1YSZA

Crystal structure of the unliganded form of grp94, the er hsp90: basis for nucleotide-induced conformational change, grp94n(delta)41 apo crystal soaked with neca
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
227
structure length
217
Chain Sequence
EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELTVKIKCDKEKNLLHVTDTGVGMTREELVKNLGTIGTSEFLNKMTEAQESTSELIGQFGVGFYSAFLVADKVIVTSKHNNDTQHIWESDSNEFSVIADPRGNTLGRGTTITLVLKEEASDYLELDTIKNLVKKYSQFINFPIYVWSSKTKTVWDWELMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords Endoplasmin
publication title Structure of Unliganded GRP94, the Endoplasmic Reticulum Hsp90: BASIS FOR NUCLEOTIDE-INDUCED CONFORMATIONAL CHANGE
pubmed doi rcsb
source organism Canis lupus familiaris
total genus 65
structure length 217
sequence length 227
ec nomenclature
pdb deposition date 2005-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 1yszA00
3QTFA 3ZM7A 2YE5A 4PRXA 2QG2A 3RKZA 5IN9A 2BTZA 3U2DA 3GIGA 4EM7A 2YEHA 4P8OA 3CRLA 4FCQA 1H7SA 4H7QA 2Q8FA 4O0BA 3HYYA 3LPSA 3INXA 4H85A 4E02A 4QPJA 4CWPA 2FWYA 4JAUA 4MOTA 4LWFA 4L91A 3QDDA 4LWEA 4LWIA 1UYMA 4EGHA 2WI5A 2BSMA 3HEKA 4U7NA 5F3KA 2CGFA 3A0TA 2YGEA 2IWXA 1Z59A 3BM9A 4QPKA 4URMA 2YJXA 5BOCA 3TZ2A 2XX4A 4URNA 4HYPA 1AH6A 4U7OA 1B63A 2YKJA 3O6OA 1H7UA 3HZ1A 1I5CA 1TC6A 2CCUA 2YK2A 4BAEA 2XJGA 1YC3A 1EI1A 2YE6A 1Y4UA 2BU2A 4YKRA 1ZWHA 2XABA 1I5BA 1YERA 4ZVIA 3G75A 4WUBA 3EHJA 4R3AA 5M4NA 3PEHA 4R1FA 1YSZA 2VCJA 2YKIA 2EXLA 3K99A 1AJ6A 1UYKA 1UYHA 1OSFA 4LWHA 2HKJA 2E0AA 3R4OA 3O0IA 5J71A 3CGYA 1YSRA 3EKRA 3NMQA 4CWTA 2YI5A 4CE1A 2YEGA 5CF0A 1BKNA 2VCIA 4K4OA 1I59A 5FNCA 4P7AA 2XJXA 1Z5BA 4FPPA 4EEHA 4HXZA 1AMWA 1ZXMA 3FT8A 4MPNA 4CWRA 2XJJA 2CCSA 3WHAA 2XX2A 3INWA 2ZBKB 2IWSA 2Q8HA 2BT0A 2XHTA 1QY8A 4XKOA 4LPBA 3U67A 2XDUA 3R4NA 4ASBA 1PVGA 4XC0A 5F5RA 2YE3A 1Y4SA 5M4KA 2YK9A 3G7BA 2C2AA 1L0OA 2YKCA 4HXWA 4ASGA 5C93A 2YJWA 1UY9A 3B27A 1US7A 3EHFA 4MPEA 3CRKA 3OWBA 4CE3A 1I5AA 3TTZA 1I5DA 2XDLA 4GCZA 3C11A 2O1VA 3FV5A 4FCRA 4NH9A 5BODA 2YEIA 1Z5CA 4MPCA 2YE9A 4ASAA 4BIZA 2FXSA 2JJCA 4LWGA 4L90A 3Q5KA 3A0WA 1UY7A 4DUHA 3R92A 4B7PA 2YEDA 3B26A 4KSHA 4GGLA 2BZ5A 2Q8IA 1BXDA 1NHJA 3SL2A 2O1WA 3R91A 4Q20A 1TILA 2YEFA 4XIQA 3HZ5A 5M4HA 2BYHA 1YT2A 4O05A 1U2OA 4CE2A 5CTYA 3A0XA 4GFNA 4H81A 1QZRA 3VHAA 2BU7A 1KIJA 2PNRA 4JAVA 3O2FA 3T2SA 4KP4A 2QFOA 3K60A 5D7DA 1GKXA 4CWFA 4BQGA 3A0RA 4NH8A 3VHCA 4XCLA 3D36A 3HHUA 2IOPA 3TZ4A 4E00A 4YKYA 2ESAA 3RLQA 1JM6A 3EHGA 3B28A 2HG1A 4KSGA 3T0HA 4MP2A 3EHHA 3H80A 4HZ0A 2WI4A 2Q2EB 3BMYA 3JZ3A 4R3MA 3RLRA 3OW6A 1YETA 2YKEA 4KTNA 4YKZA 1Y8PA 2UWDA 3IEDA 4EGIA 4EMVA 2BRCA 3B24A 2H8MA 3A0ZA 1GKZA 2XDKA 4O04A 3ZKBA 2YI7A 4W7TA 1I58A 5CTWA 5D7RA 4L93A 1YS3A 1S16A 1NHHA 5D6PA 5IDMA 2QF6A 3ZXQA 1U0ZA 1AH8A 3OMUA 3FT5A 4U93A 4YKQA 2FYPA 4HY1A 2YEBA 2BU5A 4PU9A 1THNA 4O07A 4WUCA 3RLPA 4BXIA 3TZ5A 1ZW9A 3C0EA 5IDJA 3GIFA 3TUHA 1AM1A 2IORA 4YKWA 2YGAA 3H4LA 2WI2A 4CWOA 4URLA 2XD6A 2VWCA 4HYMA 4XKKA 1TBWA 4O09A 1UYFA 4I3HA 4YKTA 2IOQA 2ZDXA 3PEJA 4XDMA 4FCPA 2IWUA 1TH8A 3T1KA 3R4PA 2YEAA 2WEQA 4UROA 4BQJA 4XKAA 4L8ZA 4AWOA 4B6CA 1GJVA 4ZKIA 2GFDA 5CTUA 2XHRA 4V26A 4EGKA 4EFUA 2WI1A 5D6QA 3HYZA 3ZKDA 1B62A 4HY6A 3B25A 3K97A 3D2RA 3CGZA 4XE2A 4AWPA 3VHDA 2WI3A 2XHXA 5L3JA 5CPHA 4FMTA 3MNRP 2XDXA 4YKUA 4CWQA 2QG0A 2YEJA 4PRVA 2XDSA 4JASA 2WERA 4JQLA 2ZKJA 4HZ5A 4L94A 2FWZA 3DGEA 4NH7A 4MBCA 4YKXA 2BU8A 4DZYA 2HCHA 1Y8NA 1YC1A 2CG9A 4I5SA 2YE4A 3G7EA 3GIEA 2YE8A 2CCTA 4KFGA 1ZXNA 3KE6A 3R4MA 1Y8OA 2CH4A 2WEPA 5M4EA 2JKIA 2WI6A 4XD8A 1UYIA 3ZXOA 1Z5AA 2GQPA 1UY8A 1UYEA 2BU6A 1EA6A 4V25A 4XCJA 4XTJA 1KZNA 1YC4A 3CWVA 2YECA 3GIGB 2VW5A 3EKOA 4GEEA 2O1UA 4X9LA 1YESA 1YT0A 3K98A 4PL9A 2H55A 2YEEA 3A0YA 3OPDA 1ID0A 4MB9A 2YE2A 2ZDYA 3D0BA 5GGZA 2YE7A 3OWDA 5D7CA 1YT1A 1BGQA 3Q5LA 1UY6A 5M4MA 4MP7A 2AKPA 1NHIA 3Q5JA 1UYLA 2XK2A 3T10A 2XX5A 4CWSA 4CWNA 2Q8GA 3TZ0A 1MU5A 1UYCA 3LNUA 3T0ZA 5J6AA 2YGFA 3WQ9A 2YI0A 4XIPA 3VADA 3U2KA 4GT8A 4BIUA 2YI6A 4XIRA 4AWQA 1R62A 2WI7A 1B3QA 4LP0A 4WUDA 1TIDA 4AS9A 2BYIA 5FWKA 5M4PA 4ASFA 4KQVA 1UYDA 2K5BA 4EFTA 4E01A 1A4HA 4XITA 5CTXA 1QYEA 2BREA 1BYQA 1UYGA 4GQTA 2YKBA 5FNFA 1MX0A 2XCMA 5FNDA 1TC0A 1S14A
chains in the Genus database with same CATH superfamily
3QTFA 3ZM7A 2YE5A 4PRXA 2QG2A 3RKZA 5IN9A 5JENA 2BTZA 3U2DA 3GIGA 4EM7A 2YEHA 4P8OA 3CRLA 4FCQA 1H7SA 4H7QA 2Q8FA 4O0BA 3HYYA 3LPSA 3INXA 4H85A 4E02A 4QPJA 4CWPA 2FWYA 4JAUA 4MOTA 4LWFA 4L91A 3QDDA 4LWEA 4LWIA 1UYMA 4EGHA 2WI5A 2BSMA 3HEKA 4U7NA 5F3KA 2CGFA 3A0TA 2YGEA 2IWXA 1Z59A 3BM9A 4QPKA 4URMA 2YJXA 5BOCA 3TZ2A 2XX4A 4URNA 4HYPA 1AH6A 4U7OA 1B63A 2YKJA 3O6OA 1H7UA 3HZ1A 1I5CA 1TC6A 2CCUA 2YK2A 4BAEA 2XJGA 1YC3A 1EI1A 2YE6A 1Y4UA 2BU2A 4YKRA 1ZWHA 2XABA 1I5BA 1YERA 4ZVIA 3G75A 4WUBA 3EHJA 4R3AA 5M4NA 3PEHA 4R1FA 1YSZA 2VCJA 2YKIA 2EXLA 3K99A 1AJ6A 1UYKA 1UYHA 1OSFA 4LWHA 2HKJA 2E0AA 3R4OA 3O0IA 3S5TA 5J71A 3CGYA 1YSRA 3EKRA 3NMQA 4CWTA 2YI5A 4CE1A 2YEGA 5CF0A 1BKNA 2VCIA 4K4OA 1I59A 5FNCA 4P7AA 2XJXA 1Z5BA 4FPPA 4EEHA 4HXZA 1AMWA 1ZXMA 3FT8A 4MPNA 4CWRA 2XJJA 2CCSA 3WHAA 2XX2A 3INWA 2ZBKB 2IWSA 2Q8HA 2BT0A 2XHTA 1QY8A 4XKOA 4LPBA 1IXMA 3U67A 2XDUA 3R4NA 4ASBA 1PVGA 4XC0A 5F5RA 2YE3A 1Y4SA 5M4KA 2YK9A 3G7BA 2C2AA 1L0OA 2YKCA 4HXWA 4ASGA 5C93A 2YJWA 1UY9A 3B27A 1US7A 3EHFA 4MPEA 3CRKA 3OWBA 4CE3A 1I5AA 3TTZA 1I5DA 2XDLA 4GCZA 3C11A 2O1VA 3FV5A 4FCRA 4NH9A 5BODA 2YEIA 1Z5CA 4MPCA 2YE9A 4ASAA 4BIZA 2FXSA 2JJCA 4LWGA 4L90A 3Q5KA 3A0WA 1UY7A 4DUHA 3R92A 4B7PA 2YEDA 3B26A 4KSHA 4GGLA 2BZ5A 2Q8IA 1BXDA 1NHJA 3SL2A 2O1WA 3R91A 4Q20A 1TILA 2YEFA 4XIQA 3HZ5A 5M4HA 2BYHA 1YT2A 4O05A 1U2OA 4CE2A 5CTYA 3A0XA 4GFNA 4H81A 1QZRA 3VHAA 2BU7A 1KIJA 2PNRA 4JAVA 3O2FA 3T2SA 4KP4A 4E72A 2QFOA 3K60A 5D7DA 1GKXA 4CWFA 4BQGA 3A0RA 4NH8A 3VHCA 4XCLA 3D36A 3HHUA 2IOPA 3TZ4A 4E00A 4YKYA 2ESAA 3RLQA 1JM6A 3EHGA 3B28A 2HG1A 4KSGA 3T0HA 4MP2A 3EHHA 3H80A 4HZ0A 2WI4A 2Q2EB 3BMYA 3JZ3A 4R3MA 3RLRA 3OW6A 1YETA 2YKEA 4KTNA 4YKZA 1Y8PA 2UWDA 3IEDA 4EGIA 4EMVA 2BRCA 3B24A 2H8MA 3A0ZA 1GKZA 2XDKA 4O04A 3ZKBA 2YI7A 4W7TA 1I58A 5CTWA 5D7RA 4L93A 1YS3A 1S16A 1F51A 1NHHA 5D6PA 5IDMA 2QF6A 3ZXQA 1U0ZA 1AH8A 3OMUA 3FT5A 4U93A 4YKQA 2FYPA 4HY1A 2YEBA 2BU5A 4PU9A 1THNA 4O07A 4WUCA 3RLPA 4BXIA 3TZ5A 1ZW9A 3C0EA 5IDJA 3GIFA 2FTKA 3TUHA 1AM1A 2IORA 4YKWA 2YGAA 3H4LA 2WI2A 2C1IA 4CWOA 4URLA 2XD6A 2VWCA 4HYMA 4XKKA 1TBWA 4O09A 1UYFA 4I3HA 4YKTA 2IOQA 2ZDXA 3PEJA 4XDMA 4FCPA 2IWUA 1TH8A 3T1KA 3R4PA 2YEAA 2WEQA 4UROA 4BQJA 4XKAA 4L8ZA 4AWOA 4B6CA 1GJVA 4ZKIA 2GFDA 5CTUA 2XHRA 4V26A 4EGKA 4EFUA 2WI1A 5D6QA 3HYZA 3ZKDA 1B62A 4HY6A 3B25A 3K97A 3D2RA 3CGZA 4XE2A 4AWPA 3VHDA 2WI3A 2XHXA 5L3JA 5CPHA 4FMTA 3MNRP 2XDXA 4YKUA 4CWQA 2QG0A 2YEJA 4PRVA 2XDSA 4JASA 2WERA 4JQLA 2ZKJA 4HZ5A 4L94A 2FWZA 2C1GA 3DGEA 4NH7A 4MBCA 4YKXA 2BU8A 4DZYA 2HCHA 1Y8NA 1YC1A 2CG9A 4I5SA 2YE4A 3G7EA 3GIEA 2YE8A 2CCTA 4KFGA 1ZXNA 3KE6A 3R4MA 1Y8OA 2CH4A 2WEPA 5M4EA 2JKIA 2WI6A 2HHIA 4XD8A 1UYIA 3ZXOA 1Z5AA 2GQPA 1UY8A 1UYEA 2BU6A 1EA6A 4V25A 4XCJA 4XTJA 1KZNA 1YC4A 3CWVA 2YECA 3GIGB 2VW5A 3EKOA 3LMMA 4GEEA 2O1UA 4X9LA 1YESA 1YT0A 3K98A 4PL9A 2H55A 2YEEA 3A0YA 3OPDA 1ID0A 4MB9A 2YE2A 2ZDYA 3D0BA 5GGZA 2YE7A 3OWDA 5D7CA 1YT1A 1BGQA 3Q5LA 1UY6A 5M4MA 4MP7A 2AKPA 1NHIA 3Q5JA 1UYLA 2XK2A 3T10A 2XX5A 4CWSA 3CYGA 4CWNA 2Q8GA 3TZ0A 1MU5A 1UYCA 3LNUA 3T0ZA 5J6AA 2YGFA 3WQ9A 2YI0A 4XIPA 3VADA 3U2KA 4GT8A 4BIUA 2YI6A 4XIRA 4AWQA 1R62A 2WI7A 1B3QA 4LP0A 4WUDA 1TIDA 4AS9A 2BYIA 5FWKA 5M4PA 4ASFA 4KQVA 1UYDA 2K5BA 4EFTA 4E01A 1A4HA 4XITA 5CTXA 1QYEA 2BREA 1BYQA 1UYGA 4GQTA 2YKBA 5FNFA 1MX0A 2XCMA 5FNDA 1TC0A 1S14A
chains in the Genus database with same CATH topology
3QTFA 3ZM7A 2YE5A 4PRXA 2QG2A 3RKZA 5IN9A 2BTZA 3U2DA 3GIGA 4EM7A 2YEHA 4P8OA 3CRLA 4FCQA 1H7SA 4H7QA 2Q8FA 4O0BA 3HYYA 3LPSA 3INXA 4H85A 4E02A 4QPJA 4CWPA 2FWYA 4JAUA 4MOTA 4LWFA 4L91A 3QDDA 4LWEA 4LWIA 1UYMA 4EGHA 2WI5A 2BSMA 3HEKA 4U7NA 5F3KA 2CGFA 3A0TA 2YGEA 2IWXA 1Z59A 3BM9A 4QPKA 4URMA 2YJXA 5BOCA 3TZ2A 2XX4A 4URNA 4HYPA 1AH6A 4U7OA 1B63A 2YKJA 3O6OA 1H7UA 3HZ1A 1I5CA 1TC6A 2CCUA 2YK2A 4BAEA 2XJGA 1YC3A 1EI1A 2YE6A 1Y4UA 2BU2A 4YKRA 1ZWHA 2XABA 1I5BA 1YERA 4ZVIA 3G75A 4WUBA 3EHJA 4R3AA 5M4NA 3PEHA 4R1FA 1YSZA 2VCJA 2YKIA 2EXLA 3K99A 1AJ6A 1UYKA 1UYHA 1OSFA 4LWHA 2HKJA 2E0AA 3R4OA 3O0IA 5J71A 3CGYA 1YSRA 3EKRA 3NMQA 4CWTA 2YI5A 4CE1A 2YEGA 5CF0A 1BKNA 2VCIA 4K4OA 1I59A 5FNCA 4P7AA 2XJXA 1Z5BA 4FPPA 4EEHA 4HXZA 1AMWA 1ZXMA 3FT8A 4MPNA 4CWRA 2XJJA 2CCSA 3WHAA 2XX2A 3INWA 2ZBKB 2IWSA 2Q8HA 2BT0A 2XHTA 1QY8A 4XKOA 4LPBA 3U67A 2XDUA 3R4NA 4ASBA 1PVGA 4XC0A 5F5RA 2YE3A 1Y4SA 5M4KA 2YK9A 3G7BA 2C2AA 1L0OA 2YKCA 4HXWA 4ASGA 5C93A 2YJWA 1UY9A 3B27A 1US7A 3EHFA 4MPEA 3CRKA 3OWBA 4CE3A 1I5AA 3TTZA 1I5DA 2XDLA 4GCZA 3C11A 2O1VA 3FV5A 4FCRA 4NH9A 5BODA 2YEIA 1Z5CA 4MPCA 2YE9A 4ASAA 4BIZA 2FXSA 2JJCA 4LWGA 4L90A 3Q5KA 3A0WA 1UY7A 4DUHA 3R92A 4B7PA 2YEDA 3B26A 4KSHA 4GGLA 2BZ5A 2Q8IA 1BXDA 1NHJA 3SL2A 2O1WA 3R91A 4Q20A 1TILA 2YEFA 4XIQA 3HZ5A 5M4HA 2BYHA 1YT2A 4O05A 1U2OA 4CE2A 5CTYA 3A0XA 4GFNA 4H81A 1QZRA 3VHAA 2BU7A 1KIJA 2PNRA 4JAVA 3O2FA 3T2SA 4KP4A 2QFOA 3K60A 5D7DA 1GKXA 4CWFA 4BQGA 3A0RA 4NH8A 3VHCA 4XCLA 3D36A 3HHUA 2IOPA 3TZ4A 4E00A 4YKYA 2ESAA 3RLQA 1JM6A 3EHGA 3B28A 2HG1A 4KSGA 3T0HA 4MP2A 3EHHA 3H80A 4HZ0A 2WI4A 2Q2EB 3BMYA 3JZ3A 4R3MA 3RLRA 3OW6A 1YETA 2YKEA 4KTNA 4YKZA 1Y8PA 2UWDA 3IEDA 4EGIA 4EMVA 2BRCA 3B24A 2H8MA 3A0ZA 1GKZA 2XDKA 4O04A 3ZKBA 2YI7A 4W7TA 1I58A 5CTWA 5D7RA 4L93A 1YS3A 1S16A 1NHHA 5D6PA 5IDMA 2QF6A 3ZXQA 1U0ZA 1AH8A 3OMUA 3FT5A 4U93A 4YKQA 2FYPA 4HY1A 2YEBA 2BU5A 4PU9A 1THNA 4O07A 4WUCA 3RLPA 4BXIA 3TZ5A 1ZW9A 3C0EA 5IDJA 3GIFA 3TUHA 1AM1A 2IORA 4YKWA 2YGAA 3H4LA 2WI2A 4CWOA 4URLA 2XD6A 2VWCA 4HYMA 4XKKA 1TBWA 4O09A 1UYFA 4I3HA 4YKTA 2IOQA 2ZDXA 3PEJA 4XDMA 4FCPA 2IWUA 1TH8A 3T1KA 3R4PA 2YEAA 2WEQA 4UROA 4BQJA 4XKAA 4L8ZA 4AWOA 4B6CA 1GJVA 4ZKIA 2GFDA 5CTUA 2XHRA 4V26A 4EGKA 4EFUA 2WI1A 5D6QA 3HYZA 3ZKDA 1B62A 4HY6A 3B25A 3K97A 3D2RA 3CGZA 4XE2A 4AWPA 3VHDA 2WI3A 2XHXA 5L3JA 5CPHA 4FMTA 3MNRP 2XDXA 4YKUA 4CWQA 2QG0A 2YEJA 4PRVA 2XDSA 4JASA 2WERA 4JQLA 2ZKJA 4HZ5A 4L94A 2FWZA 3DGEA 4NH7A 4MBCA 4YKXA 2BU8A 4DZYA 2HCHA 1Y8NA 1YC1A 2CG9A 4I5SA 2YE4A 3G7EA 3GIEA 2YE8A 2CCTA 4KFGA 1ZXNA 3KE6A 3R4MA 1Y8OA 2CH4A 2WEPA 5M4EA 2JKIA 2WI6A 4XD8A 1UYIA 3ZXOA 1Z5AA 2GQPA 1UY8A 1UYEA 2BU6A 1EA6A 4V25A 4XCJA 4XTJA 1KZNA 1YC4A 3CWVA 2YECA 3GIGB 2VW5A 3EKOA 4GEEA 2O1UA 4X9LA 1YESA 1YT0A 3K98A 4PL9A 2H55A 2YEEA 3A0YA 3OPDA 1ID0A 4MB9A 2YE2A 2ZDYA 3D0BA 5GGZA 2YE7A 3OWDA 5D7CA 1YT1A 1BGQA 3Q5LA 1UY6A 5M4MA 4MP7A 2AKPA 1NHIA 3Q5JA 1UYLA 2XK2A 3T10A 2XX5A 4CWSA 4CWNA 2Q8GA 3TZ0A 1MU5A 1UYCA 3LNUA 3T0ZA 5J6AA 2YGFA 3WQ9A 2YI0A 4XIPA 3VADA 3U2KA 4GT8A 4BIUA 2YI6A 4XIRA 4AWQA 1R62A 2WI7A 1B3QA 4LP0A 4WUDA 1TIDA 4AS9A 2BYIA 5FWKA 5M4PA 4ASFA 4KQVA 1UYDA 2K5BA 4EFTA 4E01A 1A4HA 4XITA 5CTXA 1QYEA 2BREA 1BYQA 1UYGA 4GQTA 2YKBA 5FNFA 1MX0A 2XCMA 5FNDA 1TC0A 1S14A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QTF A;  3ZM7 A;  2YE5 A;  4PRX A;  2QG2 A;  3RKZ A;  5IN9 A;  2BTZ A;  3U2D A;  3GIG A;  4EM7 A;  2YEH A;  4P8O A;  3CRL A;  4FCQ A;  1H7S A;  4H7Q A;  2Q8F A;  4O0B A;  3HYY A;  3LPS A;  3INX A;  4H85 A;  4E02 A;  4QPJ A;  4CWP A;  2FWY A;  4JAU A;  4MOT A;  4LWF A;  4L91 A;  3QDD A;  4LWE A;  4LWI A;  1UYM A;  4EGH A;  2WI5 A;  2BSM A;  3HEK A;  4U7N A;  5F3K A;  2CGF A;  3A0T A;  2YGE A;  2IWX A;  1Z59 A;  3BM9 A;  4QPK A;  4URM A;  2YJX A;  5BOC A;  3TZ2 A;  2XX4 A;  4URN A;  4HYP A;  1AH6 A;  4U7O A;  1B63 A;  2YKJ A;  3O6O A;  1H7U A;  3HZ1 A;  1I5C A;  1TC6 A;  2CCU A;  2YK2 A;  4BAE A;  2XJG A;  1YC3 A;  1EI1 A;  2YE6 A;  1Y4U A;  2BU2 A;  4YKR A;  1ZWH A;  2XAB A;  1I5B A;  1YER A;  4ZVI A;  3G75 A;  4WUB A;  3EHJ A;  4R3A A;  5M4N A;  3PEH A;  4R1F A;  1YSZ A;  2VCJ A;  2YKI A;  2EXL A;  3K99 A;  1AJ6 A;  1UYK A;  1UYH A;  1OSF A;  4LWH A;  2HKJ A;  2E0A A;  3R4O A;  3O0I A;  5J71 A;  3CGY A;  1YSR A;  3EKR A;  3NMQ A;  4CWT A;  2YI5 A;  4CE1 A;  2YEG A;  5CF0 A;  1BKN A;  2VCI A;  4K4O A;  1I59 A;  5FNC A;  4P7A A;  2XJX A;  1Z5B A;  4FPP A;  4EEH A;  4HXZ A;  1AMW A;  1ZXM A;  3FT8 A;  4MPN A;  4CWR A;  2XJJ A;  2CCS A;  3WHA A;  2XX2 A;  3INW A;  2ZBK B;  2IWS A;  2Q8H A;  2BT0 A;  2XHT A;  1QY8 A;  4XKO A;  4LPB A;  3U67 A;  2XDU A;  3R4N A;  4ASB A;  1PVG A;  4XC0 A;  5F5R A;  2YE3 A;  1Y4S A;  5M4K A;  2YK9 A;  3G7B A;  2C2A A;  1L0O A;  2YKC A;  4HXW A;  4ASG A;  5C93 A;  2YJW A;  1UY9 A;  3B27 A;  1US7 A;  3EHF A;  4MPE A;  3CRK A;  3OWB A;  4CE3 A;  1I5A A;  3TTZ A;  1I5D A;  2XDL A;  4GCZ A;  3C11 A;  2O1V A;  3FV5 A;  4FCR A;  4NH9 A;  5BOD A;  2YEI A;  1Z5C A;  4MPC A;  2YE9 A;  4ASA A;  4BIZ A;  2FXS A;  2JJC A;  4LWG A;  4L90 A;  3Q5K A;  3A0W A;  1UY7 A;  4DUH A;  3R92 A;  4B7P A;  2YED A;  3B26 A;  4KSH A;  4GGL A;  2BZ5 A;  2Q8I A;  1BXD A;  1NHJ A;  3SL2 A;  2O1W A;  3R91 A;  4Q20 A;  1TIL A;  2YEF A;  4XIQ A;  3HZ5 A;  5M4H A;  2BYH A;  1YT2 A;  4O05 A;  1U2O A;  4CE2 A;  5CTY A;  3A0X A;  4GFN A;  4H81 A;  1QZR A;  3VHA A;  2BU7 A;  1KIJ A;  2PNR A;  4JAV A;  3O2F A;  3T2S A;  4KP4 A;  2QFO A;  3K60 A;  5D7D A;  1GKX A;  4CWF A;  4BQG A;  3A0R A;  4NH8 A;  3VHC A;  4XCL A;  3D36 A;  3HHU A;  2IOP A;  3TZ4 A;  4E00 A;  4YKY A;  2ESA A;  3RLQ A;  1JM6 A;  3EHG A;  3B28 A;  2HG1 A;  4KSG A;  3T0H A;  4MP2 A;  3EHH A;  3H80 A;  4HZ0 A;  2WI4 A;  2Q2E B;  3BMY A;  3JZ3 A;  4R3M A;  3RLR A;  3OW6 A;  1YET A;  2YKE A;  4KTN A;  4YKZ A;  1Y8P A;  2UWD A;  3IED A;  4EGI A;  4EMV A;  2BRC A;  3B24 A;  2H8M A;  3A0Z A;  1GKZ A;  2XDK A;  4O04 A;  3ZKB A;  2YI7 A;  4W7T A;  1I58 A;  5CTW A;  5D7R A;  4L93 A;  1YS3 A;  1S16 A;  1NHH A;  5D6P A;  5IDM A;  2QF6 A;  3ZXQ A;  1U0Z A;  1AH8 A;  3OMU A;  3FT5 A;  4U93 A;  4YKQ A;  2FYP A;  4HY1 A;  2YEB A;  2BU5 A;  4PU9 A;  1THN A;  4O07 A;  4WUC A;  3RLP A;  4BXI A;  3TZ5 A;  1ZW9 A;  3C0E A;  5IDJ A;  3GIF A;  3TUH A;  1AM1 A;  2IOR A;  4YKW A;  2YGA A;  3H4L A;  2WI2 A;  4CWO A;  4URL A;  2XD6 A;  2VWC A;  4HYM A;  4XKK A;  1TBW A;  4O09 A;  1UYF A;  4I3H A;  4YKT A;  2IOQ A;  2ZDX A;  3PEJ A;  4XDM A;  4FCP A;  2IWU A;  1TH8 A;  3T1K A;  3R4P A;  2YEA A;  2WEQ A;  4URO A;  4BQJ A;  4XKA A;  4L8Z A;  4AWO A;  4B6C A;  1GJV A;  4ZKI A;  2GFD A;  5CTU A;  2XHR A;  4V26 A;  4EGK A;  4EFU A;  2WI1 A;  5D6Q A;  3HYZ A;  3ZKD A;  1B62 A;  4HY6 A;  3B25 A;  3K97 A;  3D2R A;  3CGZ A;  4XE2 A;  4AWP A;  3VHD A;  2WI3 A;  2XHX A;  5L3J A;  5CPH A;  4FMT A;  3MNR P;  2XDX A;  4YKU A;  4CWQ A;  2QG0 A;  2YEJ A;  4PRV A;  2XDS A;  4JAS A;  2WER A;  4JQL A;  2ZKJ A;  4HZ5 A;  4L94 A;  2FWZ A;  3DGE A;  4NH7 A;  4MBC A;  4YKX A;  2BU8 A;  4DZY A;  2HCH A;  1Y8N A;  1YC1 A;  2CG9 A;  4I5S A;  2YE4 A;  3G7E A;  3GIE A;  2YE8 A;  2CCT A;  4KFG A;  1ZXN A;  3KE6 A;  3R4M A;  1Y8O A;  2CH4 A;  2WEP A;  5M4E A;  2JKI A;  2WI6 A;  4XD8 A;  1UYI A;  3ZXO A;  1Z5A A;  2GQP A;  1UY8 A;  1UYE A;  2BU6 A;  1EA6 A;  4V25 A;  4XCJ A;  4XTJ A;  1KZN A;  1YC4 A;  3CWV A;  2YEC A;  3GIG B;  2VW5 A;  3EKO A;  4GEE A;  2O1U A;  4X9L A;  1YES A;  1YT0 A;  3K98 A;  4PL9 A;  2H55 A;  2YEE A;  3A0Y A;  3OPD A;  1ID0 A;  4MB9 A;  2YE2 A;  2ZDY A;  3D0B A;  5GGZ A;  2YE7 A;  3OWD A;  5D7C A;  1YT1 A;  1BGQ A;  3Q5L A;  1UY6 A;  5M4M A;  4MP7 A;  2AKP A;  1NHI A;  3Q5J A;  1UYL A;  2XK2 A;  3T10 A;  2XX5 A;  4CWS A;  4CWN A;  2Q8G A;  3TZ0 A;  1MU5 A;  1UYC A;  3LNU A;  3T0Z A;  5J6A A;  2YGF A;  3WQ9 A;  2YI0 A;  4XIP A;  3VAD A;  3U2K A;  4GT8 A;  4BIU A;  2YI6 A;  4XIR A;  4AWQ A;  1R62 A;  2WI7 A;  1B3Q A;  4LP0 A;  4WUD A;  1TID A;  4AS9 A;  2BYI A;  5FWK A;  5M4P A;  4ASF A;  4KQV A;  1UYD A;  2K5B A;  4EFT A;  4E01 A;  1A4H A;  4XIT A;  5CTX A;  1QYE A;  2BRE A;  1BYQ A;  1UYG A;  4GQT A;  2YKB A;  5FNF A;  1MX0 A;  2XCM A;  5FND A;  1TC0 A;  1S14 A; 
#chains in the Genus database with same CATH topology
 3QTF A;  3ZM7 A;  2YE5 A;  4PRX A;  2QG2 A;  3RKZ A;  5IN9 A;  5JEN A;  2BTZ A;  3U2D A;  3GIG A;  4EM7 A;  2YEH A;  4P8O A;  3CRL A;  4FCQ A;  1H7S A;  4H7Q A;  2Q8F A;  4O0B A;  3HYY A;  3LPS A;  3INX A;  4H85 A;  4E02 A;  4QPJ A;  4CWP A;  2FWY A;  4JAU A;  4MOT A;  4LWF A;  4L91 A;  3QDD A;  4LWE A;  4LWI A;  1UYM A;  4EGH A;  2WI5 A;  2BSM A;  3HEK A;  4U7N A;  5F3K A;  2CGF A;  3A0T A;  2YGE A;  2IWX A;  1Z59 A;  3BM9 A;  4QPK A;  4URM A;  2YJX A;  5BOC A;  3TZ2 A;  2XX4 A;  4URN A;  4HYP A;  1AH6 A;  4U7O A;  1B63 A;  2YKJ A;  3O6O A;  1H7U A;  3HZ1 A;  1I5C A;  1TC6 A;  2CCU A;  2YK2 A;  4BAE A;  2XJG A;  1YC3 A;  1EI1 A;  2YE6 A;  1Y4U A;  2BU2 A;  4YKR A;  1ZWH A;  2XAB A;  1I5B A;  1YER A;  4ZVI A;  3G75 A;  4WUB A;  3EHJ A;  4R3A A;  5M4N A;  3PEH A;  4R1F A;  1YSZ A;  2VCJ A;  2YKI A;  2EXL A;  3K99 A;  1AJ6 A;  1UYK A;  1UYH A;  1OSF A;  4LWH A;  2HKJ A;  2E0A A;  3R4O A;  3O0I A;  3S5T A;  5J71 A;  3CGY A;  1YSR A;  3EKR A;  3NMQ A;  4CWT A;  2YI5 A;  4CE1 A;  2YEG A;  5CF0 A;  1BKN A;  2VCI A;  4K4O A;  1I59 A;  5FNC A;  4P7A A;  2XJX A;  1Z5B A;  4FPP A;  4EEH A;  4HXZ A;  1AMW A;  1ZXM A;  3FT8 A;  4MPN A;  4CWR A;  2XJJ A;  2CCS A;  3WHA A;  2XX2 A;  3INW A;  2ZBK B;  2IWS A;  2Q8H A;  2BT0 A;  2XHT A;  1QY8 A;  4XKO A;  4LPB A;  1IXM A;  3U67 A;  2XDU A;  3R4N A;  4ASB A;  1PVG A;  4XC0 A;  5F5R A;  2YE3 A;  1Y4S A;  5M4K A;  2YK9 A;  3G7B A;  2C2A A;  1L0O A;  2YKC A;  4HXW A;  4ASG A;  5C93 A;  2YJW A;  1UY9 A;  3B27 A;  1US7 A;  3EHF A;  4MPE A;  3CRK A;  3OWB A;  4CE3 A;  1I5A A;  3TTZ A;  1I5D A;  2XDL A;  4GCZ A;  3C11 A;  2O1V A;  3FV5 A;  4FCR A;  4NH9 A;  5BOD A;  2YEI A;  1Z5C A;  4MPC A;  2YE9 A;  4ASA A;  4BIZ A;  2FXS A;  2JJC A;  4LWG A;  4L90 A;  3Q5K A;  3A0W A;  1UY7 A;  4DUH A;  3R92 A;  4B7P A;  2YED A;  3B26 A;  4KSH A;  4GGL A;  2BZ5 A;  2Q8I A;  1BXD A;  1NHJ A;  3SL2 A;  2O1W A;  3R91 A;  4Q20 A;  1TIL A;  2YEF A;  4XIQ A;  3HZ5 A;  5M4H A;  2BYH A;  1YT2 A;  4O05 A;  1U2O A;  4CE2 A;  5CTY A;  3A0X A;  4GFN A;  4H81 A;  1QZR A;  3VHA A;  2BU7 A;  1KIJ A;  2PNR A;  4JAV A;  3O2F A;  3T2S A;  4KP4 A;  4E72 A;  2QFO A;  3K60 A;  5D7D A;  1GKX A;  4CWF A;  4BQG A;  3A0R A;  4NH8 A;  3VHC A;  4XCL A;  3D36 A;  3HHU A;  2IOP A;  3TZ4 A;  4E00 A;  4YKY A;  2ESA A;  3RLQ A;  1JM6 A;  3EHG A;  3B28 A;  2HG1 A;  4KSG A;  3T0H A;  4MP2 A;  3EHH A;  3H80 A;  4HZ0 A;  2WI4 A;  2Q2E B;  3BMY A;  3JZ3 A;  4R3M A;  3RLR A;  3OW6 A;  1YET A;  2YKE A;  4KTN A;  4YKZ A;  1Y8P A;  2UWD A;  3IED A;  4EGI A;  4EMV A;  2BRC A;  3B24 A;  2H8M A;  3A0Z A;  1GKZ A;  2XDK A;  4O04 A;  3ZKB A;  2YI7 A;  4W7T A;  1I58 A;  5CTW A;  5D7R A;  4L93 A;  1YS3 A;  1S16 A;  1F51 A;  1NHH A;  5D6P A;  5IDM A;  2QF6 A;  3ZXQ A;  1U0Z A;  1AH8 A;  3OMU A;  3FT5 A;  4U93 A;  4YKQ A;  2FYP A;  4HY1 A;  2YEB A;  2BU5 A;  4PU9 A;  1THN A;  4O07 A;  4WUC A;  3RLP A;  4BXI A;  3TZ5 A;  1ZW9 A;  3C0E A;  5IDJ A;  3GIF A;  2FTK A;  3TUH A;  1AM1 A;  2IOR A;  4YKW A;  2YGA A;  3H4L A;  2WI2 A;  2C1I A;  4CWO A;  4URL A;  2XD6 A;  2VWC A;  4HYM A;  4XKK A;  1TBW A;  4O09 A;  1UYF A;  4I3H A;  4YKT A;  2IOQ A;  2ZDX A;  3PEJ A;  4XDM A;  4FCP A;  2IWU A;  1TH8 A;  3T1K A;  3R4P A;  2YEA A;  2WEQ A;  4URO A;  4BQJ A;  4XKA A;  4L8Z A;  4AWO A;  4B6C A;  1GJV A;  4ZKI A;  2GFD A;  5CTU A;  2XHR A;  4V26 A;  4EGK A;  4EFU A;  2WI1 A;  5D6Q A;  3HYZ A;  3ZKD A;  1B62 A;  4HY6 A;  3B25 A;  3K97 A;  3D2R A;  3CGZ A;  4XE2 A;  4AWP A;  3VHD A;  2WI3 A;  2XHX A;  5L3J A;  5CPH A;  4FMT A;  3MNR P;  2XDX A;  4YKU A;  4CWQ A;  2QG0 A;  2YEJ A;  4PRV A;  2XDS A;  4JAS A;  2WER A;  4JQL A;  2ZKJ A;  4HZ5 A;  4L94 A;  2FWZ A;  2C1G A;  3DGE A;  4NH7 A;  4MBC A;  4YKX A;  2BU8 A;  4DZY A;  2HCH A;  1Y8N A;  1YC1 A;  2CG9 A;  4I5S A;  2YE4 A;  3G7E A;  3GIE A;  2YE8 A;  2CCT A;  4KFG A;  1ZXN A;  3KE6 A;  3R4M A;  1Y8O A;  2CH4 A;  2WEP A;  5M4E A;  2JKI A;  2WI6 A;  2HHI A;  4XD8 A;  1UYI A;  3ZXO A;  1Z5A A;  2GQP A;  1UY8 A;  1UYE A;  2BU6 A;  1EA6 A;  4V25 A;  4XCJ A;  4XTJ A;  1KZN A;  1YC4 A;  3CWV A;  2YEC A;  3GIG B;  2VW5 A;  3EKO A;  3LMM A;  4GEE A;  2O1U A;  4X9L A;  1YES A;  1YT0 A;  3K98 A;  4PL9 A;  2H55 A;  2YEE A;  3A0Y A;  3OPD A;  1ID0 A;  4MB9 A;  2YE2 A;  2ZDY A;  3D0B A;  5GGZ A;  2YE7 A;  3OWD A;  5D7C A;  1YT1 A;  1BGQ A;  3Q5L A;  1UY6 A;  5M4M A;  4MP7 A;  2AKP A;  1NHI A;  3Q5J A;  1UYL A;  2XK2 A;  3T10 A;  2XX5 A;  4CWS A;  3CYG A;  4CWN A;  2Q8G A;  3TZ0 A;  1MU5 A;  1UYC A;  3LNU A;  3T0Z A;  5J6A A;  2YGF A;  3WQ9 A;  2YI0 A;  4XIP A;  3VAD A;  3U2K A;  4GT8 A;  4BIU A;  2YI6 A;  4XIR A;  4AWQ A;  1R62 A;  2WI7 A;  1B3Q A;  4LP0 A;  4WUD A;  1TID A;  4AS9 A;  2BYI A;  5FWK A;  5M4P A;  4ASF A;  4KQV A;  1UYD A;  2K5B A;  4EFT A;  4E01 A;  1A4H A;  4XIT A;  5CTX A;  1QYE A;  2BRE A;  1BYQ A;  1UYG A;  4GQT A;  2YKB A;  5FNF A;  1MX0 A;  2XCM A;  5FND A;  1TC0 A;  1S14 A; 
#chains in the Genus database with same CATH homology
 3QTF A;  3ZM7 A;  2YE5 A;  4PRX A;  2QG2 A;  3RKZ A;  5IN9 A;  2BTZ A;  3U2D A;  3GIG A;  4EM7 A;  2YEH A;  4P8O A;  3CRL A;  4FCQ A;  1H7S A;  4H7Q A;  2Q8F A;  4O0B A;  3HYY A;  3LPS A;  3INX A;  4H85 A;  4E02 A;  4QPJ A;  4CWP A;  2FWY A;  4JAU A;  4MOT A;  4LWF A;  4L91 A;  3QDD A;  4LWE A;  4LWI A;  1UYM A;  4EGH A;  2WI5 A;  2BSM A;  3HEK A;  4U7N A;  5F3K A;  2CGF A;  3A0T A;  2YGE A;  2IWX A;  1Z59 A;  3BM9 A;  4QPK A;  4URM A;  2YJX A;  5BOC A;  3TZ2 A;  2XX4 A;  4URN A;  4HYP A;  1AH6 A;  4U7O A;  1B63 A;  2YKJ A;  3O6O A;  1H7U A;  3HZ1 A;  1I5C A;  1TC6 A;  2CCU A;  2YK2 A;  4BAE A;  2XJG A;  1YC3 A;  1EI1 A;  2YE6 A;  1Y4U A;  2BU2 A;  4YKR A;  1ZWH A;  2XAB A;  1I5B A;  1YER A;  4ZVI A;  3G75 A;  4WUB A;  3EHJ A;  4R3A A;  5M4N A;  3PEH A;  4R1F A;  1YSZ A;  2VCJ A;  2YKI A;  2EXL A;  3K99 A;  1AJ6 A;  1UYK A;  1UYH A;  1OSF A;  4LWH A;  2HKJ A;  2E0A A;  3R4O A;  3O0I A;  5J71 A;  3CGY A;  1YSR A;  3EKR A;  3NMQ A;  4CWT A;  2YI5 A;  4CE1 A;  2YEG A;  5CF0 A;  1BKN A;  2VCI A;  4K4O A;  1I59 A;  5FNC A;  4P7A A;  2XJX A;  1Z5B A;  4FPP A;  4EEH A;  4HXZ A;  1AMW A;  1ZXM A;  3FT8 A;  4MPN A;  4CWR A;  2XJJ A;  2CCS A;  3WHA A;  2XX2 A;  3INW A;  2ZBK B;  2IWS A;  2Q8H A;  2BT0 A;  2XHT A;  1QY8 A;  4XKO A;  4LPB A;  3U67 A;  2XDU A;  3R4N A;  4ASB A;  1PVG A;  4XC0 A;  5F5R A;  2YE3 A;  1Y4S A;  5M4K A;  2YK9 A;  3G7B A;  2C2A A;  1L0O A;  2YKC A;  4HXW A;  4ASG A;  5C93 A;  2YJW A;  1UY9 A;  3B27 A;  1US7 A;  3EHF A;  4MPE A;  3CRK A;  3OWB A;  4CE3 A;  1I5A A;  3TTZ A;  1I5D A;  2XDL A;  4GCZ A;  3C11 A;  2O1V A;  3FV5 A;  4FCR A;  4NH9 A;  5BOD A;  2YEI A;  1Z5C A;  4MPC A;  2YE9 A;  4ASA A;  4BIZ A;  2FXS A;  2JJC A;  4LWG A;  4L90 A;  3Q5K A;  3A0W A;  1UY7 A;  4DUH A;  3R92 A;  4B7P A;  2YED A;  3B26 A;  4KSH A;  4GGL A;  2BZ5 A;  2Q8I A;  1BXD A;  1NHJ A;  3SL2 A;  2O1W A;  3R91 A;  4Q20 A;  1TIL A;  2YEF A;  4XIQ A;  3HZ5 A;  5M4H A;  2BYH A;  1YT2 A;  4O05 A;  1U2O A;  4CE2 A;  5CTY A;  3A0X A;  4GFN A;  4H81 A;  1QZR A;  3VHA A;  2BU7 A;  1KIJ A;  2PNR A;  4JAV A;  3O2F A;  3T2S A;  4KP4 A;  2QFO A;  3K60 A;  5D7D A;  1GKX A;  4CWF A;  4BQG A;  3A0R A;  4NH8 A;  3VHC A;  4XCL A;  3D36 A;  3HHU A;  2IOP A;  3TZ4 A;  4E00 A;  4YKY A;  2ESA A;  3RLQ A;  1JM6 A;  3EHG A;  3B28 A;  2HG1 A;  4KSG A;  3T0H A;  4MP2 A;  3EHH A;  3H80 A;  4HZ0 A;  2WI4 A;  2Q2E B;  3BMY A;  3JZ3 A;  4R3M A;  3RLR A;  3OW6 A;  1YET A;  2YKE A;  4KTN A;  4YKZ A;  1Y8P A;  2UWD A;  3IED A;  4EGI A;  4EMV A;  2BRC A;  3B24 A;  2H8M A;  3A0Z A;  1GKZ A;  2XDK A;  4O04 A;  3ZKB A;  2YI7 A;  4W7T A;  1I58 A;  5CTW A;  5D7R A;  4L93 A;  1YS3 A;  1S16 A;  1NHH A;  5D6P A;  5IDM A;  2QF6 A;  3ZXQ A;  1U0Z A;  1AH8 A;  3OMU A;  3FT5 A;  4U93 A;  4YKQ A;  2FYP A;  4HY1 A;  2YEB A;  2BU5 A;  4PU9 A;  1THN A;  4O07 A;  4WUC A;  3RLP A;  4BXI A;  3TZ5 A;  1ZW9 A;  3C0E A;  5IDJ A;  3GIF A;  3TUH A;  1AM1 A;  2IOR A;  4YKW A;  2YGA A;  3H4L A;  2WI2 A;  4CWO A;  4URL A;  2XD6 A;  2VWC A;  4HYM A;  4XKK A;  1TBW A;  4O09 A;  1UYF A;  4I3H A;  4YKT A;  2IOQ A;  2ZDX A;  3PEJ A;  4XDM A;  4FCP A;  2IWU A;  1TH8 A;  3T1K A;  3R4P A;  2YEA A;  2WEQ A;  4URO A;  4BQJ A;  4XKA A;  4L8Z A;  4AWO A;  4B6C A;  1GJV A;  4ZKI A;  2GFD A;  5CTU A;  2XHR A;  4V26 A;  4EGK A;  4EFU A;  2WI1 A;  5D6Q A;  3HYZ A;  3ZKD A;  1B62 A;  4HY6 A;  3B25 A;  3K97 A;  3D2R A;  3CGZ A;  4XE2 A;  4AWP A;  3VHD A;  2WI3 A;  2XHX A;  5L3J A;  5CPH A;  4FMT A;  3MNR P;  2XDX A;  4YKU A;  4CWQ A;  2QG0 A;  2YEJ A;  4PRV A;  2XDS A;  4JAS A;  2WER A;  4JQL A;  2ZKJ A;  4HZ5 A;  4L94 A;  2FWZ A;  3DGE A;  4NH7 A;  4MBC A;  4YKX A;  2BU8 A;  4DZY A;  2HCH A;  1Y8N A;  1YC1 A;  2CG9 A;  4I5S A;  2YE4 A;  3G7E A;  3GIE A;  2YE8 A;  2CCT A;  4KFG A;  1ZXN A;  3KE6 A;  3R4M A;  1Y8O A;  2CH4 A;  2WEP A;  5M4E A;  2JKI A;  2WI6 A;  4XD8 A;  1UYI A;  3ZXO A;  1Z5A A;  2GQP A;  1UY8 A;  1UYE A;  2BU6 A;  1EA6 A;  4V25 A;  4XCJ A;  4XTJ A;  1KZN A;  1YC4 A;  3CWV A;  2YEC A;  3GIG B;  2VW5 A;  3EKO A;  4GEE A;  2O1U A;  4X9L A;  1YES A;  1YT0 A;  3K98 A;  4PL9 A;  2H55 A;  2YEE A;  3A0Y A;  3OPD A;  1ID0 A;  4MB9 A;  2YE2 A;  2ZDY A;  3D0B A;  5GGZ A;  2YE7 A;  3OWD A;  5D7C A;  1YT1 A;  1BGQ A;  3Q5L A;  1UY6 A;  5M4M A;  4MP7 A;  2AKP A;  1NHI A;  3Q5J A;  1UYL A;  2XK2 A;  3T10 A;  2XX5 A;  4CWS A;  4CWN A;  2Q8G A;  3TZ0 A;  1MU5 A;  1UYC A;  3LNU A;  3T0Z A;  5J6A A;  2YGF A;  3WQ9 A;  2YI0 A;  4XIP A;  3VAD A;  3U2K A;  4GT8 A;  4BIU A;  2YI6 A;  4XIR A;  4AWQ A;  1R62 A;  2WI7 A;  1B3Q A;  4LP0 A;  4WUD A;  1TID A;  4AS9 A;  2BYI A;  5FWK A;  5M4P A;  4ASF A;  4KQV A;  1UYD A;  2K5B A;  4EFT A;  4E01 A;  1A4H A;  4XIT A;  5CTX A;  1QYE A;  2BRE A;  1BYQ A;  1UYG A;  4GQT A;  2YKB A;  5FNF A;  1MX0 A;  2XCM A;  5FND A;  1TC0 A;  1S14 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...