;  2ZNJ A;  3HYY A;  3T1K A;  4MVQ A;  1GN2 A;  1GAX A;  4I50 B;  4DV7 O;  5D5P A;  2UXX A;  4X9Q A;  5FLX N;  4AWO A;  3KKY A;  1YVW A;  1FJG O;  4R1F A;  1OCO B;  2JVD A;  4Z1M G;  4DR2 B;  2ESA A;  3X2Q B;  5CA0 B;  2N05 A;  4I55 A;  2WI4 A;  2W6I G;  4YIP A;  1GM8 A;  5D6P A;  5L3J A;  1AB3 A;  2QG2 A;  3WB0 A;  3HKD A;  1Q7Y W;  3RYH B;  3UT5 B;  1G1X B;  3ZRX A;  2C2A A;  4LNU A;  2YGE A;  2DQ0 A;  4CS3 A;  2WPD G;  2QEX V;  1YJ9 V;  1AMW A;  1R3L C;  1VIB A;  3DTU B;  2VWK A;  3ZRW A;  1ZW9 A;  3ASO C;  4Z2W A;  4XDJ A;  3E8B A;  4RQF A;  3K5N A;  4KUM A;  2JIZ G;  2YEA A;  4U3F H;  4PL9 A;  1WA8 A;  3ASN C;  1VAR A;  1XMQ O;  3SPC A;  1NTK H;  3JAR B;  2GFD A;  1Y74 B;  4PI0 A;  4TV9 B;  2KB1 A;  5LP6 B;  3W7X A;  4WF9 V;  4CH3 A;  1M57 B;  4W4K A;  4DR4 O;  3PEJ A;  1KB9 F;  3BRC A;  3JCU Z;  5LMN B;  2YE4 A;  5B1B B;  1QBZ A;  4ASU G;  1BQZ A;  1DTO A;  2YE3 A;  2AHZ A;  2LFS A;  2YKI A;  1F23 A;  1UYK A;  4FPP A;  4X89 A;  3BY6 A;  1BZK A;  3CXH F;  1VMG A;  1IBM B;  5LA6 B;  2IH3 C;  3OTO B;  4JI0 B;  4LWS B;  1AR1 B;  1RP3 B;  3RLR A;  2O57 A;  2EJ7 A;  4O07 A;  4I0X B;  3OR7 C;  2YE5 A;  2OIE A;  1Y8O A;  4DR3 O;  1ZSP A;  4J7J A;  3D36 C;  2F66 C;  4GX5 A;  2BU8 A;  3CB2 A;  2UUC B;  1I94 O;  4YKU A;  3ZHT A;  2HHI A;  4P30 A;  3FX7 A;  2KQX A;  4CS4 A;  3CRK A;  2OT5 A;  4NTW A;  1NS1 A;  3HKC B;  5E1A C;  1HNW O;  4JAV A;  4YKQ A;  1NHH A;  4B7P A;  4XD8 A;  4DK1 A;  2LO1 A;  4MB9 A;  3BCC H;  4DW0 A;  4Z1V A;  3D8C A;  5K1P A;  1N4C A;  1W0J G;  4FVM A;  2G38 A;  3H01 A;  1VQN V;  1DLB A;  2ZE8 A;  3IC9 A;  3EKR A;  4TUY B;  4MW8 A;  4X65 O;  5BR8 O;  3R4P A;  3CCE V;  3A2F A;  1UYF A;  1H2G A;  2DE0 X;  5J2U A;  2MW2 B;  1TID A;  1TAE A;  3LDC A;  3I56 V;  3OUF A;  3T10 A;  1N36 O;  2NN4 A;  4JI5 B;  2FTK A;  1SER A;  1KC8 W;  1LNQ A;  1EBO A;  2ZD9 A;  3TCU A;  2Q4P A;  4D6T H;  5J2T A;  3A0H Z;  2CCS A;  4QNH B;  5CA1 A;  3LDD A;  4K0K B;  3N2K B;  1Q86 W;  1E79 G;  2MK3 A;  4H33 A;  2YE7 A;  3R66 A;  4K3A A;  3DGE A;  3T0H A;  4DV5 O;  2X6B A;  4DUH A;  2GUZ B;  3K3W A;  2QWQ B;  4DUZ B;  4I50 A;  5LHI A;  2WI2 A;  2PYJ A;  1YT1 A;  2E75 B;  5B1N A;  2A0L A;  4GX0 A;  3RYC B;  1YEW A;  4XC0 A;  2P7T C;  4FIP C;  1IVS A;  4D7S A;  4LCU C;  4UCR A;  2YI9 A;  4X1K B;  4O4J B;  2ITC C;  5CA0 A;  4DR1 O;  1Q6U A;  1D5A A;  2RCV A;  3R91 A;  2OWO A;  1FFX B;  3A0R A;  4IHJ B;  4DV0 B;  3MHS C;  3ETD A;  2VQF O;  5M4H A;  2XND G;  2EX3 A;  1AIL A;  1SC5 B;  3OR6 C;  2IJK A;  3LUT B;  3MHH C;  4A5U B;  2YGF A;  2KG7 B;  2BU2 A;  3GWO A;  2GHY A;  4BW5 A;  2EIJ C;  4R8C A;  2EIL B;  1Q6I A;  3RYH A;  1YI2 V;  4KHP O;  3UT5 A;  3DC6 A;  1NTZ H;  4P2Z A;  2GV9 A;  3KCX A;  3CMA V;  4TQF A;  3ABM B;  4CH4 A;  1DGS A;  1B62 A;  5JQG B;  3B27 A;  1Y67 A;  4X66 B;  4J80 A;  2PTM A;  5KUK A;  2B9Z A;  1AI7 A;  5JH7 B;  3B8N A;  4URM A;  3HZ5 A;  2YKJ A;  1CEZ A;  1OCR B;  3JAR A;  1Y74 A;  2UWD A;  3ABL B;  4TV9 A;  2Y48 A;  3H1J H;  1KD1 W;  2XHX A;  5LP6 A;  2YI0 A;  3T4D A;  1SQG A;  5LYJ B;  3OT7 A;  4W7T A;  3TZ2 A;  3FYI B;  4KFG A;  1YC1 A;  2JS5 A;  5KAI Z;  1BCC H;  3JAS B;  3H80 A;  1WP8 A;  2WLL B;  1K3E A;  2Q68 A;  1GK9 A;  3TZ4 A;  3LNN A;  4UVC A;  2BU5 A;  1K5Q A;  5LHG A;  1NJI W;  1L0O A;  2EIN C;  1WB8 A;  3TXS A;  1HNZ B;  3SPI A;  2V7Q G;  2WSS G;  4PEL A;  5LA6 A;  4LWS A;  4WFA V;  1AR4 A;  2ATK C;  3K5L A;  1I5B A;  4UB6 Z;  5L3C A;  4I0X A;  3LNM B;  1XHZ A;  2DW4 A;  1QYE A;  3TGU H;  1IBL O;  3VHC A;  3JD2 A;  1XRE A;  3JAW A;  4LF9 O;  3K5M A;  3AG3 C;  3ZBH A;  3CYG A;  2E76 B;  1R73 A;  2F4V O;  4LFB B;  4TOI A;  1WAZ A;  4X64 B;  4GKJ B;  1JVM A;  3CCJ V;  1P4R A;  2BTQ B;  4OX9 B;  1YC3 A;  4LF8 O;  4MP2 A;  4TT3 G;  2YJX A;  3HKC A;  5DED A;  1YES A;  3S5T A;  2YSU B;  3D3Q A;  4DO2 A;  1YJW V;  4I9W A;  1Y8P A;  3OEE G;  3OAA G;  4NB5 A;  4RUF A;  1TC0 A;  3J7A U;  3VHD A;  1PL0 A;  2ZM6 O;  5CF0 A;  4QE7 A;  2ITD C;  2QG0 A;  3A0T A;  4B3S B;  2JEU A;  1HR0 O;  2QWN B;  4TUY A;  2UXB B;  2XX4 A;  1AH6 A;  1K4D C;  4GEE A;  2YEE A;  4FLT A;  3DSQ A;  4LF7 O;  5IE9 A;  2Q8V A;  4DR6 B;  4PA3 A;  4GX2 A;  3SYQ A;  1NKD A;  3K99 A;  3KCY A;  5CBF A;  1YDX A;  2QM8 A;  1W59 A;  5B5E Z;  5EYP B;  2VWJ A;  4MTX A;  4CS2 A;  2ZBK B;  5J9P C;  1DF5 A;  4MVS A;  2Q5Z A;  2WWW A;  4G28 B;  4PV1 B;  1FD9 A;  2A79 B;  4CH5 A;  2H8P C;  4J41 A;  4CWQ A;  5FL7 G;  4XCL A;  5KMG B;  2GUZ A;  3APQ A;  1S16 A;  3E83 A;  3SPH A;  4E2L A;  2E5L O;  4W4L A;  4KSG A;  1PNM A;  1M56 B;  3L70 H;  4JI7 B;  1R6K A;  1US6 A;  1MAB G;  1AJP A;  1O9H A;  1BS3 A;  3WQ9 A;  3RYC A;  1GJV A;  1IZ3 A;  5JCO A;  1H2K A;  1VQO V;  2Q7E A;  4X1K A;  1S72 V;  4O4J A;  4LFC O;  1XOU A;  3CCU V;  3G71 V;  2ADP A;  3U11 A;  3BA9 A;  4GUN A;  4X1Y B;  1FFX A;  4PDL A;  2XD6 A;  4IHJ A;  1US7 A;  5DN6 G;  4XCJ A;  1Z5W A;  4DV6 B;  4U3J B;  4DR7 O;  1QHT A;  2KG7 A;  2XAH A;  2XX2 A;  4PDM A;  3AG7 A;  1MZF A;  3P3N A;  2W6J G;  3JAT B;  1KZN A;  1N33 B;  4LWH A;  1D2D A;  3OW2 U;  1P7B A;  3F7Y C;  4AI8 A;  3CS5 A;  3LSU A;  1JPX A;  1NH2 B;  5JQG A;  4PA9 A;  3O6O A;  3CEI A;  2BOB C;  2DN9 A;  2YK9 A;  4DXW A;  4JYA B;  5IYZ B;  5JH7 A;  2Y0P A;  3JSL A;  1GKF A;  4ASB A;  1EI1 A;  4MW3 A;  3OUS A;  3QO7 A;  3HKE B;  4MTF A;  3RWR D;  4YY3 B;  3T4Z A;  2CTW A;  4DR5 O;  4JAA A;  5LYJ A;  2XCM A;  4LH7 A;  1EN4 A;  5LGN A;  1QLN A;  2OTL V;  4KSH A;  4PA7 A;  3S3W A;  4JI4 O;  1U2O A;  1Q90 D;  3JAS A;  4WFB V;  3T1H B;  1I5A A;  1N34 B;  2WLL A;  2YEJ A;  2LJ2 A;  4JYB A;  2BZ5 A;  5FWK A;  3EKO A;  1UYD A;  3ABK B;  4JF3 A;  3SYO A;  4NR1 A;  2YID A;  5J6A A;  4OPA A;  2WEQ A;  2PI5 A;  2BRC A;  1FXK B;  2NR5 A;  3H1L H;  4U93 A;  1QLE B;  2QGN A;  4RAI A;  3H1K H;  4DV4 B;  4X62 O;  4LF6 O;  3T2S A;  1OCO C;  4ZI7 B;  4R6Z A;  3K03 A;  3R65 A;  4PU9 A;  3OE7 G;  4DUY O;  1MA1 A;  3IC7 A;  3E2E A;  2BE3 A;  1Y4U A;  1H2M A;  3X2Q C;  2Q9L A;  2OYQ A;  2P6J A;  3GWK C;  5KX5 B;  1A32 A;  1MSW D;  4JZG A;  4BQJ A;  1G4Y B;  4PDR A;  3MDS A;  2M7W A;  2O1U A;  2BTQ A;  5CTU A;  3CP1 A;  3JD0 A;  4UXN A;  1BYQ A;  4HAM A;  1X59 A;  4XBF A;  3FT8 A;  4PRX A;  1UY9 A;  3AG2 B;  3A0Y A;  1VQ8 V;  3CC4 V;  2IU0 A;  1I58 A;  2PY5 A;  2IOR A;  3CD6 V;  5B1A B;  5IWA O;  5C8Y B;  3QG5 A;  4H13 B;  2W0F C;  3SJQ C;  1TBW A;  3B25 A;  2UXN A;  4LWF A;  4P8O A;  3CCL V;  2PF4 E;  2HP8 A;  4EGK A;  2E0A A;  2JGD B;  3ML0 A;  4K4O A;  4LF5 O;  5CPH A;  4JI8 O;  2CUG A;  4X8A A;  2RMK B;  4NXM O;  2ZT9 B;  4DV3 B;  3JSN A;  1VQK V;  1F7Y A;  2H3O A;  4HXZ A;  3IAY A;  4EGI A;  1DK1 A;  3LMM A;  4DW1 A;  1QR8 A;  5LP6 C;  1M57 C;  5EYP A;  1VQL V;  3CPW U;  4JQL A;  4GKK O;  5CB4 B;  2JJ2 G;  5B1B C;  4HNA B;  5BMV B;  2ZKJ A;  1YET A;  3U10 A;  2ZE5 A;  3LNU A;  2JEX A;  1WN7 A;  3W7S A;  1GKX A;  5L3B A;  4YKZ A;  3HKB B;  4MT8 A;  2FB5 A;  5KMG A;  1JJ2 U;  3WB1 A;  4CWR A;  3T1C A;  3IFX A;  1YTF B;  3EFF K;  4UUJ C;  5ITZ B;  5D6Q A;  1TUE B;  3JZ3 A;  2B1G A;  2XHR A;  2YIB A;  4LC1 A;  2F93 B;  2CGO A;  4AIL C;  1J5E O;  2PI4 A;  3K60 A;  1FXV A;  3K5O A;  4XKO A;  4BW9 A;  4DRX B;  1AJQ A;  3QO5 A;  2RN9 A;  1XNR B;  4YKW A;  1YSC A;  4X1Y A;  4JI1 O;  2K1E A;  1NU1 H;  4DYL A;  1KEC A;  2QWR B;  1V54 B;  2JGU A;  3OGI B;  2JJC A;  4K8Z A;  4JYY A;  1KIJ A;  4DV2 B;  4RWU A;  4U3J A;  1SKV A;  2ODM A;  3TET A;  4R3M A;  2YEI A;  2LP7 A;  3RYF B;  2VQE B;  4E02 A;  2GTA A;  2HG5 C;  1SES A;  3JAT A;  2BOC C;  5H5N A;  1YT2 A;  4QPK A;  1YIT V;  1SQF A;  4HYM A;  3Q5J A;  3L73 H;  3GIE A;  3INX A;  3CGZ A;  1U97 A;  3KZI Z;  4UCO A;  3SR2 C;  2WA4 A;  3U0Z A;  4GYC B;  1M5I A;  5L3F A;  2WLH A;  1L0L H;  2P90 A;  5IYZ A;  3CRQ A;  4F4L A;  3HPL C;  3RW0 A;  3F5W C;  1I08 A;  5CTW A;  2FL4 A;  2WA3 A;  1OCC B;  1KP3 A;  3JD4 A;  3HKE A;  4KTN A;  4MVO A;  2YGA A;  3E8H A;  4NXN B;  1XNQ O;  4O4I B;  4GX1 A;  2UXC O;  4YJ3 B;  4DV1 O;  2ZIN A;  1AP6 A;  3CXC U;  4UFZ A;  3FV5 A;  4PRV A;  3T1Y O;  4CWF A;  3QTC A;  4PI2 A;  4B3T B;  1I5Y A;  1GKZ A;  3K0D A;  3QVN A;  1B06 A;  2JDI G;  2CTQ A;  4EEQ A;  3U2K A;  2CG9 A;  5C93 A;  1VF5 B;  3RN4 A;  4OGQ B;  4J7Z A;  2PYL A;  1NR1 A;  2AZ0 A;  1FXK A;  4HYP A;  1F51 A;  3H4L A;  1WPX A;  1H2S B;  3G6E V;  5CMU A;  3B26 A;  1H8E G;  1L0N H;  4XTJ A;  5GTI Z;  4CE2 A;  5A2Q N;  3G6B A;  2AKP A;  5EBL C;  1CP9 A;  4ZI7 A;  4JTC B;  5JCO C;  2GDS A;  1K73 W;  1BQ0 A;  3VAD A;  3OFN G;  3JAW B;  1KQS U;  4CE1 A;  1M9N A;  5KX5 A;  3O65 A;  2VRZ A;  4FLV A;  4EEH A;  1FPO A;  4JI6 O;  1M4U A;  2QA4 V;  1AI4 A;  3RVY A;  2XDL A;  3G67 A;  1BXD A;  1BMF G;  1EN6 A;  2UUA O;  4F6R B;  2WI7 A;  5F3K A;  3L75 H;  3BMY A;  4MTG A;  1MNG A;  3CSX A;  2YKE A;  3RBZ A;  4IT5 A;  2WLN A;  4MVU A;  3C3T A;  1NQT A;  2WAM A;  5L3E A;  2EIL C;  2IOQ A;  1VF6 A;  1GN4 A;  3M99 B;  5C8Y A;  4IYI A;  4AHC A;  2HVK C;  1UPG A;  4B3R B;  1SZX A;  4UCV A;  3ABM C; 
#chains in the Genus database with same CATH homology
 3HYZ A;  1UYI A;  3CCS V;  2BYH A;  5EK0 A;  1JOY A;  1RPR A;  2B1I A;  1BHB A;  3ZKB A;  3BM9 A;  2YEB A;  3FT5 A;  1ZXM A;  4HY1 A;  1OCR C;  2YE9 A;  3CGY A;  3ABL C;  3ZMU A;  1AJ6 A;  3E8F A;  4WFF A;  2JK5 C;  4XIR A;  1UJW B;  4BXI A;  5IY5 C;  2DYR C;  2WI3 A;  4BQG A;  4DZY A;  2Q2E B;  1VQ9 V;  2ZXW B;  3E35 A;  3CRL A;  1F4N A;  3CC7 V;  3WG7 B;  2BU7 A;  4ZBM A;  4MOT A;  2YE2 A;  2H55 A;  2YE8 A;  3RVZ A;  2XJX A;  2GQP A;  2BU6 A;  1JM6 A;  4O09 A;  5FNF A;  3W7U A;  2XAF A;  3SL2 A;  3FYE B;  2AHY A;  1R3I C;  1GTO A;  2FWZ A;  3ZN0 A;  4GT1 A;  4BIU A;  1NH2 D;  4MPN A;  4H85 A;  2H94 A;  1UY6 A;  4XIQ A;  2Q6A A;  1K97 A;  1YJN V;  1TC6 A;  4HZ0 A;  3OW6 A;  1GO3 F;  5L3G A;  1R3K C;  2HR3 A;  1S5H C;  4JGS A;  4J9Y B;  2XDX A;  4WUB A;  1N8R W;  2P67 A;  3W7W A;  3STL C;  4WFE A;  1XL6 A;  3AG4 B;  4X9L A;  4O05 A;  2DWE C;  4FK5 C;  5B1O A;  5H6R A;  4LWG A;  2Q8G A;  2D3O W;  4RUE A;  1YER A;  1MX0 A;  5IY5 B;  2DYR B;  1K8A W;  4U7N A;  2X7R B;  2WLM A;  3ZXO A;  5BOC A;  3ABU A;  3KG2 A;  2YKC A;  3P30 A;  4H81 A;  3WFV A;  3B8M A;  3AG1 B;  2EZO A;  3B28 A;  5EBM C;  1M56 C;  2DWD C;  5M4M A;  2WLI B;  5EC1 C;  2EZP A;  2Q67 A;  1NHJ A;  3CCQ V;  2XOK G;  1MOF A;  5H6Q A;  2YEH A;  4UV8 A;  2LFR A;  4CE3 A;  3GIG B;  2YEV B;  4XKA A;  4PA4 A;  3K04 A;  3K0G A;  3R92 A;  5EC2 C;  5BZB A;  5KUM A;  3SYP A;  1TH8 A;  1SZT A;  1PVG A;  2PNR A;  1GM7 A;  2Z5U A;  1K7D A;  5D7R A;  1J95 A;  4WUC A;  4AWQ A;  2X6C A;  1YSR A;  4KP4 A;  1CPY A;  3SYA A;  4YKX A;  5LGU A;  1H38 A;  4MVR A;  2XX5 A;  5LGT A;  2Q8I A;  4BAY A;  2X6A A;  4OXS A;  4V26 A;  1V55 B;  3LPS A;  3LSS A;  1FFT B;  4LBE C;  1YTF D;  2IWU A;  2IWX A;  4GT8 A;  2EXL A;  2ZDI A;  2OCC B;  2XAS A;  4B6C A;  4JYC A;  3SPJ A;  2YI7 A;  2QM7 A;  2VCJ A;  4L94 A;  5CTY A;  5B3S B;  5FNC A;  1YC4 A;  4XDM A;  3ABK C;  3OMU A;  2WER A;  3ETG A;  3CCV V;  1FXK C;  1PNL A;  3A0X A;  1QLE C;  2WI1 A;  2ZDX A;  2BT0 A;  1COW G;  4EGH A;  5M4K A;  5M4E A;  2BTZ A;  5D7D A;  3CWV A;  5EBW C;  1I5X A;  3OMI B;  2YEF A;  2H8M A;  1GM9 A;  4V25 A;  4AS9 A;  3R4O A;  1K9M W;  3OMN B;  4BAE A;  1S3J A;  2HVJ C;  1QVF U;  3AG2 C;  2QE7 G;  4L8Z A;  4P7A A;  2ZQM A;  1AH8 A;  5B1A C;  3OWD A;  1S0V A;  3ZIA G;  1K4C C;  1OCZ B;  2Z3Y A;  2EIM B;  3GB7 C;  3D3I A;  5LBQ A;  4LWE A;  4U7O A;  2F43 G;  3JCZ A;  3ZRV A;  1ROP A;  4E01 A;  2HKO A;  2IU3 A;  2WLK A;  4O0B A;  1VQ6 V;  2YJW A;  1YHQ V;  2XAG A;  4HZ3 A;  2XDK A;  5D7C A;  3ZMS A;  2WI5 A;  2YEC A;  4R3A A;  1HWY A;  4FJC C;  4MP7 A;  2WLI A;  3ZN1 A;  1K33 A;  1VQ7 V;  4ASF A;  1K5S A;  1DF4 A;  4RQE A;  4L93 A;  3GIG A;  1YIJ V;  2FWY A;  1UYH A;  2YEV A;  3B24 A;  4MBC A;  3TTZ A;  1V54 C;  1M1K W;  3JD3 A;  4I5S A;  4JAS A;  3G7B A;  3BEH A;  5CTX A;  4J9Z B;  3OMA B;  4YKR A;  2QFO A;  1I59 A;  1Y4M A;  3ZMT A;  3U2D A;  3EHB B;  3W7T A;  2CCT A;  4MS2 A;  3VHA A;  1AM1 A;  4P9O A;  4XKK A;  1W0K G;  2Y69 B;  1UYG A;  3Q5K A;  2WEP A;  5HFM A;  3OM3 B;  1W2B U;  2XHT A;  1OCC C;  2EIK B;  2O1W A;  3EHH A;  4XDK A;  2IJJ A;  3HB3 B;  1JX9 A;  1JQ0 A;  3VBB A;  3G7E A;  1VQ5 V;  1NHI A;  3G4S V;  1OHH G;  2XDU A;  2DYS B;  4QPJ A;  3CME V;  1Y8N A;  2CK3 G;  4TWK A;  3STZ C;  2Q69 A;  3CCR V;  3K97 A;  3HHU A;  5IYD O;  2BSM A;  4HY6 A;  1VQM V;  3VOU A;  4XE2 A;  1RM1 B;  4L90 A;  4MSW C;  2FXS A;  3JD1 A;  3C0E A;  3FB8 C;  1XL4 A;  3T2M A;  3OWB A;  4YKT A;  1UY8 A;  4EFT A;  4QIW F;  2A9H A;  3TZ5 A;  2Q8H A;  2VCI A;  2B5U A;  1MU5 A;  1SRY A;  2Q8F A;  1B6Q A;  3D2R A;  1PKX A;  1ORQ C;  2DQ3 A;  2IH1 C;  4BIZ A;  1WLE A;  2GSM B;  1BL8 A;  4FCQ A;  1S77 D;  3FB7 C;  2EJR A;  1JCH A;  1Y66 A;  4FCP A;  4WUD A;  4MPC A;  1BGQ A;  2ZDI C;  4CBC A;  3MNR P;  2HJF C;  4L87 A;  4MPE A;  5GW7 A;  4JAU A;  2ZXW C;  3P32 A;  5CBG A;  4URO A;  3WG7 C;  2OTJ V;  5H9C A;  2NNU A;  3PEH A;  2YKB A;  1MG1 A;  4JTD B;  5IDM A;  3KE6 A;  2FYP A;  1B3Q A;  1NVP B;  3LDE A;  3EHF A;  3A0Z A;  3K06 A;  4PA6 A;  3ZCC A;  1QR9 A;  4WCE V;  4X88 A;  4YXW G;  4MVZ A;  1R6N A;  1E1R G;  1UYL A;  1SET A;  3ZM7 A;  5IYB O;  2XJG A;  3K79 A;  1I5C A;  2WLJ A;  3O2F A;  5KA5 A;  1ARO P;  4HYO A;  5HFL A;  3ASO B;  3ZXQ A;  5M4P A;  3RLP A;  4KQV A;  3AG4 C;  3ASN B;  4CWS A;  4R7C A;  1I5D A;  4UVB A;  1QY8 A;  3U67 A;  4UVA A;  2XAJ A;  4CZZ A;  4CWT A;  3G75 A;  4L91 A;  5BOD A;  1OSF A;  2ZR2 A;  4WFH A;  5L3D A;  2HCH A;  3AG1 C;  3ABT A;  3B77 A;  1RPO A;  3ZJZ A;  3OPD A;  3NXS A;  3QTF A;  1K92 A;  3E86 A;  1Z5A A;  3RLQ A;  3QNE A;  5KA6 A;  4I3H A;  4ZVI A;  2O1V A;  1S76 D;  1KKD A;  5DM6 V;  4NH7 A;  4N23 A;  4E00 A;  1R3J C;  3PJS K;  2VWC A;  4GQT A;  1EA6 A;  3QO8 A;  2HLD G;  1QCE A;  2HKJ A;  2CCU A;  3INW A;  1KP2 A;  3K98 A;  3HZ1 A;  4XIT A;  4FMT A;  3CC2 V;  2YEG A;  2BRE A;  1V55 C;  2YI6 A;  1L1F A;  4LP0 A;  4QJF B;  3WHA A;  4LP8 A;  1R62 A;  2XAB A;  2OCC C;  1EFR G;  2XK2 A;  3ETE A;  4XIP A;  4GCZ A;  1UYE A;  5B3S C;  1GMG A;  4EMV A;  2R9I A;  4CWO A;  1Z59 A;  4AWP A;  1E1Q G;  2ZR3 A;  3R4M A;  1M90 W;  5CBH A;  4URN A;  3TZ0 A;  3ZMZ A;  1AI5 A;  4H37 A;  4ZKI A;  4URL A;  2YI5 A;  1ID0 A;  4N21 A;  1YS3 A;  2HFE C;  4H7Q A;  2EIJ B;  3FB5 C;  3FB6 C;  1ZXN A;  1F4M A;  2IW5 A;  2XDS A;  5IYC O;  1VQ4 V;  1OCZ C;  2IWS A;  2EIM C;  3C11 A;  3OGC C;  4NH8 A;  1FS0 G;  4RO2 A;  1AJN A;  2IOP A;  4UV9 A;  4EFU A;  1AI6 A;  3UM7 A;  3AEI A;  1Q82 W;  3CYO A;  4MTO A;  2BYI A;  5FND A;  1A4H A;  1VQP V;  3A0W A;  1G8M A;  1Q81 W;  1Z5C A;  2VW5 A;  1K34 A;  4Q20 A;  4LWI A;  4JPR A;  2EIN B;  4P9P A;  1TIL A;  4R50 A;  3Q5L A;  3R4N A;  4CWP A;  2YK2 A;  4FCR A;  4YKY A;  1IXM A;  3AG3 B;  4ASA A;  5IDJ A;  3F7V C;  3CCM V;  3D36 A;  4GGL A;  1UYC A;  1NR7 A;  1FXH A;  2QKS A;  3LSQ A;  3ZMV A;  2V1D A;  3D0B A;  3NMQ A;  1THN A;  2EBO A;  1B63 A;  3TK1 A;  4HZ5 A;  1H7U A;  3QDD A;  2R9R B;  2X0L A;  5LHH A;  2K5B A;  1UY7 A;  2Y69 C;  1NBM G;  1ENV A;  2IJI A;  3ZRW B;  1Z5B A;  4WFG A;  3GIF A;  2EIK C;  3E8G A;  4QE9 A;  2IJH A;  2QTO A;  2XJJ A;  1H8H G;  1OZ0 A;  1BKN A;  1ZWH A;  3HEK A;  1PD3 A;  4G2K A;  3FKS G;  1Y4S A;  4EM7 A;  2CH4 A;  2DYS C;  1NVP D;  4GFN A;  1YSZ A;  3T0Z A;  4NH9 A;  4LPB A;  3O0I A;  1YT0 A;  4PDV A;  3K08 A;  3ZRS A;  3OEH G;  5CN0 A;  1QZR A;  1ZWI C;  3EHG A;  5M4N A;  1U0Z A;  2NLJ C;  3SYC A;  3TUH A;  1RM1 C;  4MVM A;  1S14 A;  2JJ1 G;  4TSF G;  5J71 A;  2YE6 A;  5IN9 A;  4XDL A;  1UYM A;  1QVG U;  2WI6 A;  4CWN A;  5F5R A;  2XAQ A;  1PNK A;  3IED A;  4HXW A;  1EZJ A;  2YED A;  3EHJ A;  1THZ A;  2ZDY A;  3ZKD A;  1BHA A;  3RKZ A;  4G27 B;  4O04 A;  1H7S A;  5CA3 A;  3UKM A;  3JYC A;  3E89 A;  3K9A A;  3I55 V;  3IGA C;  4EKW A;  2CGF A;  5GGZ A;  4KFM A;  4ASG A;  3MD0 A;  4JTA B;  3SPG A;  2JKI A;  2QF6 A;  2HG1 A;  3HYY A;  3T1K A;  4MVQ A;  2UXX A;  4AWO A;  4R1F A;  1OCO B;  4Z1M G;  2ESA A;  3X2Q B;  2WI4 A;  2W6I G;  1GM8 A;  5D6P A;  5L3J A;  2QG2 A;  1Q7Y W;  3ZRX A;  2C2A A;  2YGE A;  2DQ0 A;  2WPD G;  2QEX V;  1YJ9 V;  1AMW A;  1R3L C;  3DTU B;  3ZRW A;  1ZW9 A;  3ASO C;  4XDJ A;  3E8B A;  4RQF A;  4KUM A;  2JIZ G;  2YEA A;  4PL9 A;  3ASN C;  3SPC A;  2GFD A;  2KB1 A;  3W7X A;  4WF9 V;  1M57 B;  3PEJ A;  2YE4 A;  5B1B B;  1QBZ A;  4ASU G;  1DTO A;  2YE3 A;  2AHZ A;  2LFS A;  2YKI A;  1F23 A;  1UYK A;  4FPP A;  4X89 A;  3BY6 A;  2IH3 C;  1AR1 B;  3RLR A;  4O07 A;  3OR7 C;  2YE5 A;  1Y8O A;  4GX5 A;  2BU8 A;  4YKU A;  4P30 A;  3CRK A;  2OT5 A;  5E1A C;  4JAV A;  4YKQ A;  1NHH A;  4B7P A;  4XD8 A;  4MB9 A;  1W0J G;  3H01 A;  1VQN V;  1DLB A;  3EKR A;  4MW8 A;  3R4P A;  3CCE V;  1UYF A;  1H2G A;  1TID A;  3LDC A;  3I56 V;  3OUF A;  3T10 A;  2FTK A;  1SER A;  1KC8 W;  1LNQ A;  1EBO A;  2ZD9 A;  3TCU A;  2CCS A;  4QNH B;  3LDD A;  1Q86 W;  1E79 G;  2MK3 A;  4H33 A;  2YE7 A;  3T0H A;  3DGE A;  4DUH A;  2X6B A;  3K3W A;  5LHI A;  2WI2 A;  1YT1 A;  5B1N A;  2A0L A;  4GX0 A;  4XC0 A;  2P7T C;  4FIP C;  4LCU C;  2ITC C;  3R91 A;  3A0R A;  3MHS C;  3ETD A;  5M4H A;  2XND G;  3OR6 C;  2IJK A;  3LUT B;  3MHH C;  2YGF A;  2BU2 A;  3GWO A;  2GHY A;  4BW5 A;  2EIJ C;  4R8C A;  2EIL B;  1YI2 V;  4P2Z A;  3CMA V;  3ABM B;  1B62 A;  3B27 A;  5KUK A;  1AI7 A;  3B8N A;  4URM A;  3HZ5 A;  2YKJ A;  1CEZ A;  1OCR B;  2UWD A;  3ABL B;  2Y48 A;  1KD1 W;  2XHX A;  2YI0 A;  3T4D A;  4W7T A;  3TZ2 A;  3FYI B;  4KFG A;  1YC1 A;  3H80 A;  2WLL B;  1K3E A;  2Q68 A;  1GK9 A;  3TZ4 A;  4UVC A;  2BU5 A;  1K5Q A;  5LHG A;  1NJI W;  1L0O A;  2EIN C;  3SPI A;  2V7Q G;  2WSS G;  4PEL A;  4WFA V;  2ATK C;  1I5B A;  5L3C A;  3LNM B;  2DW4 A;  1QYE A;  3VHC A;  3JD2 A;  3AG3 C;  1R73 A;  1JVM A;  3CCJ V;  1P4R A;  1YC3 A;  4MP2 A;  4TT3 G;  2YJX A;  1YES A;  2YSU B;  4DO2 A;  1YJW V;  4I9W A;  1Y8P A;  3OEE G;  3OAA G;  4RUF A;  1TC0 A;  3VHD A;  1PL0 A;  5CF0 A;  4QE7 A;  2ITD C;  2QG0 A;  3A0T A;  2JEU A;  2XX4 A;  1AH6 A;  1K4D C;  4GEE A;  2YEE A;  4PA3 A;  4GX2 A;  3SYQ A;  1NKD A;  3K99 A;  5CBF A;  2QM8 A;  4MTX A;  2ZBK B;  5J9P C;  1DF5 A;  4MVS A;  2WWW A;  4G28 B;  2A79 B;  2H8P C;  4CWQ A;  5FL7 G;  4XCL A;  1S16 A;  3E83 A;  3SPH A;  4E2L A;  4KSG A;  1PNM A;  1M56 B;  1R6K A;  1MAB G;  1AJP A;  3WQ9 A;  1GJV A;  1VQO V;  1S72 V;  3CCU V;  3G71 V;  4PDL A;  2XD6 A;  1US7 A;  5DN6 G;  4XCJ A;  2XAH A;  2XX2 A;  4PDM A;  2W6J G;  1KZN A;  4LWH A;  3OW2 U;  1P7B A;  3F7Y C;  1JPX A;  1NH2 B;  4PA9 A;  3O6O A;  2BOB C;  2YK9 A;  4DXW A;  1GKF A;  4ASB A;  1EI1 A;  4MW3 A;  3OUS A;  3QO7 A;  4MTF A;  3T4Z A;  2XCM A;  5LGN A;  1QLN A;  2OTL V;  4KSH A;  4PA7 A;  1U2O A;  4WFB V;  1I5A A;  2WLL A;  2YEJ A;  4JYB A;  2BZ5 A;  5FWK A;  3EKO A;  1UYD A;  3ABK B;  4JF3 A;  3SYO A;  5J6A A;  2WEQ A;  2PI5 A;  2BRC A;  1FXK B;  4U93 A;  1QLE B;  4RAI A;  3T2S A;  1OCO C;  4R6Z A;  3K03 A;  3R65 A;  4PU9 A;  3OE7 G;  3IC7 A;  3E2E A;  1Y4U A;  3X2Q C;  2P6J A;  1MSW D;  4BQJ A;  1G4Y B;  4PDR A;  2M7W A;  2O1U A;  5CTU A;  3CP1 A;  3JD0 A;  4UXN A;  1BYQ A;  4HAM A;  3FT8 A;  4XBF A;  4PRX A;  1UY9 A;  3AG2 B;  3A0Y A;  1VQ8 V;  3CC4 V;  2IU0 A;  1I58 A;  2IOR A;  3CD6 V;  5B1A B;  4P8O A;  3SJQ C;  2W0F C;  1TBW A;  3B25 A;  4LWF A;  2UXN A;  3CCL V;  4EGK A;  2E0A A;  3ML0 A;  4K4O A;  5CPH A;  4X8A A;  1VQK V;  4HXZ A;  4EGI A;  1QR8 A;  1M57 C;  1VQL V;  3CPW U;  4JQL A;  2JJ2 G;  5B1B C;  2ZKJ A;  1YET A;  3LNU A;  2JEX A;  3W7S A;  1GKX A;  5L3B A;  4YKZ A;  4MT8 A;  1JJ2 U;  4CWR A;  3T1C A;  3IFX A;  1YTF B;  3EFF K;  4UUJ C;  5D6Q A;  1TUE B;  3JZ3 A;  2B1G A;  2XHR A;  4LC1 A;  2PI4 A;  3K60 A;  1FXV A;  4XKO A;  1AJQ A;  3QO5 A;  4YKW A;  1YSC A;  2K1E A;  1KEC A;  1V54 B;  2JJC A;  1KIJ A;  3TET A;  4R3M A;  2YEI A;  2LP7 A;  4E02 A;  2HG5 C;  1SES A;  2BOC C;  1YT2 A;  4QPK A;  1YIT V;  4HYM A;  3Q5J A;  3GIE A;  3INX A;  3CGZ A;  5L3F A;  2WLH A;  2P90 A;  4F4L A;  3HPL C;  3RW0 A;  3F5W C;  5CTW A;  1OCC B;  1KP3 A;  3JD4 A;  4KTN A;  4MVO A;  2YGA A;  3E8H A;  4GX1 A;  3CXC U;  3FV5 A;  4PRV A;  4CWF A;  1I5Y A;  1GKZ A;  3K0D A;  2JDI G;  3U2K A;  2CG9 A;  5C93 A;  1NR1 A;  1FXK A;  4HYP A;  1F51 A;  3H4L A;  1WPX A;  3G6E V;  5CMU A;  3B26 A;  1H8E G;  4XTJ A;  4CE2 A;  2AKP A;  5EBL C;  1CP9 A;  4JTC B;  1K73 W;  3VAD A;  3OFN G;  1KQS U;  4CE1 A;  1M9N A;  4EEH A;  2QA4 V;  1AI4 A;  3RVY A;  2XDL A;  1BXD A;  1BMF G;  2WI7 A;  5F3K A;  3BMY A;  4MTG A;  2YKE A;  3RBZ A;  2WLN A;  4MVU A;  5L3E A;  1NQT A;  2WAM A;  2EIL C;  2IOQ A;  3M99 B;  2HVK C;  3ABM C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...