5C93A

Histidine kinase with atp
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
239
structure length
235
Chain Sequence
b'VTEQQKIDNDRKQFVSNVSHELRTPLTSLRSYIEALSDGAWKDPEVAPGFLKVTQEETDRMIRMINELLSLSRMDSGTTRVDMELVNINEMFNYVLDRFDMILKKDDNPAKYYTIKREFTKRDLWVEIDTDKFTQVLDNIMNNAIKYSPDGGVVTCRLLETHNQVIISISDQGLGIPRADLGHVFDRFFRVDKAQGGTGLGLAISKEVVQMLGGRIWVDSVEGKGSTFYISLPYE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histidine kinase
publication title Conformational dynamics of the essential sensor histidine kinase WalK.
pubmed doi rcsb
source organism Lactobacillus plantarum 16
molecule tags Transferase
total genus 82
structure length 235
sequence length 239
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2015-06-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5c93A01
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 5c93A02
2FWYA 5J71A 3JZ3A 2BT0A 4H7QA 3R4MA 4JAVA 3HZ5A 3GIEA 1Y4SA 3IEDA 1TBWA 4LWEA 3ZCCA 1BXDA 4LWFA 3VHCA 4BIZA 3O6OA 1ZW9A 5CTWA 2YJWA 3C0EA 3U2KA 4ASFA 5BOCA 1YSZA 4XCLA 4ASGA 3OPDA 3K99A 2CCUA 4MBCA 4R3MA 4PRVA 5M4NA 1TILA 2HKJA 2WI7A 1UYEA 4GGLA 3R4PA 5IDMA 2Q8IA 4EFTA 4YKZA 2QG2A 3ZXQA 2ZKJA 1UY6A 4AS9A 2IORA 4JYCA 4B7PA 3D0BA 4P8OA 5B1NA 1TH8A 1ZWHA 3LNUA 3ZRXA 1UY9A 3PEHA 4PRXA 1UYHA 4YKUA 2ZBKB 1NHJA 4LWIA 2P67A 4XIQA 1I5AA 3CGYA 2XX4A 2YE3A 3A0ZA 4MT8A 2IWSA 4HXWA 4WUCA 3B28A 3CWVA 4EGKA 2XJXA 1U2OA 1Y8OA 2YKIA 4V26A 4CWFA 2Q8FA 1AH8A 2XDUA 1B63A 4KFGA 1TIDA 4GQTA 4FMTA 5L3JA 2JJCA 3T2SA 4CWQA 4EEHA 2WWWA 4BIUA 3R4OA 4XCJA 1ID0A 4WUBA 2CGFA 1GKZA 3FV5A 4GEEA 4YKRA 3DGEA 3U2DA 2LFSA 4CWOA 5CTUA 2O1UA 2YEJA 1Z5BA 1NHHA 3MNRP 5M4EA 3ZRVA 2BSMA 5B1OA 1UYCA 5M4KA 1H7UA 1UYIA 3TUHA 2QM7A 4ZKIA 4BAEA 3O0IA 3HYZA 4CWTA 1EI1A 2GQPA 3RLQA 2YE6A 4E00A 4O0BA 4HY1A 3ZXOA 2BU7A 4CE2A 4ASAA 3U67A 1I5DA 2YEIA 3HEKA 3OMUA 4FCRA 3NXSA 1KZNA 1UY7A 2VW5A 2YI6A 3EKOA 2YGEA 2YE8A 4JASA 4PU9A 2AKPA 3VHAA 3Q5KA 4EM7A 3VADA 4MPNA 4NH8A 3GIGA 4XKKA 4CWNA 5FNCA 2IOPA 3OW6A 4H81A 1UYFA 3TZ2A 4BQGA 1GKXA 1BYQA 4E02A 2FTKA 4URMA 3ZKBA 2O1WA 1YERA 4LWGA 4EGHA 4L8ZA 4KSHA 1OSFA 2LFRA 4YKTA 3A0RA 2YE7A 1UYDA 1YT1A 2VCIA 3BM9A 3OWDA 4U7OA 4WUDA 4U7NA 2BYHA 3C11A 4BQJA 2WI3A 2YEFA 3TZ0A 1YC4A 2FXSA 4GFNA 2XJJA 1KIJA 2CCTA 2XK2A 5C93A 3G7BA 2ESAA 4PL9A 2XHXA 1ZXMA 1QY8A 4L91A 2XABA 4NH9A 2XHRA 2XJGA 2BTZA 3K97A 2YEHA 4UROA 2XX5A 4R1FA 3B24A 4QPKA 2WI4A 3FT8A 3A0TA 4MPCA 1AJ6A 4MP2A 4DUHA 4X9LA 5CTYA 2QG0A 3INWA 4KQVA 2VWCA 3MD0A 4LP0A 2BU8A 4JYBA 2YEBA 4XKOA 2YGAA 3R92A 4EMVA 4E01A 1R62A 2H8MA 4CE3A 4XIRA 4YKYA 4BXIA 3QTFA 4XITA 4AWOA 2YE2A 2XDXA 1YETA 1Y8NA 4MTXA 3Q5LA 4K4OA 4KSGA 3B26A 5FNFA 2BU2A 2WI5A 2YKJA 3T1KA 1TC6A 2Q8HA 2YE9A 2XD6A 4FCQA 4XKAA 5FNDA 3H4LA 4HZ5A 1I5CA 4HZ0A 2BYIA 3EKRA 1US7A 2BRCA 2YKCA 4EFUA 3T10A 4CE1A 2XX2A 2IWXA 5M4HA 1Z59A 2YKBA 3TZ5A 2QF6A 2XDSA 2PNRA 3A0WA 2YE5A 5IDJA 1S16A 2Q2EB 1UYLA 1AMWA 1AH6A 2HG1A 4I5SA 1BKNA 3WQ9A 2YJXA 2YEEA 1YS3A 1QZRA 4HYPA 2EXLA 4MPEA 5D7DA 3CGZA 5F5RA 2BREA 2IWUA 4HYMA 2WI6A 1Y8PA 2YK9A 3GIGB 5FWKA 2C2AA 4XIPA 1Z5CA 3HYYA 2WEQA 4YKXA 4GT8A 1PVGA 5D7RA 3FT5A 4B6CA 2BU5A 1I5BA 2WERA 3WHAA 5D6QA 3ZRWA 3T0HA 3EHGA 4O04A 1I59A 3RLRA 3ZKDA 2YI0A 1MX0A 1H7SA 3TZ4A 2YKEA 1F51A 4CWSA 3RLPA 2YK2A 4HXZA 1I58A 3ZM7A 3EHFA 4O09A 2YEGA 4ASBA 3CRKA 1UYGA 2YI7A 2FWZA 3R91A 2QFOA 3PEJA 4XD8A 3D36A 5F3KA 5BODA 1UYMA 3GIFA 3K60A 3A0XA 4CWRA 4L93A 3INXA 2ZDYA 4XDMA 2YECA 5GGZA 3EHHA 4ZVIA 2XDLA 2BZ5A 1YC3A 1Y4UA 4AWPA 4LC1A 3NMQA 3QDDA 4FPPA 4FCPA 1YC1A 1B62A 1S14A 2CH4A 4V25A 4YKWA 4URLA 4XE2A 1YESA 4XTJA 4JQLA 3Q5JA 3KE6A 3HHUA 4GCZA 1QYEA 3K98A 2WEPA 4NH7A 2WI1A 4KP4A 3R4NA 3G75A 1B3QA 3B25A 1UY8A 3HZ1A 4H85A 1AM1A 1MU5A 3EHJA 4Q20A 4U93A 4W7TA 4URNA 4O07A 4JAUA 2QM8A 2YE4A 4YKQA 2YGFA 4EGIA 1IXMA 4HY6A 2UWDA 3BMYA 3P32A 3T0ZA 3TK1A 2O1VA 4L94A 5CPHA 5M4PA 2H55A 4LWHA 4O05A 1NHIA 1YSRA 2ZDXA 1BGQA 1Z5AA 4LPBA 4GT1A 3RKZA 2YEAA 4R3AA 1L0OA 2XHTA 1ZXNA 2BU6A 4QPJA 3VHDA 4KTNA 3H80A 5J6AA 1JOYA 2JKIA 1UYKA 4MB9A 1U0ZA 4AWQA 4MP7A 2E0AA 2YI5A 2IOQA 1YT0A 2FYPA 3LPSA 3SL2A 1EA6A 2CCSA 5D7CA 1A4HA 4P7AA 2HCHA 1THNA 3ZRWB 1YT2A 4MOTA 3OWBA 4DZYA 1TC0A 5CTXA 4L90A 4I3HA 2XDKA 2XCMA 2YEDA 2GFDA 3TTZA 2WI2A 3D2RA 1JM6A 3G7EA 2VCJA 3O2FA 4XC0A 3CRLA 3A0YA 2CG9A 3B27A 2Q8GA 5M4MA 5IN9A 2K5BA 1GJVA 5D6PA 5CF0A 4CWPA
chains in the Genus database with same CATH superfamily
1BE3H 1W0JG 3GVMA 3SJCC 2BT0A 4RQFA 3J7AU 1OCOB 1GO3F 4JAVA 2HP8A 1Y4SA 4LWEA 1BXDA 1N34B 1JCHA 3G71V 1PNKA 3VHCA 2Q7EA 3GB7C 4G27B 3CRCA 1BT8A 5BOCA 4ASGA 1WLEA 4L87A 2Z0AA 4EFEA 2CCUA 3RYIA 4UCSA 4PRVA 5M4NA 4UCVA 1IDSA 1UYEA 3ZHUA 4GGLA 5IDMA 2Q8IA 1PD3A 2QG2A 1XILA 3JAMN 4JYCA 3VBBA 4GX1A 1L0NH 1TH8A 1ZWHA 2R9AA 1XI1A 1AJPA 4PRXA 1EM1A 2ZBKB 4MW3A 4XIQA 4GLXA 1KQSU 2QKAA 1Q90D 2LO1A 2LJ2A 3A0ZA 3B4SA 3FB8C 4ZHQB 1VQNV 3BA9A 1I0HA 2JJ2G 4GX5A 4ZBMA 1Y8OA 2Q4PA 2WSSG 3ICXA 1M56B 2Q8FA 2XDUA 3SYOA 2ETNA 2YIAA 3RYFA 1BSMA 4FLWA 4GQTA 1FFXA 2ZE8A 3H01A 2ILMA 4YY3O 1J95A 2VQFO 1XHXA 3ASNB 2BTQB 4IT5A 4XCJA 1SA0A 1SA0B 3E8FA 1H2NA 5FPOA 1TGOA 2CGFA 4GEEA 4YKRA 3DGEA 3CC2V 2LFSA 4CWOA 1ZL8B 2O1UA 2YEJA 4B3SB 3MNRP 5M4EA 4CZZA 4H37A 4DK0A 4H33A 1Z2GA 4E72A 5M4KA 1HNZO 1H7UA 1YDXA 1FXHA 1UYIA 4ZKIA 4CH3A 4BAEA 4ABMA 1H8EG 3O0IA 5L3GA 1IBKO 1EI1A 2GQPA 3RLQA 2YE6A 1M9NA 4L8JA 4MSWC 4CS3A 4O0BA 4FM2A 4PDMA 2QWRB 3ZXOA 1R6NA 4FJCC 4WFAV 5LMNB 1OHHG 1BCCH 4FCRA 2XAFA 4X89A 4JTCB 4IIJB 1I5YA 4YHHB 2BSKB 3K5LA 1IBMB 4R50A 3VADA 1A32A 4I55A 1VF6C 3GIGA 4XKKA 2ZDIA 1O9GA 4FLXA 4UV9A 3RW0A 1NR7A 2LW7A 1I94O 2PI4A 2O1WA 3OMNB 4EGHA 2UUAB 4UXNA 3KCYA 1VQ5V 1OSFA 3CCUV 3BRCA 5F2VO 1KYOF 4JTDB 3LNNA 2YE7A 2P7TC 1UYDA 3MHHC 5CBGA 4FFBB 3AG7A 4WF9V 1M4UA 1M93A 2WLIB 1Y74A 2ZNJA 3C11A 4BQJA 1XL6A 2E74B 3TZ0A 2FXSA 5LXTA 2EJ7A 2LW1A 4DV0B 4DR6B 1KIJA 5CBFA 1V55C 3CCVV 2YI8A 1ZXMA 3PN1A 1QY8A 4LH7A 4B3MB 1NI8A 2YEHA 4ZOLB 3B24A 3CC7V 3ZN0A 3FT8A 4DV4O 1XHZA 3L9DA 3ETGA 4F6EA 5IJ0B 1PL4A 5IJ0A 5CMUA 3G4SV 3WG7B 2XNDG 2QG0A 4DRXB 3RVZA 2VWCA 2X6BA 2AZ0A 4LP0A 2CTPA 3FAVB 3CRAA 3UO2A 4DUYO 4E01A 1R62A 5CB4A 3CCLV 1T5EA 1BHBA 4XIRA 3KZIZ 1OCZB 4AWOA 2YE2A 4MTXA 1GM7A 5KX5A 4KSGA 1GRJA 4I0XA 4NB5A 3T4ZA 4NTWA 2OIGA 4NKGB 3AG1B 1KUQA 4TT3G 4XKAA 3QVNA 1H8HG 4O2BB 5FNDA 1XEQA 2RDCA 4TOIA 4HZ5A 1ZSPA 2R9RB 4UB6Z 1I5CA 4LF8B 1FXKB 2BYIA 1HWYA 1IXBA 1AI7A 1QLEC 1RFYA 2H94A 1N33B 2Z3YA 3ZHVA 2BRCA 1YEWA 3I5DA 2YKCA 4CC5A 4EFUA 2CDYA 3JARB 4X1YA 1FAFA 2ZNIA 1KMIZ 3R65A 1SESA 4O2AB 2HKOA 3ZX6A 2PNRA 2V7QG 2YE5A 3A0WA 5DEDA 1AH6A 1HNXO 5IWAO 1BKNA 2OCCB 3WQ9A 2Y4UA 4HYPA 3Q4HA 3Q4HB 3WB0A 4R7CA 3HKCB 2EIJB 2EXLA 1CEZA 3CGZA 2VQFB 1D2DA 4HYMA 2OT5A 2R72A 2DOSA 5FWKA 1SQPH 1Z5CA 4RAIA 2Q68A 1W0KG 1PVGA 4GT8A 3OR6C 4O4LB 3FT5A 3JD0A 2EIMB 2WERA 5EYPA 5EYPB 3OD4A 1HNZB 1BZKA 3T0HA 3OAAG 2F95B 1Q43A 2XHBA 3OW2U 3ZKDA 1IBKB 1NS1A 3H9VA 3CXHF 2ZR3A 4BIOA 3CC4V 4DXWA 1VF5B 3MDSA 2QEXV 2YKEA 1K92A 2JRIA 2YK2A 2CTWA 4LF6B 3AG3B 3EHFA 3U10A 4PA7A 2QGNA 1AROP 4ASUG 3BAAA 1RPOA 3AG4B 3R91A 4J7ZA 2QFOA 4ICGA 5JVDA 4A5UB 5A2QN 5F3KA 4PDVA 1K97A 2GTSA 1I94B 2ARHA 2Q69A 3OR7C 3RYCB 5EC2C 4K3AA 3CRQA 5GGZA 1PPJH 1LUWA 1K73W 4WCEV 3JCUZ 4TV9A 4TV9B 4AWPA 4LC1A 3JASA 4EB6A 1RSOA 3QG5A 4MS2A 4FCPA 3HKEA 1NH2B 3ETEA 1NU1H 4N21A 1B62A 3K0GA 4YKWA 4URLA 5JH7B 1YESA 1ZTEA 4XTJA 4BW9A 4JQLA 3Q5JA 4LWSA 4LWSB 2G38A 3CE2A 4RUEA 3D8CA 4DR7O 2WI1A 2X7RB 3R4NA 3FYIB 3TJTA 1DK1A 1OCZC 4NVPA 4X65O 3SYAA 1VQ7V 3ABLB 1KKDA 2A7WA 5LGUA 2CAZC 4DV4B 1MU5A 1Y4MA 5B66Z 1YI2V 3EHJA 4U93A 2LGWA 1XOUA 2ZT9B 3CCMV 2OWOA 1QBZA 1SQXH 2BOBC 4JAUA 4YKQA 1SZXA 3AG1C 1GM8A 4HY6A 3T0ZA 4JI3O 4DUYB 4MW8A 2QM4A 3EHBB 1FXKC 4DV6B 1Y76B 4PDLA 5A9GA 4J9YB 2X6CA 1Q82W 4GT1A 2YEAA 5L3CA 4YJ3B 1NBMG 4PDRA 2XAGA 1WP7A 1NZ6A 5BR8O 3G80A 3T1HO 4KTNA 5J6AA 1VIBA 2JDIG 1JOYA 3D3QA 2UXBO 3ZEDA 2IBZH 4XBFA 1U0ZA 3NR7A 4PI0A 3WB1A 2FYPA 2UXNA 1WB8A 2CCSA 5KHHA 1NJIW 5D7CA 4GX0A 2QWNB 3ZRWB 2QKSA 4I4TB 4I4TA 4MOTA 4X64O 4R6ZA 1TC0A 5CTXA 3ZN1A 2Y0IA 4L90A 4DO2A 1JJOA 1BQZA 3L72H 1YHQV 2GFDA 2W6JG 5FLXN 2WI2A 1K7DA 3SJBC 4CH4A 1JM6A 3T1CA 3JSLA 4HNAA 3O2FA 2EX3A 3RFRA 5CA0A 2UU9O 1KU9A 5CN0A 3QF7A 5EK0A 4JV5O 1US6A 3B27A 2Q8GA 4TQDA 3UT5A 2JS3A 5LHGA 5CF0A 4CWPA 3ZHSA 3AG3C 2FWYA 3W7UA 2YIBA 5IT9N 4JI7O 1K34A 2ADQB 3IEDA 2AW9A 3O6OA 3DXRA 4G28B 1ZW9A 5CTWA 2YJWA 3C0EA 4FM1A 4ASFA 3IJ4A 4XCLA 3CCRV 1S77D 2ZE6A 5LYJA 3K9SA 4MBCA 5LHHA 4KHPO 1TILA 4QIWF 2HKJA 4UCUA 4LF4O 1GM9A 2JIZG 4EFTA 4YKZA 1EN4A 4AS9A 1QCEA 4B7PA 5B1NA 3C3TA 4FM0A 3EVKA 3S3WA 3CCJV 1UYHA 4YKUA 1TVKA 1NHJA 4PHZA 3CGYA 2XX4A 2IWSA 1AJQA 5CBHA 1U2OA 1GTOA 5LOVA 2YKIA 3JATA 4V26A 2Y69B 4XDJA 2HHHO 2MK3A 2P4KA 3ABLC 4KFGA 3H1HH 4YIPA 4WBNB 4FLYA 1NTKH 1M5IA 3DTUB 2F23A 2WWWA 3ZRSA 5J2TB 1MSWD 4BIUA 4JPRA 4RQEA 3R4OA 2F66C 4UFZA 2B5UA 1GKZA 4TUYB 1YJ9V 1VF7A 3E22B 5E79Z 3K58A 1NHHA 2IH3C 3SPCA 3ZRVA 3C3SA 1UYCA 5AG2A 4DR7B 4CS4A 2HLDG 1MZFA 3ETDA 4X65B 3T4DA 4CWTA 2B1GA 3T1YO 2YIDA 4E00A 4HY1A 1KD1W 2BU7A 2AZ2A 4CE2A 2M7WA 3U67A 2OCHA 3GWKC 3IAYA 4NXMO 3OMUA 4Q6GA 4CH5A 3SJQC 2V1DA 1KZNA 1QVGU 2VW5A 4AILC 3JD4A 2YGEA 4JI3B 2QWQB 1D5NA 3VHAA 4LF7B 1K4DC 3Q5KA 2BE3A 4GYCB 1WA8A 4NR1A 1HNWB 2X6AA 3OW6A 3TETA 4BQGA 3TZ2A 4E02A 5BR8B 2CGOA 3T1HB 3B2EE 3B8NA 4NXNO 1OV9A 2DWDC 5B5EZ 4YKTA 1GH6A 2UXBB 3A0RA 2CH7B 3HKDA 4UVCA 2M6YA 2VCIA 3BABA 4U7OA 4WUDA 4X20A 3I56V 5JCOC 1YC4A 2XAHA 2XJJA 4X64B 1BHAA 4J41A 2F4VB 2IJHA 3G7BA 2AGAA 3D36C 2EILB 2XHXA 1K5QA 1PL0A 2WA4A 3RYIB 2XJGA 3N2GA 1JX9A 3IC7A 3ABKC 5JWPA 2R70A 4R1FA 3STZC 3CCEV 1HDJA 3OMAB 2UU9B 3A0TA 2Y48A 3JAKA 1G4YB 3K79A 2QA4V 1PP9H 5L3EA 2X0LA 3RYHA 4X9LA 1SKVA 3INWA 2CTRA 4KQVA 1KBHA 3IFXA 3MD0A 4U3JA 1ZUQA 4HAMA 4U3JB 2BU8A 4Z1VA 2YEBA 1KECA 2YGAA 4DV5B 2YS8A 3R92A 1N0NA 4JI7B 4EMVA 3VQVA 2PI5A 4CE3A 3WFVA 1LUVA 2JS5A 1BL8A 5DN6G 1YETA 4PA6A 1I5XA 3CS5A 2BU2A 4DV7B 1FPOA 4FLZA 3R66A 4UUJC 1QNMA 4CC6A 3RYFB 5J2UA 1FFXB 4B3TO 3T1KA 4OGQB 5KHJA 2JGUA 1L1FA 4LF4B 2YE9A 4AHCA 1AR5A 4RWUA 2PF4E 3OEHG 3A0HZ 4GKKO 2Y69C 1FJGB 4PA9A 1M1KW 5DM6V 4DR4B 2JVDA 1QHTA 3D3IA 1KKCA 4JYYA 2NLJC 1I7FA 2DW4A 5M4HA 3HKBA 2YKBA 2OIEA 3TZ5A 2UUCO 3G67A 2F93B 3ZMSA 2ZE5A 2QF6A 5IYZA 2Q8VA 2GUZA 1JQ0A 1S16A 2Q2EB 1AMWA 2XAQA 5KHGA 1J5EB 1GMGA 2HHHB 2F1MA 3JD2A 3OEEG 2YJXA 2RJZA 4DW1A 3L71H 4WFHA 1YS3A 2RN9A 1V9PA 5LP6A 4MPEA 1ZX3A 4I55B 2Q6AA 3GIGB 2IM9A 3ZBHA 4KL1A 5B1AC 2H8PC 2WEQA 4YKXA 2Q67A 1NH2D 2HR3A 3CCQV 3AK2A 2BU5A 4B6CA 3LSSA 4B3RO 2UUBO 4X66O 2N04A 4FIPC 2Y4TA 1GN4A 4DR2O 3BHPA 3CHXA 3K3WA 4W4LA 1I59A 3RLRA 2YI0A 2RMKB 1MX0A 1U96A 3T1YB 2W6IG 5L3BA 1F51A 2EULA 4JI0O 1Y74B 4NXMB 5BXZA 1N0JA 1I58A 1JVMA 5LXTB 4ZIBA 3CRKA 2YI7A 3K5MA 2IH1C 2FWZA 1VEWA 3K57A 2YICA 3PEJA 2FL4A 1DF4A 5KA6A 5LL6Y 4G2KA 1OCOC 4XD8A 2A9HA 4X8AA 4JF3A 4GX2A 3GIFA 3K60A 1WP8A 2IW5A 1PNMA 4CWRA 4O4HA 4O4HB 4XDKA 4O4IA 2VWJA 4WFBV 2EILC 4NXNB 3B77A 1CP9A 3EHHA 2N74A 3AG2B 2XDLA 1R3LC 4MVOA 1Y4UA 2ZINA 3FKSG 3NMQA 3QDDA 1B6QA 5CB4B 2KG7A 4FVMA 3CRMA 1M90W 1IVSA 4LF5O 5KX5B 3KE6A 4JAAA 5FPRA 4I0XB 5KUKA 4N23A 2WEPA 2WLNA 1L0LH 2ZM6O 3SYCA 2CUGA 5HFMA 1HW7A 1NTMH 1M56C 3BCCH 2QTOA 5HFLA 2GHYA 5LGTA 5GW7A 5B3SB 5JQGA 3UM7A 3L74H 2O57A 1AI6A 4QJFB 2Z5UA 2LQTA 4YJ2A 1YZBA 1IXMA 4X1YB 3ASNC 3TK1A 5M4PA 1TA8A 2H55A 5IY5B 4U3FH 1NQTA 4H0LB 2WPDG 2HHIA 4JI1O 1YSRA 1AR4A 3E8HA 2WLHA 3CPWU 1ZXNA 4Z2WA 4O4JA 4O4JB 1VQPV 5B1BB 4P9PA 4B3TB 3KCXA 2JK5C 4YY3B 1WN7A 3ZHRA 4IHJA 4IHJB 1H2SB 2ZD9A 5EZYA 3SR2C 4GKKB 2AXTZ 1OZ0A 1XMOO 1Q81W 4MP7A 1QQCA 1MOFA 2YI5A 3DSQA 3CSXA 2Y0PA 1YT0A 4UB8Z 3E86A 1P84F 4JI8O 3JSNA 1QVFU 1F23A 5LA6A 4P7AA 2FYUH 1JFFA 1YT2A 4BR6A 4HZ3A 4DZYA 2WLKA 5FNVA 2UXXA 3F7VC 1S72V 2ZDIC 2Q0OC 2UUCB 4B7KA 5GONA 4I3HA 2VQEO 2YUAA 2DQ0A 4FK5C 2YEDA 3BFRA 1Q6IA 2ZIOA 3D2RA 4H44B 2QR4A 4MVRA 1P4RA 4UVAA 3LDEA 3JALA 1AILA 3HPLC 5JVDB 4TWKA 4C7UA 5KHIA 5LBQA 5J71A 3JZ3A 4H7QA 3R4MA 4DK1A 3HZ5A 3RBZA 3GIEA 4B3RB 2UUBB 4X66B 4LWFA 5ITZA 5ITZB 4DR2B 1KP3A 2OTJV 1G1XB 1CPYA 5BMVA 3U2KA 1YSZA 1NVPB 4KFMA 3OPDA 4JYAO 1GKFA 3K99A 1UFIA 3JASB 4EB6B 4R3MA 1RSOB 1DLBA 4JI0B 3HKEB 3E8BA 5KAIZ 3R4PA 4Z1MG 3X2QB 3WG7C 5H2FZ 3ZXQA 1UY6A 3A0BZ 2BOCC 3AG2C 1PM9A 4P8OA 3ZRXA 1H2MA 1UY9A 3PEHA 4TV8A 3CCSV 1FKAO 2DJVA 3LNMB 5KA5A 4LWIA 2P67A 2ZIMA 1WAZA 1XL4A 3K0DA 1W59A 4OX9O 4UV8A 1ENVA 1Y67A 2UXDO 4WUCA 3OTFA 3CP1A 3B28A 3ZHTA 1YVWA 5EBMC 3TXSA 4EGKA 2XJXA 5EBLC 3CB2A 4CWFA 4CH6A 2RQ6A 1AH8A 1Q5OA 2EIKB 4LFBO 2PY5A 3ASOB 1B63A 1M57B 1IBLO 2JJCA 1IURA 4CWQA 4EEHA 3LSUA 2WLLA 4H13B 1ID0A 2Q0AA 4EEQA 4LF5B 1EBOA 2PYJA 2OYQA 2HFEC 2OTLV 2BSMA 5B1OA 1N4CA 2KKWA 1V54B 1VQOV 3FB7C 4MTOA 3TUHA 1GAXA 2QM7A 1SQGA 1ZLZA 3HYZA 1FS0G 1WPBA 3LDDA 4OXSA 1B06A 2DN9A 2CGNA 2OCCC 1B04A 2ZE7A 3FFQA 1WB7A 3L70H 5B1BC 4FLTA 2YEIA 3HEKA 3LSQA 1F4NA 1DF5A 2IU0A 2EIJC 4IYHA 1GN2A 1N32O 4JASA 4PU9A 1ZAUA 2AKPA 4MTGA 5KHKA 3G6EV 4EM7A 2GV9A 4JI1B 2L35A 4CWNA 1R3IC 2ITCC 4J10A 2EIMC 3CX5F 3CJHA 1HNXB 1XNRO 4HNAB 5IWAB 3KKYA 3CD6V 3M8AA 1UYFA 5LGNA 2FB5A 2FTKA 3ZKBA 5CA0B 4QNHB 4FZ0A 1YERA 3HB3B 4KSHA 2YEVA 4LCUC 3UT5B 4DR5O 1AI4A 3DC6A 3ML0A 2K1EA 3BM9A 1F4MA 3ZMZA 4JI8B 2BYHA 1DGSA 2LGQA 1R73A 2QWOB 2YEFA 1S5HC 4GFNA 1YIJV 3AG4C 3DXRB 3RGBA 3ABTA 2ZKOA 5E1AC 2GSMB 1SETA 3O65A 2ESAA 5LYJB 2VQEB 4NH9A 5KMGA 3FD9A 2BTZA 3K97A 1RP3B 4UROA 2XX5A 4QPKA 1O9HA 2WI4A 2YXLA 3CMEV 4MPCA 4MP2A 1PKXA 1VQKV 1D5AA 5CTYA 2DMXA 2N05A 1VARA 3CYOA 1SC5B 1TVKB 3F7YC 2RCVA 1Q3EA 1S3JA 4XKOA 3FB5C 2C1GA 1I08A 3SYQA 3X2QC 2A79B 2H8MA 4X1IA 4QGPA 1AI5A 2QKCA 3K08A 4AQYO 2QE7G 1ORQC 3QTFA 4XITA 3TGUH 4BXIA 5KAFZ 1Y8NA 1S5JA 4DV2O 4K4OA 5LOVB 3B26A 3JATB 2YKJA 4JYAB 1SERA 2WAMA 1TC6A 2GTAA 3UKMA 2XD6A 2W0XA 1NTZH 1F7YA 1AP5A 3BA8A 3H4LA 3B8MA 1RPRA 2EIKC 4HZ0A 1K3EA 4LNUA 3ASOC 3EKRA 3APOA 1US7A 3EFFK 1AP6A 5H6RA 5KUMA 3T10A 1R3JC 4CE1A 1JJ2U 1VP7A 2KSDA 4NTXA 4OX9B 1Z59A 1R3KC 3APQA 2UXDB 2VRZA 4BW5A 2HVKC 2JJ1G 2BCCH 3N2KA 4PI2A 1UYLA 5D5QA 1FYJA 2HG1A 3RWRD 2DE0X 4I7ZB 2NN4A 4UCOA 2YEEA 4ZI7A 1IBLB 5D7DA 4GUNA 3A8TA 2EZOA 5F5RA 2BREA 2IWUA 4J80A 1MSDA 2WI6A 2YK9A 1WA8B 2HG5C 1GN3A 2PTMA 1YTFB 2C2AA 1VF6A 2V4DA 1AB3A 5JJJB 2D2CB 4J7JA 3EHGA 4O04A 3GWOA 2AHYA 3WU2Z 5L3DA 2YSUB 1H38A 4LR3A 2R9IA 3HKDB 2QWPB 2FKXA 2P6JA 5EC1C 3IGAC 3JAWA 4X20B 2GBOA 4B3MO 3P3PA 3ZM7A 1UJWB 3LUTB 4PELA 3CYGA 3K5NA 2YEGA 1N32B 4ASBA 1QR9A 5J9PC 3E8GA 4F4LA 4KUMA 4K35A 1RM1B 2XASA 1AVMA 3AK1A 3ZJZA 2GDSA 3N2GB 2YC0A 3ZMVA 5BODA 3CXCU 1XNRB 5K1PA 1H2LA 1QU7A 1VQ9V 3K04A 1JA8A 1NKDA 3CMAV 3JAKB 4L93A 1TAEA 2QJ1A 3BY6A 4JV5B 2HVJC 4DR5B 4XDMA 2YECA 2P22C 3SYPA 3RYHB 3JYCA 3ZHQA 1P49A 2IJJA 2BZ5A 1YC3A 1BQ0A 3U0ZA 1Q86W 4V25A 1U97A 4JGSA 3W7WA 3KG2A 4AI8A 3QTCA 4LF8O 5D5PA 2FMLA 3HHUA 1N33O 4NYKA 4GCZA 1QYEA 1XUQA 1YCIA 5J2UB 4KHPB 2EINB 1G8MA 3G75A 3LDCA 5JJNB 3B25A 3CEIA 4PA4A 1QLNA 4Q20A 4ZHQA 4MVSA 4O07A 1EZJA 4IYIA 2XT9A 1SZTA 2QM8A 4YXWG 1LR1A 4HBNA 4P9OA 1QLEB 1ZWIC 1VQLV 2A06H 2UWDA 4EGIA 3P32A 3JCZA 3JD1A 5GTIZ 3HKBB 1FXVA 1Q6UA 4L94A 2BTQA 4X9QA 4AQYB 4LWHA 2YXHA 2WLMA 1NHIA 2ZDXA 5IYZB 1BGQA 4LPBA 2GUZB 2P4VA 4DV2B 1SQVH 1XQ8A 3K03A 2E3CA 4R3AA 1ZL8A 1E1RG 3J80N 2QTSA 1CXZB 4QPJA 5LP6B 3VHDA 4W4KA 3ETQA 1NVPD 2ZQMA 2PZSA 2JKIA 1S76D 1X59A 2E0AA 2NNUA 3LPSA 3SL2A 4LF9O 1EA6A 1GK9A 4LF6O 1A4HA 5K1XA 4FLUA 1JMKC 4IIJA 4KXRA 2BSKA 2CTQA 2JEXA 4IGGA 3P3NA 1WPXA 4MVQA 3OUSA 3TTZA 5LMUO 1MNGA 3G7EA 1E1QG 2VCJA 4XC0A 3CRLA 4UVBA 3A0YA 2CG9A 1UPGA 4JI5O 2HJDA 3E83A 5IJ9A 5IJ9B 5M4MA 1KP2A 2K5BA 1GJVA 4PA3A 3OTOO 2YXYA 2ATKC 3VOUA 4FFBA 1BMFG 1MABG 1YSCA 5EIBD 2WLIA 1VQ4V 5L3FA 1TBWA 4J7KA 3ZCCA 2EJRA 4BIZA 1LNQA 4O4IB 1VQMV 1RM1C 2JGDA 2JGDB 3W7TA 1XDCA 2WA3A 1HR0O 4DR3O 3ZMTA 3E2EA 4DV1O 3UCSC 2DYSB 3U11A 2HJFC 2Q7GA 4ZOLA 2WI7A 1YF2A 2KG7B 2XTAA 3S3XA 2ZKJA 4EKWA 1VQ6V 1K8AW 2IORA 2HEPA 3D0BA 1HP8A 3FX7A 3LNUA 2A0LA 4DRXA 2E5LO 1MA1A 3FAVA 1OCCB 1EZVH 1I5AA 2YE3A 4HXWA 4MT8A 4E4EA 4DV6O 3CWVA 4QE7A 3BEHA 4X62O 2RNBA 5JQGB 2EINC 4YJ2B 4TSFG 2ZR2A 3H1LH 1TIDA 4FMTA 5L3JA 1XNQO 3BVOA 4LFAO 3T2SA 4DR1O 1IX9A 4O2BA 3RT3C 4UCTA 1EN5A 4WUBA 3OGCC 4JI2O 3FV5A 3U2DA 2YIBD 1FXKA 2BTOA 4QE9A 4WFEA 5CTUA 1Z5BA 2EZPA 4P2ZA 1P7BA 1Z5WA 3PJSK 3JARA 2ODMA 2ZXWB 1THZA 1H2GA 5EZYB 2MW2B 3WB2A 3ZMUA 4JI4O 4J9ZB 1K33A 4O2AA 2E76B 3K59A 1K9MW 4ASAA 2JEUA 1I5DA 3I55V 5LP6C 5LA6B 3NXSA 1SRYA 1JFFB 1UY7A 3STLC 2IJKA 2YI6A 1TUEB 3P30A 3EKOA 2YE8A 1MMMA 5FNVB 1FFTB 3HKCA 5GONB 4TQFA 1N36O 4MPNA 1X4TA 4NH8A 4HYOA 1XMQO 5FNCA 4OPHA 2IOPA 4D7TA 2P06A 4H81A 4O4LA 4JZ2A 1FD9A 1GKXA 1BYQA 4X1KA 4X1KB 4URMA 1SQBH 3ZIAG 4LWGA 5KLVH 5IE9A 4L8ZA 4MVUA 3N27A 2UXCO 3JALB 2VWKA 1AJNA 1GN6A 2LFRA 3THOA 3SPGA 1YJWV 2EBOA 1R6KA 4EFBA 1YT1A 3OWDA 4LF9B 1JPXA 4U7NA 2E75B 2WI3A 4JZGA 1JR9A 4B08A 2ITDC 5BMVB 2CCTA 3K9AA 4CBCA 2XK2A 5C93A 1KB9F 3B40A 4NTYA 4I50A 4I50B 3L75H 1G6UA 2ADPA 2Q7HA 3F5TA 4FFKA 4PL9A 1SF9A 4WFFA 4BWAA 4K8XA 4L91A 2XABA 2XHRA 1OCRB 1S0VA 1YXBA 1Y66A 5LMUB 3CRRA 3RYCA 1COWG 1TUBA 1TUBB 4JI5B 1AJ6A 4DUHA 4DUZO 3UO3A 2B1IA 4J42A 2DYSC 4TV8B 1Y6XA 3OTOB 2WLJA 4DV3O 4LH6A 3SGIA 4JYBA 2DYRB 2P90A 3ABUA 3ABMB 2CE4A 4B7EA 4YKYA 3OMIB 5JH7A 3AK3A 1EN6A 2XDXA 1YTFD 2C1IA 3Q5LA 5FNFA 1HR0B 2QDOA 2WI5A 4DR3B 1OCCC 2CK3G 1SQFA 4DV1B 2KB1A 4LFCO 4DW0A 1H2KA 1WNSA 1YITV 4K0KO 1EFRG 2Q8HA 4FCQA 2WLLB 2IJIA 5B3SC 4D7SA 1XREA 2A3QA 3OE7G 3FYEB 5IYDO 1QR8A 4P30A 2IU3A 4JI6O 3JD3A 2E5LB 4LBEC 3K5OA 5IY5C 1K4CC 2XUMA 2XX2A 2ZM6B 2IWXA 4I9QA 4LF7O 4IL6Z 4FZ1A 3G6BA 3OT7A 1Y76A 2XDSA 3EXAA 4X62B 5IDJA 1HNWO 5H9CA 4I5SA 4YJ3A 3TXQA 3M99B 1S5LZ 1Q7YW 2ZXWC 3SDLA 5H6QA 5EBWC 1MZEA 1VMGA 1XNQB 4LFAB 1QZRA 1OJHA 1BS3A 3QO7A 4DR1B 5BY1A 1Y8PA 4JI2B 5CA1A 5CA1B 4GKJO 1AR1B 4XIPA 3HYYA 4CS2A 3CJHB 5D7RA 1YJNV 1I5BA 3DC5A 1ROPA 1N34O 1IZ3A 3FB6C 3E35A 3O9OA 4X88A 3ZRWA 3UQ8A 5D6QA 3WHAA 2Q5ZA 2YEVB 2F4VO 3A2FA 3OGIB 2KQXA 4JI4B 1XMOB 1H7SA 3TZ4A 3IC9A 3SPJA 5CA3A 4CWSA 3RLPA 4HXZA 3H1KH 3W7XA 1PNLA 1Z5VA 4RUFA 4OPAA 4O09A 1NR1A 3QO5A 1N8RW 3ZS8C 5DECA 1UYGA 5JCOA 4PD4F 4XDLA 4F6RA 4F6RB 2QSAA 3W7SA 1NT2B 3OUFA 1N36B 5JENA 1DTOA 5KMGB 3D36A 1XMQB 2PGGA 1UYMA 2PUSA 4DV5O 4E2LA 2VS0A 3OFNG 3A0XA 3ABKB 2Q9LA 1MG1A 3INXA 2PYLA 3MAQA 3VQYA 2UXCB 2ZDYA 1L8DA 5IYBO 4ZVIA 4DV7O 1OCRC 2YDEA 1XBLA 4PJ0Z 2D3OW 4J11A 4D6TH 4FPPA 4DYLA 1URFA 4X1IB 1YC1A 1S14A 2CH4A 4K8ZA 4XE2A 5JJEB 1FJGO 3F5WC 5GTHZ 4DR4O 3K06A 4B3SO 1SQQH 3H1IH 3SPHA 2F43G 1KC8W 2DYRC 2DQ3A 3K98A 2B9ZA 4NH7A 3ABMC 3SPIA 4KP4A 3TCUA 1R6TA 1B3QA 4LP8A 4WFGA 1UY8A 3HZ1A 4H85A 4GZRB 1AM1A 5H5NA 4I9WA 4MVZA 4DUZB 4W7TA 4LNUB 4URNA 1P7GA 1M57C 4UCRA 5LMNO 1J5EO 1VQ8V 4DV3B 5EIBC 2ZCEA 2YE4A 2YGFA 2H3OA 3H1JH 3BMYA 4FLVA 3B09A 4YHHO 3L73H 4WBNA 2O1VA 5CPHA 2W0FC 5J2TA 3J81N 5LHIA 1IBMO 2YI9A 2P5OA 4O05A 3MHSC 5IYCO 1BGYH 1Z5AA 4TUYA 3LMMA 4YIOA 3HR0A 4PV1B 3N2KB 3RKZA 3E22A 1L0OA 1V54C 4RO2A 2XHTA 2XOKG 4LFBB 3M7MX 4LFCB 2BU6A 4ZI7B 4K0KB 2UUAO 4R8CA 3H80A 2L6LA 1Q8IA 1UYKA 3QO8A 3SJAC 4MB9A 4AWQA 2AHZA 3T2MA 2IOQA 4JI6B 1Q6HA 5FL7G 5BZBA 1E79G 3C90A 5B1AB 4MVMA 2HCHA 1THNA 1SS3A 3OM3B 1K5SA 4DV0O 4DR6O 3OWBA 3VQWA 3S5TA 4MTFA 1WJZA 1PV0A 5C8YA 5C8YB 3E89A 1W2BU 3RVYA 3BPZA 2XDKA 2LP7A 2XCMA 3JAWB 2XAJA 3VQXA 1R1BA 3CWBH 2DWEC 4BAYA 2Q73A 2K9PA 5TISZ 3QNEA 5IN9A 2NR5A 3RN4A 3AEIA 5D6PA 1V55B 4JTAB 4GKJB 2CH7A
chains in the Genus database with same CATH topology
1W0JG 2BT0A 4RQFA 1OCOB 1GO3F 4JAVA 1Y4SA 4LWEA 1BXDA 3VHCA 1JCHA 3G71V 1PNKA 3GB7C 4G27B 5BOCA 4ASGA 1WLEA 4L87A 2CCUA 4PRVA 5M4NA 1UYEA 4GGLA 5IDMA 2Q8IA 1PD3A 2QG2A 4JYCA 3VBBA 4GX1A 1TH8A 1ZWHA 1AJPA 4PRXA 2ZBKB 4MW3A 4XIQA 1KQSU 3A0ZA 3FB8C 1VQNV 4GX5A 2JJ2G 4ZBMA 1Y8OA 2WSSG 1M56B 2Q8FA 2XDUA 3SYOA 4GQTA 3H01A 1J95A 3ASNB 4XCJA 3E8FA 2CGFA 4GEEA 4YKRA 3DGEA 3CC2V 2LFSA 4CWOA 2O1UA 2YEJA 3MNRP 5M4EA 4CZZA 4H37A 4H33A 5M4KA 1H7UA 1UYIA 1FXHA 4ZKIA 4BAEA 3O0IA 1H8EG 5L3GA 1EI1A 2GQPA 3RLQA 2YE6A 1M9NA 4MSWC 4O0BA 4PDMA 3ZXOA 1R6NA 4FJCC 4WFAV 1OHHG 4FCRA 2XAFA 4X89A 4JTCB 1I5YA 4R50A 3VADA 3GIGA 4XKKA 2ZDIA 4UV9A 3RW0A 1NR7A 2PI4A 2O1WA 3OMNB 4EGHA 4UXNA 1VQ5V 1OSFA 3CCUV 4JTDB 2YE7A 2P7TC 1UYDA 3MHHC 5CBGA 4WF9V 2WLIB 3C11A 4BQJA 1XL6A 3TZ0A 2FXSA 1KIJA 5CBFA 1V55C 3CCVV 1ZXMA 1QY8A 2YEHA 3B24A 3CC7V 3ZN0A 3FT8A 3ETGA 5CMUA 3G4SV 3WG7B 2XNDG 2QG0A 3RVZA 2VWCA 2X6BA 4LP0A 4E01A 1R62A 3CCLV 1BHBA 4XIRA 1OCZB 4AWOA 2YE2A 4MTXA 1GM7A 4KSGA 3T4ZA 3AG1B 4TT3G 4XKAA 1H8HG 5FNDA 4HZ5A 1I5CA 2R9RB 1FXKB 2BYIA 1HWYA 1AI7A 1QLEC 2H94A 2Z3YA 2BRCA 2YKCA 4EFUA 3R65A 1SESA 2HKOA 2PNRA 2YE5A 2V7QG 3A0WA 1AH6A 1BKNA 2OCCB 3WQ9A 4HYPA 2EXLA 4R7CA 2EIJB 3CGZA 1CEZA 4HYMA 2OT5A 5FWKA 1Z5CA 4RAIA 2Q68A 1W0KG 1PVGA 4GT8A 3OR6C 3FT5A 3JD0A 2EIMB 2WERA 3T0HA 3OAAG 3OW2U 3ZKDA 2ZR3A 3CC4V 4DXWA 2QEXV 2YKEA 1K92A 2YK2A 3AG3B 3EHFA 4PA7A 1AROP 4ASUG 1RPOA 3AG4B 3R91A 2QFOA 5F3KA 4PDVA 1K97A 2Q69A 3OR7C 5EC2C 5GGZA 1K73W 4WCEV 4AWPA 4LC1A 4MS2A 4FCPA 1NH2B 3ETEA 4N21A 1B62A 3K0GA 4YKWA 4URLA 1YESA 4XTJA 4JQLA 3Q5JA 4RUEA 2WI1A 2X7RB 3R4NA 3FYIB 1OCZC 3SYAA 1VQ7V 3ABLB 1KKDA 5LGUA 1MU5A 1Y4MA 3EHJA 1YI2V 4U93A 3CCMV 1QBZA 4JAUA 2BOBC 4YKQA 3AG1C 1GM8A 4HY6A 3T0ZA 4MW8A 3EHBB 1FXKC 4PDLA 4J9YB 2X6CA 1Q82W 4GT1A 2YEAA 5L3CA 1NBMG 4PDRA 2XAGA 4KTNA 5J6AA 2JDIG 1JOYA 4XBFA 1U0ZA 2FYPA 2UXNA 2CCSA 1NJIW 5D7CA 4GX0A 3ZRWB 2QKSA 4MOTA 4R6ZA 1TC0A 5CTXA 3ZN1A 4L90A 4DO2A 1YHQV 2GFDA 2W6JG 2WI2A 1K7DA 1JM6A 3T1CA 3O2FA 5CN0A 5EK0A 3B27A 2Q8GA 5LHGA 5CF0A 4CWPA 3AG3C 2FWYA 3W7UA 1K34A 3IEDA 3O6OA 4G28B 1ZW9A 5CTWA 2YJWA 3C0EA 4ASFA 4XCLA 3CCRV 1S77D 4MBCA 5LHHA 1TILA 4QIWF 2HKJA 1GM9A 2JIZG 4EFTA 4YKZA 4AS9A 1QCEA 4B7PA 5B1NA 3CCJV 1UYHA 4YKUA 1NHJA 3CGYA 2XX4A 2IWSA 1AJQA 5CBHA 1U2OA 1GTOA 2YKIA 4V26A 2Y69B 4XDJA 2MK3A 3ABLC 4KFGA 3DTUB 3ZRSA 2WWWA 1MSWD 4BIUA 4JPRA 4RQEA 3R4OA 2B5UA 1GKZA 1YJ9V 1NHHA 2IH3C 3SPCA 3ZRVA 1UYCA 2HLDG 3ETDA 3T4DA 4CWTA 2B1GA 4E00A 4HY1A 1KD1W 2BU7A 4CE2A 2M7WA 3U67A 3OMUA 3SJQC 2V1DA 1KZNA 1QVGU 2VW5A 3JD4A 2YGEA 3VHAA 1K4DC 3Q5KA 2X6AA 3OW6A 3TETA 4BQGA 3TZ2A 4E02A 3B8NA 2DWDC 4YKTA 3A0RA 4UVCA 2VCIA 4U7OA 4WUDA 3I56V 1YC4A 2XAHA 2XJJA 1BHAA 2IJHA 3G7BA 2EILB 2XHXA 1K5QA 1PL0A 2XJGA 1JX9A 3IC7A 3ABKC 4R1FA 3STZC 3CCEV 3OMAB 3A0TA 2Y48A 1G4YB 3K79A 2QA4V 5L3EA 2X0LA 4X9LA 3INWA 4KQVA 3IFXA 3MD0A 4HAMA 2BU8A 2YEBA 2YGAA 1KECA 3R92A 4EMVA 2PI5A 4CE3A 3WFVA 1BL8A 5DN6G 1YETA 4PA6A 1I5XA 2BU2A 4UUJC 3T1KA 1L1FA 2YE9A 3OEHG 2Y69C 4PA9A 1M1KW 5DM6V 3D3IA 2NLJC 2DW4A 5M4HA 2YKBA 3TZ5A 3ZMSA 2QF6A 1JQ0A 1S16A 2Q2EB 1AMWA 2XAQA 1GMGA 3JD2A 3OEEG 2YJXA 4WFHA 1YS3A 4MPEA 2Q6AA 3GIGB 5B1AC 2H8PC 2WEQA 4YKXA 2Q67A 1NH2D 2HR3A 3CCQV 2BU5A 4B6CA 3LSSA 4FIPC 3K3WA 1I59A 3RLRA 2YI0A 1MX0A 2W6IG 5L3BA 1F51A 1I58A 1JVMA 3CRKA 2YI7A 2IH1C 2FWZA 3PEJA 1DF4A 5KA6A 4G2KA 1OCOC 4XD8A 2A9HA 4X8AA 4JF3A 4GX2A 3GIFA 3K60A 2IW5A 1PNMA 4CWRA 4XDKA 4WFBV 2EILC 3B77A 1CP9A 3EHHA 3AG2B 2XDLA 1R3LC 4MVOA 1Y4UA 3FKSG 3NMQA 3QDDA 1B6QA 1M90W 3KE6A 5KUKA 4N23A 2WEPA 2WLNA 3SYCA 5HFMA 1M56C 2QTOA 5HFLA 2GHYA 5LGTA 5GW7A 5B3SB 3UM7A 1AI6A 4QJFB 2Z5UA 1IXMA 3ASNC 3TK1A 5M4PA 2H55A 5IY5B 1NQTA 2WPDG 1YSRA 3E8HA 2WLHA 3CPWU 1ZXNA 1VQPV 5B1BB 4P9PA 2JK5C 2ZD9A 1OZ0A 1Q81W 4MP7A 1MOFA 2YI5A 1YT0A 3E86A 1QVFU 1F23A 4P7AA 1YT2A 4HZ3A 4DZYA 2WLKA 2UXXA 3F7VC 1S72V 2ZDIC 4I3HA 2DQ0A 4FK5C 2YEDA 3D2RA 4MVRA 1P4RA 4UVAA 3LDEA 3HPLC 4TWKA 5LBQA 5J71A 3JZ3A 4H7QA 3R4MA 3HZ5A 3RBZA 3GIEA 4LWFA 1KP3A 2OTJV 1CPYA 3U2KA 1YSZA 1NVPB 4KFMA 3OPDA 1GKFA 3K99A 4R3MA 1DLBA 3E8BA 3R4PA 4Z1MG 3X2QB 3WG7C 3ZXQA 1UY6A 2BOCC 3AG2C 4P8OA 3ZRXA 1UY9A 3PEHA 3CCSV 3LNMB 5KA5A 4LWIA 2P67A 1XL4A 3K0DA 4UV8A 1ENVA 4WUCA 3CP1A 3B28A 4EGKA 5EBMC 2XJXA 5EBLC 4CWFA 1AH8A 2EIKB 3ASOB 1B63A 1M57B 2JJCA 4CWQA 4EEHA 2WLLA 1ID0A 1EBOA 2HFEC 2OTLV 2BSMA 5B1OA 1V54B 1VQOV 3FB7C 4MTOA 3TUHA 2QM7A 3HYZA 1FS0G 3LDDA 4OXSA 2OCCC 5B1BC 2YEIA 3HEKA 3LSQA 1F4NA 1DF5A 2IU0A 2EIJC 4JASA 4PU9A 2AKPA 4MTGA 3G6EV 4EM7A 4CWNA 1R3IC 2ITCC 2EIMC 3CD6V 1UYFA 5LGNA 2FTKA 3ZKBA 4QNHB 1YERA 3HB3B 4KSHA 2YEVA 4LCUC 1AI4A 3ML0A 2K1EA 3BM9A 1F4MA 3ZMZA 2BYHA 1R73A 2YEFA 1S5HC 4GFNA 1YIJV 3AG4C 3ABTA 5E1AC 2GSMB 1SETA 2ESAA 4NH9A 2BTZA 3K97A 4UROA 2XX5A 4QPKA 2WI4A 3CMEV 4MPCA 4MP2A 1PKXA 1VQKV 5CTYA 3CYOA 3F7YC 1S3JA 4XKOA 3FB5C 3SYQA 3X2QC 2A79B 2H8MA 1AI5A 3K08A 3QTFA 2QE7G 1ORQC 4XITA 4BXIA 1Y8NA 4K4OA 3B26A 2YKJA 1SERA 2WAMA 1TC6A 3UKMA 2XD6A 3H4LA 3B8MA 1RPRA 2EIKC 4HZ0A 1K3EA 3ASOC 3EKRA 1US7A 3EFFK 5H6RA 5KUMA 3T10A 1R3JC 4CE1A 1JJ2U 1Z59A 1R3KC 4BW5A 2HVKC 2JJ1G 1UYLA 2HG1A 2YEEA 5D7DA 2EZOA 5F5RA 2BREA 2IWUA 2WI6A 2YK9A 2HG5C 1YTFB 2C2AA 3EHGA 4O04A 3GWOA 2AHYA 5L3DA 2YSUB 1H38A 2R9IA 2P6JA 5EC1C 3IGAC 3ZM7A 1UJWB 3LUTB 4PELA 2YEGA 4ASBA 1QR9A 5J9PC 3E8GA 4F4LA 4KUMA 1RM1B 2XASA 3ZJZA 3ZMVA 5BODA 3CXCU 1VQ9V 3K04A 1NKDA 3CMAV 4L93A 3BY6A 2HVJC 4XDMA 2YECA 3SYPA 3JYCA 2IJJA 2BZ5A 1YC3A 1Q86W 4V25A 4JGSA 3W7WA 3KG2A 3HHUA 4GCZA 1QYEA 2EINB 1G8MA 3G75A 3LDCA 3B25A 4PA4A 1QLNA 4Q20A 4MVSA 4O07A 1EZJA 1SZTA 2QM8A 4YXWG 4EGIA 4P9OA 1QLEB 1ZWIC 1VQLV 2UWDA 3P32A 3JCZA 3JD1A 4L94A 1FXVA 4LWHA 2WLMA 1NHIA 2ZDXA 1BGQA 4LPBA 3K03A 4R3AA 1E1RG 4QPJA 3VHDA 1NVPD 2ZQMA 2JKIA 1S76D 2E0AA 2NNUA 3LPSA 3SL2A 1EA6A 1GK9A 1A4HA 2JEXA 1WPXA 4MVQA 3OUSA 3TTZA 3G7EA 1E1QG 2VCJA 4XC0A 3CRLA 4UVBA 3A0YA 2CG9A 3E83A 5M4MA 1KP2A 2K5BA 1GJVA 4PA3A 2ATKC 3VOUA 1BMFG 1MABG 1YSCA 2WLIA 1VQ4V 5L3FA 1TBWA 3ZCCA 2EJRA 4BIZA 1LNQA 1VQMV 1RM1C 3W7TA 3ZMTA 3E2EA 2DYSB 2HJFC 2WI7A 2ZKJA 4EKWA 1VQ6V 1K8AW 2IORA 3D0BA 3LNUA 2A0LA 1OCCB 1I5AA 2YE3A 4HXWA 4MT8A 3CWVA 4QE7A 3BEHA 2EINC 4TSFG 2ZR2A 1TIDA 4FMTA 5L3JA 3T2SA 4WUBA 3OGCC 3FV5A 3U2DA 1FXKA 4QE9A 4WFEA 5CTUA 1Z5BA 2EZPA 4P2ZA 1P7BA 3PJSK 2ZXWB 1THZA 1H2GA 3ZMUA 4J9ZB 1K33A 1K9MW 4ASAA 2JEUA 1I5DA 3I55V 3NXSA 1SRYA 1UY7A 3STLC 2IJKA 2YI6A 1TUEB 3P30A 3EKOA 2YE8A 1FFTB 4MPNA 4NH8A 4HYOA 5FNCA 2IOPA 4H81A 1GKXA 1BYQA 4URMA 3ZIAG 4LWGA 4L8ZA 4MVUA 1AJNA 2LFRA 3SPGA 1YJWV 2EBOA 1R6KA 1YT1A 3OWDA 1JPXA 4U7NA 2WI3A 2ITDC 2CCTA 3K9AA 4CBCA 2XK2A 5C93A 4PL9A 4WFFA 4L91A 2XABA 2XHRA 1OCRB 1S0VA 1Y66A 1COWG 1AJ6A 4DUHA 2B1IA 2DYSC 2WLJA 4JYBA 2DYRB 2P90A 3ABUA 3ABMB 4YKYA 3OMIB 2XDXA 1YTFD 3Q5LA 5FNFA 2WI5A 1OCCC 2CK3G 2KB1A 1YITV 1EFRG 2Q8HA 4FCQA 2WLLB 2IJIA 5B3SC 3OE7G 3FYEB 5IYDO 1QR8A 4P30A 2IU3A 3JD3A 4LBEC 5IY5C 1K4CC 2XX2A 2IWXA 2XDSA 5IDJA 5H9CA 4I5SA 3M99B 1Q7YW 2ZXWC 5H6QA 5EBWC 1QZRA 3QO7A 1Y8PA 1AR1B 4XIPA 3HYYA 5D7RA 1YJNV 1I5BA 1ROPA 3FB6C 3E35A 4X88A 5D6QA 3ZRWA 3WHAA 2YEVB 1H7SA 3TZ4A 3SPJA 5CA3A 4CWSA 3RLPA 4HXZA 3W7XA 1PNLA 4RUFA 4O09A 1NR1A 3QO5A 1N8RW 1UYGA 4XDLA 3W7SA 3OUFA 1DTOA 3D36A 1UYMA 4E2LA 3OFNG 3A0XA 3ABKB 1MG1A 3INXA 2ZDYA 5IYBO 4ZVIA 1OCRC 2D3OW 4FPPA 1YC1A 1S14A 2CH4A 4XE2A 3F5WC 3K06A 3SPHA 2F43G 1KC8W 2DYRC 2DQ3A 3K98A 4NH7A 3ABMC 3SPIA 4KP4A 3TCUA 4LP8A 1B3QA 4WFGA 1UY8A 3HZ1A 4H85A 1AM1A 4I9WA 4MVZA 4W7TA 4URNA 1M57C 1VQ8V 2YE4A 2YGFA 3BMYA 2O1VA 5CPHA 2W0FC 5LHIA 4O05A 3MHSC 5IYCO 1Z5AA 3RKZA 1L0OA 1V54C 4RO2A 2XHTA 2XOKG 2BU6A 4R8CA 3H80A 1UYKA 3QO8A 4MB9A 4AWQA 2AHZA 3T2MA 2IOQA 5FL7G 5BZBA 1E79G 5B1AB 4MVMA 2HCHA 1THNA 3OM3B 1K5SA 3OWBA 4MTFA 3E89A 1W2BU 3RVYA 2XDKA 2LP7A 2XCMA 2XAJA 2DWEC 4BAYA 3QNEA 5IN9A 3AEIA 5D6PA 1V55B 4JTAB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FWY A;  5J71 A;  3JZ3 A;  2BT0 A;  4H7Q A;  3R4M A;  4JAV A;  3HZ5 A;  3GIE A;  1Y4S A;  3IED A;  1TBW A;  4LWE A;  3ZCC A;  1BXD A;  4LWF A;  3VHC A;  4BIZ A;  3O6O A;  1ZW9 A;  5CTW A;  2YJW A;  3C0E A;  3U2K A;  4ASF A;  5BOC A;  1YSZ A;  4XCL A;  4ASG A;  3OPD A;  3K99 A;  2CCU A;  4MBC A;  4R3M A;  4PRV A;  5M4N A;  1TIL A;  2HKJ A;  2WI7 A;  1UYE A;  4GGL A;  3R4P A;  5IDM A;  2Q8I A;  4EFT A;  4YKZ A;  2QG2 A;  3ZXQ A;  2ZKJ A;  1UY6 A;  4AS9 A;  2IOR A;  4JYC A;  4B7P A;  3D0B A;  4P8O A;  5B1N A;  1TH8 A;  1ZWH A;  3LNU A;  3ZRX A;  1UY9 A;  3PEH A;  4PRX A;  1UYH A;  4YKU A;  2ZBK B;  1NHJ A;  4LWI A;  2P67 A;  4XIQ A;  1I5A A;  3CGY A;  2XX4 A;  2YE3 A;  3A0Z A;  4MT8 A;  2IWS A;  4HXW A;  4WUC A;  3B28 A;  3CWV A;  4EGK A;  2XJX A;  1U2O A;  1Y8O A;  2YKI A;  4V26 A;  4CWF A;  2Q8F A;  1AH8 A;  2XDU A;  1B63 A;  4KFG A;  1TID A;  4GQT A;  4FMT A;  5L3J A;  2JJC A;  3T2S A;  4CWQ A;  4EEH A;  2WWW A;  4BIU A;  3R4O A;  4XCJ A;  1ID0 A;  4WUB A;  2CGF A;  1GKZ A;  3FV5 A;  4GEE A;  4YKR A;  3DGE A;  3U2D A;  2LFS A;  4CWO A;  5CTU A;  2O1U A;  2YEJ A;  1Z5B A;  1NHH A;  3MNR P;  5M4E A;  3ZRV A;  2BSM A;  5B1O A;  1UYC A;  5M4K A;  1H7U A;  1UYI A;  3TUH A;  2QM7 A;  4ZKI A;  4BAE A;  3O0I A;  3HYZ A;  4CWT A;  1EI1 A;  2GQP A;  3RLQ A;  2YE6 A;  4E00 A;  4O0B A;  4HY1 A;  3ZXO A;  2BU7 A;  4CE2 A;  4ASA A;  3U67 A;  1I5D A;  2YEI A;  3HEK A;  3OMU A;  4FCR A;  3NXS A;  1KZN A;  1UY7 A;  2VW5 A;  2YI6 A;  3EKO A;  2YGE A;  2YE8 A;  4JAS A;  4PU9 A;  2AKP A;  3VHA A;  3Q5K A;  4EM7 A;  3VAD A;  4MPN A;  4NH8 A;  3GIG A;  4XKK A;  4CWN A;  5FNC A;  2IOP A;  3OW6 A;  4H81 A;  1UYF A;  3TZ2 A;  4BQG A;  1GKX A;  1BYQ A;  4E02 A;  2FTK A;  4URM A;  3ZKB A;  2O1W A;  1YER A;  4LWG A;  4EGH A;  4L8Z A;  4KSH A;  1OSF A;  2LFR A;  4YKT A;  3A0R A;  2YE7 A;  1UYD A;  1YT1 A;  2VCI A;  3BM9 A;  3OWD A;  4U7O A;  4WUD A;  4U7N A;  2BYH A;  3C11 A;  4BQJ A;  2WI3 A;  2YEF A;  3TZ0 A;  1YC4 A;  2FXS A;  4GFN A;  2XJJ A;  1KIJ A;  2CCT A;  2XK2 A;  5C93 A;  3G7B A;  2ESA A;  4PL9 A;  2XHX A;  1ZXM A;  1QY8 A;  4L91 A;  2XAB A;  4NH9 A;  2XHR A;  2XJG A;  2BTZ A;  3K97 A;  2YEH A;  4URO A;  2XX5 A;  4R1F A;  3B24 A;  4QPK A;  2WI4 A;  3FT8 A;  3A0T A;  4MPC A;  1AJ6 A;  4MP2 A;  4DUH A;  4X9L A;  5CTY A;  2QG0 A;  3INW A;  4KQV A;  2VWC A;  3MD0 A;  4LP0 A;  2BU8 A;  4JYB A;  2YEB A;  4XKO A;  2YGA A;  3R92 A;  4EMV A;  4E01 A;  1R62 A;  2H8M A;  4CE3 A;  4XIR A;  4YKY A;  4BXI A;  3QTF A;  4XIT A;  4AWO A;  2YE2 A;  2XDX A;  1YET A;  1Y8N A;  4MTX A;  3Q5L A;  4K4O A;  4KSG A;  3B26 A;  5FNF A;  2BU2 A;  2WI5 A;  2YKJ A;  3T1K A;  1TC6 A;  2Q8H A;  2YE9 A;  2XD6 A;  4FCQ A;  4XKA A;  5FND A;  3H4L A;  4HZ5 A;  1I5C A;  4HZ0 A;  2BYI A;  3EKR A;  1US7 A;  2BRC A;  2YKC A;  4EFU A;  3T10 A;  4CE1 A;  2XX2 A;  2IWX A;  5M4H A;  1Z59 A;  2YKB A;  3TZ5 A;  2QF6 A;  2XDS A;  2PNR A;  3A0W A;  2YE5 A;  5IDJ A;  1S16 A;  2Q2E B;  1UYL A;  1AMW A;  1AH6 A;  2HG1 A;  4I5S A;  1BKN A;  3WQ9 A;  2YJX A;  2YEE A;  1YS3 A;  1QZR A;  4HYP A;  2EXL A;  4MPE A;  5D7D A;  3CGZ A;  5F5R A;  2BRE A;  2IWU A;  4HYM A;  2WI6 A;  1Y8P A;  2YK9 A;  3GIG B;  5FWK A;  2C2A A;  4XIP A;  1Z5C A;  3HYY A;  2WEQ A;  4YKX A;  4GT8 A;  1PVG A;  5D7R A;  3FT5 A;  4B6C A;  2BU5 A;  1I5B A;  2WER A;  3WHA A;  5D6Q A;  3ZRW A;  3T0H A;  3EHG A;  4O04 A;  1I59 A;  3RLR A;  3ZKD A;  2YI0 A;  1MX0 A;  1H7S A;  3TZ4 A;  2YKE A;  1F51 A;  4CWS A;  3RLP A;  2YK2 A;  4HXZ A;  1I58 A;  3ZM7 A;  3EHF A;  4O09 A;  2YEG A;  4ASB A;  3CRK A;  1UYG A;  2YI7 A;  2FWZ A;  3R91 A;  2QFO A;  3PEJ A;  4XD8 A;  3D36 A;  5F3K A;  5BOD A;  1UYM A;  3GIF A;  3K60 A;  3A0X A;  4CWR A;  4L93 A;  3INX A;  2ZDY A;  4XDM A;  2YEC A;  5GGZ A;  3EHH A;  4ZVI A;  2XDL A;  2BZ5 A;  1YC3 A;  1Y4U A;  4AWP A;  4LC1 A;  3NMQ A;  3QDD A;  4FPP A;  4FCP A;  1YC1 A;  1B62 A;  1S14 A;  2CH4 A;  4V25 A;  4YKW A;  4URL A;  4XE2 A;  1YES A;  4XTJ A;  4JQL A;  3Q5J A;  3KE6 A;  3HHU A;  4GCZ A;  1QYE A;  3K98 A;  2WEP A;  4NH7 A;  2WI1 A;  4KP4 A;  3R4N A;  3G75 A;  1B3Q A;  3B25 A;  1UY8 A;  3HZ1 A;  4H85 A;  1AM1 A;  1MU5 A;  3EHJ A;  4Q20 A;  4U93 A;  4W7T A;  4URN A;  4O07 A;  4JAU A;  2QM8 A;  2YE4 A;  4YKQ A;  2YGF A;  4EGI A;  1IXM A;  4HY6 A;  2UWD A;  3BMY A;  3P32 A;  3T0Z A;  3TK1 A;  2O1V A;  4L94 A;  5CPH A;  5M4P A;  2H55 A;  4LWH A;  4O05 A;  1NHI A;  1YSR A;  2ZDX A;  1BGQ A;  1Z5A A;  4LPB A;  4GT1 A;  3RKZ A;  2YEA A;  4R3A A;  1L0O A;  2XHT A;  1ZXN A;  2BU6 A;  4QPJ A;  3VHD A;  4KTN A;  3H80 A;  5J6A A;  1JOY A;  2JKI A;  1UYK A;  4MB9 A;  1U0Z A;  4AWQ A;  4MP7 A;  2E0A A;  2YI5 A;  2IOQ A;  1YT0 A;  2FYP A;  3LPS A;  3SL2 A;  1EA6 A;  2CCS A;  5D7C A;  1A4H A;  4P7A A;  2HCH A;  1THN A;  3ZRW B;  1YT2 A;  4MOT A;  3OWB A;  4DZY A;  1TC0 A;  5CTX A;  4L90 A;  4I3H A;  2XDK A;  2XCM A;  2YED A;  2GFD A;  3TTZ A;  2WI2 A;  3D2R A;  1JM6 A;  3G7E A;  2VCJ A;  3O2F A;  4XC0 A;  3CRL A;  3A0Y A;  2CG9 A;  3B27 A;  2Q8G A;  5M4M A;  5IN9 A;  2K5B A;  1GJV A;  5D6P A;  5CF0 A;  4CWP A; 
#chains in the Genus database with same CATH topology
 1BE3 H;  1W0J G;  3GVM A;  3SJC C;  2BT0 A;  4RQF A;  3J7A U;  1OCO B;  1GO3 F;  4JAV A;  2HP8 A;  1Y4S A;  4LWE A;  1BXD A;  1N34 B;  1JCH A;  3G71 V;  1PNK A;  3VHC A;  2Q7E A;  3GB7 C;  4G27 B;  3CRC A;  1BT8 A;  5BOC A;  4ASG A;  1WLE A;  4L87 A;  2Z0A A;  4EFE A;  2CCU A;  3RYI A;  4UCS A;  4PRV A;  5M4N A;  4UCV A;  1IDS A;  1UYE A;  3ZHU A;  4GGL A;  5IDM A;  2Q8I A;  1PD3 A;  2QG2 A;  1XIL A;  3JAM N;  4JYC A;  3VBB A;  4GX1 A;  1L0N H;  1TH8 A;  1ZWH A;  2R9A A;  1XI1 A;  1AJP A;  4PRX A;  1EM1 A;  2ZBK B;  4MW3 A;  4XIQ A;  4GLX A;  1KQS U;  2QKA A;  1Q90 D;  2LO1 A;  2LJ2 A;  3A0Z A;  3B4S A;  3FB8 C;  4ZHQ B;  1VQN V;  3BA9 A;  1I0H A;  2JJ2 G;  4GX5 A;  4ZBM A;  1Y8O A;  2Q4P A;  2WSS G;  3ICX A;  1M56 B;  2Q8F A;  2XDU A;  3SYO A;  2ETN A;  2YIA A;  3RYF A;  1BSM A;  4FLW A;  4GQT A;  1FFX A;  2ZE8 A;  3H01 A;  2ILM A;  4YY3 O;  1J95 A;  2VQF O;  1XHX A;  3ASN B;  2BTQ B;  4IT5 A;  4XCJ A;  1SA0 A;  1SA0 B;  3E8F A;  1H2N A;  5FPO A;  1TGO A;  2CGF A;  4GEE A;  4YKR A;  3DGE A;  3CC2 V;  2LFS A;  4CWO A;  1ZL8 B;  2O1U A;  2YEJ A;  4B3S B;  3MNR P;  5M4E A;  4CZZ A;  4H37 A;  4DK0 A;  4H33 A;  1Z2G A;  4E72 A;  5M4K A;  1HNZ O;  1H7U A;  1YDX A;  1FXH A;  1UYI A;  4ZKI A;  4CH3 A;  4BAE A;  4ABM A;  1H8E G;  3O0I A;  5L3G A;  1IBK O;  1EI1 A;  2GQP A;  3RLQ A;  2YE6 A;  1M9N A;  4L8J A;  4MSW C;  4CS3 A;  4O0B A;  4FM2 A;  4PDM A;  2QWR B;  3ZXO A;  1R6N A;  4FJC C;  4WFA V;  5LMN B;  1OHH G;  1BCC H;  4FCR A;  2XAF A;  4X89 A;  4JTC B;  4IIJ B;  1I5Y A;  4YHH B;  2BSK B;  3K5L A;  1IBM B;  4R50 A;  3VAD A;  1A32 A;  4I55 A;  1VF6 C;  3GIG A;  4XKK A;  2ZDI A;  1O9G A;  4FLX A;  4UV9 A;  3RW0 A;  1NR7 A;  2LW7 A;  1I94 O;  2PI4 A;  2O1W A;  3OMN B;  4EGH A;  2UUA B;  4UXN A;  3KCY A;  1VQ5 V;  1OSF A;  3CCU V;  3BRC A;  5F2V O;  1KYO F;  4JTD B;  3LNN A;  2YE7 A;  2P7T C;  1UYD A;  3MHH C;  5CBG A;  4FFB B;  3AG7 A;  4WF9 V;  1M4U A;  1M93 A;  2WLI B;  1Y74 A;  2ZNJ A;  3C11 A;  4BQJ A;  1XL6 A;  2E74 B;  3TZ0 A;  2FXS A;  5LXT A;  2EJ7 A;  2LW1 A;  4DV0 B;  4DR6 B;  1KIJ A;  5CBF A;  1V55 C;  3CCV V;  2YI8 A;  1ZXM A;  3PN1 A;  1QY8 A;  4LH7 A;  4B3M B;  1NI8 A;  2YEH A;  4ZOL B;  3B24 A;  3CC7 V;  3ZN0 A;  3FT8 A;  4DV4 O;  1XHZ A;  3L9D A;  3ETG A;  4F6E A;  5IJ0 B;  1PL4 A;  5IJ0 A;  5CMU A;  3G4S V;  3WG7 B;  2XND G;  2QG0 A;  4DRX B;  3RVZ A;  2VWC A;  2X6B A;  2AZ0 A;  4LP0 A;  2CTP A;  3FAV B;  3CRA A;  3UO2 A;  4DUY O;  4E01 A;  1R62 A;  5CB4 A;  3CCL V;  1T5E A;  1BHB A;  4XIR A;  3KZI Z;  1OCZ B;  4AWO A;  2YE2 A;  4MTX A;  1GM7 A;  5KX5 A;  4KSG A;  1GRJ A;  4I0X A;  4NB5 A;  3T4Z A;  4NTW A;  2OIG A;  4NKG B;  3AG1 B;  1KUQ A;  4TT3 G;  4XKA A;  3QVN A;  1H8H G;  4O2B B;  5FND A;  1XEQ A;  2RDC A;  4TOI A;  4HZ5 A;  1ZSP A;  2R9R B;  4UB6 Z;  1I5C A;  4LF8 B;  1FXK B;  2BYI A;  1HWY A;  1IXB A;  1AI7 A;  1QLE C;  1RFY A;  2H94 A;  1N33 B;  2Z3Y A;  3ZHV A;  2BRC A;  1YEW A;  3I5D A;  2YKC A;  4CC5 A;  4EFU A;  2CDY A;  3JAR B;  4X1Y A;  1FAF A;  2ZNI A;  1KMI Z;  3R65 A;  1SES A;  4O2A B;  2HKO A;  3ZX6 A;  2PNR A;  2V7Q G;  2YE5 A;  3A0W A;  5DED A;  1AH6 A;  1HNX O;  5IWA O;  1BKN A;  2OCC B;  3WQ9 A;  2Y4U A;  4HYP A;  3Q4H A;  3Q4H B;  3WB0 A;  4R7C A;  3HKC B;  2EIJ B;  2EXL A;  1CEZ A;  3CGZ A;  2VQF B;  1D2D A;  4HYM A;  2OT5 A;  2R72 A;  2DOS A;  5FWK A;  1SQP H;  1Z5C A;  4RAI A;  2Q68 A;  1W0K G;  1PVG A;  4GT8 A;  3OR6 C;  4O4L B;  3FT5 A;  3JD0 A;  2EIM B;  2WER A;  5EYP A;  5EYP B;  3OD4 A;  1HNZ B;  1BZK A;  3T0H A;  3OAA G;  2F95 B;  1Q43 A;  2XHB A;  3OW2 U;  3ZKD A;  1IBK B;  1NS1 A;  3H9V A;  3CXH F;  2ZR3 A;  4BIO A;  3CC4 V;  4DXW A;  1VF5 B;  3MDS A;  2QEX V;  2YKE A;  1K92 A;  2JRI A;  2YK2 A;  2CTW A;  4LF6 B;  3AG3 B;  3EHF A;  3U10 A;  4PA7 A;  2QGN A;  1ARO P;  4ASU G;  3BAA A;  1RPO A;  3AG4 B;  3R91 A;  4J7Z A;  2QFO A;  4ICG A;  5JVD A;  4A5U B;  5A2Q N;  5F3K A;  4PDV A;  1K97 A;  2GTS A;  1I94 B;  2ARH A;  2Q69 A;  3OR7 C;  3RYC B;  5EC2 C;  4K3A A;  3CRQ A;  5GGZ A;  1PPJ H;  1LUW A;  1K73 W;  4WCE V;  3JCU Z;  4TV9 A;  4TV9 B;  4AWP A;  4LC1 A;  3JAS A;  4EB6 A;  1RSO A;  3QG5 A;  4MS2 A;  4FCP A;  3HKE A;  1NH2 B;  3ETE A;  1NU1 H;  4N21 A;  1B62 A;  3K0G A;  4YKW A;  4URL A;  5JH7 B;  1YES A;  1ZTE A;  4XTJ A;  4BW9 A;  4JQL A;  3Q5J A;  4LWS A;  4LWS B;  2G38 A;  3CE2 A;  4RUE A;  3D8C A;  4DR7 O;  2WI1 A;  2X7R B;  3R4N A;  3FYI B;  3TJT A;  1DK1 A;  1OCZ C;  4NVP A;  4X65 O;  3SYA A;  1VQ7 V;  3ABL B;  1KKD A;  2A7W A;  5LGU A;  2CAZ C;  4DV4 B;  1MU5 A;  1Y4M A;  5B66 Z;  1YI2 V;  3EHJ A;  4U93 A;  2LGW A;  1XOU A;  2ZT9 B;  3CCM V;  2OWO A;  1QBZ A;  1SQX H;  2BOB C;  4JAU A;  4YKQ A;  1SZX A;  3AG1 C;  1GM8 A;  4HY6 A;  3T0Z A;  4JI3 O;  4DUY B;  4MW8 A;  2QM4 A;  3EHB B;  1FXK C;  4DV6 B;  1Y76 B;  4PDL A;  5A9G A;  4J9Y B;  2X6C A;  1Q82 W;  4GT1 A;  2YEA A;  5L3C A;  4YJ3 B;  1NBM G;  4PDR A;  2XAG A;  1WP7 A;  1NZ6 A;  5BR8 O;  3G80 A;  3T1H O;  4KTN A;  5J6A A;  1VIB A;  2JDI G;  1JOY A;  3D3Q A;  2UXB O;  3ZED A;  2IBZ H;  4XBF A;  1U0Z A;  3NR7 A;  4PI0 A;  3WB1 A;  2FYP A;  2UXN A;  1WB8 A;  2CCS A;  5KHH A;  1NJI W;  5D7C A;  4GX0 A;  2QWN B;  3ZRW B;  2QKS A;  4I4T B;  4I4T A;  4MOT A;  4X64 O;  4R6Z A;  1TC0 A;  5CTX A;  3ZN1 A;  2Y0I A;  4L90 A;  4DO2 A;  1JJO A;  1BQZ A;  3L72 H;  1YHQ V;  2GFD A;  2W6J G;  5FLX N;  2WI2 A;  1K7D A;  3SJB C;  4CH4 A;  1JM6 A;  3T1C A;  3JSL A;  4HNA A;  3O2F A;  2EX3 A;  3RFR A;  5CA0 A;  2UU9 O;  1KU9 A;  5CN0 A;  3QF7 A;  5EK0 A;  4JV5 O;  1US6 A;  3B27 A;  2Q8G A;  4TQD A;  3UT5 A;  2JS3 A;  5LHG A;  5CF0 A;  4CWP A;  3ZHS A;  3AG3 C;  2FWY A;  3W7U A;  2YIB A;  5IT9 N;  4JI7 O;  1K34 A;  2ADQ B;  3IED A;  2AW9 A;  3O6O A;  3DXR A;  4G28 B;  1ZW9 A;  5CTW A;  2YJW A;  3C0E A;  4FM1 A;  4ASF A;  3IJ4 A;  4XCL A;  3CCR V;  1S77 D;  2ZE6 A;  5LYJ A;  3K9S A;  4MBC A;  5LHH A;  4KHP O;  1TIL A;  4QIW F;  2HKJ A;  4UCU A;  4LF4 O;  1GM9 A;  2JIZ G;  4EFT A;  4YKZ A;  1EN4 A;  4AS9 A;  1QCE A;  4B7P A;  5B1N A;  3C3T A;  4FM0 A;  3EVK A;  3S3W A;  3CCJ V;  1UYH A;  4YKU A;  1TVK A;  1NHJ A;  4PHZ A;  3CGY A;  2XX4 A;  2IWS A;  1AJQ A;  5CBH A;  1U2O A;  1GTO A;  5LOV A;  2YKI A;  3JAT A;  4V26 A;  2Y69 B;  4XDJ A;  2HHH O;  2MK3 A;  2P4K A;  3ABL C;  4KFG A;  3H1H H;  4YIP A;  4WBN B;  4FLY A;  1NTK H;  1M5I A;  3DTU B;  2F23 A;  2WWW A;  3ZRS A;  5J2T B;  1MSW D;  4BIU A;  4JPR A;  4RQE A;  3R4O A;  2F66 C;  4UFZ A;  2B5U A;  1GKZ A;  4TUY B;  1YJ9 V;  1VF7 A;  3E22 B;  5E79 Z;  3K58 A;  1NHH A;  2IH3 C;  3SPC A;  3ZRV A;  3C3S A;  1UYC A;  5AG2 A;  4DR7 B;  4CS4 A;  2HLD G;  1MZF A;  3ETD A;  4X65 B;  3T4D A;  4CWT A;  2B1G A;  3T1Y O;  2YID A;  4E00 A;  4HY1 A;  1KD1 W;  2BU7 A;  2AZ2 A;  4CE2 A;  2M7W A;  3U67 A;  2OCH A;  3GWK C;  3IAY A;  4NXM O;  3OMU A;  4Q6G A;  4CH5 A;  3SJQ C;  2V1D A;  1KZN A;  1QVG U;  2VW5 A;  4AIL C;  3JD4 A;  2YGE A;  4JI3 B;  2QWQ B;  1D5N A;  3VHA A;  4LF7 B;  1K4D C;  3Q5K A;  2BE3 A;  4GYC B;  1WA8 A;  4NR1 A;  1HNW B;  2X6A A;  3OW6 A;  3TET A;  4BQG A;  3TZ2 A;  4E02 A;  5BR8 B;  2CGO A;  3T1H B;  3B2E E;  3B8N A;  4NXN O;  1OV9 A;  2DWD C;  5B5E Z;  4YKT A;  1GH6 A;  2UXB B;  3A0R A;  2CH7 B;  3HKD A;  4UVC A;  2M6Y A;  2VCI A;  3BAB A;  4U7O A;  4WUD A;  4X20 A;  3I56 V;  5JCO C;  1YC4 A;  2XAH A;  2XJJ A;  4X64 B;  1BHA A;  4J41 A;  2F4V B;  2IJH A;  3G7B A;  2AGA A;  3D36 C;  2EIL B;  2XHX A;  1K5Q A;  1PL0 A;  2WA4 A;  3RYI B;  2XJG A;  3N2G A;  1JX9 A;  3IC7 A;  3ABK C;  5JWP A;  2R70 A;  4R1F A;  3STZ C;  3CCE V;  1HDJ A;  3OMA B;  2UU9 B;  3A0T A;  2Y48 A;  3JAK A;  1G4Y B;  3K79 A;  2QA4 V;  1PP9 H;  5L3E A;  2X0L A;  3RYH A;  4X9L A;  1SKV A;  3INW A;  2CTR A;  4KQV A;  1KBH A;  3IFX A;  3MD0 A;  4U3J A;  1ZUQ A;  4HAM A;  4U3J B;  2BU8 A;  4Z1V A;  2YEB A;  1KEC A;  2YGA A;  4DV5 B;  2YS8 A;  3R92 A;  1N0N A;  4JI7 B;  4EMV A;  3VQV A;  2PI5 A;  4CE3 A;  3WFV A;  1LUV A;  2JS5 A;  1BL8 A;  5DN6 G;  1YET A;  4PA6 A;  1I5X A;  3CS5 A;  2BU2 A;  4DV7 B;  1FPO A;  4FLZ A;  3R66 A;  4UUJ C;  1QNM A;  4CC6 A;  3RYF B;  5J2U A;  1FFX B;  4B3T O;  3T1K A;  4OGQ B;  5KHJ A;  2JGU A;  1L1F A;  4LF4 B;  2YE9 A;  4AHC A;  1AR5 A;  4RWU A;  2PF4 E;  3OEH G;  3A0H Z;  4GKK O;  2Y69 C;  1FJG B;  4PA9 A;  1M1K W;  5DM6 V;  4DR4 B;  2JVD A;  1QHT A;  3D3I A;  1KKC A;  4JYY A;  2NLJ C;  1I7F A;  2DW4 A;  5M4H A;  3HKB A;  2YKB A;  2OIE A;  3TZ5 A;  2UUC O;  3G67 A;  2F93 B;  3ZMS A;  2ZE5 A;  2QF6 A;  5IYZ A;  2Q8V A;  2GUZ A;  1JQ0 A;  1S16 A;  2Q2E B;  1AMW A;  2XAQ A;  5KHG A;  1J5E B;  1GMG A;  2HHH B;  2F1M A;  3JD2 A;  3OEE G;  2YJX A;  2RJZ A;  4DW1 A;  3L71 H;  4WFH A;  1YS3 A;  2RN9 A;  1V9P A;  5LP6 A;  4MPE A;  1ZX3 A;  4I55 B;  2Q6A A;  3GIG B;  2IM9 A;  3ZBH A;  4KL1 A;  5B1A C;  2H8P C;  2WEQ A;  4YKX A;  2Q67 A;  1NH2 D;  2HR3 A;  3CCQ V;  3AK2 A;  2BU5 A;  4B6C A;  3LSS A;  4B3R O;  2UUB O;  4X66 O;  2N04 A;  4FIP C;  2Y4T A;  1GN4 A;  4DR2 O;  3BHP A;  3CHX A;  3K3W A;  4W4L A;  1I59 A;  3RLR A;  2YI0 A;  2RMK B;  1MX0 A;  1U96 A;  3T1Y B;  2W6I G;  5L3B A;  1F51 A;  2EUL A;  4JI0 O;  1Y74 B;  4NXM B;  5BXZ A;  1N0J A;  1I58 A;  1JVM A;  5LXT B;  4ZIB A;  3CRK A;  2YI7 A;  3K5M A;  2IH1 C;  2FWZ A;  1VEW A;  3K57 A;  2YIC A;  3PEJ A;  2FL4 A;  1DF4 A;  5KA6 A;  5LL6 Y;  4G2K A;  1OCO C;  4XD8 A;  2A9H A;  4X8A A;  4JF3 A;  4GX2 A;  3GIF A;  3K60 A;  1WP8 A;  2IW5 A;  1PNM A;  4CWR A;  4O4H A;  4O4H B;  4XDK A;  4O4I A;  2VWJ A;  4WFB V;  2EIL C;  4NXN B;  3B77 A;  1CP9 A;  3EHH A;  2N74 A;  3AG2 B;  2XDL A;  1R3L C;  4MVO A;  1Y4U A;  2ZIN A;  3FKS G;  3NMQ A;  3QDD A;  1B6Q A;  5CB4 B;  2KG7 A;  4FVM A;  3CRM A;  1M90 W;  1IVS A;  4LF5 O;  5KX5 B;  3KE6 A;  4JAA A;  5FPR A;  4I0X B;  5KUK A;  4N23 A;  2WEP A;  2WLN A;  1L0L H;  2ZM6 O;  3SYC A;  2CUG A;  5HFM A;  1HW7 A;  1NTM H;  1M56 C;  3BCC H;  2QTO A;  5HFL A;  2GHY A;  5LGT A;  5GW7 A;  5B3S B;  5JQG A;  3UM7 A;  3L74 H;  2O57 A;  1AI6 A;  4QJF B;  2Z5U A;  2LQT A;  4YJ2 A;  1YZB A;  1IXM A;  4X1Y B;  3ASN C;  3TK1 A;  5M4P A;  1TA8 A;  2H55 A;  5IY5 B;  4U3F H;  1NQT A;  4H0L B;  2WPD G;  2HHI A;  4JI1 O;  1YSR A;  1AR4 A;  3E8H A;  2WLH A;  3CPW U;  1ZXN A;  4Z2W A;  4O4J A;  4O4J B;  1VQP V;  5B1B B;  4P9P A;  4B3T B;  3KCX A;  2JK5 C;  4YY3 B;  1WN7 A;  3ZHR A;  4IHJ A;  4IHJ B;  1H2S B;  2ZD9 A;  5EZY A;  3SR2 C;  4GKK B;  2AXT Z;  1OZ0 A;  1XMO O;  1Q81 W;  4MP7 A;  1QQC A;  1MOF A;  2YI5 A;  3DSQ A;  3CSX A;  2Y0P A;  1YT0 A;  4UB8 Z;  3E86 A;  1P84 F;  4JI8 O;  3JSN A;  1QVF U;  1F23 A;  5LA6 A;  4P7A A;  2FYU H;  1JFF A;  1YT2 A;  4BR6 A;  4HZ3 A;  4DZY A;  2WLK A;  5FNV A;  2UXX A;  3F7V C;  1S72 V;  2ZDI C;  2Q0O C;  2UUC B;  4B7K A;  5GON A;  4I3H A;  2VQE O;  2YUA A;  2DQ0 A;  4FK5 C;  2YED A;  3BFR A;  1Q6I A;  2ZIO A;  3D2R A;  4H44 B;  2QR4 A;  4MVR A;  1P4R A;  4UVA A;  3LDE A;  3JAL A;  1AIL A;  3HPL C;  5JVD B;  4TWK A;  4C7U A;  5KHI A;  5LBQ A;  5J71 A;  3JZ3 A;  4H7Q A;  3R4M A;  4DK1 A;  3HZ5 A;  3RBZ A;  3GIE A;  4B3R B;  2UUB B;  4X66 B;  4LWF A;  5ITZ A;  5ITZ B;  4DR2 B;  1KP3 A;  2OTJ V;  1G1X B;  1CPY A;  5BMV A;  3U2K A;  1YSZ A;  1NVP B;  4KFM A;  3OPD A;  4JYA O;  1GKF A;  3K99 A;  1UFI A;  3JAS B;  4EB6 B;  4R3M A;  1RSO B;  1DLB A;  4JI0 B;  3HKE B;  3E8B A;  5KAI Z;  3R4P A;  4Z1M G;  3X2Q B;  3WG7 C;  5H2F Z;  3ZXQ A;  1UY6 A;  3A0B Z;  2BOC C;  3AG2 C;  1PM9 A;  4P8O A;  3ZRX A;  1H2M A;  1UY9 A;  3PEH A;  4TV8 A;  3CCS V;  1FKA O;  2DJV A;  3LNM B;  5KA5 A;  4LWI A;  2P67 A;  2ZIM A;  1WAZ A;  1XL4 A;  3K0D A;  1W59 A;  4OX9 O;  4UV8 A;  1ENV A;  1Y67 A;  2UXD O;  4WUC A;  3OTF A;  3CP1 A;  3B28 A;  3ZHT A;  1YVW A;  5EBM C;  3TXS A;  4EGK A;  2XJX A;  5EBL C;  3CB2 A;  4CWF A;  4CH6 A;  2RQ6 A;  1AH8 A;  1Q5O A;  2EIK B;  4LFB O;  2PY5 A;  3ASO B;  1B63 A;  1M57 B;  1IBL O;  2JJC A;  1IUR A;  4CWQ A;  4EEH A;  3LSU A;  2WLL A;  4H13 B;  1ID0 A;  2Q0A A;  4EEQ A;  4LF5 B;  1EBO A;  2PYJ A;  2OYQ A;  2HFE C;  2OTL V;  2BSM A;  5B1O A;  1N4C A;  2KKW A;  1V54 B;  1VQO V;  3FB7 C;  4MTO A;  3TUH A;  1GAX A;  2QM7 A;  1SQG A;  1ZLZ A;  3HYZ A;  1FS0 G;  1WPB A;  3LDD A;  4OXS A;  1B06 A;  2DN9 A;  2CGN A;  2OCC C;  1B04 A;  2ZE7 A;  3FFQ A;  1WB7 A;  3L70 H;  5B1B C;  4FLT A;  2YEI A;  3HEK A;  3LSQ A;  1F4N A;  1DF5 A;  2IU0 A;  2EIJ C;  4IYH A;  1GN2 A;  1N32 O;  4JAS A;  4PU9 A;  1ZAU A;  2AKP A;  4MTG A;  5KHK A;  3G6E V;  4EM7 A;  2GV9 A;  4JI1 B;  2L35 A;  4CWN A;  1R3I C;  2ITC C;  4J10 A;  2EIM C;  3CX5 F;  3CJH A;  1HNX B;  1XNR O;  4HNA B;  5IWA B;  3KKY A;  3CD6 V;  3M8A A;  1UYF A;  5LGN A;  2FB5 A;  2FTK A;  3ZKB A;  5CA0 B;  4QNH B;  4FZ0 A;  1YER A;  3HB3 B;  4KSH A;  2YEV A;  4LCU C;  3UT5 B;  4DR5 O;  1AI4 A;  3DC6 A;  3ML0 A;  2K1E A;  3BM9 A;  1F4M A;  3ZMZ A;  4JI8 B;  2BYH A;  1DGS A;  2LGQ A;  1R73 A;  2QWO B;  2YEF A;  1S5H C;  4GFN A;  1YIJ V;  3AG4 C;  3DXR B;  3RGB A;  3ABT A;  2ZKO A;  5E1A C;  2GSM B;  1SET A;  3O65 A;  2ESA A;  5LYJ B;  2VQE B;  4NH9 A;  5KMG A;  3FD9 A;  2BTZ A;  3K97 A;  1RP3 B;  4URO A;  2XX5 A;  4QPK A;  1O9H A;  2WI4 A;  2YXL A;  3CME V;  4MPC A;  4MP2 A;  1PKX A;  1VQK V;  1D5A A;  5CTY A;  2DMX A;  2N05 A;  1VAR A;  3CYO A;  1SC5 B;  1TVK B;  3F7Y C;  2RCV A;  1Q3E A;  1S3J A;  4XKO A;  3FB5 C;  2C1G A;  1I08 A;  3SYQ A;  3X2Q C;  2A79 B;  2H8M A;  4X1I A;  4QGP A;  1AI5 A;  2QKC A;  3K08 A;  4AQY O;  2QE7 G;  1ORQ C;  3QTF A;  4XIT A;  3TGU H;  4BXI A;  5KAF Z;  1Y8N A;  1S5J A;  4DV2 O;  4K4O A;  5LOV B;  3B26 A;  3JAT B;  2YKJ A;  4JYA B;  1SER A;  2WAM A;  1TC6 A;  2GTA A;  3UKM A;  2XD6 A;  2W0X A;  1NTZ H;  1F7Y A;  1AP5 A;  3BA8 A;  3H4L A;  3B8M A;  1RPR A;  2EIK C;  4HZ0 A;  1K3E A;  4LNU A;  3ASO C;  3EKR A;  3APO A;  1US7 A;  3EFF K;  1AP6 A;  5H6R A;  5KUM A;  3T10 A;  1R3J C;  4CE1 A;  1JJ2 U;  1VP7 A;  2KSD A;  4NTX A;  4OX9 B;  1Z59 A;  1R3K C;  3APQ A;  2UXD B;  2VRZ A;  4BW5 A;  2HVK C;  2JJ1 G;  2BCC H;  3N2K A;  4PI2 A;  1UYL A;  5D5Q A;  1FYJ A;  2HG1 A;  3RWR D;  2DE0 X;  4I7Z B;  2NN4 A;  4UCO A;  2YEE A;  4ZI7 A;  1IBL B;  5D7D A;  4GUN A;  3A8T A;  2EZO A;  5F5R A;  2BRE A;  2IWU A;  4J80 A;  1MSD A;  2WI6 A;  2YK9 A;  1WA8 B;  2HG5 C;  1GN3 A;  2PTM A;  1YTF B;  2C2A A;  1VF6 A;  2V4D A;  1AB3 A;  5JJJ B;  2D2C B;  4J7J A;  3EHG A;  4O04 A;  3GWO A;  2AHY A;  3WU2 Z;  5L3D A;  2YSU B;  1H38 A;  4LR3 A;  2R9I A;  3HKD B;  2QWP B;  2FKX A;  2P6J A;  5EC1 C;  3IGA C;  3JAW A;  4X20 B;  2GBO A;  4B3M O;  3P3P A;  3ZM7 A;  1UJW B;  3LUT B;  4PEL A;  3CYG A;  3K5N A;  2YEG A;  1N32 B;  4ASB A;  1QR9 A;  5J9P C;  3E8G A;  4F4L A;  4KUM A;  4K35 A;  1RM1 B;  2XAS A;  1AVM A;  3AK1 A;  3ZJZ A;  2GDS A;  3N2G B;  2YC0 A;  3ZMV A;  5BOD A;  3CXC U;  1XNR B;  5K1P A;  1H2L A;  1QU7 A;  1VQ9 V;  3K04 A;  1JA8 A;  1NKD A;  3CMA V;  3JAK B;  4L93 A;  1TAE A;  2QJ1 A;  3BY6 A;  4JV5 B;  2HVJ C;  4DR5 B;  4XDM A;  2YEC A;  2P22 C;  3SYP A;  3RYH B;  3JYC A;  3ZHQ A;  1P49 A;  2IJJ A;  2BZ5 A;  1YC3 A;  1BQ0 A;  3U0Z A;  1Q86 W;  4V25 A;  1U97 A;  4JGS A;  3W7W A;  3KG2 A;  4AI8 A;  3QTC A;  4LF8 O;  5D5P A;  2FML A;  3HHU A;  1N33 O;  4NYK A;  4GCZ A;  1QYE A;  1XUQ A;  1YCI A;  5J2U B;  4KHP B;  2EIN B;  1G8M A;  3G75 A;  3LDC A;  5JJN B;  3B25 A;  3CEI A;  4PA4 A;  1QLN A;  4Q20 A;  4ZHQ A;  4MVS A;  4O07 A;  1EZJ A;  4IYI A;  2XT9 A;  1SZT A;  2QM8 A;  4YXW G;  1LR1 A;  4HBN A;  4P9O A;  1QLE B;  1ZWI C;  1VQL V;  2A06 H;  2UWD A;  4EGI A;  3P32 A;  3JCZ A;  3JD1 A;  5GTI Z;  3HKB B;  1FXV A;  1Q6U A;  4L94 A;  2BTQ A;  4X9Q A;  4AQY B;  4LWH A;  2YXH A;  2WLM A;  1NHI A;  2ZDX A;  5IYZ B;  1BGQ A;  4LPB A;  2GUZ B;  2P4V A;  4DV2 B;  1SQV H;  1XQ8 A;  3K03 A;  2E3C A;  4R3A A;  1ZL8 A;  1E1R G;  3J80 N;  2QTS A;  1CXZ B;  4QPJ A;  5LP6 B;  3VHD A;  4W4K A;  3ETQ A;  1NVP D;  2ZQM A;  2PZS A;  2JKI A;  1S76 D;  1X59 A;  2E0A A;  2NNU A;  3LPS A;  3SL2 A;  4LF9 O;  1EA6 A;  1GK9 A;  4LF6 O;  1A4H A;  5K1X A;  4FLU A;  1JMK C;  4IIJ A;  4KXR A;  2BSK A;  2CTQ A;  2JEX A;  4IGG A;  3P3N A;  1WPX A;  4MVQ A;  3OUS A;  3TTZ A;  5LMU O;  1MNG A;  3G7E A;  1E1Q G;  2VCJ A;  4XC0 A;  3CRL A;  4UVB A;  3A0Y A;  2CG9 A;  1UPG A;  4JI5 O;  2HJD A;  3E83 A;  5IJ9 A;  5IJ9 B;  5M4M A;  1KP2 A;  2K5B A;  1GJV A;  4PA3 A;  3OTO O;  2YXY A;  2ATK C;  3VOU A;  4FFB A;  1BMF G;  1MAB G;  1YSC A;  5EIB D;  2WLI A;  1VQ4 V;  5L3F A;  1TBW A;  4J7K A;  3ZCC A;  2EJR A;  4BIZ A;  1LNQ A;  4O4I B;  1VQM V;  1RM1 C;  2JGD A;  2JGD B;  3W7T A;  1XDC A;  2WA3 A;  1HR0 O;  4DR3 O;  3ZMT A;  3E2E A;  4DV1 O;  3UCS C;  2DYS B;  3U11 A;  2HJF C;  2Q7G A;  4ZOL A;  2WI7 A;  1YF2 A;  2KG7 B;  2XTA A;  3S3X A;  2ZKJ A;  4EKW A;  1VQ6 V;  1K8A W;  2IOR A;  2HEP A;  3D0B A;  1HP8 A;  3FX7 A;  3LNU A;  2A0L A;  4DRX A;  2E5L O;  1MA1 A;  3FAV A;  1OCC B;  1EZV H;  1I5A A;  2YE3 A;  4HXW A;  4MT8 A;  4E4E A;  4DV6 O;  3CWV A;  4QE7 A;  3BEH A;  4X62 O;  2RNB A;  5JQG B;  2EIN C;  4YJ2 B;  4TSF G;  2ZR2 A;  3H1L H;  1TID A;  4FMT A;  5L3J A;  1XNQ O;  3BVO A;  4LFA O;  3T2S A;  4DR1 O;  1IX9 A;  4O2B A;  3RT3 C;  4UCT A;  1EN5 A;  4WUB A;  3OGC C;  4JI2 O;  3FV5 A;  3U2D A;  2YIB D;  1FXK A;  2BTO A;  4QE9 A;  4WFE A;  5CTU A;  1Z5B A;  2EZP A;  4P2Z A;  1P7B A;  1Z5W A;  3PJS K;  3JAR A;  2ODM A;  2ZXW B;  1THZ A;  1H2G A;  5EZY B;  2MW2 B;  3WB2 A;  3ZMU A;  4JI4 O;  4J9Z B;  1K33 A;  4O2A A;  2E76 B;  3K59 A;  1K9M W;  4ASA A;  2JEU A;  1I5D A;  3I55 V;  5LP6 C;  5LA6 B;  3NXS A;  1SRY A;  1JFF B;  1UY7 A;  3STL C;  2IJK A;  2YI6 A;  1TUE B;  3P30 A;  3EKO A;  2YE8 A;  1MMM A;  5FNV B;  1FFT B;  3HKC A;  5GON B;  4TQF A;  1N36 O;  4MPN A;  1X4T A;  4NH8 A;  4HYO A;  1XMQ O;  5FNC A;  4OPH A;  2IOP A;  4D7T A;  2P06 A;  4H81 A;  4O4L A;  4JZ2 A;  1FD9 A;  1GKX A;  1BYQ A;  4X1K A;  4X1K B;  4URM A;  1SQB H;  3ZIA G;  4LWG A;  5KLV H;  5IE9 A;  4L8Z A;  4MVU A;  3N27 A;  2UXC O;  3JAL B;  2VWK A;  1AJN A;  1GN6 A;  2LFR A;  3THO A;  3SPG A;  1YJW V;  2EBO A;  1R6K A;  4EFB A;  1YT1 A;  3OWD A;  4LF9 B;  1JPX A;  4U7N A;  2E75 B;  2WI3 A;  4JZG A;  1JR9 A;  4B08 A;  2ITD C;  5BMV B;  2CCT A;  3K9A A;  4CBC A;  2XK2 A;  5C93 A;  1KB9 F;  3B40 A;  4NTY A;  4I50 A;  4I50 B;  3L75 H;  1G6U A;  2ADP A;  2Q7H A;  3F5T A;  4FFK A;  4PL9 A;  1SF9 A;  4WFF A;  4BWA A;  4K8X A;  4L91 A;  2XAB A;  2XHR A;  1OCR B;  1S0V A;  1YXB A;  1Y66 A;  5LMU B;  3CRR A;  3RYC A;  1COW G;  1TUB A;  1TUB B;  4JI5 B;  1AJ6 A;  4DUH A;  4DUZ O;  3UO3 A;  2B1I A;  4J42 A;  2DYS C;  4TV8 B;  1Y6X A;  3OTO B;  2WLJ A;  4DV3 O;  4LH6 A;  3SGI A;  4JYB A;  2DYR B;  2P90 A;  3ABU A;  3ABM B;  2CE4 A;  4B7E A;  4YKY A;  3OMI B;  5JH7 A;  3AK3 A;  1EN6 A;  2XDX A;  1YTF D;  2C1I A;  3Q5L A;  5FNF A;  1HR0 B;  2QDO A;  2WI5 A;  4DR3 B;  1OCC C;  2CK3 G;  1SQF A;  4DV1 B;  2KB1 A;  4LFC O;  4DW0 A;  1H2K A;  1WNS A;  1YIT V;  4K0K O;  1EFR G;  2Q8H A;  4FCQ A;  2WLL B;  2IJI A;  5B3S C;  4D7S A;  1XRE A;  2A3Q A;  3OE7 G;  3FYE B;  5IYD O;  1QR8 A;  4P30 A;  2IU3 A;  4JI6 O;  3JD3 A;  2E5L B;  4LBE C;  3K5O A;  5IY5 C;  1K4C C;  2XUM A;  2XX2 A;  2ZM6 B;  2IWX A;  4I9Q A;  4LF7 O;  4IL6 Z;  4FZ1 A;  3G6B A;  3OT7 A;  1Y76 A;  2XDS A;  3EXA A;  4X62 B;  5IDJ A;  1HNW O;  5H9C A;  4I5S A;  4YJ3 A;  3TXQ A;  3M99 B;  1S5L Z;  1Q7Y W;  2ZXW C;  3SDL A;  5H6Q A;  5EBW C;  1MZE A;  1VMG A;  1XNQ B;  4LFA B;  1QZR A;  1OJH A;  1BS3 A;  3QO7 A;  4DR1 B;  5BY1 A;  1Y8P A;  4JI2 B;  5CA1 A;  5CA1 B;  4GKJ O;  1AR1 B;  4XIP A;  3HYY A;  4CS2 A;  3CJH B;  5D7R A;  1YJN V;  1I5B A;  3DC5 A;  1ROP A;  1N34 O;  1IZ3 A;  3FB6 C;  3E35 A;  3O9O A;  4X88 A;  3ZRW A;  3UQ8 A;  5D6Q A;  3WHA A;  2Q5Z A;  2YEV B;  2F4V O;  3A2F A;  3OGI B;  2KQX A;  4JI4 B;  1XMO B;  1H7S A;  3TZ4 A;  3IC9 A;  3SPJ A;  5CA3 A;  4CWS A;  3RLP A;  4HXZ A;  3H1K H;  3W7X A;  1PNL A;  1Z5V A;  4RUF A;  4OPA A;  4O09 A;  1NR1 A;  3QO5 A;  1N8R W;  3ZS8 C;  5DEC A;  1UYG A;  5JCO A;  4PD4 F;  4XDL A;  4F6R A;  4F6R B;  2QSA A;  3W7S A;  1NT2 B;  3OUF A;  1N36 B;  5JEN A;  1DTO A;  5KMG B;  3D36 A;  1XMQ B;  2PGG A;  1UYM A;  2PUS A;  4DV5 O;  4E2L A;  2VS0 A;  3OFN G;  3A0X A;  3ABK B;  2Q9L A;  1MG1 A;  3INX A;  2PYL A;  3MAQ A;  3VQY A;  2UXC B;  2ZDY A;  1L8D A;  5IYB O;  4ZVI A;  4DV7 O;  1OCR C;  2YDE A;  1XBL A;  4PJ0 Z;  2D3O W;  4J11 A;  4D6T H;  4FPP A;  4DYL A;  1URF A;  4X1I B;  1YC1 A;  1S14 A;  2CH4 A;  4K8Z A;  4XE2 A;  5JJE B;  1FJG O;  3F5W C;  5GTH Z;  4DR4 O;  3K06 A;  4B3S O;  1SQQ H;  3H1I H;  3SPH A;  2F43 G;  1KC8 W;  2DYR C;  2DQ3 A;  3K98 A;  2B9Z A;  4NH7 A;  3ABM C;  3SPI A;  4KP4 A;  3TCU A;  1R6T A;  1B3Q A;  4LP8 A;  4WFG A;  1UY8 A;  3HZ1 A;  4H85 A;  4GZR B;  1AM1 A;  5H5N A;  4I9W A;  4MVZ A;  4DUZ B;  4W7T A;  4LNU B;  4URN A;  1P7G A;  1M57 C;  4UCR A;  5LMN O;  1J5E O;  1VQ8 V;  4DV3 B;  5EIB C;  2ZCE A;  2YE4 A;  2YGF A;  2H3O A;  3H1J H;  3BMY A;  4FLV A;  3B09 A;  4YHH O;  3L73 H;  4WBN A;  2O1V A;  5CPH A;  2W0F C;  5J2T A;  3J81 N;  5LHI A;  1IBM O;  2YI9 A;  2P5O A;  4O05 A;  3MHS C;  5IYC O;  1BGY H;  1Z5A A;  4TUY A;  3LMM A;  4YIO A;  3HR0 A;  4PV1 B;  3N2K B;  3RKZ A;  3E22 A;  1L0O A;  1V54 C;  4RO2 A;  2XHT A;  2XOK G;  4LFB B;  3M7M X;  4LFC B;  2BU6 A;  4ZI7 B;  4K0K B;  2UUA O;  4R8C A;  3H80 A;  2L6L A;  1Q8I A;  1UYK A;  3QO8 A;  3SJA C;  4MB9 A;  4AWQ A;  2AHZ A;  3T2M A;  2IOQ A;  4JI6 B;  1Q6H A;  5FL7 G;  5BZB A;  1E79 G;  3C90 A;  5B1A B;  4MVM A;  2HCH A;  1THN A;  1SS3 A;  3OM3 B;  1K5S A;  4DV0 O;  4DR6 O;  3OWB A;  3VQW A;  3S5T A;  4MTF A;  1WJZ A;  1PV0 A;  5C8Y A;  5C8Y B;  3E89 A;  1W2B U;  3RVY A;  3BPZ A;  2XDK A;  2LP7 A;  2XCM A;  3JAW B;  2XAJ A;  3VQX A;  1R1B A;  3CWB H;  2DWE C;  4BAY A;  2Q73 A;  2K9P A;  5TIS Z;  3QNE A;  5IN9 A;  2NR5 A;  3RN4 A;  3AEI A;  5D6P A;  1V55 B;  4JTA B;  4GKJ B;  2CH7 A; 
#chains in the Genus database with same CATH homology
 1W0J G;  2BT0 A;  4RQF A;  1OCO B;  1GO3 F;  4JAV A;  1Y4S A;  4LWE A;  1BXD A;  3VHC A;  1JCH A;  3G71 V;  1PNK A;  3GB7 C;  4G27 B;  5BOC A;  4ASG A;  1WLE A;  4L87 A;  2CCU A;  4PRV A;  5M4N A;  1UYE A;  4GGL A;  5IDM A;  2Q8I A;  1PD3 A;  2QG2 A;  4JYC A;  3VBB A;  4GX1 A;  1TH8 A;  1ZWH A;  1AJP A;  4PRX A;  2ZBK B;  4MW3 A;  4XIQ A;  1KQS U;  3A0Z A;  3FB8 C;  1VQN V;  4GX5 A;  2JJ2 G;  4ZBM A;  1Y8O A;  2WSS G;  1M56 B;  2Q8F A;  2XDU A;  3SYO A;  4GQT A;  3H01 A;  1J95 A;  3ASN B;  4XCJ A;  3E8F A;  2CGF A;  4GEE A;  4YKR A;  3DGE A;  3CC2 V;  2LFS A;  4CWO A;  2O1U A;  2YEJ A;  3MNR P;  5M4E A;  4CZZ A;  4H37 A;  4H33 A;  5M4K A;  1H7U A;  1UYI A;  1FXH A;  4ZKI A;  4BAE A;  3O0I A;  1H8E G;  5L3G A;  1EI1 A;  2GQP A;  3RLQ A;  2YE6 A;  1M9N A;  4MSW C;  4O0B A;  4PDM A;  3ZXO A;  1R6N A;  4FJC C;  4WFA V;  1OHH G;  4FCR A;  2XAF A;  4X89 A;  4JTC B;  1I5Y A;  4R50 A;  3VAD A;  3GIG A;  4XKK A;  2ZDI A;  4UV9 A;  3RW0 A;  1NR7 A;  2PI4 A;  2O1W A;  3OMN B;  4EGH A;  4UXN A;  1VQ5 V;  1OSF A;  3CCU V;  4JTD B;  2YE7 A;  2P7T C;  1UYD A;  3MHH C;  5CBG A;  4WF9 V;  2WLI B;  3C11 A;  4BQJ A;  1XL6 A;  3TZ0 A;  2FXS A;  1KIJ A;  5CBF A;  1V55 C;  3CCV V;  1ZXM A;  1QY8 A;  2YEH A;  3B24 A;  3CC7 V;  3ZN0 A;  3FT8 A;  3ETG A;  5CMU A;  3G4S V;  3WG7 B;  2XND G;  2QG0 A;  3RVZ A;  2VWC A;  2X6B A;  4LP0 A;  4E01 A;  1R62 A;  3CCL V;  1BHB A;  4XIR A;  1OCZ B;  4AWO A;  2YE2 A;  4MTX A;  1GM7 A;  4KSG A;  3T4Z A;  3AG1 B;  4TT3 G;  4XKA A;  1H8H G;  5FND A;  4HZ5 A;  1I5C A;  2R9R B;  1FXK B;  2BYI A;  1HWY A;  1AI7 A;  1QLE C;  2H94 A;  2Z3Y A;  2BRC A;  2YKC A;  4EFU A;  3R65 A;  1SES A;  2HKO A;  2PNR A;  2YE5 A;  2V7Q G;  3A0W A;  1AH6 A;  1BKN A;  2OCC B;  3WQ9 A;  4HYP A;  2EXL A;  4R7C A;  2EIJ B;  3CGZ A;  1CEZ A;  4HYM A;  2OT5 A;  5FWK A;  1Z5C A;  4RAI A;  2Q68 A;  1W0K G;  1PVG A;  4GT8 A;  3OR6 C;  3FT5 A;  3JD0 A;  2EIM B;  2WER A;  3T0H A;  3OAA G;  3OW2 U;  3ZKD A;  2ZR3 A;  3CC4 V;  4DXW A;  2QEX V;  2YKE A;  1K92 A;  2YK2 A;  3AG3 B;  3EHF A;  4PA7 A;  1ARO P;  4ASU G;  1RPO A;  3AG4 B;  3R91 A;  2QFO A;  5F3K A;  4PDV A;  1K97 A;  2Q69 A;  3OR7 C;  5EC2 C;  5GGZ A;  1K73 W;  4WCE V;  4AWP A;  4LC1 A;  4MS2 A;  4FCP A;  1NH2 B;  3ETE A;  4N21 A;  1B62 A;  3K0G A;  4YKW A;  4URL A;  1YES A;  4XTJ A;  4JQL A;  3Q5J A;  4RUE A;  2WI1 A;  2X7R B;  3R4N A;  3FYI B;  1OCZ C;  3SYA A;  1VQ7 V;  3ABL B;  1KKD A;  5LGU A;  1MU5 A;  1Y4M A;  3EHJ A;  1YI2 V;  4U93 A;  3CCM V;  1QBZ A;  4JAU A;  2BOB C;  4YKQ A;  3AG1 C;  1GM8 A;  4HY6 A;  3T0Z A;  4MW8 A;  3EHB B;  1FXK C;  4PDL A;  4J9Y B;  2X6C A;  1Q82 W;  4GT1 A;  2YEA A;  5L3C A;  1NBM G;  4PDR A;  2XAG A;  4KTN A;  5J6A A;  2JDI G;  1JOY A;  4XBF A;  1U0Z A;  2FYP A;  2UXN A;  2CCS A;  1NJI W;  5D7C A;  4GX0 A;  3ZRW B;  2QKS A;  4MOT A;  4R6Z A;  1TC0 A;  5CTX A;  3ZN1 A;  4L90 A;  4DO2 A;  1YHQ V;  2GFD A;  2W6J G;  2WI2 A;  1K7D A;  1JM6 A;  3T1C A;  3O2F A;  5CN0 A;  5EK0 A;  3B27 A;  2Q8G A;  5LHG A;  5CF0 A;  4CWP A;  3AG3 C;  2FWY A;  3W7U A;  1K34 A;  3IED A;  3O6O A;  4G28 B;  1ZW9 A;  5CTW A;  2YJW A;  3C0E A;  4ASF A;  4XCL A;  3CCR V;  1S77 D;  4MBC A;  5LHH A;  1TIL A;  4QIW F;  2HKJ A;  1GM9 A;  2JIZ G;  4EFT A;  4YKZ A;  4AS9 A;  1QCE A;  4B7P A;  5B1N A;  3CCJ V;  1UYH A;  4YKU A;  1NHJ A;  3CGY A;  2XX4 A;  2IWS A;  1AJQ A;  5CBH A;  1U2O A;  1GTO A;  2YKI A;  4V26 A;  2Y69 B;  4XDJ A;  2MK3 A;  3ABL C;  4KFG A;  3DTU B;  3ZRS A;  2WWW A;  1MSW D;  4BIU A;  4JPR A;  4RQE A;  3R4O A;  2B5U A;  1GKZ A;  1YJ9 V;  1NHH A;  2IH3 C;  3SPC A;  3ZRV A;  1UYC A;  2HLD G;  3ETD A;  3T4D A;  4CWT A;  2B1G A;  4E00 A;  4HY1 A;  1KD1 W;  2BU7 A;  4CE2 A;  2M7W A;  3U67 A;  3OMU A;  3SJQ C;  2V1D A;  1KZN A;  1QVG U;  2VW5 A;  3JD4 A;  2YGE A;  3VHA A;  1K4D C;  3Q5K A;  2X6A A;  3OW6 A;  3TET A;  4BQG A;  3TZ2 A;  4E02 A;  3B8N A;  2DWD C;  4YKT A;  3A0R A;  4UVC A;  2VCI A;  4U7O A;  4WUD A;  3I56 V;  1YC4 A;  2XAH A;  2XJJ A;  1BHA A;  2IJH A;  3G7B A;  2EIL B;  2XHX A;  1K5Q A;  1PL0 A;  2XJG A;  1JX9 A;  3IC7 A;  3ABK C;  4R1F A;  3STZ C;  3CCE V;  3OMA B;  3A0T A;  2Y48 A;  1G4Y B;  3K79 A;  2QA4 V;  5L3E A;  2X0L A;  4X9L A;  3INW A;  4KQV A;  3IFX A;  3MD0 A;  4HAM A;  2BU8 A;  2YEB A;  2YGA A;  1KEC A;  3R92 A;  4EMV A;  2PI5 A;  4CE3 A;  3WFV A;  1BL8 A;  5DN6 G;  1YET A;  4PA6 A;  1I5X A;  2BU2 A;  4UUJ C;  3T1K A;  1L1F A;  2YE9 A;  3OEH G;  2Y69 C;  4PA9 A;  1M1K W;  5DM6 V;  3D3I A;  2NLJ C;  2DW4 A;  5M4H A;  2YKB A;  3TZ5 A;  3ZMS A;  2QF6 A;  1JQ0 A;  1S16 A;  2Q2E B;  1AMW A;  2XAQ A;  1GMG A;  3JD2 A;  3OEE G;  2YJX A;  4WFH A;  1YS3 A;  4MPE A;  2Q6A A;  3GIG B;  5B1A C;  2H8P C;  2WEQ A;  4YKX A;  2Q67 A;  1NH2 D;  2HR3 A;  3CCQ V;  2BU5 A;  4B6C A;  3LSS A;  4FIP C;  3K3W A;  1I59 A;  3RLR A;  2YI0 A;  1MX0 A;  2W6I G;  5L3B A;  1F51 A;  1I58 A;  1JVM A;  3CRK A;  2YI7 A;  2IH1 C;  2FWZ A;  3PEJ A;  1DF4 A;  5KA6 A;  4G2K A;  1OCO C;  4XD8 A;  2A9H A;  4X8A A;  4JF3 A;  4GX2 A;  3GIF A;  3K60 A;  2IW5 A;  1PNM A;  4CWR A;  4XDK A;  4WFB V;  2EIL C;  3B77 A;  1CP9 A;  3EHH A;  3AG2 B;  2XDL A;  1R3L C;  4MVO A;  1Y4U A;  3FKS G;  3NMQ A;  3QDD A;  1B6Q A;  1M90 W;  3KE6 A;  5KUK A;  4N23 A;  2WEP A;  2WLN A;  3SYC A;  5HFM A;  1M56 C;  2QTO A;  5HFL A;  2GHY A;  5LGT A;  5GW7 A;  5B3S B;  3UM7 A;  1AI6 A;  4QJF B;  2Z5U A;  1IXM A;  3ASN C;  3TK1 A;  5M4P A;  2H55 A;  5IY5 B;  1NQT A;  2WPD G;  1YSR A;  3E8H A;  2WLH A;  3CPW U;  1ZXN A;  1VQP V;  5B1B B;  4P9P A;  2JK5 C;  2ZD9 A;  1OZ0 A;  1Q81 W;  4MP7 A;  1MOF A;  2YI5 A;  1YT0 A;  3E86 A;  1QVF U;  1F23 A;  4P7A A;  1YT2 A;  4HZ3 A;  4DZY A;  2WLK A;  2UXX A;  3F7V C;  1S72 V;  2ZDI C;  4I3H A;  2DQ0 A;  4FK5 C;  2YED A;  3D2R A;  4MVR A;  1P4R A;  4UVA A;  3LDE A;  3HPL C;  4TWK A;  5LBQ A;  5J71 A;  3JZ3 A;  4H7Q A;  3R4M A;  3HZ5 A;  3RBZ A;  3GIE A;  4LWF A;  1KP3 A;  2OTJ V;  1CPY A;  3U2K A;  1YSZ A;  1NVP B;  4KFM A;  3OPD A;  1GKF A;  3K99 A;  4R3M A;  1DLB A;  3E8B A;  3R4P A;  4Z1M G;  3X2Q B;  3WG7 C;  3ZXQ A;  1UY6 A;  2BOC C;  3AG2 C;  4P8O A;  3ZRX A;  1UY9 A;  3PEH A;  3CCS V;  3LNM B;  5KA5 A;  4LWI A;  2P67 A;  1XL4 A;  3K0D A;  4UV8 A;  1ENV A;  4WUC A;  3CP1 A;  3B28 A;  4EGK A;  5EBM C;  2XJX A;  5EBL C;  4CWF A;  1AH8 A;  2EIK B;  3ASO B;  1B63 A;  1M57 B;  2JJC A;  4CWQ A;  4EEH A;  2WLL A;  1ID0 A;  1EBO A;  2HFE C;  2OTL V;  2BSM A;  5B1O A;  1V54 B;  1VQO V;  3FB7 C;  4MTO A;  3TUH A;  2QM7 A;  3HYZ A;  1FS0 G;  3LDD A;  4OXS A;  2OCC C;  5B1B C;  2YEI A;  3HEK A;  3LSQ A;  1F4N A;  1DF5 A;  2IU0 A;  2EIJ C;  4JAS A;  4PU9 A;  2AKP A;  4MTG A;  3G6E V;  4EM7 A;  4CWN A;  1R3I C;  2ITC C;  2EIM C;  3CD6 V;  1UYF A;  5LGN A;  2FTK A;  3ZKB A;  4QNH B;  1YER A;  3HB3 B;  4KSH A;  2YEV A;  4LCU C;  1AI4 A;  3ML0 A;  2K1E A;  3BM9 A;  1F4M A;  3ZMZ A;  2BYH A;  1R73 A;  2YEF A;  1S5H C;  4GFN A;  1YIJ V;  3AG4 C;  3ABT A;  5E1A C;  2GSM B;  1SET A;  2ESA A;  4NH9 A;  2BTZ A;  3K97 A;  4URO A;  2XX5 A;  4QPK A;  2WI4 A;  3CME V;  4MPC A;  4MP2 A;  1PKX A;  1VQK V;  5CTY A;  3CYO A;  3F7Y C;  1S3J A;  4XKO A;  3FB5 C;  3SYQ A;  3X2Q C;  2A79 B;  2H8M A;  1AI5 A;  3K08 A;  3QTF A;  2QE7 G;  1ORQ C;  4XIT A;  4BXI A;  1Y8N A;  4K4O A;  3B26 A;  2YKJ A;  1SER A;  2WAM A;  1TC6 A;  3UKM A;  2XD6 A;  3H4L A;  3B8M A;  1RPR A;  2EIK C;  4HZ0 A;  1K3E A;  3ASO C;  3EKR A;  1US7 A;  3EFF K;  5H6R A;  5KUM A;  3T10 A;  1R3J C;  4CE1 A;  1JJ2 U;  1Z59 A;  1R3K C;  4BW5 A;  2HVK C;  2JJ1 G;  1UYL A;  2HG1 A;  2YEE A;  5D7D A;  2EZO A;  5F5R A;  2BRE A;  2IWU A;  2WI6 A;  2YK9 A;  2HG5 C;  1YTF B;  2C2A A;  3EHG A;  4O04 A;  3GWO A;  2AHY A;  5L3D A;  2YSU B;  1H38 A;  2R9I A;  2P6J A;  5EC1 C;  3IGA C;  3ZM7 A;  1UJW B;  3LUT B;  4PEL A;  2YEG A;  4ASB A;  1QR9 A;  5J9P C;  3E8G A;  4F4L A;  4KUM A;  1RM1 B;  2XAS A;  3ZJZ A;  3ZMV A;  5BOD A;  3CXC U;  1VQ9 V;  3K04 A;  1NKD A;  3CMA V;  4L93 A;  3BY6 A;  2HVJ C;  4XDM A;  2YEC A;  3SYP A;  3JYC A;  2IJJ A;  2BZ5 A;  1YC3 A;  1Q86 W;  4V25 A;  4JGS A;  3W7W A;  3KG2 A;  3HHU A;  4GCZ A;  1QYE A;  2EIN B;  1G8M A;  3G75 A;  3LDC A;  3B25 A;  4PA4 A;  1QLN A;  4Q20 A;  4MVS A;  4O07 A;  1EZJ A;  1SZT A;  2QM8 A;  4YXW G;  4EGI A;  4P9O A;  1QLE B;  1ZWI C;  1VQL V;  2UWD A;  3P32 A;  3JCZ A;  3JD1 A;  4L94 A;  1FXV A;  4LWH A;  2WLM A;  1NHI A;  2ZDX A;  1BGQ A;  4LPB A;  3K03 A;  4R3A A;  1E1R G;  4QPJ A;  3VHD A;  1NVP D;  2ZQM A;  2JKI A;  1S76 D;  2E0A A;  2NNU A;  3LPS A;  3SL2 A;  1EA6 A;  1GK9 A;  1A4H A;  2JEX A;  1WPX A;  4MVQ A;  3OUS A;  3TTZ A;  3G7E A;  1E1Q G;  2VCJ A;  4XC0 A;  3CRL A;  4UVB A;  3A0Y A;  2CG9 A;  3E83 A;  5M4M A;  1KP2 A;  2K5B A;  1GJV A;  4PA3 A;  2ATK C;  3VOU A;  1BMF G;  1MAB G;  1YSC A;  2WLI A;  1VQ4 V;  5L3F A;  1TBW A;  3ZCC A;  2EJR A;  4BIZ A;  1LNQ A;  1VQM V;  1RM1 C;  3W7T A;  3ZMT A;  3E2E A;  2DYS B;  2HJF C;  2WI7 A;  2ZKJ A;  4EKW A;  1VQ6 V;  1K8A W;  2IOR A;  3D0B A;  3LNU A;  2A0L A;  1OCC B;  1I5A A;  2YE3 A;  4HXW A;  4MT8 A;  3CWV A;  4QE7 A;  3BEH A;  2EIN C;  4TSF G;  2ZR2 A;  1TID A;  4FMT A;  5L3J A;  3T2S A;  4WUB A;  3OGC C;  3FV5 A;  3U2D A;  1FXK A;  4QE9 A;  4WFE A;  5CTU A;  1Z5B A;  2EZP A;  4P2Z A;  1P7B A;  3PJS K;  2ZXW B;  1THZ A;  1H2G A;  3ZMU A;  4J9Z B;  1K33 A;  1K9M W;  4ASA A;  2JEU A;  1I5D A;  3I55 V;  3NXS A;  1SRY A;  1UY7 A;  3STL C;  2IJK A;  2YI6 A;  1TUE B;  3P30 A;  3EKO A;  2YE8 A;  1FFT B;  4MPN A;  4NH8 A;  4HYO A;  5FNC A;  2IOP A;  4H81 A;  1GKX A;  1BYQ A;  4URM A;  3ZIA G;  4LWG A;  4L8Z A;  4MVU A;  1AJN A;  2LFR A;  3SPG A;  1YJW V;  2EBO A;  1R6K A;  1YT1 A;  3OWD A;  1JPX A;  4U7N A;  2WI3 A;  2ITD C;  2CCT A;  3K9A A;  4CBC A;  2XK2 A;  5C93 A;  4PL9 A;  4WFF A;  4L91 A;  2XAB A;  2XHR A;  1OCR B;  1S0V A;  1Y66 A;  1COW G;  1AJ6 A;  4DUH A;  2B1I A;  2DYS C;  2WLJ A;  4JYB A;  2DYR B;  2P90 A;  3ABU A;  3ABM B;  4YKY A;  3OMI B;  2XDX A;  1YTF D;  3Q5L A;  5FNF A;  2WI5 A;  1OCC C;  2CK3 G;  2KB1 A;  1YIT V;  1EFR G;  2Q8H A;  4FCQ A;  2WLL B;  2IJI A;  5B3S C;  3OE7 G;  3FYE B;  5IYD O;  1QR8 A;  4P30 A;  2IU3 A;  3JD3 A;  4LBE C;  5IY5 C;  1K4C C;  2XX2 A;  2IWX A;  2XDS A;  5IDJ A;  5H9C A;  4I5S A;  3M99 B;  1Q7Y W;  2ZXW C;  5H6Q A;  5EBW C;  1QZR A;  3QO7 A;  1Y8P A;  1AR1 B;  4XIP A;  3HYY A;  5D7R A;  1YJN V;  1I5B A;  1ROP A;  3FB6 C;  3E35 A;  4X88 A;  5D6Q A;  3ZRW A;  3WHA A;  2YEV B;  1H7S A;  3TZ4 A;  3SPJ A;  5CA3 A;  4CWS A;  3RLP A;  4HXZ A;  3W7X A;  1PNL A;  4RUF A;  4O09 A;  1NR1 A;  3QO5 A;  1N8R W;  1UYG A;  4XDL A;  3W7S A;  3OUF A;  1DTO A;  3D36 A;  1UYM A;  4E2L A;  3OFN G;  3A0X A;  3ABK B;  1MG1 A;  3INX A;  2ZDY A;  5IYB O;  4ZVI A;  1OCR C;  2D3O W;  4FPP A;  1YC1 A;  1S14 A;  2CH4 A;  4XE2 A;  3F5W C;  3K06 A;  3SPH A;  2F43 G;  1KC8 W;  2DYR C;  2DQ3 A;  3K98 A;  4NH7 A;  3ABM C;  3SPI A;  4KP4 A;  3TCU A;  4LP8 A;  1B3Q A;  4WFG A;  1UY8 A;  3HZ1 A;  4H85 A;  1AM1 A;  4I9W A;  4MVZ A;  4W7T A;  4URN A;  1M57 C;  1VQ8 V;  2YE4 A;  2YGF A;  3BMY A;  2O1V A;  5CPH A;  2W0F C;  5LHI A;  4O05 A;  3MHS C;  5IYC O;  1Z5A A;  3RKZ A;  1L0O A;  1V54 C;  4RO2 A;  2XHT A;  2XOK G;  2BU6 A;  4R8C A;  3H80 A;  1UYK A;  3QO8 A;  4MB9 A;  4AWQ A;  2AHZ A;  3T2M A;  2IOQ A;  5FL7 G;  5BZB A;  1E79 G;  5B1A B;  4MVM A;  2HCH A;  1THN A;  3OM3 B;  1K5S A;  3OWB A;  4MTF A;  3E89 A;  1W2B U;  3RVY A;  2XDK A;  2LP7 A;  2XCM A;  2XAJ A;  2DWE C;  4BAY A;  3QNE A;  5IN9 A;  3AEI A;  5D6P A;  1V55 B;  4JTA B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...