1YSZA

Crystal structure of the unliganded form of grp94, the er hsp90: basis for nucleotide-induced conformational change, grp94n(delta)41 apo crystal soaked with neca
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
227
structure length
217
Chain Sequence
EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELTVKIKCDKEKNLLHVTDTGVGMTREELVKNLGTIGTSEFLNKMTEAQESTSELIGQFGVGFYSAFLVADKVIVTSKHNNDTQHIWESDSNEFSVIADPRGNTLGRGTTITLVLKEEASDYLELDTIKNLVKKYSQFINFPIYVWSSKTKTVWDWELMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Unliganded GRP94, the Endoplasmic Reticulum Hsp90: BASIS FOR NUCLEOTIDE-INDUCED CONFORMATIONAL CHANGE
pubmed doi rcsb
source organism Canis lupus familiaris
molecule tags Chaperone
molecule keywords Endoplasmin
total genus 65
structure length 217
sequence length 227
ec nomenclature
pdb deposition date 2005-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 1yszA00
5BOCA 1BXDA 5FNFA 3MNRP 2Q8FA 4U7OA 3GIEA 4O07A 3HZ5A 4ASFA 2BU6A 2IWXA 5M4PA 3A0ZA 4XCLA 2VW5A 3TZ4A 1UYDA 4HXZA 1GKXA 2YE4A 3HEKA 5F3KA 3Q5JA 4LWHA 1YT0A 2FXSA 3K99A 4P7AA 2YE6A 4L8ZA 1MU5A 4O05A 1BGQA 4U93A 4GQTA 4PU9A 1YERA 2YK2A 3B28A 2BZ5A 1UYHA 2QG0A 3T2SA 4R3MA 3FT8A 1KIJA 2XDKA 4XIRA 4E02A 4KQVA 3R4OA 4KSGA 3CRKA 4YKRA 4XE2A 4EM7A 4W7TA 2YKCA 5IN9A 3K97A 1UYEA 4FCPA 4HY1A 1EA6A 3A0XA 2IOPA 4MPCA 3RLPA 2WI3A 4GT8A 2YEBA 3HHUA 2JKIA 4L91A 2BU2A 4B6CA 5D7DA 3B24A 3HYZA 4O09A 5J6AA 1GKZA 4R3AA 4O0BA 4CWTA 4FMTA 1Z59A 1YESA 5CTXA 4X9LA 2YGFA 2IOQA 3PEHA 2IWSA 5CF0A 1Z5AA 2YE2A 2YI6A 2FWZA 3SL2A 4JAVA 2ZKJA 2IORA 2VCIA 1UY9A 2O1VA 4P8OA 2UWDA 3EKOA 1OSFA 1I5AA 2CGFA 1H7SA 4URNA 2WEPA 3JZ3A 3A0YA 4MPNA 5M4MA 1NHHA 4JQLA 2JJCA 4PL9A 3EHJA 1TILA 3TZ2A 2IWUA 5L3JA 2C2AA 3PEJA 3ZXOA 3ZXQA 4BQGA 3FV5A 5CTYA 4XKOA 3U67A 5D6PA 1YETA 2YEEA 4EGIA 2GQPA 2BU5A 3RLQA 4URLA 2HCHA 1UYIA 4MP2A 3C0EA 4LPBA 3EKRA 5M4NA 4QPKA 2BRCA 2YJWA 2WI1A 1QZRA 2VWCA 2XJXA 3U2KA 2O1UA 2XX5A 1ZW9A 2H55A 3VHCA 3HYYA 2XHRA 4CE3A 5F5RA 1S14A 4UROA 4NH8A 5D6QA 4CWNA 3LNUA 1I5CA 2BU8A 2YGEA 1I5BA 3G7EA 4GEEA 2YEHA 4ZVIA 4H85A 2CH4A 4L94A 2YEGA 4JAUA 3FT5A 4WUCA 5FWKA 2YE9A 2Q8HA 2WI4A 2YKEA 3INWA 4QPJA 4ASAA 3O0IA 4H81A 3HZ1A 4CWSA 3CGYA 4U7NA 2EXLA 2K5BA 4O04A 3VHDA 2YKJA 5CTUA 1AH8A 4R1FA 1YC1A 4LWEA 4CWPA 3GIGA 1Y8PA 3TZ5A 4KTNA 1Z5CA 2ESAA 2ZBKB 4DUHA 3B27A 1KZNA 4AWPA 2BYIA 2BTZA 3BMYA 1ID0A 4MOTA 3A0TA 1US7A 2Q2EB 2CCUA 1Y4UA 2YEJA 3A0WA 4FCRA 1Y4SA 2XDSA 4FPPA 3WHAA 1YT2A 1THNA 4WUBA 2CCTA 1I58A 2GFDA 4EGKA 1UYCA 1GJVA 5M4HA 3R91A 1AM1A 2YI0A 3GIGB 4HZ0A 1B3QA 1S16A 1U0ZA 2BREA 1A4HA 2XDLA 3GIFA 2XDUA 2YKIA 4GGLA 3NMQA 4NH9A 4YKYA 4L90A 3T0HA 5IDMA 2QF6A 3EHHA 1UYMA 3KE6A 3D0BA 2XCMA 2XJJA 2YEFA 2FWYA 2XHXA 4V26A 3RKZA 4KFGA 2O1WA 2YI7A 4PRXA 3EHFA 2HG1A 4ASBA 4GFNA 4YKQA 3K98A 3CRLA 1UYLA 3OPDA 3RLRA 3T0ZA 2WI2A 2YE3A 4L93A 4KP4A 2XDXA 2Q8GA 3K60A 4XC0A 4YKXA 4WUDA 1UYFA 1UY8A 1TH8A 1UY6A 5FNCA 2YE5A 1Y8OA 2ZDXA 5M4KA 4EGHA 3VHAA 3D2RA 2BU7A 4EEHA 2BSMA 4CWFA 2QFOA 3TTZA 1NHJA 2Q8IA 2YGAA 5M4EA 2YJXA 1AJ6A 4ASGA 4DZYA 3G7BA 4AWOA 4XKAA 4B7PA 2ZDYA 4PRVA 1UY7A 5D7CA 2YEAA 1AH6A 4H7QA 5IDJA 3Q5KA 4CWQA 3QTFA 4HXWA 4V25A 1YS3A 1YT1A 5FNDA 4Q20A 4MBCA 2XABA 4MP7A 1TC6A 2YKBA 4LWIA 4HYMA 3EHGA 5CTWA 3B26A 2QG2A 2YK9A 2H8MA 3CWVA 2XHTA 1BYQA 4EMVA 4YKZA 3OMUA 4AWQA 4XD8A 1UYKA 4XKKA 1JM6A 1QYEA 3R4NA 2YEIA 4YKTA 4E00A 4MB9A 1YC4A 4I3HA 4XTJA 3ZKDA 2HKJA 2PNRA 3OW6A 4URMA 4ZKIA 2XX4A 4EFUA 4BAEA 1YSZA 4CWOA 1TIDA 1YSRA 2YE7A 4XDMA 2YEDA 4XCJA 1ZXMA 5CPHA 4EFTA 1I59A 2WI5A 4BXIA 1Z5BA 1Y8NA 2YE8A 3VADA 1R62A 1U2OA 3H4LA 4CE1A 3TUHA 4XIPA 3D36A 1TC0A 4BIZA 4XIQA 2XX2A 2FYPA 1H7UA 4BIUA 4LWFA 3BM9A 4GCZA 1ZWHA 3Q5LA 2VCJA 1UYGA 4XITA 3IEDA 1AMWA 4AS9A 5GGZA 4I5SA 4BQJA 3O2FA 3T1KA 1B62A 3A0RA 2AKPA 2WI6A 3H80A 4LP0A 4MPEA 4CE2A 4YKUA 1TBWA 2XD6A 3R4MA 3R4PA 5D7RA 3G75A 4LWGA 4HYPA 3R92A 3U2DA 2YECA 1YC3A 4JASA 3OWDA 3ZKBA 1NHIA 3O6OA 3TZ0A 4CWRA 1QY8A 1MX0A 1I5DA 4KSHA 1L0OA 3DGEA 2BT0A 3CGZA 1BKNA 1PVGA 3INXA 3ZM7A 3LPSA 4HY6A 3T10A 3WQ9A 2BYHA 4K4OA 3B25A 2WEQA 2CCSA 2WERA 4NH7A 2YI5A 4FCQA 5C93A 2CG9A 3OWBA 2XJGA 2XK2A 4E01A 3QDDA 4YKWA 1ZXNA 2E0AA 4HZ5A 5BODA 1B63A 3C11A 5J71A 2WI7A 1EI1A
chains in the Genus database with same CATH superfamily
5BOCA 1BXDA 5FNFA 3MNRP 2Q8FA 4U7OA 3GIEA 4O07A 3HZ5A 4ASFA 2BU6A 2IWXA 5M4PA 3A0ZA 4XCLA 2VW5A 3TZ4A 1UYDA 4HXZA 1GKXA 2YE4A 3HEKA 5F3KA 3Q5JA 4LWHA 1YT0A 2FXSA 3K99A 4P7AA 2YE6A 4L8ZA 1MU5A 4O05A 1BGQA 4U93A 4GQTA 4PU9A 1YERA 2YK2A 3B28A 2BZ5A 1UYHA 2QG0A 3T2SA 4R3MA 3FT8A 1KIJA 2XDKA 4XIRA 4E02A 4KQVA 3R4OA 5JENA 4KSGA 3CRKA 4YKRA 4XE2A 4EM7A 4W7TA 3LMMA 2YKCA 5IN9A 3K97A 1UYEA 4FCPA 4HY1A 1EA6A 3A0XA 2IOPA 4MPCA 3RLPA 2WI3A 4GT8A 2YEBA 3HHUA 2JKIA 4L91A 2BU2A 4B6CA 5D7DA 3B24A 3HYZA 4O09A 5J6AA 1GKZA 4R3AA 4O0BA 4CWTA 4FMTA 1Z59A 1YESA 5CTXA 4X9LA 2YGFA 2IOQA 3PEHA 2IWSA 5CF0A 1Z5AA 2YE2A 2YI6A 2FWZA 3SL2A 4JAVA 2ZKJA 2IORA 2VCIA 1UY9A 2O1VA 4P8OA 2UWDA 3EKOA 1OSFA 1I5AA 2CGFA 1H7SA 4URNA 2WEPA 3JZ3A 3A0YA 4MPNA 5M4MA 1NHHA 4JQLA 2JJCA 4PL9A 3EHJA 1TILA 3TZ2A 2IWUA 5L3JA 2C2AA 3PEJA 3ZXOA 3ZXQA 4BQGA 3FV5A 5CTYA 4XKOA 3U67A 5D6PA 1YETA 2YEEA 4EGIA 2GQPA 2BU5A 3RLQA 4URLA 2HCHA 1UYIA 4MP2A 3C0EA 4LPBA 3EKRA 5M4NA 4QPKA 2BRCA 2YJWA 2WI1A 1QZRA 2VWCA 2XJXA 3U2KA 2O1UA 2XX5A 1ZW9A 2H55A 3VHCA 3HYYA 2XHRA 4CE3A 5F5RA 1S14A 4UROA 4NH8A 5D6QA 4CWNA 3LNUA 1I5CA 2BU8A 2YGEA 1I5BA 3CYGA 3G7EA 4GEEA 2YEHA 4ZVIA 4H85A 2CH4A 4L94A 2YEGA 4JAUA 3FT5A 4WUCA 3S5TA 5FWKA 2YE9A 2Q8HA 2WI4A 2YKEA 3INWA 4QPJA 4ASAA 3O0IA 4H81A 3HZ1A 4CWSA 3CGYA 4U7NA 2EXLA 2K5BA 4O04A 1F51A 3VHDA 2YKJA 5CTUA 2C1IA 1AH8A 4R1FA 1YC1A 4LWEA 4CWPA 3GIGA 1Y8PA 3TZ5A 4KTNA 1Z5CA 2ESAA 2ZBKB 4DUHA 3B27A 1KZNA 4AWPA 2BYIA 2BTZA 3BMYA 1ID0A 4MOTA 3A0TA 1US7A 2Q2EB 2CCUA 1Y4UA 2YEJA 3A0WA 4FCRA 1Y4SA 2XDSA 4FPPA 3WHAA 1YT2A 1THNA 4WUBA 2CCTA 1I58A 2GFDA 4EGKA 1UYCA 1GJVA 5M4HA 3R91A 1AM1A 2YI0A 3GIGB 4HZ0A 1B3QA 1S16A 1U0ZA 2BREA 1A4HA 2XDLA 3GIFA 2XDUA 2YKIA 4GGLA 3NMQA 4NH9A 4YKYA 4L90A 3T0HA 5IDMA 2QF6A 3EHHA 1UYMA 3KE6A 3D0BA 2XCMA 2XJJA 2YEFA 2FWYA 2XHXA 4V26A 3RKZA 4KFGA 2O1WA 2YI7A 4PRXA 3EHFA 2HG1A 4ASBA 4GFNA 4YKQA 3K98A 3CRLA 1UYLA 3OPDA 3RLRA 3T0ZA 2WI2A 2YE3A 2C1GA 4L93A 4KP4A 4E72A 2XDXA 2Q8GA 3K60A 4XC0A 4YKXA 4WUDA 1UYFA 1UY8A 1TH8A 1UY6A 5FNCA 2YE5A 1Y8OA 2ZDXA 5M4KA 4EGHA 3VHAA 3D2RA 2BU7A 4EEHA 2BSMA 4CWFA 2QFOA 3TTZA 1NHJA 2Q8IA 2YGAA 5M4EA 2YJXA 1AJ6A 4ASGA 4DZYA 3G7BA 4AWOA 4XKAA 4B7PA 2ZDYA 4PRVA 1UY7A 5D7CA 2YEAA 1AH6A 4H7QA 5IDJA 3Q5KA 4CWQA 3QTFA 4HXWA 2FTKA 4V25A 1YS3A 1YT1A 5FNDA 4Q20A 4MBCA 2XABA 4MP7A 1TC6A 2YKBA 4LWIA 4HYMA 3EHGA 5CTWA 3B26A 2QG2A 2YK9A 2H8MA 3CWVA 2XHTA 1BYQA 4EMVA 4YKZA 3OMUA 4AWQA 4XD8A 1UYKA 4XKKA 1JM6A 1QYEA 3R4NA 2YEIA 4YKTA 4E00A 4MB9A 1YC4A 4I3HA 4XTJA 3ZKDA 2HKJA 2PNRA 3OW6A 4URMA 4ZKIA 2XX4A 4EFUA 4BAEA 1YSZA 4CWOA 1TIDA 1YSRA 2YE7A 4XDMA 2YEDA 4XCJA 1ZXMA 5CPHA 4EFTA 1I59A 2WI5A 4BXIA 1Z5BA 1Y8NA 2YE8A 3VADA 1R62A 1U2OA 3H4LA 4CE1A 3TUHA 4XIPA 3D36A 1TC0A 4BIZA 4XIQA 2XX2A 2FYPA 1H7UA 4BIUA 4LWFA 3BM9A 4GCZA 1ZWHA 3Q5LA 2VCJA 1UYGA 4XITA 3IEDA 1AMWA 4AS9A 5GGZA 4I5SA 4BQJA 3O2FA 3T1KA 1B62A 3A0RA 2AKPA 2WI6A 3H80A 4LP0A 4MPEA 4CE2A 4YKUA 1TBWA 2XD6A 3R4MA 3R4PA 5D7RA 3G75A 4LWGA 4HYPA 3R92A 1IXMA 3U2DA 2YECA 1YC3A 4JASA 3OWDA 3ZKBA 1NHIA 3O6OA 3TZ0A 4CWRA 1QY8A 1MX0A 1I5DA 4KSHA 1L0OA 3DGEA 2BT0A 2HHIA 3CGZA 1BKNA 1PVGA 3INXA 3ZM7A 3LPSA 4HY6A 3T10A 3WQ9A 2BYHA 4K4OA 3B25A 2WEQA 2CCSA 2WERA 4NH7A 2YI5A 4FCQA 5C93A 2CG9A 3OWBA 2XJGA 2XK2A 4E01A 3QDDA 4YKWA 1ZXNA 2E0AA 4HZ5A 5BODA 1B63A 3C11A 5J71A 2WI7A 1EI1A
chains in the Genus database with same CATH topology
5BOCA 1BXDA 5FNFA 3MNRP 2Q8FA 4U7OA 3GIEA 4O07A 3HZ5A 4ASFA 2BU6A 2IWXA 5M4PA 3A0ZA 4XCLA 2VW5A 3TZ4A 1UYDA 4HXZA 1GKXA 2YE4A 3HEKA 5F3KA 3Q5JA 4LWHA 1YT0A 2FXSA 3K99A 4P7AA 2YE6A 4L8ZA 1MU5A 4O05A 1BGQA 4U93A 4GQTA 4PU9A 1YERA 2YK2A 3B28A 2BZ5A 1UYHA 2QG0A 3T2SA 4R3MA 3FT8A 1KIJA 2XDKA 4XIRA 4E02A 4KQVA 3R4OA 4KSGA 3CRKA 4YKRA 4XE2A 4EM7A 4W7TA 2YKCA 5IN9A 3K97A 1UYEA 4FCPA 4HY1A 1EA6A 3A0XA 2IOPA 4MPCA 3RLPA 2WI3A 4GT8A 2YEBA 3HHUA 2JKIA 4L91A 2BU2A 4B6CA 5D7DA 3B24A 3HYZA 4O09A 5J6AA 1GKZA 4R3AA 4O0BA 4CWTA 4FMTA 1Z59A 1YESA 5CTXA 4X9LA 2YGFA 2IOQA 3PEHA 2IWSA 5CF0A 1Z5AA 2YE2A 2YI6A 2FWZA 3SL2A 4JAVA 2ZKJA 2IORA 2VCIA 1UY9A 2O1VA 4P8OA 2UWDA 3EKOA 1OSFA 1I5AA 2CGFA 1H7SA 4URNA 2WEPA 3JZ3A 3A0YA 4MPNA 5M4MA 1NHHA 4JQLA 2JJCA 4PL9A 3EHJA 1TILA 3TZ2A 2IWUA 5L3JA 2C2AA 3PEJA 3ZXOA 3ZXQA 4BQGA 3FV5A 5CTYA 4XKOA 3U67A 5D6PA 1YETA 2YEEA 4EGIA 2GQPA 2BU5A 3RLQA 4URLA 2HCHA 1UYIA 4MP2A 3C0EA 4LPBA 3EKRA 5M4NA 4QPKA 2BRCA 2YJWA 2WI1A 1QZRA 2VWCA 2XJXA 3U2KA 2O1UA 2XX5A 1ZW9A 2H55A 3VHCA 3HYYA 2XHRA 4CE3A 5F5RA 1S14A 4UROA 4NH8A 5D6QA 4CWNA 3LNUA 1I5CA 2BU8A 2YGEA 1I5BA 3G7EA 4GEEA 2YEHA 4ZVIA 4H85A 2CH4A 4L94A 2YEGA 4JAUA 3FT5A 4WUCA 5FWKA 2YE9A 2Q8HA 2WI4A 2YKEA 3INWA 4QPJA 4ASAA 3O0IA 4H81A 3HZ1A 4CWSA 3CGYA 4U7NA 2EXLA 2K5BA 4O04A 3VHDA 2YKJA 5CTUA 1AH8A 4R1FA 1YC1A 4LWEA 4CWPA 3GIGA 1Y8PA 3TZ5A 4KTNA 1Z5CA 2ESAA 2ZBKB 4DUHA 3B27A 1KZNA 4AWPA 2BYIA 2BTZA 3BMYA 1ID0A 4MOTA 3A0TA 1US7A 2Q2EB 2CCUA 1Y4UA 2YEJA 3A0WA 4FCRA 1Y4SA 2XDSA 4FPPA 3WHAA 1YT2A 1THNA 4WUBA 2CCTA 1I58A 2GFDA 4EGKA 1UYCA 1GJVA 5M4HA 3R91A 1AM1A 2YI0A 3GIGB 4HZ0A 1B3QA 1S16A 1U0ZA 2BREA 1A4HA 2XDLA 3GIFA 2XDUA 2YKIA 4GGLA 3NMQA 4NH9A 4YKYA 4L90A 3T0HA 5IDMA 2QF6A 3EHHA 1UYMA 3KE6A 3D0BA 2XCMA 2XJJA 2YEFA 2FWYA 2XHXA 4V26A 3RKZA 4KFGA 2O1WA 2YI7A 4PRXA 3EHFA 2HG1A 4ASBA 4GFNA 4YKQA 3K98A 3CRLA 1UYLA 3OPDA 3RLRA 3T0ZA 2WI2A 2YE3A 4L93A 4KP4A 2XDXA 2Q8GA 3K60A 4XC0A 4YKXA 4WUDA 1UYFA 1UY8A 1TH8A 1UY6A 5FNCA 2YE5A 1Y8OA 2ZDXA 5M4KA 4EGHA 3VHAA 3D2RA 2BU7A 4EEHA 2BSMA 4CWFA 2QFOA 3TTZA 1NHJA 2Q8IA 2YGAA 5M4EA 2YJXA 1AJ6A 4ASGA 4DZYA 3G7BA 4AWOA 4XKAA 4B7PA 2ZDYA 4PRVA 1UY7A 5D7CA 2YEAA 1AH6A 4H7QA 5IDJA 3Q5KA 4CWQA 3QTFA 4HXWA 4V25A 1YS3A 1YT1A 5FNDA 4Q20A 4MBCA 2XABA 4MP7A 1TC6A 2YKBA 4LWIA 4HYMA 3EHGA 5CTWA 3B26A 2QG2A 2YK9A 2H8MA 3CWVA 2XHTA 1BYQA 4EMVA 4YKZA 3OMUA 4AWQA 4XD8A 1UYKA 4XKKA 1JM6A 1QYEA 3R4NA 2YEIA 4YKTA 4E00A 4MB9A 1YC4A 4I3HA 4XTJA 3ZKDA 2HKJA 2PNRA 3OW6A 4URMA 4ZKIA 2XX4A 4EFUA 4BAEA 1YSZA 4CWOA 1TIDA 1YSRA 2YE7A 4XDMA 2YEDA 4XCJA 1ZXMA 5CPHA 4EFTA 1I59A 2WI5A 4BXIA 1Z5BA 1Y8NA 2YE8A 3VADA 1R62A 1U2OA 3H4LA 4CE1A 3TUHA 4XIPA 3D36A 1TC0A 4BIZA 4XIQA 2XX2A 2FYPA 1H7UA 4BIUA 4LWFA 3BM9A 4GCZA 1ZWHA 3Q5LA 2VCJA 1UYGA 4XITA 3IEDA 1AMWA 4AS9A 5GGZA 4I5SA 4BQJA 3O2FA 3T1KA 1B62A 3A0RA 2AKPA 2WI6A 3H80A 4LP0A 4MPEA 4CE2A 4YKUA 1TBWA 2XD6A 3R4MA 3R4PA 5D7RA 3G75A 4LWGA 4HYPA 3R92A 3U2DA 2YECA 1YC3A 4JASA 3OWDA 3ZKBA 1NHIA 3O6OA 3TZ0A 4CWRA 1QY8A 1MX0A 1I5DA 4KSHA 1L0OA 3DGEA 2BT0A 3CGZA 1BKNA 1PVGA 3INXA 3ZM7A 3LPSA 4HY6A 3T10A 3WQ9A 2BYHA 4K4OA 3B25A 2WEQA 2CCSA 2WERA 4NH7A 2YI5A 4FCQA 5C93A 2CG9A 3OWBA 2XJGA 2XK2A 4E01A 3QDDA 4YKWA 1ZXNA 2E0AA 4HZ5A 5BODA 1B63A 3C11A 5J71A 2WI7A 1EI1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BOC A;  1BXD A;  5FNF A;  3MNR P;  2Q8F A;  4U7O A;  3GIE A;  4O07 A;  3HZ5 A;  4ASF A;  2BU6 A;  2IWX A;  5M4P A;  3A0Z A;  4XCL A;  2VW5 A;  3TZ4 A;  1UYD A;  4HXZ A;  1GKX A;  2YE4 A;  3HEK A;  5F3K A;  3Q5J A;  4LWH A;  1YT0 A;  2FXS A;  3K99 A;  4P7A A;  2YE6 A;  4L8Z A;  1MU5 A;  4O05 A;  1BGQ A;  4U93 A;  4GQT A;  4PU9 A;  1YER A;  2YK2 A;  3B28 A;  2BZ5 A;  1UYH A;  2QG0 A;  3T2S A;  4R3M A;  3FT8 A;  1KIJ A;  2XDK A;  4XIR A;  4E02 A;  4KQV A;  3R4O A;  4KSG A;  3CRK A;  4YKR A;  4XE2 A;  4EM7 A;  4W7T A;  2YKC A;  5IN9 A;  3K97 A;  1UYE A;  4FCP A;  4HY1 A;  1EA6 A;  3A0X A;  2IOP A;  4MPC A;  3RLP A;  2WI3 A;  4GT8 A;  2YEB A;  3HHU A;  2JKI A;  4L91 A;  2BU2 A;  4B6C A;  5D7D A;  3B24 A;  3HYZ A;  4O09 A;  5J6A A;  1GKZ A;  4R3A A;  4O0B A;  4CWT A;  4FMT A;  1Z59 A;  1YES A;  5CTX A;  4X9L A;  2YGF A;  2IOQ A;  3PEH A;  2IWS A;  5CF0 A;  1Z5A A;  2YE2 A;  2YI6 A;  2FWZ A;  3SL2 A;  4JAV A;  2ZKJ A;  2IOR A;  2VCI A;  1UY9 A;  2O1V A;  4P8O A;  2UWD A;  3EKO A;  1OSF A;  1I5A A;  2CGF A;  1H7S A;  4URN A;  2WEP A;  3JZ3 A;  3A0Y A;  4MPN A;  5M4M A;  1NHH A;  4JQL A;  2JJC A;  4PL9 A;  3EHJ A;  1TIL A;  3TZ2 A;  2IWU A;  5L3J A;  2C2A A;  3PEJ A;  3ZXO A;  3ZXQ A;  4BQG A;  3FV5 A;  5CTY A;  4XKO A;  3U67 A;  5D6P A;  1YET A;  2YEE A;  4EGI A;  2GQP A;  2BU5 A;  3RLQ A;  4URL A;  2HCH A;  1UYI A;  4MP2 A;  3C0E A;  4LPB A;  3EKR A;  5M4N A;  4QPK A;  2BRC A;  2YJW A;  2WI1 A;  1QZR A;  2VWC A;  2XJX A;  3U2K A;  2O1U A;  2XX5 A;  1ZW9 A;  2H55 A;  3VHC A;  3HYY A;  2XHR A;  4CE3 A;  5F5R A;  1S14 A;  4URO A;  4NH8 A;  5D6Q A;  4CWN A;  3LNU A;  1I5C A;  2BU8 A;  2YGE A;  1I5B A;  3G7E A;  4GEE A;  2YEH A;  4ZVI A;  4H85 A;  2CH4 A;  4L94 A;  2YEG A;  4JAU A;  3FT5 A;  4WUC A;  5FWK A;  2YE9 A;  2Q8H A;  2WI4 A;  2YKE A;  3INW A;  4QPJ A;  4ASA A;  3O0I A;  4H81 A;  3HZ1 A;  4CWS A;  3CGY A;  4U7N A;  2EXL A;  2K5B A;  4O04 A;  3VHD A;  2YKJ A;  5CTU A;  1AH8 A;  4R1F A;  1YC1 A;  4LWE A;  4CWP A;  3GIG A;  1Y8P A;  3TZ5 A;  4KTN A;  1Z5C A;  2ESA A;  2ZBK B;  4DUH A;  3B27 A;  1KZN A;  4AWP A;  2BYI A;  2BTZ A;  3BMY A;  1ID0 A;  4MOT A;  3A0T A;  1US7 A;  2Q2E B;  2CCU A;  1Y4U A;  2YEJ A;  3A0W A;  4FCR A;  1Y4S A;  2XDS A;  4FPP A;  3WHA A;  1YT2 A;  1THN A;  4WUB A;  2CCT A;  1I58 A;  2GFD A;  4EGK A;  1UYC A;  1GJV A;  5M4H A;  3R91 A;  1AM1 A;  2YI0 A;  3GIG B;  4HZ0 A;  1B3Q A;  1S16 A;  1U0Z A;  2BRE A;  1A4H A;  2XDL A;  3GIF A;  2XDU A;  2YKI A;  4GGL A;  3NMQ A;  4NH9 A;  4YKY A;  4L90 A;  3T0H A;  5IDM A;  2QF6 A;  3EHH A;  1UYM A;  3KE6 A;  3D0B A;  2XCM A;  2XJJ A;  2YEF A;  2FWY A;  2XHX A;  4V26 A;  3RKZ A;  4KFG A;  2O1W A;  2YI7 A;  4PRX A;  3EHF A;  2HG1 A;  4ASB A;  4GFN A;  4YKQ A;  3K98 A;  3CRL A;  1UYL A;  3OPD A;  3RLR A;  3T0Z A;  2WI2 A;  2YE3 A;  4L93 A;  4KP4 A;  2XDX A;  2Q8G A;  3K60 A;  4XC0 A;  4YKX A;  4WUD A;  1UYF A;  1UY8 A;  1TH8 A;  1UY6 A;  5FNC A;  2YE5 A;  1Y8O A;  2ZDX A;  5M4K A;  4EGH A;  3VHA A;  3D2R A;  2BU7 A;  4EEH A;  2BSM A;  4CWF A;  2QFO A;  3TTZ A;  1NHJ A;  2Q8I A;  2YGA A;  5M4E A;  2YJX A;  1AJ6 A;  4ASG A;  4DZY A;  3G7B A;  4AWO A;  4XKA A;  4B7P A;  2ZDY A;  4PRV A;  1UY7 A;  5D7C A;  2YEA A;  1AH6 A;  4H7Q A;  5IDJ A;  3Q5K A;  4CWQ A;  3QTF A;  4HXW A;  4V25 A;  1YS3 A;  1YT1 A;  5FND A;  4Q20 A;  4MBC A;  2XAB A;  4MP7 A;  1TC6 A;  2YKB A;  4LWI A;  4HYM A;  3EHG A;  5CTW A;  3B26 A;  2QG2 A;  2YK9 A;  2H8M A;  3CWV A;  2XHT A;  1BYQ A;  4EMV A;  4YKZ A;  3OMU A;  4AWQ A;  4XD8 A;  1UYK A;  4XKK A;  1JM6 A;  1QYE A;  3R4N A;  2YEI A;  4YKT A;  4E00 A;  4MB9 A;  1YC4 A;  4I3H A;  4XTJ A;  3ZKD A;  2HKJ A;  2PNR A;  3OW6 A;  4URM A;  4ZKI A;  2XX4 A;  4EFU A;  4BAE A;  1YSZ A;  4CWO A;  1TID A;  1YSR A;  2YE7 A;  4XDM A;  2YED A;  4XCJ A;  1ZXM A;  5CPH A;  4EFT A;  1I59 A;  2WI5 A;  4BXI A;  1Z5B A;  1Y8N A;  2YE8 A;  3VAD A;  1R62 A;  1U2O A;  3H4L A;  4CE1 A;  3TUH A;  4XIP A;  3D36 A;  1TC0 A;  4BIZ A;  4XIQ A;  2XX2 A;  2FYP A;  1H7U A;  4BIU A;  4LWF A;  3BM9 A;  4GCZ A;  1ZWH A;  3Q5L A;  2VCJ A;  1UYG A;  4XIT A;  3IED A;  1AMW A;  4AS9 A;  5GGZ A;  4I5S A;  4BQJ A;  3O2F A;  3T1K A;  1B62 A;  3A0R A;  2AKP A;  2WI6 A;  3H80 A;  4LP0 A;  4MPE A;  4CE2 A;  4YKU A;  1TBW A;  2XD6 A;  3R4M A;  3R4P A;  5D7R A;  3G75 A;  4LWG A;  4HYP A;  3R92 A;  3U2D A;  2YEC A;  1YC3 A;  4JAS A;  3OWD A;  3ZKB A;  1NHI A;  3O6O A;  3TZ0 A;  4CWR A;  1QY8 A;  1MX0 A;  1I5D A;  4KSH A;  1L0O A;  3DGE A;  2BT0 A;  3CGZ A;  1BKN A;  1PVG A;  3INX A;  3ZM7 A;  3LPS A;  4HY6 A;  3T10 A;  3WQ9 A;  2BYH A;  4K4O A;  3B25 A;  2WEQ A;  2CCS A;  2WER A;  4NH7 A;  2YI5 A;  4FCQ A;  5C93 A;  2CG9 A;  3OWB A;  2XJG A;  2XK2 A;  4E01 A;  3QDD A;  4YKW A;  1ZXN A;  2E0A A;  4HZ5 A;  5BOD A;  1B63 A;  3C11 A;  5J71 A;  2WI7 A;  1EI1 A; 
#chains in the Genus database with same CATH topology
 5BOC A;  1BXD A;  5FNF A;  3MNR P;  2Q8F A;  4U7O A;  3GIE A;  4O07 A;  3HZ5 A;  4ASF A;  2BU6 A;  2IWX A;  5M4P A;  3A0Z A;  4XCL A;  2VW5 A;  3TZ4 A;  1UYD A;  4HXZ A;  1GKX A;  2YE4 A;  3HEK A;  5F3K A;  3Q5J A;  4LWH A;  1YT0 A;  2FXS A;  3K99 A;  4P7A A;  2YE6 A;  4L8Z A;  1MU5 A;  4O05 A;  1BGQ A;  4U93 A;  4GQT A;  4PU9 A;  1YER A;  2YK2 A;  3B28 A;  2BZ5 A;  1UYH A;  2QG0 A;  3T2S A;  4R3M A;  3FT8 A;  1KIJ A;  2XDK A;  4XIR A;  4E02 A;  4KQV A;  3R4O A;  5JEN A;  4KSG A;  3CRK A;  4YKR A;  4XE2 A;  4EM7 A;  4W7T A;  3LMM A;  2YKC A;  5IN9 A;  3K97 A;  1UYE A;  4FCP A;  4HY1 A;  1EA6 A;  3A0X A;  2IOP A;  4MPC A;  3RLP A;  2WI3 A;  4GT8 A;  2YEB A;  3HHU A;  2JKI A;  4L91 A;  2BU2 A;  4B6C A;  5D7D A;  3B24 A;  3HYZ A;  4O09 A;  5J6A A;  1GKZ A;  4R3A A;  4O0B A;  4CWT A;  4FMT A;  1Z59 A;  1YES A;  5CTX A;  4X9L A;  2YGF A;  2IOQ A;  3PEH A;  2IWS A;  5CF0 A;  1Z5A A;  2YE2 A;  2YI6 A;  2FWZ A;  3SL2 A;  4JAV A;  2ZKJ A;  2IOR A;  2VCI A;  1UY9 A;  2O1V A;  4P8O A;  2UWD A;  3EKO A;  1OSF A;  1I5A A;  2CGF A;  1H7S A;  4URN A;  2WEP A;  3JZ3 A;  3A0Y A;  4MPN A;  5M4M A;  1NHH A;  4JQL A;  2JJC A;  4PL9 A;  3EHJ A;  1TIL A;  3TZ2 A;  2IWU A;  5L3J A;  2C2A A;  3PEJ A;  3ZXO A;  3ZXQ A;  4BQG A;  3FV5 A;  5CTY A;  4XKO A;  3U67 A;  5D6P A;  1YET A;  2YEE A;  4EGI A;  2GQP A;  2BU5 A;  3RLQ A;  4URL A;  2HCH A;  1UYI A;  4MP2 A;  3C0E A;  4LPB A;  3EKR A;  5M4N A;  4QPK A;  2BRC A;  2YJW A;  2WI1 A;  1QZR A;  2VWC A;  2XJX A;  3U2K A;  2O1U A;  2XX5 A;  1ZW9 A;  2H55 A;  3VHC A;  3HYY A;  2XHR A;  4CE3 A;  5F5R A;  1S14 A;  4URO A;  4NH8 A;  5D6Q A;  4CWN A;  3LNU A;  1I5C A;  2BU8 A;  2YGE A;  1I5B A;  3CYG A;  3G7E A;  4GEE A;  2YEH A;  4ZVI A;  4H85 A;  2CH4 A;  4L94 A;  2YEG A;  4JAU A;  3FT5 A;  4WUC A;  3S5T A;  5FWK A;  2YE9 A;  2Q8H A;  2WI4 A;  2YKE A;  3INW A;  4QPJ A;  4ASA A;  3O0I A;  4H81 A;  3HZ1 A;  4CWS A;  3CGY A;  4U7N A;  2EXL A;  2K5B A;  4O04 A;  1F51 A;  3VHD A;  2YKJ A;  5CTU A;  2C1I A;  1AH8 A;  4R1F A;  1YC1 A;  4LWE A;  4CWP A;  3GIG A;  1Y8P A;  3TZ5 A;  4KTN A;  1Z5C A;  2ESA A;  2ZBK B;  4DUH A;  3B27 A;  1KZN A;  4AWP A;  2BYI A;  2BTZ A;  3BMY A;  1ID0 A;  4MOT A;  3A0T A;  1US7 A;  2Q2E B;  2CCU A;  1Y4U A;  2YEJ A;  3A0W A;  4FCR A;  1Y4S A;  2XDS A;  4FPP A;  3WHA A;  1YT2 A;  1THN A;  4WUB A;  2CCT A;  1I58 A;  2GFD A;  4EGK A;  1UYC A;  1GJV A;  5M4H A;  3R91 A;  1AM1 A;  2YI0 A;  3GIG B;  4HZ0 A;  1B3Q A;  1S16 A;  1U0Z A;  2BRE A;  1A4H A;  2XDL A;  3GIF A;  2XDU A;  2YKI A;  4GGL A;  3NMQ A;  4NH9 A;  4YKY A;  4L90 A;  3T0H A;  5IDM A;  2QF6 A;  3EHH A;  1UYM A;  3KE6 A;  3D0B A;  2XCM A;  2XJJ A;  2YEF A;  2FWY A;  2XHX A;  4V26 A;  3RKZ A;  4KFG A;  2O1W A;  2YI7 A;  4PRX A;  3EHF A;  2HG1 A;  4ASB A;  4GFN A;  4YKQ A;  3K98 A;  3CRL A;  1UYL A;  3OPD A;  3RLR A;  3T0Z A;  2WI2 A;  2YE3 A;  2C1G A;  4L93 A;  4KP4 A;  4E72 A;  2XDX A;  2Q8G A;  3K60 A;  4XC0 A;  4YKX A;  4WUD A;  1UYF A;  1UY8 A;  1TH8 A;  1UY6 A;  5FNC A;  2YE5 A;  1Y8O A;  2ZDX A;  5M4K A;  4EGH A;  3VHA A;  3D2R A;  2BU7 A;  4EEH A;  2BSM A;  4CWF A;  2QFO A;  3TTZ A;  1NHJ A;  2Q8I A;  2YGA A;  5M4E A;  2YJX A;  1AJ6 A;  4ASG A;  4DZY A;  3G7B A;  4AWO A;  4XKA A;  4B7P A;  2ZDY A;  4PRV A;  1UY7 A;  5D7C A;  2YEA A;  1AH6 A;  4H7Q A;  5IDJ A;  3Q5K A;  4CWQ A;  3QTF A;  4HXW A;  2FTK A;  4V25 A;  1YS3 A;  1YT1 A;  5FND A;  4Q20 A;  4MBC A;  2XAB A;  4MP7 A;  1TC6 A;  2YKB A;  4LWI A;  4HYM A;  3EHG A;  5CTW A;  3B26 A;  2QG2 A;  2YK9 A;  2H8M A;  3CWV A;  2XHT A;  1BYQ A;  4EMV A;  4YKZ A;  3OMU A;  4AWQ A;  4XD8 A;  1UYK A;  4XKK A;  1JM6 A;  1QYE A;  3R4N A;  2YEI A;  4YKT A;  4E00 A;  4MB9 A;  1YC4 A;  4I3H A;  4XTJ A;  3ZKD A;  2HKJ A;  2PNR A;  3OW6 A;  4URM A;  4ZKI A;  2XX4 A;  4EFU A;  4BAE A;  1YSZ A;  4CWO A;  1TID A;  1YSR A;  2YE7 A;  4XDM A;  2YED A;  4XCJ A;  1ZXM A;  5CPH A;  4EFT A;  1I59 A;  2WI5 A;  4BXI A;  1Z5B A;  1Y8N A;  2YE8 A;  3VAD A;  1R62 A;  1U2O A;  3H4L A;  4CE1 A;  3TUH A;  4XIP A;  3D36 A;  1TC0 A;  4BIZ A;  4XIQ A;  2XX2 A;  2FYP A;  1H7U A;  4BIU A;  4LWF A;  3BM9 A;  4GCZ A;  1ZWH A;  3Q5L A;  2VCJ A;  1UYG A;  4XIT A;  3IED A;  1AMW A;  4AS9 A;  5GGZ A;  4I5S A;  4BQJ A;  3O2F A;  3T1K A;  1B62 A;  3A0R A;  2AKP A;  2WI6 A;  3H80 A;  4LP0 A;  4MPE A;  4CE2 A;  4YKU A;  1TBW A;  2XD6 A;  3R4M A;  3R4P A;  5D7R A;  3G75 A;  4LWG A;  4HYP A;  3R92 A;  1IXM A;  3U2D A;  2YEC A;  1YC3 A;  4JAS A;  3OWD A;  3ZKB A;  1NHI A;  3O6O A;  3TZ0 A;  4CWR A;  1QY8 A;  1MX0 A;  1I5D A;  4KSH A;  1L0O A;  3DGE A;  2BT0 A;  2HHI A;  3CGZ A;  1BKN A;  1PVG A;  3INX A;  3ZM7 A;  3LPS A;  4HY6 A;  3T10 A;  3WQ9 A;  2BYH A;  4K4O A;  3B25 A;  2WEQ A;  2CCS A;  2WER A;  4NH7 A;  2YI5 A;  4FCQ A;  5C93 A;  2CG9 A;  3OWB A;  2XJG A;  2XK2 A;  4E01 A;  3QDD A;  4YKW A;  1ZXN A;  2E0A A;  4HZ5 A;  5BOD A;  1B63 A;  3C11 A;  5J71 A;  2WI7 A;  1EI1 A; 
#chains in the Genus database with same CATH homology
 5BOC A;  1BXD A;  5FNF A;  3MNR P;  2Q8F A;  4U7O A;  3GIE A;  4O07 A;  3HZ5 A;  4ASF A;  2BU6 A;  2IWX A;  5M4P A;  3A0Z A;  4XCL A;  2VW5 A;  3TZ4 A;  1UYD A;  4HXZ A;  1GKX A;  2YE4 A;  3HEK A;  5F3K A;  3Q5J A;  4LWH A;  1YT0 A;  2FXS A;  3K99 A;  4P7A A;  2YE6 A;  4L8Z A;  1MU5 A;  4O05 A;  1BGQ A;  4U93 A;  4GQT A;  4PU9 A;  1YER A;  2YK2 A;  3B28 A;  2BZ5 A;  1UYH A;  2QG0 A;  3T2S A;  4R3M A;  3FT8 A;  1KIJ A;  2XDK A;  4XIR A;  4E02 A;  4KQV A;  3R4O A;  4KSG A;  3CRK A;  4YKR A;  4XE2 A;  4EM7 A;  4W7T A;  2YKC A;  5IN9 A;  3K97 A;  1UYE A;  4FCP A;  4HY1 A;  1EA6 A;  3A0X A;  2IOP A;  4MPC A;  3RLP A;  2WI3 A;  4GT8 A;  2YEB A;  3HHU A;  2JKI A;  4L91 A;  2BU2 A;  4B6C A;  5D7D A;  3B24 A;  3HYZ A;  4O09 A;  5J6A A;  1GKZ A;  4R3A A;  4O0B A;  4CWT A;  4FMT A;  1Z59 A;  1YES A;  5CTX A;  4X9L A;  2YGF A;  2IOQ A;  3PEH A;  2IWS A;  5CF0 A;  1Z5A A;  2YE2 A;  2YI6 A;  2FWZ A;  3SL2 A;  4JAV A;  2ZKJ A;  2IOR A;  2VCI A;  1UY9 A;  2O1V A;  4P8O A;  2UWD A;  3EKO A;  1OSF A;  1I5A A;  2CGF A;  1H7S A;  4URN A;  2WEP A;  3JZ3 A;  3A0Y A;  4MPN A;  5M4M A;  1NHH A;  4JQL A;  2JJC A;  4PL9 A;  3EHJ A;  1TIL A;  3TZ2 A;  2IWU A;  5L3J A;  2C2A A;  3PEJ A;  3ZXO A;  3ZXQ A;  4BQG A;  3FV5 A;  5CTY A;  4XKO A;  3U67 A;  5D6P A;  1YET A;  2YEE A;  4EGI A;  2GQP A;  2BU5 A;  3RLQ A;  4URL A;  2HCH A;  1UYI A;  4MP2 A;  3C0E A;  4LPB A;  3EKR A;  5M4N A;  4QPK A;  2BRC A;  2YJW A;  2WI1 A;  1QZR A;  2VWC A;  2XJX A;  3U2K A;  2O1U A;  2XX5 A;  1ZW9 A;  2H55 A;  3VHC A;  3HYY A;  2XHR A;  4CE3 A;  5F5R A;  1S14 A;  4URO A;  4NH8 A;  5D6Q A;  4CWN A;  3LNU A;  1I5C A;  2BU8 A;  2YGE A;  1I5B A;  3G7E A;  4GEE A;  2YEH A;  4ZVI A;  4H85 A;  2CH4 A;  4L94 A;  2YEG A;  4JAU A;  3FT5 A;  4WUC A;  5FWK A;  2YE9 A;  2Q8H A;  2WI4 A;  2YKE A;  3INW A;  4QPJ A;  4ASA A;  3O0I A;  4H81 A;  3HZ1 A;  4CWS A;  3CGY A;  4U7N A;  2EXL A;  2K5B A;  4O04 A;  3VHD A;  2YKJ A;  5CTU A;  1AH8 A;  4R1F A;  1YC1 A;  4LWE A;  4CWP A;  3GIG A;  1Y8P A;  3TZ5 A;  4KTN A;  1Z5C A;  2ESA A;  2ZBK B;  4DUH A;  3B27 A;  1KZN A;  4AWP A;  2BYI A;  2BTZ A;  3BMY A;  1ID0 A;  4MOT A;  3A0T A;  1US7 A;  2Q2E B;  2CCU A;  1Y4U A;  2YEJ A;  3A0W A;  4FCR A;  1Y4S A;  2XDS A;  4FPP A;  3WHA A;  1YT2 A;  1THN A;  4WUB A;  2CCT A;  1I58 A;  2GFD A;  4EGK A;  1UYC A;  1GJV A;  5M4H A;  3R91 A;  1AM1 A;  2YI0 A;  3GIG B;  4HZ0 A;  1B3Q A;  1S16 A;  1U0Z A;  2BRE A;  1A4H A;  2XDL A;  3GIF A;  2XDU A;  2YKI A;  4GGL A;  3NMQ A;  4NH9 A;  4YKY A;  4L90 A;  3T0H A;  5IDM A;  2QF6 A;  3EHH A;  1UYM A;  3KE6 A;  3D0B A;  2XCM A;  2XJJ A;  2YEF A;  2FWY A;  2XHX A;  4V26 A;  3RKZ A;  4KFG A;  2O1W A;  2YI7 A;  4PRX A;  3EHF A;  2HG1 A;  4ASB A;  4GFN A;  4YKQ A;  3K98 A;  3CRL A;  1UYL A;  3OPD A;  3RLR A;  3T0Z A;  2WI2 A;  2YE3 A;  4L93 A;  4KP4 A;  2XDX A;  2Q8G A;  3K60 A;  4XC0 A;  4YKX A;  4WUD A;  1UYF A;  1UY8 A;  1TH8 A;  1UY6 A;  5FNC A;  2YE5 A;  1Y8O A;  2ZDX A;  5M4K A;  4EGH A;  3VHA A;  3D2R A;  2BU7 A;  4EEH A;  2BSM A;  4CWF A;  2QFO A;  3TTZ A;  1NHJ A;  2Q8I A;  2YGA A;  5M4E A;  2YJX A;  1AJ6 A;  4ASG A;  4DZY A;  3G7B A;  4AWO A;  4XKA A;  4B7P A;  2ZDY A;  4PRV A;  1UY7 A;  5D7C A;  2YEA A;  1AH6 A;  4H7Q A;  5IDJ A;  3Q5K A;  4CWQ A;  3QTF A;  4HXW A;  4V25 A;  1YS3 A;  1YT1 A;  5FND A;  4Q20 A;  4MBC A;  2XAB A;  4MP7 A;  1TC6 A;  2YKB A;  4LWI A;  4HYM A;  3EHG A;  5CTW A;  3B26 A;  2QG2 A;  2YK9 A;  2H8M A;  3CWV A;  2XHT A;  1BYQ A;  4EMV A;  4YKZ A;  3OMU A;  4AWQ A;  4XD8 A;  1UYK A;  4XKK A;  1JM6 A;  1QYE A;  3R4N A;  2YEI A;  4YKT A;  4E00 A;  4MB9 A;  1YC4 A;  4I3H A;  4XTJ A;  3ZKD A;  2HKJ A;  2PNR A;  3OW6 A;  4URM A;  4ZKI A;  2XX4 A;  4EFU A;  4BAE A;  1YSZ A;  4CWO A;  1TID A;  1YSR A;  2YE7 A;  4XDM A;  2YED A;  4XCJ A;  1ZXM A;  5CPH A;  4EFT A;  1I59 A;  2WI5 A;  4BXI A;  1Z5B A;  1Y8N A;  2YE8 A;  3VAD A;  1R62 A;  1U2O A;  3H4L A;  4CE1 A;  3TUH A;  4XIP A;  3D36 A;  1TC0 A;  4BIZ A;  4XIQ A;  2XX2 A;  2FYP A;  1H7U A;  4BIU A;  4LWF A;  3BM9 A;  4GCZ A;  1ZWH A;  3Q5L A;  2VCJ A;  1UYG A;  4XIT A;  3IED A;  1AMW A;  4AS9 A;  5GGZ A;  4I5S A;  4BQJ A;  3O2F A;  3T1K A;  1B62 A;  3A0R A;  2AKP A;  2WI6 A;  3H80 A;  4LP0 A;  4MPE A;  4CE2 A;  4YKU A;  1TBW A;  2XD6 A;  3R4M A;  3R4P A;  5D7R A;  3G75 A;  4LWG A;  4HYP A;  3R92 A;  3U2D A;  2YEC A;  1YC3 A;  4JAS A;  3OWD A;  3ZKB A;  1NHI A;  3O6O A;  3TZ0 A;  4CWR A;  1QY8 A;  1MX0 A;  1I5D A;  4KSH A;  1L0O A;  3DGE A;  2BT0 A;  3CGZ A;  1BKN A;  1PVG A;  3INX A;  3ZM7 A;  3LPS A;  4HY6 A;  3T10 A;  3WQ9 A;  2BYH A;  4K4O A;  3B25 A;  2WEQ A;  2CCS A;  2WER A;  4NH7 A;  2YI5 A;  4FCQ A;  5C93 A;  2CG9 A;  3OWB A;  2XJG A;  2XK2 A;  4E01 A;  3QDD A;  4YKW A;  1ZXN A;  2E0A A;  4HZ5 A;  5BOD A;  1B63 A;  3C11 A;  5J71 A;  2WI7 A;  1EI1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...