1YSZA

Crystal structure of the unliganded form of grp94, the er hsp90: basis for nucleotide-induced conformational change, grp94n(delta)41 apo crystal soaked with neca
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
227
structure length
217
Chain Sequence
b'EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELTVKIKCDKEKNLLHVTDTGVGMTREELVKNLGTIGTSEFLNKMTEAQESTSELIGQFGVGFYSAFLVADKVIVTSKHNNDTQHIWESDSNEFSVIADPRGNTLGRGTTITLVLKEEASDYLELDTIKNLVKKYSQFINFPIYVWSSKTKTVWDWELMN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endoplasmin
publication title Structure of Unliganded GRP94, the Endoplasmic Reticulum Hsp90: BASIS FOR NUCLEOTIDE-INDUCED CONFORMATIONAL CHANGE
pubmed doi rcsb
source organism Canis lupus familiaris
molecule tags Chaperone
total genus 65
structure length 217
sequence length 227
ec nomenclature
pdb deposition date 2005-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 1yszA00
5FWKA 1NHHA 5C93A 3R92A 3B28A 3A0YA 4WUBA 3Q5KA 1YESA 2WERA 1YC4A 3LNUA 4CWSA 1YT1A 4CE2A 2YE4A 2CCTA 4R1FA 4WUDA 2BU8A 4GT8A 3EHJA 2YKIA 3T0HA 1YETA 3C11A 2BYHA 2XCMA 1MU5A 3RLPA 1KZNA 2XD6A 5D7RA 5IDJA 2HCHA 1KIJA 5FNCA 2BSMA 3TZ4A 3EKRA 2XABA 3R4MA 4YKXA 4P7AA 3D2RA 2IWSA 4FCQA 3A0TA 4CWRA 2XX2A 4E02A 4HYPA 2JJCA 3HYYA 4MP7A 4ASFA 2XJJA 2YE6A 3EHFA 3JZ3A 5M4PA 3T2SA 4YKYA 1BYQA 2YEGA 2YEFA 4GCZA 4LWGA 5L3JA 4LWIA 2ZDXA 2YEEA 1UYMA 4PRVA 4XKOA 3OWBA 2YK2A 3HZ5A 4QPKA 1AH8A 4L90A 4UROA 2WI7A 4L8ZA 1YT0A 3RKZA 3BMYA 3WQ9A 3QTFA 3Q5JA 3H80A 2YKJA 3G7BA 2BYIA 3R4OA 2H8MA 3T0ZA 2ZDYA 3TTZA 1JM6A 2BT0A 3FT5A 1UYGA 1TIDA 5J71A 4DZYA 1AMWA 2EXLA 2O1VA 2Q2EB 1TC6A 2IOPA 4CWOA 2YEJA 3K97A 3ZKBA 2WI6A 4YKWA 4O04A 4YKQA 1B62A 4I3HA 1BKNA 3OPDA 4XTJA 2O1WA 4H85A 2Q8GA 2XX5A 3O6OA 2XDXA 4EM7A 4E01A 3OW6A 2YI6A 5F3KA 2YE8A 1UYIA 2YEBA 5IN9A 1Y8OA 1UYFA 4XKAA 5CF0A 2CCSA 4K4OA 4NH8A 3VHCA 2IORA 2ESAA 4Q20A 4BXIA 4BQJA 3T1KA 4CWPA 4XIQA 1EI1A 2BU6A 1QYEA 1ZXMA 4BQGA 4BIUA 3NMQA 1EA6A 3VHDA 2WI1A 3T10A 3CRLA 1U2OA 1NHIA 1THNA 3C0EA 4AWOA 4E00A 1YSRA 4EGHA 1AM1A 3FT8A 2IWXA 4GEEA 5IDMA 1B63A 2AKPA 4PRXA 3B25A 1ZW9A 1YS3A 4L91A 2WI3A 1S16A 1UY9A 3RLQA 2JKIA 2VCIA 2BREA 5CTWA 1I5BA 2FYPA 1Z59A 2CG9A 2QF6A 4CWFA 4H81A 2WEPA 1U0ZA 3H4LA 2BU5A 3GIGB 2YJWA 3D36A 4JQLA 2YI0A 2Q8IA 3SL2A 5M4KA 3ZXQA 4NH9A 4KTNA 4WUCA 4EGIA 1US7A 4GFNA 3ZKDA 3A0WA 1GKZA 4XD8A 3U2KA 3HHUA 1ZXNA 2UWDA 2H55A 2YI7A 4X9LA 4ASBA 4BAEA 4FMTA 5D6PA 1A4HA 4O09A 4FCRA 1Y8PA 2XJGA 2FXSA 2XDSA 4XC0A 1BGQA 2CCUA 5M4MA 4BIZA 1GKXA 4MPEA 1UYCA 2BZ5A 3VADA 1ZWHA 3U2DA 2XK2A 1Z5AA 2VCJA 1YT2A 2YE9A 4MOTA 4L94A 3ZXOA 1UY8A 2C2AA 4LWFA 2HKJA 1H7UA 4U7OA 4YKZA 1GJVA 1S14A 2XX4A 3IEDA 4JAVA 2XHTA 3O2FA 4XIPA 4YKRA 3A0RA 3HZ1A 3O0IA 2WI2A 2QG2A 2YEDA 4XDMA 1UYLA 3B27A 4I5SA 2YJXA 5D6QA 2PNRA 2XHXA 1YERA 4URLA 2HG1A 3PEJA 3D0BA 2BU7A 4LP0A 2XDLA 3HEKA 5BOCA 2YEHA 3U67A 2BU2A 4XE2A 1UY7A 3CGZA 4XCJA 4EFTA 2BRCA 2YK9A 4ASGA 4L93A 4V25A 1L0OA 4EMVA 3VHAA 2YE2A 4AWQA 5BODA 1YC3A 5D7DA 2YE5A 4MB9A 1AJ6A 4W7TA 3QDDA 4MPCA 4MPNA 4HZ5A 2ZKJA 1TC0A 3G75A 1PVGA 1UYEA 1QZRA 4MBCA 3R4PA 2IOQA 2YKCA 2WI5A 4LWHA 3OWDA 3DGEA 3CGYA 4GGLA 4CE1A 2VW5A 4KFGA 4URMA 4AWPA 1Y4UA 3TZ0A 4R3MA 4QPJA 4HXWA 3FV5A 5D7CA 2YKEA 1AH6A 2YE3A 2YE7A 4FCPA 1QY8A 5CTYA 5M4HA 2WI4A 1ID0A 2ZBKB 4XKKA 3B26A 4PU9A 3TUHA 2GFDA 3GIGA 2XJXA 4U7NA 4ZVIA 3BM9A 2XDKA 4GQTA 4ZKIA 2Q8HA 5CTUA 4H7QA 4O07A 3ZM7A 4HY6A 1YC1A 5M4EA 2VWCA 2YGFA 4P8OA 1I5DA 2WEQA 5CTXA 1I5CA 2YKBA 1Z5BA 2GQPA 2YECA 1Z5CA 3KE6A 4XIRA 4EGKA 1OSFA 1I5AA 2CGFA 3B24A 1B3QA 4HXZA 4O0BA 4V26A 3CRKA 2IWUA 1R62A 5GGZA 3OMUA 4ASAA 3R4NA 4FPPA 2FWZA 1UYDA 4R3AA 2QFOA 2YEAA 1UYHA 3K60A 4NH7A 4HZ0A 3EHHA 3LPSA 1TILA 4JAUA 3CWVA 4EFUA 3A0ZA 3A0XA 3TZ2A 3INWA 4DUHA 1Y4SA 4CWQA 2O1UA 1BXDA 3GIFA 3GIEA 2XDUA 2YEIA 1MX0A 2XHRA 3K99A 4KSGA 3K98A 5M4NA 2YI5A 4PL9A 3HYZA 4LPBA 1UY6A 5FNDA 4XITA 3G7EA 1Y8NA 1H7SA 5FNFA 2QG0A 4AS9A 5F5RA 3RLRA 4CWTA 4MP2A 4LWEA 2BTZA 2E0AA 4CWNA 4O05A 2K5BA 4KP4A 3R91A 4YKTA 3EHGA 5J6AA 3MNRP 2Q8FA 4XCLA 3PEHA 4YKUA 4KSHA 1I59A 4EEHA 4B6CA 1NHJA 3INXA 4HYMA 4U93A 2FWYA 1TBWA 4CE3A 2YGAA 4JASA 4B7PA 5CPHA 3TZ5A 1YSZA 3EKOA 4KQVA 1UYKA 2YGEA 2CH4A 4URNA 4HY1A 3Q5LA 3WHAA 1TH8A 1I58A
chains in the Genus database with same CATH superfamily
5FWKA 1NHHA 5C93A 3R92A 3B28A 3A0YA 4WUBA 3Q5KA 1YESA 2WERA 1YC4A 3LNUA 4CWSA 1YT1A 4CE2A 2YE4A 2CCTA 4R1FA 4WUDA 2BU8A 4GT8A 3EHJA 3S5TA 2YKIA 3T0HA 1YETA 3C11A 2BYHA 2XCMA 1MU5A 3RLPA 1KZNA 2XD6A 5D7RA 5IDJA 2HCHA 1KIJA 5FNCA 2BSMA 3TZ4A 3EKRA 2XABA 3R4MA 4YKXA 4P7AA 3D2RA 2IWSA 4FCQA 3A0TA 4CWRA 2XX2A 4E02A 4HYPA 2JJCA 3HYYA 4MP7A 4ASFA 2XJJA 2YE6A 3EHFA 3JZ3A 5M4PA 3T2SA 4YKYA 1BYQA 2YEGA 2YEFA 4GCZA 4LWGA 5L3JA 4LWIA 2ZDXA 2YEEA 1UYMA 4PRVA 4XKOA 3OWBA 2YK2A 3HZ5A 4QPKA 1AH8A 4L90A 4UROA 2WI7A 4L8ZA 1YT0A 3RKZA 3BMYA 3WQ9A 3QTFA 3Q5JA 3H80A 2YKJA 3G7BA 2BYIA 3R4OA 2H8MA 3T0ZA 2ZDYA 3TTZA 1JM6A 2BT0A 3FT5A 1UYGA 1TIDA 5J71A 4DZYA 1AMWA 1IXMA 2EXLA 2O1VA 2Q2EB 1TC6A 2IOPA 4CWOA 2YEJA 3K97A 3ZKBA 2WI6A 4YKWA 4O04A 4YKQA 1B62A 4I3HA 1BKNA 3OPDA 4XTJA 2O1WA 4H85A 2Q8GA 2XX5A 3O6OA 2XDXA 4EM7A 4E01A 3OW6A 2YI6A 5F3KA 2YE8A 1UYIA 2YEBA 5IN9A 1Y8OA 1UYFA 4XKAA 5CF0A 2CCSA 4K4OA 4NH8A 3VHCA 2IORA 2ESAA 4Q20A 4BXIA 4BQJA 3T1KA 4CWPA 4XIQA 1EI1A 2BU6A 1QYEA 1ZXMA 4BQGA 2C1GA 4BIUA 3NMQA 1EA6A 3VHDA 5JENA 2WI1A 3T10A 3CRLA 1U2OA 1NHIA 1THNA 3C0EA 4AWOA 4E00A 1YSRA 4EGHA 1AM1A 3FT8A 2IWXA 4GEEA 5IDMA 1B63A 2AKPA 4PRXA 3B25A 1ZW9A 1YS3A 4L91A 2WI3A 1S16A 1UY9A 3RLQA 2JKIA 2VCIA 2BREA 5CTWA 1I5BA 2FYPA 1Z59A 2CG9A 2QF6A 4CWFA 4H81A 2WEPA 1U0ZA 3H4LA 2BU5A 3GIGB 2YJWA 3D36A 4JQLA 2YI0A 2Q8IA 3SL2A 5M4KA 3ZXQA 4NH9A 4KTNA 4WUCA 4EGIA 1US7A 4GFNA 3ZKDA 3A0WA 1GKZA 4XD8A 3U2KA 4E72A 3HHUA 1ZXNA 2UWDA 2H55A 2YI7A 4X9LA 4ASBA 4BAEA 2C1IA 4FMTA 5D6PA 1A4HA 4O09A 3LMMA 4FCRA 1Y8PA 2XJGA 2FXSA 2XDSA 4XC0A 1BGQA 2CCUA 5M4MA 4BIZA 1GKXA 2FTKA 4MPEA 1UYCA 2BZ5A 3VADA 1ZWHA 3U2DA 2XK2A 1Z5AA 2VCJA 1YT2A 2YE9A 4MOTA 4L94A 3ZXOA 1UY8A 2C2AA 4LWFA 2HKJA 1F51A 1H7UA 4U7OA 4YKZA 1GJVA 1S14A 2XX4A 3IEDA 4JAVA 2XHTA 3O2FA 4XIPA 4YKRA 3A0RA 3HZ1A 3O0IA 2WI2A 2QG2A 2YEDA 4XDMA 1UYLA 3B27A 4I5SA 2YJXA 5D6QA 2PNRA 2XHXA 1YERA 4URLA 2HG1A 3PEJA 3D0BA 2BU7A 4LP0A 2XDLA 3HEKA 5BOCA 2YEHA 3U67A 2BU2A 4XE2A 1UY7A 3CGZA 4XCJA 4EFTA 2BRCA 2YK9A 4ASGA 4L93A 4V25A 1L0OA 4EMVA 3VHAA 2HHIA 2YE2A 4AWQA 5BODA 1YC3A 5D7DA 2YE5A 4MB9A 1AJ6A 4W7TA 3QDDA 4MPCA 4MPNA 4HZ5A 2ZKJA 1TC0A 3G75A 1PVGA 1UYEA 1QZRA 4MBCA 3R4PA 2IOQA 2YKCA 2WI5A 4LWHA 3OWDA 3DGEA 3CGYA 4GGLA 4CE1A 2VW5A 4KFGA 4URMA 4AWPA 1Y4UA 3TZ0A 4R3MA 4QPJA 4HXWA 3FV5A 5D7CA 2YKEA 1AH6A 2YE3A 2YE7A 4FCPA 1QY8A 5CTYA 5M4HA 2WI4A 1ID0A 2ZBKB 4XKKA 3B26A 4PU9A 3TUHA 2GFDA 3GIGA 2XJXA 4U7NA 4ZVIA 3BM9A 2XDKA 4GQTA 4ZKIA 2Q8HA 5CTUA 4H7QA 4O07A 3ZM7A 4HY6A 1YC1A 5M4EA 2VWCA 2YGFA 4P8OA 1I5DA 2WEQA 5CTXA 1I5CA 2YKBA 1Z5BA 2GQPA 2YECA 1Z5CA 3KE6A 4XIRA 4EGKA 1OSFA 1I5AA 2CGFA 3B24A 1B3QA 4HXZA 4O0BA 4V26A 3CRKA 2IWUA 3CYGA 1R62A 5GGZA 3OMUA 4ASAA 3R4NA 4FPPA 2FWZA 1UYDA 4R3AA 2QFOA 2YEAA 1UYHA 3K60A 4NH7A 4HZ0A 3EHHA 3LPSA 1TILA 4JAUA 3CWVA 4EFUA 3A0ZA 3A0XA 3TZ2A 3INWA 4DUHA 1Y4SA 4CWQA 2O1UA 1BXDA 3GIFA 3GIEA 2XDUA 2YEIA 1MX0A 2XHRA 3K99A 4KSGA 3K98A 5M4NA 2YI5A 4PL9A 3HYZA 4LPBA 1UY6A 5FNDA 4XITA 3G7EA 1Y8NA 1H7SA 5FNFA 2QG0A 4AS9A 5F5RA 3RLRA 4CWTA 4MP2A 4LWEA 2BTZA 2E0AA 4CWNA 4O05A 2K5BA 4KP4A 3R91A 4YKTA 3EHGA 5J6AA 3MNRP 2Q8FA 4XCLA 3PEHA 4YKUA 4KSHA 1I59A 4EEHA 4B6CA 1NHJA 3INXA 4HYMA 4U93A 2FWYA 1TBWA 4CE3A 2YGAA 4JASA 4B7PA 5CPHA 3TZ5A 1YSZA 3EKOA 4KQVA 1UYKA 2YGEA 2CH4A 4URNA 4HY1A 3Q5LA 3WHAA 1TH8A 1I58A
chains in the Genus database with same CATH topology
5FWKA 1NHHA 5C93A 3R92A 3B28A 3A0YA 4WUBA 3Q5KA 1YESA 2WERA 1YC4A 3LNUA 4CWSA 1YT1A 4CE2A 2YE4A 2CCTA 4R1FA 4WUDA 2BU8A 4GT8A 3EHJA 2YKIA 3T0HA 1YETA 3C11A 2BYHA 2XCMA 1MU5A 3RLPA 1KZNA 2XD6A 5D7RA 5IDJA 2HCHA 1KIJA 5FNCA 2BSMA 3TZ4A 3EKRA 2XABA 3R4MA 4YKXA 4P7AA 3D2RA 2IWSA 4FCQA 3A0TA 4CWRA 2XX2A 4E02A 4HYPA 2JJCA 3HYYA 4MP7A 4ASFA 2XJJA 2YE6A 3EHFA 3JZ3A 5M4PA 3T2SA 4YKYA 1BYQA 2YEGA 2YEFA 4GCZA 4LWGA 5L3JA 4LWIA 2ZDXA 2YEEA 1UYMA 4PRVA 4XKOA 3OWBA 2YK2A 3HZ5A 4QPKA 1AH8A 4L90A 4UROA 2WI7A 4L8ZA 1YT0A 3RKZA 3BMYA 3WQ9A 3QTFA 3Q5JA 3H80A 2YKJA 3G7BA 2BYIA 3R4OA 2H8MA 3T0ZA 2ZDYA 3TTZA 1JM6A 2BT0A 3FT5A 1UYGA 1TIDA 5J71A 4DZYA 1AMWA 2EXLA 2O1VA 2Q2EB 1TC6A 2IOPA 4CWOA 2YEJA 3K97A 3ZKBA 2WI6A 4YKWA 4O04A 4YKQA 1B62A 4I3HA 1BKNA 3OPDA 4XTJA 2O1WA 4H85A 2Q8GA 2XX5A 3O6OA 2XDXA 4EM7A 4E01A 3OW6A 2YI6A 5F3KA 2YE8A 1UYIA 2YEBA 5IN9A 1Y8OA 1UYFA 4XKAA 5CF0A 2CCSA 4K4OA 4NH8A 3VHCA 2IORA 2ESAA 4Q20A 4BXIA 4BQJA 3T1KA 4CWPA 4XIQA 1EI1A 2BU6A 1QYEA 1ZXMA 4BQGA 4BIUA 3NMQA 1EA6A 3VHDA 2WI1A 3T10A 3CRLA 1U2OA 1NHIA 1THNA 3C0EA 4AWOA 4E00A 1YSRA 4EGHA 1AM1A 3FT8A 2IWXA 4GEEA 5IDMA 1B63A 2AKPA 4PRXA 3B25A 1ZW9A 1YS3A 4L91A 2WI3A 1S16A 1UY9A 3RLQA 2JKIA 2VCIA 2BREA 5CTWA 1I5BA 2FYPA 1Z59A 2CG9A 2QF6A 4CWFA 4H81A 2WEPA 1U0ZA 3H4LA 2BU5A 3GIGB 2YJWA 3D36A 4JQLA 2YI0A 2Q8IA 3SL2A 5M4KA 3ZXQA 4NH9A 4KTNA 4WUCA 4EGIA 1US7A 4GFNA 3ZKDA 3A0WA 1GKZA 4XD8A 3U2KA 3HHUA 1ZXNA 2UWDA 2H55A 2YI7A 4X9LA 4ASBA 4BAEA 4FMTA 5D6PA 1A4HA 4O09A 4FCRA 1Y8PA 2XJGA 2FXSA 2XDSA 4XC0A 1BGQA 2CCUA 5M4MA 4BIZA 1GKXA 4MPEA 1UYCA 2BZ5A 3VADA 1ZWHA 3U2DA 2XK2A 1Z5AA 2VCJA 1YT2A 2YE9A 4MOTA 4L94A 3ZXOA 1UY8A 2C2AA 4LWFA 2HKJA 1H7UA 4U7OA 4YKZA 1GJVA 1S14A 2XX4A 3IEDA 4JAVA 2XHTA 3O2FA 4XIPA 4YKRA 3A0RA 3HZ1A 3O0IA 2WI2A 2QG2A 2YEDA 4XDMA 1UYLA 3B27A 4I5SA 2YJXA 5D6QA 2PNRA 2XHXA 1YERA 4URLA 2HG1A 3PEJA 3D0BA 2BU7A 4LP0A 2XDLA 3HEKA 5BOCA 2YEHA 3U67A 2BU2A 4XE2A 1UY7A 3CGZA 4XCJA 4EFTA 2BRCA 2YK9A 4ASGA 4L93A 4V25A 1L0OA 4EMVA 3VHAA 2YE2A 4AWQA 5BODA 1YC3A 5D7DA 2YE5A 4MB9A 1AJ6A 4W7TA 3QDDA 4MPCA 4MPNA 4HZ5A 2ZKJA 1TC0A 3G75A 1PVGA 1UYEA 1QZRA 4MBCA 3R4PA 2IOQA 2YKCA 2WI5A 4LWHA 3OWDA 3DGEA 3CGYA 4GGLA 4CE1A 2VW5A 4KFGA 4URMA 4AWPA 1Y4UA 3TZ0A 4R3MA 4QPJA 4HXWA 3FV5A 5D7CA 2YKEA 1AH6A 2YE3A 2YE7A 4FCPA 1QY8A 5CTYA 5M4HA 2WI4A 1ID0A 2ZBKB 4XKKA 3B26A 4PU9A 3TUHA 2GFDA 3GIGA 2XJXA 4U7NA 4ZVIA 3BM9A 2XDKA 4GQTA 4ZKIA 2Q8HA 5CTUA 4H7QA 4O07A 3ZM7A 4HY6A 1YC1A 5M4EA 2VWCA 2YGFA 4P8OA 1I5DA 2WEQA 5CTXA 1I5CA 2YKBA 1Z5BA 2GQPA 2YECA 1Z5CA 3KE6A 4XIRA 4EGKA 1OSFA 1I5AA 2CGFA 3B24A 1B3QA 4HXZA 4O0BA 4V26A 3CRKA 2IWUA 1R62A 5GGZA 3OMUA 4ASAA 3R4NA 4FPPA 2FWZA 1UYDA 4R3AA 2QFOA 2YEAA 1UYHA 3K60A 4NH7A 4HZ0A 3EHHA 3LPSA 1TILA 4JAUA 3CWVA 4EFUA 3A0ZA 3A0XA 3TZ2A 3INWA 4DUHA 1Y4SA 4CWQA 2O1UA 1BXDA 3GIFA 3GIEA 2XDUA 2YEIA 1MX0A 2XHRA 3K99A 4KSGA 3K98A 5M4NA 2YI5A 4PL9A 3HYZA 4LPBA 1UY6A 5FNDA 4XITA 3G7EA 1Y8NA 1H7SA 5FNFA 2QG0A 4AS9A 5F5RA 3RLRA 4CWTA 4MP2A 4LWEA 2BTZA 2E0AA 4CWNA 4O05A 2K5BA 4KP4A 3R91A 4YKTA 3EHGA 5J6AA 3MNRP 2Q8FA 4XCLA 3PEHA 4YKUA 4KSHA 1I59A 4EEHA 4B6CA 1NHJA 3INXA 4HYMA 4U93A 2FWYA 1TBWA 4CE3A 2YGAA 4JASA 4B7PA 5CPHA 3TZ5A 1YSZA 3EKOA 4KQVA 1UYKA 2YGEA 2CH4A 4URNA 4HY1A 3Q5LA 3WHAA 1TH8A 1I58A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FWK A;  1NHH A;  5C93 A;  3R92 A;  3B28 A;  3A0Y A;  4WUB A;  3Q5K A;  1YES A;  2WER A;  1YC4 A;  3LNU A;  4CWS A;  1YT1 A;  4CE2 A;  2YE4 A;  2CCT A;  4R1F A;  4WUD A;  2BU8 A;  4GT8 A;  3EHJ A;  2YKI A;  3T0H A;  1YET A;  3C11 A;  2BYH A;  2XCM A;  1MU5 A;  3RLP A;  1KZN A;  2XD6 A;  5D7R A;  5IDJ A;  2HCH A;  1KIJ A;  5FNC A;  2BSM A;  3TZ4 A;  3EKR A;  2XAB A;  3R4M A;  4YKX A;  4P7A A;  3D2R A;  2IWS A;  4FCQ A;  3A0T A;  4CWR A;  2XX2 A;  4E02 A;  4HYP A;  2JJC A;  3HYY A;  4MP7 A;  4ASF A;  2XJJ A;  2YE6 A;  3EHF A;  3JZ3 A;  5M4P A;  3T2S A;  4YKY A;  1BYQ A;  2YEG A;  2YEF A;  4GCZ A;  4LWG A;  5L3J A;  4LWI A;  2ZDX A;  2YEE A;  1UYM A;  4PRV A;  4XKO A;  3OWB A;  2YK2 A;  3HZ5 A;  4QPK A;  1AH8 A;  4L90 A;  4URO A;  2WI7 A;  4L8Z A;  1YT0 A;  3RKZ A;  3BMY A;  3WQ9 A;  3QTF A;  3Q5J A;  3H80 A;  2YKJ A;  3G7B A;  2BYI A;  3R4O A;  2H8M A;  3T0Z A;  2ZDY A;  3TTZ A;  1JM6 A;  2BT0 A;  3FT5 A;  1UYG A;  1TID A;  5J71 A;  4DZY A;  1AMW A;  2EXL A;  2O1V A;  2Q2E B;  1TC6 A;  2IOP A;  4CWO A;  2YEJ A;  3K97 A;  3ZKB A;  2WI6 A;  4YKW A;  4O04 A;  4YKQ A;  1B62 A;  4I3H A;  1BKN A;  3OPD A;  4XTJ A;  2O1W A;  4H85 A;  2Q8G A;  2XX5 A;  3O6O A;  2XDX A;  4EM7 A;  4E01 A;  3OW6 A;  2YI6 A;  5F3K A;  2YE8 A;  1UYI A;  2YEB A;  5IN9 A;  1Y8O A;  1UYF A;  4XKA A;  5CF0 A;  2CCS A;  4K4O A;  4NH8 A;  3VHC A;  2IOR A;  2ESA A;  4Q20 A;  4BXI A;  4BQJ A;  3T1K A;  4CWP A;  4XIQ A;  1EI1 A;  2BU6 A;  1QYE A;  1ZXM A;  4BQG A;  4BIU A;  3NMQ A;  1EA6 A;  3VHD A;  2WI1 A;  3T10 A;  3CRL A;  1U2O A;  1NHI A;  1THN A;  3C0E A;  4AWO A;  4E00 A;  1YSR A;  4EGH A;  1AM1 A;  3FT8 A;  2IWX A;  4GEE A;  5IDM A;  1B63 A;  2AKP A;  4PRX A;  3B25 A;  1ZW9 A;  1YS3 A;  4L91 A;  2WI3 A;  1S16 A;  1UY9 A;  3RLQ A;  2JKI A;  2VCI A;  2BRE A;  5CTW A;  1I5B A;  2FYP A;  1Z59 A;  2CG9 A;  2QF6 A;  4CWF A;  4H81 A;  2WEP A;  1U0Z A;  3H4L A;  2BU5 A;  3GIG B;  2YJW A;  3D36 A;  4JQL A;  2YI0 A;  2Q8I A;  3SL2 A;  5M4K A;  3ZXQ A;  4NH9 A;  4KTN A;  4WUC A;  4EGI A;  1US7 A;  4GFN A;  3ZKD A;  3A0W A;  1GKZ A;  4XD8 A;  3U2K A;  3HHU A;  1ZXN A;  2UWD A;  2H55 A;  2YI7 A;  4X9L A;  4ASB A;  4BAE A;  4FMT A;  5D6P A;  1A4H A;  4O09 A;  4FCR A;  1Y8P A;  2XJG A;  2FXS A;  2XDS A;  4XC0 A;  1BGQ A;  2CCU A;  5M4M A;  4BIZ A;  1GKX A;  4MPE A;  1UYC A;  2BZ5 A;  3VAD A;  1ZWH A;  3U2D A;  2XK2 A;  1Z5A A;  2VCJ A;  1YT2 A;  2YE9 A;  4MOT A;  4L94 A;  3ZXO A;  1UY8 A;  2C2A A;  4LWF A;  2HKJ A;  1H7U A;  4U7O A;  4YKZ A;  1GJV A;  1S14 A;  2XX4 A;  3IED A;  4JAV A;  2XHT A;  3O2F A;  4XIP A;  4YKR A;  3A0R A;  3HZ1 A;  3O0I A;  2WI2 A;  2QG2 A;  2YED A;  4XDM A;  1UYL A;  3B27 A;  4I5S A;  2YJX A;  5D6Q A;  2PNR A;  2XHX A;  1YER A;  4URL A;  2HG1 A;  3PEJ A;  3D0B A;  2BU7 A;  4LP0 A;  2XDL A;  3HEK A;  5BOC A;  2YEH A;  3U67 A;  2BU2 A;  4XE2 A;  1UY7 A;  3CGZ A;  4XCJ A;  4EFT A;  2BRC A;  2YK9 A;  4ASG A;  4L93 A;  4V25 A;  1L0O A;  4EMV A;  3VHA A;  2YE2 A;  4AWQ A;  5BOD A;  1YC3 A;  5D7D A;  2YE5 A;  4MB9 A;  1AJ6 A;  4W7T A;  3QDD A;  4MPC A;  4MPN A;  4HZ5 A;  2ZKJ A;  1TC0 A;  3G75 A;  1PVG A;  1UYE A;  1QZR A;  4MBC A;  3R4P A;  2IOQ A;  2YKC A;  2WI5 A;  4LWH A;  3OWD A;  3DGE A;  3CGY A;  4GGL A;  4CE1 A;  2VW5 A;  4KFG A;  4URM A;  4AWP A;  1Y4U A;  3TZ0 A;  4R3M A;  4QPJ A;  4HXW A;  3FV5 A;  5D7C A;  2YKE A;  1AH6 A;  2YE3 A;  2YE7 A;  4FCP A;  1QY8 A;  5CTY A;  5M4H A;  2WI4 A;  1ID0 A;  2ZBK B;  4XKK A;  3B26 A;  4PU9 A;  3TUH A;  2GFD A;  3GIG A;  2XJX A;  4U7N A;  4ZVI A;  3BM9 A;  2XDK A;  4GQT A;  4ZKI A;  2Q8H A;  5CTU A;  4H7Q A;  4O07 A;  3ZM7 A;  4HY6 A;  1YC1 A;  5M4E A;  2VWC A;  2YGF A;  4P8O A;  1I5D A;  2WEQ A;  5CTX A;  1I5C A;  2YKB A;  1Z5B A;  2GQP A;  2YEC A;  1Z5C A;  3KE6 A;  4XIR A;  4EGK A;  1OSF A;  1I5A A;  2CGF A;  3B24 A;  1B3Q A;  4HXZ A;  4O0B A;  4V26 A;  3CRK A;  2IWU A;  1R62 A;  5GGZ A;  3OMU A;  4ASA A;  3R4N A;  4FPP A;  2FWZ A;  1UYD A;  4R3A A;  2QFO A;  2YEA A;  1UYH A;  3K60 A;  4NH7 A;  4HZ0 A;  3EHH A;  3LPS A;  1TIL A;  4JAU A;  3CWV A;  4EFU A;  3A0Z A;  3A0X A;  3TZ2 A;  3INW A;  4DUH A;  1Y4S A;  4CWQ A;  2O1U A;  1BXD A;  3GIF A;  3GIE A;  2XDU A;  2YEI A;  1MX0 A;  2XHR A;  3K99 A;  4KSG A;  3K98 A;  5M4N A;  2YI5 A;  4PL9 A;  3HYZ A;  4LPB A;  1UY6 A;  5FND A;  4XIT A;  3G7E A;  1Y8N A;  1H7S A;  5FNF A;  2QG0 A;  4AS9 A;  5F5R A;  3RLR A;  4CWT A;  4MP2 A;  4LWE A;  2BTZ A;  2E0A A;  4CWN A;  4O05 A;  2K5B A;  4KP4 A;  3R91 A;  4YKT A;  3EHG A;  5J6A A;  3MNR P;  2Q8F A;  4XCL A;  3PEH A;  4YKU A;  4KSH A;  1I59 A;  4EEH A;  4B6C A;  1NHJ A;  3INX A;  4HYM A;  4U93 A;  2FWY A;  1TBW A;  4CE3 A;  2YGA A;  4JAS A;  4B7P A;  5CPH A;  3TZ5 A;  1YSZ A;  3EKO A;  4KQV A;  1UYK A;  2YGE A;  2CH4 A;  4URN A;  4HY1 A;  3Q5L A;  3WHA A;  1TH8 A;  1I58 A; 
#chains in the Genus database with same CATH topology
 5FWK A;  1NHH A;  5C93 A;  3R92 A;  3B28 A;  3A0Y A;  4WUB A;  3Q5K A;  1YES A;  2WER A;  1YC4 A;  3LNU A;  4CWS A;  1YT1 A;  4CE2 A;  2YE4 A;  2CCT A;  4R1F A;  4WUD A;  2BU8 A;  4GT8 A;  3EHJ A;  3S5T A;  2YKI A;  3T0H A;  1YET A;  3C11 A;  2BYH A;  2XCM A;  1MU5 A;  3RLP A;  1KZN A;  2XD6 A;  5D7R A;  5IDJ A;  2HCH A;  1KIJ A;  5FNC A;  2BSM A;  3TZ4 A;  3EKR A;  2XAB A;  3R4M A;  4YKX A;  4P7A A;  3D2R A;  2IWS A;  4FCQ A;  3A0T A;  4CWR A;  2XX2 A;  4E02 A;  4HYP A;  2JJC A;  3HYY A;  4MP7 A;  4ASF A;  2XJJ A;  2YE6 A;  3EHF A;  3JZ3 A;  5M4P A;  3T2S A;  4YKY A;  1BYQ A;  2YEG A;  2YEF A;  4GCZ A;  4LWG A;  5L3J A;  4LWI A;  2ZDX A;  2YEE A;  1UYM A;  4PRV A;  4XKO A;  3OWB A;  2YK2 A;  3HZ5 A;  4QPK A;  1AH8 A;  4L90 A;  4URO A;  2WI7 A;  4L8Z A;  1YT0 A;  3RKZ A;  3BMY A;  3WQ9 A;  3QTF A;  3Q5J A;  3H80 A;  2YKJ A;  3G7B A;  2BYI A;  3R4O A;  2H8M A;  3T0Z A;  2ZDY A;  3TTZ A;  1JM6 A;  2BT0 A;  3FT5 A;  1UYG A;  1TID A;  5J71 A;  4DZY A;  1AMW A;  1IXM A;  2EXL A;  2O1V A;  2Q2E B;  1TC6 A;  2IOP A;  4CWO A;  2YEJ A;  3K97 A;  3ZKB A;  2WI6 A;  4YKW A;  4O04 A;  4YKQ A;  1B62 A;  4I3H A;  1BKN A;  3OPD A;  4XTJ A;  2O1W A;  4H85 A;  2Q8G A;  2XX5 A;  3O6O A;  2XDX A;  4EM7 A;  4E01 A;  3OW6 A;  2YI6 A;  5F3K A;  2YE8 A;  1UYI A;  2YEB A;  5IN9 A;  1Y8O A;  1UYF A;  4XKA A;  5CF0 A;  2CCS A;  4K4O A;  4NH8 A;  3VHC A;  2IOR A;  2ESA A;  4Q20 A;  4BXI A;  4BQJ A;  3T1K A;  4CWP A;  4XIQ A;  1EI1 A;  2BU6 A;  1QYE A;  1ZXM A;  4BQG A;  2C1G A;  4BIU A;  3NMQ A;  1EA6 A;  3VHD A;  5JEN A;  2WI1 A;  3T10 A;  3CRL A;  1U2O A;  1NHI A;  1THN A;  3C0E A;  4AWO A;  4E00 A;  1YSR A;  4EGH A;  1AM1 A;  3FT8 A;  2IWX A;  4GEE A;  5IDM A;  1B63 A;  2AKP A;  4PRX A;  3B25 A;  1ZW9 A;  1YS3 A;  4L91 A;  2WI3 A;  1S16 A;  1UY9 A;  3RLQ A;  2JKI A;  2VCI A;  2BRE A;  5CTW A;  1I5B A;  2FYP A;  1Z59 A;  2CG9 A;  2QF6 A;  4CWF A;  4H81 A;  2WEP A;  1U0Z A;  3H4L A;  2BU5 A;  3GIG B;  2YJW A;  3D36 A;  4JQL A;  2YI0 A;  2Q8I A;  3SL2 A;  5M4K A;  3ZXQ A;  4NH9 A;  4KTN A;  4WUC A;  4EGI A;  1US7 A;  4GFN A;  3ZKD A;  3A0W A;  1GKZ A;  4XD8 A;  3U2K A;  4E72 A;  3HHU A;  1ZXN A;  2UWD A;  2H55 A;  2YI7 A;  4X9L A;  4ASB A;  4BAE A;  2C1I A;  4FMT A;  5D6P A;  1A4H A;  4O09 A;  3LMM A;  4FCR A;  1Y8P A;  2XJG A;  2FXS A;  2XDS A;  4XC0 A;  1BGQ A;  2CCU A;  5M4M A;  4BIZ A;  1GKX A;  2FTK A;  4MPE A;  1UYC A;  2BZ5 A;  3VAD A;  1ZWH A;  3U2D A;  2XK2 A;  1Z5A A;  2VCJ A;  1YT2 A;  2YE9 A;  4MOT A;  4L94 A;  3ZXO A;  1UY8 A;  2C2A A;  4LWF A;  2HKJ A;  1F51 A;  1H7U A;  4U7O A;  4YKZ A;  1GJV A;  1S14 A;  2XX4 A;  3IED A;  4JAV A;  2XHT A;  3O2F A;  4XIP A;  4YKR A;  3A0R A;  3HZ1 A;  3O0I A;  2WI2 A;  2QG2 A;  2YED A;  4XDM A;  1UYL A;  3B27 A;  4I5S A;  2YJX A;  5D6Q A;  2PNR A;  2XHX A;  1YER A;  4URL A;  2HG1 A;  3PEJ A;  3D0B A;  2BU7 A;  4LP0 A;  2XDL A;  3HEK A;  5BOC A;  2YEH A;  3U67 A;  2BU2 A;  4XE2 A;  1UY7 A;  3CGZ A;  4XCJ A;  4EFT A;  2BRC A;  2YK9 A;  4ASG A;  4L93 A;  4V25 A;  1L0O A;  4EMV A;  3VHA A;  2HHI A;  2YE2 A;  4AWQ A;  5BOD A;  1YC3 A;  5D7D A;  2YE5 A;  4MB9 A;  1AJ6 A;  4W7T A;  3QDD A;  4MPC A;  4MPN A;  4HZ5 A;  2ZKJ A;  1TC0 A;  3G75 A;  1PVG A;  1UYE A;  1QZR A;  4MBC A;  3R4P A;  2IOQ A;  2YKC A;  2WI5 A;  4LWH A;  3OWD A;  3DGE A;  3CGY A;  4GGL A;  4CE1 A;  2VW5 A;  4KFG A;  4URM A;  4AWP A;  1Y4U A;  3TZ0 A;  4R3M A;  4QPJ A;  4HXW A;  3FV5 A;  5D7C A;  2YKE A;  1AH6 A;  2YE3 A;  2YE7 A;  4FCP A;  1QY8 A;  5CTY A;  5M4H A;  2WI4 A;  1ID0 A;  2ZBK B;  4XKK A;  3B26 A;  4PU9 A;  3TUH A;  2GFD A;  3GIG A;  2XJX A;  4U7N A;  4ZVI A;  3BM9 A;  2XDK A;  4GQT A;  4ZKI A;  2Q8H A;  5CTU A;  4H7Q A;  4O07 A;  3ZM7 A;  4HY6 A;  1YC1 A;  5M4E A;  2VWC A;  2YGF A;  4P8O A;  1I5D A;  2WEQ A;  5CTX A;  1I5C A;  2YKB A;  1Z5B A;  2GQP A;  2YEC A;  1Z5C A;  3KE6 A;  4XIR A;  4EGK A;  1OSF A;  1I5A A;  2CGF A;  3B24 A;  1B3Q A;  4HXZ A;  4O0B A;  4V26 A;  3CRK A;  2IWU A;  3CYG A;  1R62 A;  5GGZ A;  3OMU A;  4ASA A;  3R4N A;  4FPP A;  2FWZ A;  1UYD A;  4R3A A;  2QFO A;  2YEA A;  1UYH A;  3K60 A;  4NH7 A;  4HZ0 A;  3EHH A;  3LPS A;  1TIL A;  4JAU A;  3CWV A;  4EFU A;  3A0Z A;  3A0X A;  3TZ2 A;  3INW A;  4DUH A;  1Y4S A;  4CWQ A;  2O1U A;  1BXD A;  3GIF A;  3GIE A;  2XDU A;  2YEI A;  1MX0 A;  2XHR A;  3K99 A;  4KSG A;  3K98 A;  5M4N A;  2YI5 A;  4PL9 A;  3HYZ A;  4LPB A;  1UY6 A;  5FND A;  4XIT A;  3G7E A;  1Y8N A;  1H7S A;  5FNF A;  2QG0 A;  4AS9 A;  5F5R A;  3RLR A;  4CWT A;  4MP2 A;  4LWE A;  2BTZ A;  2E0A A;  4CWN A;  4O05 A;  2K5B A;  4KP4 A;  3R91 A;  4YKT A;  3EHG A;  5J6A A;  3MNR P;  2Q8F A;  4XCL A;  3PEH A;  4YKU A;  4KSH A;  1I59 A;  4EEH A;  4B6C A;  1NHJ A;  3INX A;  4HYM A;  4U93 A;  2FWY A;  1TBW A;  4CE3 A;  2YGA A;  4JAS A;  4B7P A;  5CPH A;  3TZ5 A;  1YSZ A;  3EKO A;  4KQV A;  1UYK A;  2YGE A;  2CH4 A;  4URN A;  4HY1 A;  3Q5L A;  3WHA A;  1TH8 A;  1I58 A; 
#chains in the Genus database with same CATH homology
 5FWK A;  1NHH A;  5C93 A;  3R92 A;  3B28 A;  3A0Y A;  4WUB A;  3Q5K A;  1YES A;  2WER A;  1YC4 A;  3LNU A;  4CWS A;  1YT1 A;  4CE2 A;  2YE4 A;  2CCT A;  4R1F A;  4WUD A;  2BU8 A;  4GT8 A;  3EHJ A;  2YKI A;  3T0H A;  1YET A;  3C11 A;  2BYH A;  2XCM A;  1MU5 A;  3RLP A;  1KZN A;  2XD6 A;  5D7R A;  5IDJ A;  2HCH A;  1KIJ A;  5FNC A;  2BSM A;  3TZ4 A;  3EKR A;  2XAB A;  3R4M A;  4YKX A;  4P7A A;  3D2R A;  2IWS A;  4FCQ A;  3A0T A;  4CWR A;  2XX2 A;  4E02 A;  4HYP A;  2JJC A;  3HYY A;  4MP7 A;  4ASF A;  2XJJ A;  2YE6 A;  3EHF A;  3JZ3 A;  5M4P A;  3T2S A;  4YKY A;  1BYQ A;  2YEG A;  2YEF A;  4GCZ A;  4LWG A;  5L3J A;  4LWI A;  2ZDX A;  2YEE A;  1UYM A;  4PRV A;  4XKO A;  3OWB A;  2YK2 A;  3HZ5 A;  4QPK A;  1AH8 A;  4L90 A;  4URO A;  2WI7 A;  4L8Z A;  1YT0 A;  3RKZ A;  3BMY A;  3WQ9 A;  3QTF A;  3Q5J A;  3H80 A;  2YKJ A;  3G7B A;  2BYI A;  3R4O A;  2H8M A;  3T0Z A;  2ZDY A;  3TTZ A;  1JM6 A;  2BT0 A;  3FT5 A;  1UYG A;  1TID A;  5J71 A;  4DZY A;  1AMW A;  2EXL A;  2O1V A;  2Q2E B;  1TC6 A;  2IOP A;  4CWO A;  2YEJ A;  3K97 A;  3ZKB A;  2WI6 A;  4YKW A;  4O04 A;  4YKQ A;  1B62 A;  4I3H A;  1BKN A;  3OPD A;  4XTJ A;  2O1W A;  4H85 A;  2Q8G A;  2XX5 A;  3O6O A;  2XDX A;  4EM7 A;  4E01 A;  3OW6 A;  2YI6 A;  5F3K A;  2YE8 A;  1UYI A;  2YEB A;  5IN9 A;  1Y8O A;  1UYF A;  4XKA A;  5CF0 A;  2CCS A;  4K4O A;  4NH8 A;  3VHC A;  2IOR A;  2ESA A;  4Q20 A;  4BXI A;  4BQJ A;  3T1K A;  4CWP A;  4XIQ A;  1EI1 A;  2BU6 A;  1QYE A;  1ZXM A;  4BQG A;  4BIU A;  3NMQ A;  1EA6 A;  3VHD A;  2WI1 A;  3T10 A;  3CRL A;  1U2O A;  1NHI A;  1THN A;  3C0E A;  4AWO A;  4E00 A;  1YSR A;  4EGH A;  1AM1 A;  3FT8 A;  2IWX A;  4GEE A;  5IDM A;  1B63 A;  2AKP A;  4PRX A;  3B25 A;  1ZW9 A;  1YS3 A;  4L91 A;  2WI3 A;  1S16 A;  1UY9 A;  3RLQ A;  2JKI A;  2VCI A;  2BRE A;  5CTW A;  1I5B A;  2FYP A;  1Z59 A;  2CG9 A;  2QF6 A;  4CWF A;  4H81 A;  2WEP A;  1U0Z A;  3H4L A;  2BU5 A;  3GIG B;  2YJW A;  3D36 A;  4JQL A;  2YI0 A;  2Q8I A;  3SL2 A;  5M4K A;  3ZXQ A;  4NH9 A;  4KTN A;  4WUC A;  4EGI A;  1US7 A;  4GFN A;  3ZKD A;  3A0W A;  1GKZ A;  4XD8 A;  3U2K A;  3HHU A;  1ZXN A;  2UWD A;  2H55 A;  2YI7 A;  4X9L A;  4ASB A;  4BAE A;  4FMT A;  5D6P A;  1A4H A;  4O09 A;  4FCR A;  1Y8P A;  2XJG A;  2FXS A;  2XDS A;  4XC0 A;  1BGQ A;  2CCU A;  5M4M A;  4BIZ A;  1GKX A;  4MPE A;  1UYC A;  2BZ5 A;  3VAD A;  1ZWH A;  3U2D A;  2XK2 A;  1Z5A A;  2VCJ A;  1YT2 A;  2YE9 A;  4MOT A;  4L94 A;  3ZXO A;  1UY8 A;  2C2A A;  4LWF A;  2HKJ A;  1H7U A;  4U7O A;  4YKZ A;  1GJV A;  1S14 A;  2XX4 A;  3IED A;  4JAV A;  2XHT A;  3O2F A;  4XIP A;  4YKR A;  3A0R A;  3HZ1 A;  3O0I A;  2WI2 A;  2QG2 A;  2YED A;  4XDM A;  1UYL A;  3B27 A;  4I5S A;  2YJX A;  5D6Q A;  2PNR A;  2XHX A;  1YER A;  4URL A;  2HG1 A;  3PEJ A;  3D0B A;  2BU7 A;  4LP0 A;  2XDL A;  3HEK A;  5BOC A;  2YEH A;  3U67 A;  2BU2 A;  4XE2 A;  1UY7 A;  3CGZ A;  4XCJ A;  4EFT A;  2BRC A;  2YK9 A;  4ASG A;  4L93 A;  4V25 A;  1L0O A;  4EMV A;  3VHA A;  2YE2 A;  4AWQ A;  5BOD A;  1YC3 A;  5D7D A;  2YE5 A;  4MB9 A;  1AJ6 A;  4W7T A;  3QDD A;  4MPC A;  4MPN A;  4HZ5 A;  2ZKJ A;  1TC0 A;  3G75 A;  1PVG A;  1UYE A;  1QZR A;  4MBC A;  3R4P A;  2IOQ A;  2YKC A;  2WI5 A;  4LWH A;  3OWD A;  3DGE A;  3CGY A;  4GGL A;  4CE1 A;  2VW5 A;  4KFG A;  4URM A;  4AWP A;  1Y4U A;  3TZ0 A;  4R3M A;  4QPJ A;  4HXW A;  3FV5 A;  5D7C A;  2YKE A;  1AH6 A;  2YE3 A;  2YE7 A;  4FCP A;  1QY8 A;  5CTY A;  5M4H A;  2WI4 A;  1ID0 A;  2ZBK B;  4XKK A;  3B26 A;  4PU9 A;  3TUH A;  2GFD A;  3GIG A;  2XJX A;  4U7N A;  4ZVI A;  3BM9 A;  2XDK A;  4GQT A;  4ZKI A;  2Q8H A;  5CTU A;  4H7Q A;  4O07 A;  3ZM7 A;  4HY6 A;  1YC1 A;  5M4E A;  2VWC A;  2YGF A;  4P8O A;  1I5D A;  2WEQ A;  5CTX A;  1I5C A;  2YKB A;  1Z5B A;  2GQP A;  2YEC A;  1Z5C A;  3KE6 A;  4XIR A;  4EGK A;  1OSF A;  1I5A A;  2CGF A;  3B24 A;  1B3Q A;  4HXZ A;  4O0B A;  4V26 A;  3CRK A;  2IWU A;  1R62 A;  5GGZ A;  3OMU A;  4ASA A;  3R4N A;  4FPP A;  2FWZ A;  1UYD A;  4R3A A;  2QFO A;  2YEA A;  1UYH A;  3K60 A;  4NH7 A;  4HZ0 A;  3EHH A;  3LPS A;  1TIL A;  4JAU A;  3CWV A;  4EFU A;  3A0Z A;  3A0X A;  3TZ2 A;  3INW A;  4DUH A;  1Y4S A;  4CWQ A;  2O1U A;  1BXD A;  3GIF A;  3GIE A;  2XDU A;  2YEI A;  1MX0 A;  2XHR A;  3K99 A;  4KSG A;  3K98 A;  5M4N A;  2YI5 A;  4PL9 A;  3HYZ A;  4LPB A;  1UY6 A;  5FND A;  4XIT A;  3G7E A;  1Y8N A;  1H7S A;  5FNF A;  2QG0 A;  4AS9 A;  5F5R A;  3RLR A;  4CWT A;  4MP2 A;  4LWE A;  2BTZ A;  2E0A A;  4CWN A;  4O05 A;  2K5B A;  4KP4 A;  3R91 A;  4YKT A;  3EHG A;  5J6A A;  3MNR P;  2Q8F A;  4XCL A;  3PEH A;  4YKU A;  4KSH A;  1I59 A;  4EEH A;  4B6C A;  1NHJ A;  3INX A;  4HYM A;  4U93 A;  2FWY A;  1TBW A;  4CE3 A;  2YGA A;  4JAS A;  4B7P A;  5CPH A;  3TZ5 A;  1YSZ A;  3EKO A;  4KQV A;  1UYK A;  2YGE A;  2CH4 A;  4URN A;  4HY1 A;  3Q5L A;  3WHA A;  1TH8 A;  1I58 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...