3CYGA

Crystal structure of an uncharacterized protein from fervidobacterium nodosum rt17-b1
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
215
structure length
215
Chain Sequence
LRMKVFEIVKSSTENEIVRIHVELPRLKYLKDSNFEEKFNSEVEEKIKKFVNEVKGIAQEDHDKDVQHTPYEAYVSVDVRYEGKDFLSFVVYYYQFTGGAHGITFFETYNIDLKNSKVLKLYDIIKEEAEDTIKSNILKQIEQNNTDFFPDAPMNILKDDIFSREFTISKDGLIIMYPHYDLAPYASGMPEFVIPWNVIEKFLKYDILSLLKEGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein
publication title Crystal structure of an uncharacterized protein from Fervidobacterium nodosum Rt17-B1.
rcsb
source organism Fervidobacterium nodosum rt17-b1
total genus 56
structure length 215
sequence length 215
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11738 DUF3298 Protein of unknown function (DUF3298)
A PF13739 PdaC Deacetylase PdaC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.40 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Fervidobacterium nodosum Rt17-B1 like 3cygA01
3.90.640.20 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Heat-shock cognate protein, ATPase 3cygA02
5JENA 4E72A 3CYGA 3S5TA 2HHIA
chains in the Genus database with same CATH superfamily
2C1GA 1E4GT 5FNFA 4B1UB 1E4FT 3U4LA 4BE7B 5M4PA 5AQXA 4KFGA 2XX5A 3EKSA 1IXMA 4JASA 4WUBA 2A40A 4JHDA 4H7QA 4E01A 4CZLA 2XHTA 1NGBA 2C2AA 1YT2A 4XIPA 3A5MC 5F3KA 2QWOA 2YE3A 3INWA 1ESVA 4HYPA 2P9UB 1S16A 3D2EA 3A0YA 3D36A 5JENA 2YI7A 3HZ1A 3A0XA 3MNRP 4CWSA 1DEJA 3OPDA 5L3JA 2WI2A 5M4KA 1YSRA 2VWCA 4CWPA 3FZLA 5FNCA 3O2FA 3TZ5A 1KAYA 1MA9B 2BTZA 2YJWA 5IDJA 3EL2A 1JM6A 1PVGA 3A5OC 4CZMA 4LWHA 1NGGA 3C7NA 4K4OA 5TKYA 3DXKB 1S3XA 3A0WA 1YT0A 4V26A 4O09A 3SL2A 1GJVA 2WI3A 2BU5A 3WEEB 2D1KA 2XD6A 3LDOA 5AQZA 4CZKA 1EI1A 2P9KB 3EHHA 1UYFA 4L8ZA 2Q8FA 1RFQA 4CI6A 1TC0A 4EEHA 2YJEA 2YEBA 4YKRA 3K99A 3OW6A 2HCHA 2GWKA 1ZXNA 3Q5KA 4MP2A 4H0XB 2PAVA 3G7EA 4XEIA 4L93A 2EXLA 1I5AA 4FL9A 1BKNA 5CE3A 4E02A 4H5TA 4XKKA 2CGFA 2XDSA 4CZHA 2FF3B 4KSGA 2GFDA 4MPNA 4U93A 3Q5JA 1BYQA 3GIGB 4AWPA 5D6QA 4B1WB 1H7UA 1LCUA 3DWLA 1QZ6A 3TPQA 2Q36A 2KHOA 2BU7A 2WI4A 2Q8GA 3U2DA 1NGIA 4URMA 3A5LC 5E84A 3LPSA 3FT8A 3BM9A 1UYMA 3GIEA 4H5WA 3QDDA 3M1FA 5AQVA 3WHAA 1NGCA 2YEEA 4JHDB 3QB0A 2O1WA 5FNDA 4MB9A 4KSHA 2PNRA 3FV5A 2HKJA 4YKQA 4CE2A 2YI5A 5M4NA 4BAEA 4EFHA 1UY7A 2YGEA 4XJXA 4MP7A 4ZVIA 3RLRA 5BN9A 1U2OA 4KP4A 3SJHA 5BPLA 4H5VA 1F51A 3CWVA 4CWQA 3R4PA 5D7CA 2PBDA 4JD2A 5IDMA 1XQSC 4R3AA 4I3HA 1Y4UA 2XJJA 4W7TA 1UY6A 2QG2A 4ASGA 3EKUA 2IWXA 1S14A 4E72A 1KAZA 1NGAA 4GCZA 3GL1A 2BRCA 1AMWA 5BOCA 3C7NB 3U9ZA 3TTZA 1BA0A 4B1YB 1I59A 2QWNA 3PEHA 3QMLA 4LP0A 3CYGA 4QPJA 2WUSA 2P9KA 5J6AA 5D7DA 3B25A 4B6CA 5C93A 2QW9A 3K60A 3MMVA 5AQJA 2H55A 1C0GA 4XKAA 2XDXA 3C0EA 3KVGA 1I5DA 4JN4A 5D6PA 3C11A 4YKXA 2WERA 2VCPA 1NGDA 2XX4A 1T44A 2ESAA 2HHIA 4FO0A 4CZGA 2VCJA 2XJXA 3JXUA 3A0ZA 5FWKA 5AQGA 2W00A 4HXZA 2Q8IA 1TC6A 3DXMB 3LDNA 1Y64A 4AM6A 1I58A 2YEDA 2YKBA 3RLQA 3O0IA 2Q8HA 3H80A 1YAGA 4XCJA 1B62A 4EFUA 2CH4A 2V7ZA 4O05A 3CJCA 1YERA 4WUCA 3B28A 1MDUB 3CQXA 2YEGA 4FSVA 2P9IB 3CGZA 4FPPA 2YI6A 2V7YA 1I5CA 2XABA 4CWFA 1KIJA 4PL9A 2CCUA 4LWEA 3RLPA 2YJXA 2QWPA 1UYCA 3FZHA 4KBOA 3W3DA 2QXLA 4CZIA 2ZBKB 4BIUA 3O6OA 5AQKA 1TBWA 4CBWA 1IJJA 4EM7A 2Q2EB 5I9EB 4H0VB 2FXSA 5CTUA 5AQUA 1NLVA 5AQOA 4JD2B 4E00A 5EVZA 2CG9A 3LNUA 2BU2A 4EGIA 2AKPA 4BQJA 3D2RA 3ZKDA 4P7AA 1YUWA 3CJBA 2YEHA 5CF0A 3R4MA 3HYYA 1TIDA 3PEJA 2XHXA 1SQKA 1H7SA 1P8ZA 2ASMA 1NHHA 2YK2A 2P9SA 4U7NA 3R4NA 3UB5A 5AFUA 3IUCA 2JJCA 3EKRA 1NHIA 1ID0A 3H4LA 2V52B 1C0FA 2QG0A 3INXA 4BQGA 4Z94A 2IOPA 3KE6A 2H8MA 1H1VA 4CZEA 1QQMA 1HX1A 3QTFA 3T0HA 4PL8A 1AM1A 3DXMA 1WUAA 5CTXA 5AQNA 2YJFA 1UYGA 4WYBA 3VADA 1NMDA 5JLFA 2QFOA 1ZW9A 1MU5A 4ASFA 1THNA 4L94A 4HZ0A 4GEEA 2QF6A 4PU9A 4XIQA 4A2BA 1YT1A 3U67A 4K42A 3I33A 3T1KA 1BA1A 2V51B 4H0YB 2YEJA 4CWTA 2P9IA 4CWOA 2YE6A 5AQIA 2QWLA 1QQOA 1EA6A 4P8OA 5FPDA 4GY2B 5ADXH 3K97A 2XCMA 4B7PA 3B26A 4H85A 1NGHA 2BTFA 2ASOA 5FPMA 3B24A 4URLA 2Q1NA 5F2RA 3TZ2A 2YE7A 4EAHD 3U2KA 4BXIA 1AH6A 5AQWA 3CI5A 4XC0A 1AJ6A 3VHCA 1Z59A 1ATNA 3NMQA 4HYMA 4MBCA 1HJOA 2VYPA 2IWSA 1UYIA 5EY4A 2BYIA 4O0BA 4I5SA 3OWDA 3IEDA 4DUHA 3T0ZA 3U9DA 4CBUA 3EHGA 4Q20A 5CPHA 4GQTA 1TILA 2P9SB 4B1ZA 3AY9A 4CZFA 1NHJA 4CE1A 3ZXOA 4ASBA 4QPKA 5M4EA 1KAXA 4H5NA 3T10A 4XD8A 3DGEA 3TU5A 4L91A 3UKUB 1ZWHA 2WI1A 2YK9A 4O04A 4URNA 4CBXA 5BN8A 3RKZA 4WUDA 4XKOA 3L6QA 2A5XA 1NGFA 1UYEA 2FF6A 2WI7A 2IORA 4PRVA 3FFKB 3A0RA 4EGKA 3FZMA 5BPNA 2HF3A 3Q5LA 5IN9A 4K43A 1GKXA 2BU8A 4JAVA 3TZ4A 1B63A 4AWQA 2P9LA 2YEIA 2Q31A 1BUPA 4YKYA 2BZ5A 4NH7A 5F1XA 1YS3A 1YVNA 3FT5A 2YI0A 1GKZA 1OSFA 2P9PA 3MN5A 4J8FA 3ULEB 2IWUA 4LWGA 5EX5A 4PRXA 4RWTA 4LWFA 2QWQA 4BIZA 4H0TB 5J71A 3D2FB 1Y8NA 2FYPA 3CHWA 3FE1A 3T2SA 1YC4A 2VCIA 2YEFA 5AQTA 3G7BA 4FMTA 1YC1A 1QYEA 3TUHA 4R3MA 1BXDA 4CZJA 4PKIA 2XHRA 4XE2A 4YKTA 2YGAA 3EHJA 1A4HA 2ZDXA 4X9LA 4HZ5A 2OANA 5GGZA 2HMPA 1LOTB 5CTYA 4MOTA 2P9NA 2A41A 4JQLA 5AQYA 4CWNA 4H5RA 3HZ5A 3UKRA 2XJGA 4R1FA 1Z5AA 2BSMA 4HXWA 3ZKBA 2O1UA 2XDUA 3BMYA 4L90A 1YESA 1NWKA 3U8XA 5F0XA 1D4XA 2E88A 1TYQB 4RTFD 3MN6A 5CTWA 1Z5CA 4KTNA 1ATRA 2WI5A 1DKGD 5FPNA 3EKOA 4CWRA 2ZWHA 3EHFA 2QWRA 2C1IA 1J6ZA 3R91A 4AWOA 5M4HA 2YKJA 2YECA 3UKUA 4EMVA 2FTKA 3MN7A 5AQRA 5EXWA 2E8AA 4FCRA 2Q0UA 4I6MB 2CCTA 3CRLA 2QWMA 1Y8OA 4HY1A 3S5TA 2E0AA 4K41A 2CCSA 2YKIA 4YKZA 1UY9A 2ZKJA 1Z5BA 4GT8A 2P9LB 2FWYA 4U7OA 3RSEA 4B1VA 1QQNA 3HEKA 3ULEA 2BREA 3LDPA 1AH8A 5F5RA 4JNEA 2P9PB 2A42A 2O1VA 4EGHA 3D2FA 2YE9A 1JCEA 4ASAA 2GQPA 1S22A 1U2VA 4XTJA 4YKUA 4DZYA 4XCLA 3ATUA 4H03B 3R4OA 3GIFA 1K8KA 1YETA 4UROA 2XDKA 4XDMA 5AQPA 1UYLA 2XK2A 3LDQA 4PKGA 1JCGA 4YKWA 3QFUA 1BGQA 1UYDA 3QFPA 2XX2A 4GNIA 2A3ZA 2UWDA 1NM1A 3K98A 2K5BA 2VW5A 4MPCA 2YE4A 1YXQA 2P9NB 3HHUA 4BEBA 2IOQA 4H81A 3UKRB 5AQHA 1RDWX 5D7RA 4MPEA 2BUPA 1UYKA 1TYQA 2YEAA 1QZRA 2YGFA 3G75A 3WQ9A 3VHAA 3VHDA 2ASPA 2P9UA 4BECA 5JLHA 4AS9A 4GGLA 4JAUA 1U0ZA 3DAWA 4B9QA 1ZXMA 5BPMA 1YSZA 3D2EB 1US7A 3FZFA 1KZNA 2FWZA 2WEPA 3FZKA 4V25A 3HSCA 4M63C 4I6MA 1NGJA 2HG1A 4O07A 3A5NC 4NH9A 5AQLA 2HF4A 1HLUA 2WI6A 4LWIA 5AR0A 3DXKA 4HY6A 4FCQA 5M4MA 2YKEA 2BU6A 1UY8A 2JKIA 3M6GA 5AQMA 3CGYA 1EQYA 1Y4SA 3UE5A 3A8YA 3WEEA 2XDLA 3ZXQA 1R62A 1MX0A 3R92A 4PKHA 4B1XB 4FCPA 3OMUA 1L0OA 1NGEA 5AFUH 4PL7A 3RSEB 3CIPA 5AQQA 1B3QA 3LMMA 1ATSA 2Q97A 4HWIA 4CE3A 4GFNA 4A2AA 3L4IA 1QZ5A 3A0TA 1YC3A 4KQVA 4LPBA 1I5BA 2WEQA 3GDQA 4NH8A 3BUZB 3TZ0A 4AM7A 1QY8A 1TH8A 1U2VB 3J8AA 2YE2A 1KXPA 4EFTA 1JCFA 3HYZA 1RGIA 5ADXA 4IO8A 1K8KB 5AQFA 5FPEA 2Q0RA 3HBTA 2FXUA 5BODA 3GIGA 5AQSA 3LDLA 2YE5A 2BYHA 4ZKIA 3JZ3A 3D0BA 2YKCA 3CRKA 3OWBA 3B27A 4XIRA 2ZDYA 2GWJA 3ATVA 3MN9A 1Y8PA 4XITA 1HPMA 3M3ZA 2YE8A 1UYHA 3ZM7A 2BT0A
chains in the Genus database with same CATH topology
5JENA 4E72A 3CYGA 3S5TA 2HHIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JEN A;  4E72 A;  3CYG A;  3S5T A;  2HHI A; 
#chains in the Genus database with same CATH topology
 2C1G A;  1E4G T;  5FNF A;  4B1U B;  1E4F T;  3U4L A;  4BE7 B;  5M4P A;  5AQX A;  4KFG A;  2XX5 A;  3EKS A;  1IXM A;  4JAS A;  4WUB A;  2A40 A;  4JHD A;  4H7Q A;  4E01 A;  4CZL A;  2XHT A;  1NGB A;  2C2A A;  1YT2 A;  4XIP A;  3A5M C;  5F3K A;  2QWO A;  2YE3 A;  3INW A;  1ESV A;  4HYP A;  2P9U B;  1S16 A;  3D2E A;  3A0Y A;  3D36 A;  5JEN A;  2YI7 A;  3HZ1 A;  3A0X A;  3MNR P;  4CWS A;  1DEJ A;  3OPD A;  5L3J A;  2WI2 A;  5M4K A;  1YSR A;  2VWC A;  4CWP A;  3FZL A;  5FNC A;  3O2F A;  3TZ5 A;  1KAY A;  1MA9 B;  2BTZ A;  2YJW A;  5IDJ A;  3EL2 A;  1JM6 A;  1PVG A;  3A5O C;  4CZM A;  4LWH A;  1NGG A;  3C7N A;  4K4O A;  5TKY A;  3DXK B;  1S3X A;  3A0W A;  1YT0 A;  4V26 A;  4O09 A;  3SL2 A;  1GJV A;  2WI3 A;  2BU5 A;  3WEE B;  2D1K A;  2XD6 A;  3LDO A;  5AQZ A;  4CZK A;  1EI1 A;  2P9K B;  3EHH A;  1UYF A;  4L8Z A;  2Q8F A;  1RFQ A;  4CI6 A;  1TC0 A;  4EEH A;  2YJE A;  2YEB A;  4YKR A;  3K99 A;  3OW6 A;  2HCH A;  2GWK A;  1ZXN A;  3Q5K A;  4MP2 A;  4H0X B;  2PAV A;  3G7E A;  4XEI A;  4L93 A;  2EXL A;  1I5A A;  4FL9 A;  1BKN A;  5CE3 A;  4E02 A;  4H5T A;  4XKK A;  2CGF A;  2XDS A;  4CZH A;  2FF3 B;  4KSG A;  2GFD A;  4MPN A;  4U93 A;  3Q5J A;  1BYQ A;  3GIG B;  4AWP A;  5D6Q A;  4B1W B;  1H7U A;  1LCU A;  3DWL A;  1QZ6 A;  3TPQ A;  2Q36 A;  2KHO A;  2BU7 A;  2WI4 A;  2Q8G A;  3U2D A;  1NGI A;  4URM A;  3A5L C;  5E84 A;  3LPS A;  3FT8 A;  3BM9 A;  1UYM A;  3GIE A;  4H5W A;  3QDD A;  3M1F A;  5AQV A;  3WHA A;  1NGC A;  2YEE A;  4JHD B;  3QB0 A;  2O1W A;  5FND A;  4MB9 A;  4KSH A;  2PNR A;  3FV5 A;  2HKJ A;  4YKQ A;  4CE2 A;  2YI5 A;  5M4N A;  4BAE A;  4EFH A;  1UY7 A;  2YGE A;  4XJX A;  4MP7 A;  4ZVI A;  3RLR A;  5BN9 A;  1U2O A;  4KP4 A;  3SJH A;  5BPL A;  4H5V A;  1F51 A;  3CWV A;  4CWQ A;  3R4P A;  5D7C A;  2PBD A;  4JD2 A;  5IDM A;  1XQS C;  4R3A A;  4I3H A;  1Y4U A;  2XJJ A;  4W7T A;  1UY6 A;  2QG2 A;  4ASG A;  3EKU A;  2IWX A;  1S14 A;  4E72 A;  1KAZ A;  1NGA A;  4GCZ A;  3GL1 A;  2BRC A;  1AMW A;  5BOC A;  3C7N B;  3U9Z A;  3TTZ A;  1BA0 A;  4B1Y B;  1I59 A;  2QWN A;  3PEH A;  3QML A;  4LP0 A;  3CYG A;  4QPJ A;  2WUS A;  2P9K A;  5J6A A;  5D7D A;  3B25 A;  4B6C A;  5C93 A;  2QW9 A;  3K60 A;  3MMV A;  5AQJ A;  2H55 A;  1C0G A;  4XKA A;  2XDX A;  3C0E A;  3KVG A;  1I5D A;  4JN4 A;  5D6P A;  3C11 A;  4YKX A;  2WER A;  2VCP A;  1NGD A;  2XX4 A;  1T44 A;  2ESA A;  2HHI A;  4FO0 A;  4CZG A;  2VCJ A;  2XJX A;  3JXU A;  3A0Z A;  5FWK A;  5AQG A;  2W00 A;  4HXZ A;  2Q8I A;  1TC6 A;  3DXM B;  3LDN A;  1Y64 A;  4AM6 A;  1I58 A;  2YED A;  2YKB A;  3RLQ A;  3O0I A;  2Q8H A;  3H80 A;  1YAG A;  4XCJ A;  1B62 A;  4EFU A;  2CH4 A;  2V7Z A;  4O05 A;  3CJC A;  1YER A;  4WUC A;  3B28 A;  1MDU B;  3CQX A;  2YEG A;  4FSV A;  2P9I B;  3CGZ A;  4FPP A;  2YI6 A;  2V7Y A;  1I5C A;  2XAB A;  4CWF A;  1KIJ A;  4PL9 A;  2CCU A;  4LWE A;  3RLP A;  2YJX A;  2QWP A;  1UYC A;  3FZH A;  4KBO A;  3W3D A;  2QXL A;  4CZI A;  2ZBK B;  4BIU A;  3O6O A;  5AQK A;  1TBW A;  4CBW A;  1IJJ A;  4EM7 A;  2Q2E B;  5I9E B;  4H0V B;  2FXS A;  5CTU A;  5AQU A;  1NLV A;  5AQO A;  4JD2 B;  4E00 A;  5EVZ A;  2CG9 A;  3LNU A;  2BU2 A;  4EGI A;  2AKP A;  4BQJ A;  3D2R A;  3ZKD A;  4P7A A;  1YUW A;  3CJB A;  2YEH A;  5CF0 A;  3R4M A;  3HYY A;  1TID A;  3PEJ A;  2XHX A;  1SQK A;  1H7S A;  1P8Z A;  2ASM A;  1NHH A;  2YK2 A;  2P9S A;  4U7N A;  3R4N A;  3UB5 A;  5AFU A;  3IUC A;  2JJC A;  3EKR A;  1NHI A;  1ID0 A;  3H4L A;  2V52 B;  1C0F A;  2QG0 A;  3INX A;  4BQG A;  4Z94 A;  2IOP A;  3KE6 A;  2H8M A;  1H1V A;  4CZE A;  1QQM A;  1HX1 A;  3QTF A;  3T0H A;  4PL8 A;  1AM1 A;  3DXM A;  1WUA A;  5CTX A;  5AQN A;  2YJF A;  1UYG A;  4WYB A;  3VAD A;  1NMD A;  5JLF A;  2QFO A;  1ZW9 A;  1MU5 A;  4ASF A;  1THN A;  4L94 A;  4HZ0 A;  4GEE A;  2QF6 A;  4PU9 A;  4XIQ A;  4A2B A;  1YT1 A;  3U67 A;  4K42 A;  3I33 A;  3T1K A;  1BA1 A;  2V51 B;  4H0Y B;  2YEJ A;  4CWT A;  2P9I A;  4CWO A;  2YE6 A;  5AQI A;  2QWL A;  1QQO A;  1EA6 A;  4P8O A;  5FPD A;  4GY2 B;  5ADX H;  3K97 A;  2XCM A;  4B7P A;  3B26 A;  4H85 A;  1NGH A;  2BTF A;  2ASO A;  5FPM A;  3B24 A;  4URL A;  2Q1N A;  5F2R A;  3TZ2 A;  2YE7 A;  4EAH D;  3U2K A;  4BXI A;  1AH6 A;  5AQW A;  3CI5 A;  4XC0 A;  1AJ6 A;  3VHC A;  1Z59 A;  1ATN A;  3NMQ A;  4HYM A;  4MBC A;  1HJO A;  2VYP A;  2IWS A;  1UYI A;  5EY4 A;  2BYI A;  4O0B A;  4I5S A;  3OWD A;  3IED A;  4DUH A;  3T0Z A;  3U9D A;  4CBU A;  3EHG A;  4Q20 A;  5CPH A;  4GQT A;  1TIL A;  2P9S B;  4B1Z A;  3AY9 A;  4CZF A;  1NHJ A;  4CE1 A;  3ZXO A;  4ASB A;  4QPK A;  5M4E A;  1KAX A;  4H5N A;  3T10 A;  4XD8 A;  3DGE A;  3TU5 A;  4L91 A;  3UKU B;  1ZWH A;  2WI1 A;  2YK9 A;  4O04 A;  4URN A;  4CBX A;  5BN8 A;  3RKZ A;  4WUD A;  4XKO A;  3L6Q A;  2A5X A;  1NGF A;  1UYE A;  2FF6 A;  2WI7 A;  2IOR A;  4PRV A;  3FFK B;  3A0R A;  4EGK A;  3FZM A;  5BPN A;  2HF3 A;  3Q5L A;  5IN9 A;  4K43 A;  1GKX A;  2BU8 A;  4JAV A;  3TZ4 A;  1B63 A;  4AWQ A;  2P9L A;  2YEI A;  2Q31 A;  1BUP A;  4YKY A;  2BZ5 A;  4NH7 A;  5F1X A;  1YS3 A;  1YVN A;  3FT5 A;  2YI0 A;  1GKZ A;  1OSF A;  2P9P A;  3MN5 A;  4J8F A;  3ULE B;  2IWU A;  4LWG A;  5EX5 A;  4PRX A;  4RWT A;  4LWF A;  2QWQ A;  4BIZ A;  4H0T B;  5J71 A;  3D2F B;  1Y8N A;  2FYP A;  3CHW A;  3FE1 A;  3T2S A;  1YC4 A;  2VCI A;  2YEF A;  5AQT A;  3G7B A;  4FMT A;  1YC1 A;  1QYE A;  3TUH A;  4R3M A;  1BXD A;  4CZJ A;  4PKI A;  2XHR A;  4XE2 A;  4YKT A;  2YGA A;  3EHJ A;  1A4H A;  2ZDX A;  4X9L A;  4HZ5 A;  2OAN A;  5GGZ A;  2HMP A;  1LOT B;  5CTY A;  4MOT A;  2P9N A;  2A41 A;  4JQL A;  5AQY A;  4CWN A;  4H5R A;  3HZ5 A;  3UKR A;  2XJG A;  4R1F A;  1Z5A A;  2BSM A;  4HXW A;  3ZKB A;  2O1U A;  2XDU A;  3BMY A;  4L90 A;  1YES A;  1NWK A;  3U8X A;  5F0X A;  1D4X A;  2E88 A;  1TYQ B;  4RTF D;  3MN6 A;  5CTW A;  1Z5C A;  4KTN A;  1ATR A;  2WI5 A;  1DKG D;  5FPN A;  3EKO A;  4CWR A;  2ZWH A;  3EHF A;  2QWR A;  2C1I A;  1J6Z A;  3R91 A;  4AWO A;  5M4H A;  2YKJ A;  2YEC A;  3UKU A;  4EMV A;  2FTK A;  3MN7 A;  5AQR A;  5EXW A;  2E8A A;  4FCR A;  2Q0U A;  4I6M B;  2CCT A;  3CRL A;  2QWM A;  1Y8O A;  4HY1 A;  3S5T A;  2E0A A;  4K41 A;  2CCS A;  2YKI A;  4YKZ A;  1UY9 A;  2ZKJ A;  1Z5B A;  4GT8 A;  2P9L B;  2FWY A;  4U7O A;  3RSE A;  4B1V A;  1QQN A;  3HEK A;  3ULE A;  2BRE A;  3LDP A;  1AH8 A;  5F5R A;  4JNE A;  2P9P B;  2A42 A;  2O1V A;  4EGH A;  3D2F A;  2YE9 A;  1JCE A;  4ASA A;  2GQP A;  1S22 A;  1U2V A;  4XTJ A;  4YKU A;  4DZY A;  4XCL A;  3ATU A;  4H03 B;  3R4O A;  3GIF A;  1K8K A;  1YET A;  4URO A;  2XDK A;  4XDM A;  5AQP A;  1UYL A;  2XK2 A;  3LDQ A;  4PKG A;  1JCG A;  4YKW A;  3QFU A;  1BGQ A;  1UYD A;  3QFP A;  2XX2 A;  4GNI A;  2A3Z A;  2UWD A;  1NM1 A;  3K98 A;  2K5B A;  2VW5 A;  4MPC A;  2YE4 A;  1YXQ A;  2P9N B;  3HHU A;  4BEB A;  2IOQ A;  4H81 A;  3UKR B;  5AQH A;  1RDW X;  5D7R A;  4MPE A;  2BUP A;  1UYK A;  1TYQ A;  2YEA A;  1QZR A;  2YGF A;  3G75 A;  3WQ9 A;  3VHA A;  3VHD A;  2ASP A;  2P9U A;  4BEC A;  5JLH A;  4AS9 A;  4GGL A;  4JAU A;  1U0Z A;  3DAW A;  4B9Q A;  1ZXM A;  5BPM A;  1YSZ A;  3D2E B;  1US7 A;  3FZF A;  1KZN A;  2FWZ A;  2WEP A;  3FZK A;  4V25 A;  3HSC A;  4M63 C;  4I6M A;  1NGJ A;  2HG1 A;  4O07 A;  3A5N C;  4NH9 A;  5AQL A;  2HF4 A;  1HLU A;  2WI6 A;  4LWI A;  5AR0 A;  3DXK A;  4HY6 A;  4FCQ A;  5M4M A;  2YKE A;  2BU6 A;  1UY8 A;  2JKI A;  3M6G A;  5AQM A;  3CGY A;  1EQY A;  1Y4S A;  3UE5 A;  3A8Y A;  3WEE A;  2XDL A;  3ZXQ A;  1R62 A;  1MX0 A;  3R92 A;  4PKH A;  4B1X B;  4FCP A;  3OMU A;  1L0O A;  1NGE A;  5AFU H;  4PL7 A;  3RSE B;  3CIP A;  5AQQ A;  1B3Q A;  3LMM A;  1ATS A;  2Q97 A;  4HWI A;  4CE3 A;  4GFN A;  4A2A A;  3L4I A;  1QZ5 A;  3A0T A;  1YC3 A;  4KQV A;  4LPB A;  1I5B A;  2WEQ A;  3GDQ A;  4NH8 A;  3BUZ B;  3TZ0 A;  4AM7 A;  1QY8 A;  1TH8 A;  1U2V B;  3J8A A;  2YE2 A;  1KXP A;  4EFT A;  1JCF A;  3HYZ A;  1RGI A;  5ADX A;  4IO8 A;  1K8K B;  5AQF A;  5FPE A;  2Q0R A;  3HBT A;  2FXU A;  5BOD A;  3GIG A;  5AQS A;  3LDL A;  2YE5 A;  2BYH A;  4ZKI A;  3JZ3 A;  3D0B A;  2YKC A;  3CRK A;  3OWB A;  3B27 A;  4XIR A;  2ZDY A;  2GWJ A;  3ATV A;  3MN9 A;  1Y8P A;  4XIT A;  1HPM A;  3M3Z A;  2YE8 A;  1UYH A;  3ZM7 A;  2BT0 A; 
#chains in the Genus database with same CATH homology
 5JEN A;  4E72 A;  3CYG A;  3S5T A;  2HHI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...