3CYGA

Crystal structure of an uncharacterized protein from fervidobacterium nodosum rt17-b1
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
215
structure length
215
Chain Sequence
LRMKVFEIVKSSTENEIVRIHVELPRLKYLKDSNFEEKFNSEVEEKIKKFVNEVKGIAQEDHDKDVQHTPYEAYVSVDVRYEGKDFLSFVVYYYQFTGGAHGITFFETYNIDLKNSKVLKLYDIIKEEAEDTIKSNILKQIEQNNTDFFPDAPMNILKDDIFSREFTISKDGLIIMYPHYDLAPYASGMPEFVIPWNVIEKFLKYDILSLLKEGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an uncharacterized protein from Fervidobacterium nodosum Rt17-B1.
rcsb
source organism Fervidobacterium nodosum rt17-b1
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein
total genus 56
structure length 215
sequence length 215
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11738 DUF3298 Protein of unknown function (DUF3298)
A PF13739 PdaC Deacetylase PdaC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.40 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Fervidobacterium nodosum Rt17-B1 like 3cygA01
3.90.640.20 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Heat-shock cognate protein, ATPase 3cygA02
3S5TA 5JENA 2HHIA 3CYGA 4E72A
chains in the Genus database with same CATH superfamily
4MB9A 3EHJA 2HG1A 3SL2A 2O1VA 5IN9A 1ZW9A 4MBCA 3A0WA 1BGQA 1QZ5A 3A0ZA 4FCPA 4BQJA 1H7SA 1HPMA 1UY8A 4B6CA 1NLVA 4KBOA 5AQYA 2YGAA 4E00A 3HZ5A 3D0BA 1GKZA 3EHFA 2PBDA 3OW6A 4CI6A 2YEBA 4ZKIA 3VHDA 4R1FA 1LCUA 4U7OA 1YSRA 3L6QA 1YERA 1KZNA 2A5XA 3UKUB 2XDLA 3U2KA 2BSMA 2QG2A 3H4LA 1YT1A 4L91A 3IUCA 1S3XA 5AQMA 1NGDA 2D1KA 5FPEA 4JD2B 5JLHA 4WUDA 3HYYA 4R3MA 2EXLA 4JNEA 2VCPA 2BU8A 3WHAA 3G75A 3INWA 3HSCA 3R92A 4I6MA 3OWBA 2ZWHA 4CE2A 5CTYA 3EHHA 2VCJA 4H0TB 1Z5CA 1P8ZA 1U0ZA 4DUHA 2XABA 4URMA 4EFHA 1I5CA 1Z5BA 2YE5A 1WUAA 4FCQA 2P9NA 1R62A 1LOTB 1K8KA 1I59A 4I3HA 3TPQA 1YSZA 1Z5AA 2VCIA 4CWQA 4YKQA 3T0ZA 1NWKA 5ADXH 2AKPA 1NGCA 5AR0A 1UY6A 1SQKA 3U8XA 5F1XA 3B25A 1UYIA 3DXKB 2XDSA 4LPBA 3FZFA 3D2EA 3M3ZA 2YK9A 4O09A 5F3KA 2YEAA 3A5NC 2ESAA 4FSVA 3B26A 1ZWHA 3QMLA 4X9LA 2YEDA 3D2EB 1A4HA 2QWRA 2Q36A 1YC4A 4O05A 2XHTA 2YEJA 1ATSA 1YC3A 5BOCA 1JCFA 1XQSC 3M6GA 4XJXA 4HY6A 2YK2A 3CJCA 4KTNA 2QWLA 2XDXA 5AQJA 1EI1A 4PKHA 2CCTA 1JM6A 3R4MA 2A3ZA 4GQTA 3RKZA 4CZGA 2Q31A 2HCHA 3K97A 5AQHA 3TZ2A 5EXWA 4EGIA 1L0OA 3FT5A 4PL8A 1MX0A 4KFGA 1QZRA 3TUHA 2P9KA 4KQVA 2QG0A 3U67A 1BXDA 3CIPA 4GT8A 2C1IA 1QQOA 4XCJA 4GFNA 4YKTA 2IORA 3M1FA 2HF3A 2P9UB 5EY4A 4L93A 3UKRA 2YJXA 3L4IA 1MU5A 4CWOA 5F2RA 4H85A 1HX1A 4ASFA 2IOQA 3C11A 3CYGA 4RWTA 3FZLA 4XKKA 4CZHA 4LWHA 4YKYA 1BA1A 4KSHA 2GWJA 3A5MC 1K8KB 1YC1A 3UKRB 1F51A 1UYLA 3CI5A 2YGFA 4NH9A 1JCGA 1UYGA 4CZMA 4M63C 1QQMA 5FPNA 4BE7B 2GFDA 3DXMB 4JQLA 4XKOA 3O2FA 4WYBA 5AQIA 1AH8A 1Y8OA 5AQQA 1AJ6A 2FWZA 5AQGA 3JXUA 5AQSA 1TIDA 4PL9A 2W00A 4H5NA 1NHHA 4EGHA 5CE3A 3Q5LA 3RLPA 2Q8HA 3UE5A 5I9EB 3MN5A 4MPCA 2YE4A 4HXZA 5AQNA 1KAZA 2VW5A 4HWIA 5ADXA 4PRVA 2E0AA 2BU6A 5CPHA 5GGZA 3HBTA 3VHAA 3TU5A 1AM1A 1THNA 1QY8A 2QF6A 2C2AA 3FT8A 2QXLA 2O1UA 3CQXA 3B24A 3FFKB 4CWRA 4EFTA 2QWNA 2H55A 4KP4A 3WQ9A 1UYKA 3OMUA 5EVZA 4XC0A 4CZIA 1YT2A 5BODA 2WI5A 1C0FA 2YEEA 4BEBA 2XJGA 4YKWA 4MP2A 2WERA 3KVGA 4JHDA 5AQPA 3CHWA 4B1VA 2YKEA 5AQTA 4AM6A 4B1ZA 1YESA 4UROA 4B1WB 4XIRA 4CE1A 2BTZA 3LMMA 4B1XB 3DXKA 1Y4SA 2CGFA 2YECA 2HMPA 3A8YA 3TZ5A 4QPKA 4GY2B 3D36A 1HJOA 4JAVA 4QPJA 5JLFA 1AH6A 5BN9A 2P9LA 3CWVA 5CTWA 2YKJA 2CCSA 3HHUA 4U7NA 2BU5A 1NHIA 3LDLA 2UWDA 2YEIA 5AFUH 5FPMA 1MA9B 2BYIA 2YE2A 5F0XA 2CH4A 3WEEA 2WUSA 1TH8A 4GCZA 1NGHA 2V7ZA 4LWGA 5BPMA 4CZLA 1BKNA 1I5BA 5FNCA 4B1UB 4L94A 4L8ZA 3R4OA 4CZEA 1UYDA 3FE1A 3FZMA 3A0YA 5C93A 5J6AA 2FF6A 3U9DA 4H5WA 2WI6A 3LNUA 2GWKA 1UYFA 3CGZA 4L90A 5D6QA 5F5RA 4CBUA 3A5LC 2WEQA 5FNDA 2P9NB 2BYHA 2K5BA 2XHXA 2QWPA 1ATNA 4B9QA 4HYMA 3Q5JA 2H8MA 2XHRA 3K98A 4FCRA 3BM9A 4NH7A 3U9ZA 1S14A 1B63A 2BREA 5AQWA 1NGIA 3FZHA 3GL1A 5AQXA 2BRCA 4HYPA 4PRXA 5M4EA 4H0YB 2JJCA 4O07A 4BQGA 2YE6A 2YI0A 1S22A 3I33A 1NGAA 1ID0A 4FMTA 4CE3A 4JASA 4H5VA 5M4KA 4GNIA 4CZKA 1TC6A 5D6PA 3ZKBA 3A0RA 2HF4A 2A41A 3DGEA 4JHDB 4CWTA 3PEHA 4EFUA 4AWPA 1H7UA 1UY7A 5M4MA 2YI6A 2ZDYA 3D2FA 4EMVA 3R4NA 2WI4A 3QFPA 4PKGA 2HHIA 4YKZA 3MN7A 5E84A 2BTFA 1BUPA 1U2OA 2P9SB 2P9IB 1US7A 1KIJA 4HZ5A 1U2VA 4GGLA 2BUPA 2FF3B 2IWUA 2O1WA 2ASMA 4CWPA 2FWYA 3GIGB 5AQKA 5BN8A 1EQYA 5CTXA 2Q1NA 3ULEA 4HZ0A 1RDWX 1E4FT 2BU2A 1J6ZA 1NGBA 3BMYA 3FZKA 2A42A 1YT0A 5BPLA 2V52B 1RFQA 3KE6A 1KAXA 4PKIA 3RLQA 3Q5KA 4MOTA 4Q20A 2QFOA 3C7NA 2CCUA 3EKOA 5AQUA 1ZXNA 3D2FB 1NM1A 3ULEB 3TTZA 3PEJA 4B7PA 1DKGD 4XTJA 4AM7A 4FL9A 2QW9A 1S16A 1BA0A 1Z59A 3T2SA 2QWOA 4JN4A 2OANA 4PL7A 4MPEA 2PAVA 2E88A 4AWQA 2IOPA 1YETA 5AQVA 2Q2EB 3R4PA 2E8AA 2XCMA 1UY9A 2Q0RA 3K60A 4EM7A 2XJXA 3GIFA 1UYEA 1TYQA 5IDJA 3CRLA 2CG9A 2YJFA 2FYPA 2HKJA 1NGJA 2P9UA 3JZ3A 4XITA 1TYQB 3CJBA 2P9LB 3TZ0A 4CZJA 4BXIA 3WEEB 2KHOA 2Q8IA 2P9KB 2YGEA 4FPPA 3RSEB 2BU7A 3QB0A 3QDDA 3EKRA 4O04A 4I5SA 3T0HA 2QWMA 2WEPA 4DZYA 4CWNA 3DWLA 3K99A 3ZXQA 2YE7A 1ATRA 3ATUA 3LDNA 3R91A 1NHJA 4CZFA 3A5OC 4MPNA 4XCLA 1NGEA 4H7QA 2YE3A 4P8OA 4IO8A 2WI7A 3RLRA 1HLUA 1D4XA 3MN6A 3AY9A 1TC0A 2BZ5A 4BIZA 4LWIA 2YKCA 5D7RA 4NH8A 2YE8A 3G7EA 3A0XA 1YVNA 4AS9A 3O0IA 3EL2A 4J8FA 3LDPA 3MN9A 4BAEA 3HYZA 1UYMA 5D7CA 1YAGA 3T1KA 3DAWA 2YEHA 5J71A 1IXMA 2WI2A 2XD6A 4LWFA 5EX5A 2P9PB 1I5DA 5AFUA 3U2DA 1UYHA 4H5RA 3OWDA 4K42A 1UYCA 4B1YB 4R3AA 1NGFA 2P9PA 3LDQA 4O0BA 3A0TA 2VWCA 1NMDA 2YKIA 4XIQA 3QFUA 4H0XB 4CBXA 2XX2A 3B28A 4CWFA 1ESVA 1GKXA 2XDKA 4H03B 1PVGA 3MNRP 4ASBA 3U4LA 3C0EA 4A2AA 5L3JA 4K43A 1B62A 4YKRA 1KXPA 3J8AA 2P9IA 4WUBA 3DXMA 5M4NA 1QYEA 4CWSA 4H81A 4JAUA 5AQLA 1I58A 1TBWA 4XD8A 4JD2A 1OSFA 2YE9A 4ASGA 4E02A 2FXUA 4EAHD 2XDUA 3IEDA 3LPSA 1RGIA 2ASOA 2QWQA 3BUZB 1AMWA 2Q8FA 4I6MB 3S5TA 3ZKDA 2YKBA 3FV5A 3H80A 3HZ1A 2ASPA 4EGKA 3MMVA 5IDMA 3UB5A 4XIPA 3OPDA 4HY1A 4FO0A 1NGGA 3G7BA 2ZKJA 2IWXA 3HEKA 3RSEA 4URNA 4P7AA 2IWSA 2VYPA 4U93A 1TILA 5AQFA 1YXQA 4EEHA 3W3DA 5AQZA 4CBWA 4PU9A 2ZDXA 4XKAA 2C1GA 4XEIA 4Z94A 4GEEA 1C0GA 4KSGA 1QZ6A 2V51B 4RTFD 1KAYA 3LDOA 3B27A 3EHGA 4K4OA 4W7TA 1QQNA 1EA6A 1E4GT 5AQRA 2GQPA 2WI3A 4HXWA 2Q8GA 1H1VA 3O6OA 2YI5A 2XJJA 4V25A 4XE2A 3C7NB 1U2VB 1JCEA 4K41A 5CF0A 3EKSA 2YJEA 3ATVA 4H0VB 5FPDA 3VADA 4A2BA 3GDQA 5FNFA 1IJJA 2FTKA 4URLA 3GIEA 2YEGA 1Y8PA 1YUWA 2A40A 4LWEA 1GJVA 5AQOA 2YI7A 3CRKA 4ASAA 1Y8NA 1B3QA 4BECA 5M4HA 1MDUB 5JENA 4V26A 1YS3A 4ZVIA 3VHCA 4E72A 4AWOA 5M4PA 2FXSA 4WUCA 2P9SA 4H5TA 2XK2A 2XX5A 3SJHA 3ZXOA 1BYQA 2WI1A 2XX4A 2V7YA 2JKIA 2BT0A 4E01A 4YKXA 3GIGA 3D2RA 1DEJA 1I5AA 1T44A 2Q0UA 5BPNA 2YJWA 2ZBKB 2Q97A 2PNRA 3TZ4A 3T10A 3INXA 3NMQA 4XDMA 4LP0A 4MP7A 4BIUA 3CGYA 4YKUA 5D7DA 3UKUA 1Y64A 5FWKA 1Y4UA 5TKYA 3QTFA 5CTUA 2YEFA 3EKUA 1ZXMA 3ZM7A
chains in the Genus database with same CATH topology
3S5TA 5JENA 2HHIA 3CYGA 4E72A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S5T A;  5JEN A;  2HHI A;  3CYG A;  4E72 A; 
#chains in the Genus database with same CATH topology
 4MB9 A;  3EHJ A;  2HG1 A;  3SL2 A;  2O1V A;  5IN9 A;  1ZW9 A;  4MBC A;  3A0W A;  1BGQ A;  1QZ5 A;  3A0Z A;  4FCP A;  4BQJ A;  1H7S A;  1HPM A;  1UY8 A;  4B6C A;  1NLV A;  4KBO A;  5AQY A;  2YGA A;  4E00 A;  3HZ5 A;  3D0B A;  1GKZ A;  3EHF A;  2PBD A;  3OW6 A;  4CI6 A;  2YEB A;  4ZKI A;  3VHD A;  4R1F A;  1LCU A;  4U7O A;  1YSR A;  3L6Q A;  1YER A;  1KZN A;  2A5X A;  3UKU B;  2XDL A;  3U2K A;  2BSM A;  2QG2 A;  3H4L A;  1YT1 A;  4L91 A;  3IUC A;  1S3X A;  5AQM A;  1NGD A;  2D1K A;  5FPE A;  4JD2 B;  5JLH A;  4WUD A;  3HYY A;  4R3M A;  2EXL A;  4JNE A;  2VCP A;  2BU8 A;  3WHA A;  3G75 A;  3INW A;  3HSC A;  3R92 A;  4I6M A;  3OWB A;  2ZWH A;  4CE2 A;  5CTY A;  3EHH A;  2VCJ A;  4H0T B;  1Z5C A;  1P8Z A;  1U0Z A;  4DUH A;  2XAB A;  4URM A;  4EFH A;  1I5C A;  1Z5B A;  2YE5 A;  1WUA A;  4FCQ A;  2P9N A;  1R62 A;  1LOT B;  1K8K A;  1I59 A;  4I3H A;  3TPQ A;  1YSZ A;  1Z5A A;  2VCI A;  4CWQ A;  4YKQ A;  3T0Z A;  1NWK A;  5ADX H;  2AKP A;  1NGC A;  5AR0 A;  1UY6 A;  1SQK A;  3U8X A;  5F1X A;  3B25 A;  1UYI A;  3DXK B;  2XDS A;  4LPB A;  3FZF A;  3D2E A;  3M3Z A;  2YK9 A;  4O09 A;  5F3K A;  2YEA A;  3A5N C;  2ESA A;  4FSV A;  3B26 A;  1ZWH A;  3QML A;  4X9L A;  2YED A;  3D2E B;  1A4H A;  2QWR A;  2Q36 A;  1YC4 A;  4O05 A;  2XHT A;  2YEJ A;  1ATS A;  1YC3 A;  5BOC A;  1JCF A;  1XQS C;  3M6G A;  4XJX A;  4HY6 A;  2YK2 A;  3CJC A;  4KTN A;  2QWL A;  2XDX A;  5AQJ A;  1EI1 A;  4PKH A;  2CCT A;  1JM6 A;  3R4M A;  2A3Z A;  4GQT A;  3RKZ A;  4CZG A;  2Q31 A;  2HCH A;  3K97 A;  5AQH A;  3TZ2 A;  5EXW A;  4EGI A;  1L0O A;  3FT5 A;  4PL8 A;  1MX0 A;  4KFG A;  1QZR A;  3TUH A;  2P9K A;  4KQV A;  2QG0 A;  3U67 A;  1BXD A;  3CIP A;  4GT8 A;  2C1I A;  1QQO A;  4XCJ A;  4GFN A;  4YKT A;  2IOR A;  3M1F A;  2HF3 A;  2P9U B;  5EY4 A;  4L93 A;  3UKR A;  2YJX A;  3L4I A;  1MU5 A;  4CWO A;  5F2R A;  4H85 A;  1HX1 A;  4ASF A;  2IOQ A;  3C11 A;  3CYG A;  4RWT A;  3FZL A;  4XKK A;  4CZH A;  4LWH A;  4YKY A;  1BA1 A;  4KSH A;  2GWJ A;  3A5M C;  1K8K B;  1YC1 A;  3UKR B;  1F51 A;  1UYL A;  3CI5 A;  2YGF A;  4NH9 A;  1JCG A;  1UYG A;  4CZM A;  4M63 C;  1QQM A;  5FPN A;  4BE7 B;  2GFD A;  3DXM B;  4JQL A;  4XKO A;  3O2F A;  4WYB A;  5AQI A;  1AH8 A;  1Y8O A;  5AQQ A;  1AJ6 A;  2FWZ A;  5AQG A;  3JXU A;  5AQS A;  1TID A;  4PL9 A;  2W00 A;  4H5N A;  1NHH A;  4EGH A;  5CE3 A;  3Q5L A;  3RLP A;  2Q8H A;  3UE5 A;  5I9E B;  3MN5 A;  4MPC A;  2YE4 A;  4HXZ A;  5AQN A;  1KAZ A;  2VW5 A;  4HWI A;  5ADX A;  4PRV A;  2E0A A;  2BU6 A;  5CPH A;  5GGZ A;  3HBT A;  3VHA A;  3TU5 A;  1AM1 A;  1THN A;  1QY8 A;  2QF6 A;  2C2A A;  3FT8 A;  2QXL A;  2O1U A;  3CQX A;  3B24 A;  3FFK B;  4CWR A;  4EFT A;  2QWN A;  2H55 A;  4KP4 A;  3WQ9 A;  1UYK A;  3OMU A;  5EVZ A;  4XC0 A;  4CZI A;  1YT2 A;  5BOD A;  2WI5 A;  1C0F A;  2YEE A;  4BEB A;  2XJG A;  4YKW A;  4MP2 A;  2WER A;  3KVG A;  4JHD A;  5AQP A;  3CHW A;  4B1V A;  2YKE A;  5AQT A;  4AM6 A;  4B1Z A;  1YES A;  4URO A;  4B1W B;  4XIR A;  4CE1 A;  2BTZ A;  3LMM A;  4B1X B;  3DXK A;  1Y4S A;  2CGF A;  2YEC A;  2HMP A;  3A8Y A;  3TZ5 A;  4QPK A;  4GY2 B;  3D36 A;  1HJO A;  4JAV A;  4QPJ A;  5JLF A;  1AH6 A;  5BN9 A;  2P9L A;  3CWV A;  5CTW A;  2YKJ A;  2CCS A;  3HHU A;  4U7N A;  2BU5 A;  1NHI A;  3LDL A;  2UWD A;  2YEI A;  5AFU H;  5FPM A;  1MA9 B;  2BYI A;  2YE2 A;  5F0X A;  2CH4 A;  3WEE A;  2WUS A;  1TH8 A;  4GCZ A;  1NGH A;  2V7Z A;  4LWG A;  5BPM A;  4CZL A;  1BKN A;  1I5B A;  5FNC A;  4B1U B;  4L94 A;  4L8Z A;  3R4O A;  4CZE A;  1UYD A;  3FE1 A;  3FZM A;  3A0Y A;  5C93 A;  5J6A A;  2FF6 A;  3U9D A;  4H5W A;  2WI6 A;  3LNU A;  2GWK A;  1UYF A;  3CGZ A;  4L90 A;  5D6Q A;  5F5R A;  4CBU A;  3A5L C;  2WEQ A;  5FND A;  2P9N B;  2BYH A;  2K5B A;  2XHX A;  2QWP A;  1ATN A;  4B9Q A;  4HYM A;  3Q5J A;  2H8M A;  2XHR A;  3K98 A;  4FCR A;  3BM9 A;  4NH7 A;  3U9Z A;  1S14 A;  1B63 A;  2BRE A;  5AQW A;  1NGI A;  3FZH A;  3GL1 A;  5AQX A;  2BRC A;  4HYP A;  4PRX A;  5M4E A;  4H0Y B;  2JJC A;  4O07 A;  4BQG A;  2YE6 A;  2YI0 A;  1S22 A;  3I33 A;  1NGA A;  1ID0 A;  4FMT A;  4CE3 A;  4JAS A;  4H5V A;  5M4K A;  4GNI A;  4CZK A;  1TC6 A;  5D6P A;  3ZKB A;  3A0R A;  2HF4 A;  2A41 A;  3DGE A;  4JHD B;  4CWT A;  3PEH A;  4EFU A;  4AWP A;  1H7U A;  1UY7 A;  5M4M A;  2YI6 A;  2ZDY A;  3D2F A;  4EMV A;  3R4N A;  2WI4 A;  3QFP A;  4PKG A;  2HHI A;  4YKZ A;  3MN7 A;  5E84 A;  2BTF A;  1BUP A;  1U2O A;  2P9S B;  2P9I B;  1US7 A;  1KIJ A;  4HZ5 A;  1U2V A;  4GGL A;  2BUP A;  2FF3 B;  2IWU A;  2O1W A;  2ASM A;  4CWP A;  2FWY A;  3GIG B;  5AQK A;  5BN8 A;  1EQY A;  5CTX A;  2Q1N A;  3ULE A;  4HZ0 A;  1RDW X;  1E4F T;  2BU2 A;  1J6Z A;  1NGB A;  3BMY A;  3FZK A;  2A42 A;  1YT0 A;  5BPL A;  2V52 B;  1RFQ A;  3KE6 A;  1KAX A;  4PKI A;  3RLQ A;  3Q5K A;  4MOT A;  4Q20 A;  2QFO A;  3C7N A;  2CCU A;  3EKO A;  5AQU A;  1ZXN A;  3D2F B;  1NM1 A;  3ULE B;  3TTZ A;  3PEJ A;  4B7P A;  1DKG D;  4XTJ A;  4AM7 A;  4FL9 A;  2QW9 A;  1S16 A;  1BA0 A;  1Z59 A;  3T2S A;  2QWO A;  4JN4 A;  2OAN A;  4PL7 A;  4MPE A;  2PAV A;  2E88 A;  4AWQ A;  2IOP A;  1YET A;  5AQV A;  2Q2E B;  3R4P A;  2E8A A;  2XCM A;  1UY9 A;  2Q0R A;  3K60 A;  4EM7 A;  2XJX A;  3GIF A;  1UYE A;  1TYQ A;  5IDJ A;  3CRL A;  2CG9 A;  2YJF A;  2FYP A;  2HKJ A;  1NGJ A;  2P9U A;  3JZ3 A;  4XIT A;  1TYQ B;  3CJB A;  2P9L B;  3TZ0 A;  4CZJ A;  4BXI A;  3WEE B;  2KHO A;  2Q8I A;  2P9K B;  2YGE A;  4FPP A;  3RSE B;  2BU7 A;  3QB0 A;  3QDD A;  3EKR A;  4O04 A;  4I5S A;  3T0H A;  2QWM A;  2WEP A;  4DZY A;  4CWN A;  3DWL A;  3K99 A;  3ZXQ A;  2YE7 A;  1ATR A;  3ATU A;  3LDN A;  3R91 A;  1NHJ A;  4CZF A;  3A5O C;  4MPN A;  4XCL A;  1NGE A;  4H7Q A;  2YE3 A;  4P8O A;  4IO8 A;  2WI7 A;  3RLR A;  1HLU A;  1D4X A;  3MN6 A;  3AY9 A;  1TC0 A;  2BZ5 A;  4BIZ A;  4LWI A;  2YKC A;  5D7R A;  4NH8 A;  2YE8 A;  3G7E A;  3A0X A;  1YVN A;  4AS9 A;  3O0I A;  3EL2 A;  4J8F A;  3LDP A;  3MN9 A;  4BAE A;  3HYZ A;  1UYM A;  5D7C A;  1YAG A;  3T1K A;  3DAW A;  2YEH A;  5J71 A;  1IXM A;  2WI2 A;  2XD6 A;  4LWF A;  5EX5 A;  2P9P B;  1I5D A;  5AFU A;  3U2D A;  1UYH A;  4H5R A;  3OWD A;  4K42 A;  1UYC A;  4B1Y B;  4R3A A;  1NGF A;  2P9P A;  3LDQ A;  4O0B A;  3A0T A;  2VWC A;  1NMD A;  2YKI A;  4XIQ A;  3QFU A;  4H0X B;  4CBX A;  2XX2 A;  3B28 A;  4CWF A;  1ESV A;  1GKX A;  2XDK A;  4H03 B;  1PVG A;  3MNR P;  4ASB A;  3U4L A;  3C0E A;  4A2A A;  5L3J A;  4K43 A;  1B62 A;  4YKR A;  1KXP A;  3J8A A;  2P9I A;  4WUB A;  3DXM A;  5M4N A;  1QYE A;  4CWS A;  4H81 A;  4JAU A;  5AQL A;  1I58 A;  1TBW A;  4XD8 A;  4JD2 A;  1OSF A;  2YE9 A;  4ASG A;  4E02 A;  2FXU A;  4EAH D;  2XDU A;  3IED A;  3LPS A;  1RGI A;  2ASO A;  2QWQ A;  3BUZ B;  1AMW A;  2Q8F A;  4I6M B;  3S5T A;  3ZKD A;  2YKB A;  3FV5 A;  3H80 A;  3HZ1 A;  2ASP A;  4EGK A;  3MMV A;  5IDM A;  3UB5 A;  4XIP A;  3OPD A;  4HY1 A;  4FO0 A;  1NGG A;  3G7B A;  2ZKJ A;  2IWX A;  3HEK A;  3RSE A;  4URN A;  4P7A A;  2IWS A;  2VYP A;  4U93 A;  1TIL A;  5AQF A;  1YXQ A;  4EEH A;  3W3D A;  5AQZ A;  4CBW A;  4PU9 A;  2ZDX A;  4XKA A;  2C1G A;  4XEI A;  4Z94 A;  4GEE A;  1C0G A;  4KSG A;  1QZ6 A;  2V51 B;  4RTF D;  1KAY A;  3LDO A;  3B27 A;  3EHG A;  4K4O A;  4W7T A;  1QQN A;  1EA6 A;  1E4G T;  5AQR A;  2GQP A;  2WI3 A;  4HXW A;  2Q8G A;  1H1V A;  3O6O A;  2YI5 A;  2XJJ A;  4V25 A;  4XE2 A;  3C7N B;  1U2V B;  1JCE A;  4K41 A;  5CF0 A;  3EKS A;  2YJE A;  3ATV A;  4H0V B;  5FPD A;  3VAD A;  4A2B A;  3GDQ A;  5FNF A;  1IJJ A;  2FTK A;  4URL A;  3GIE A;  2YEG A;  1Y8P A;  1YUW A;  2A40 A;  4LWE A;  1GJV A;  5AQO A;  2YI7 A;  3CRK A;  4ASA A;  1Y8N A;  1B3Q A;  4BEC A;  5M4H A;  1MDU B;  5JEN A;  4V26 A;  1YS3 A;  4ZVI A;  3VHC A;  4E72 A;  4AWO A;  5M4P A;  2FXS A;  4WUC A;  2P9S A;  4H5T A;  2XK2 A;  2XX5 A;  3SJH A;  3ZXO A;  1BYQ A;  2WI1 A;  2XX4 A;  2V7Y A;  2JKI A;  2BT0 A;  4E01 A;  4YKX A;  3GIG A;  3D2R A;  1DEJ A;  1I5A A;  1T44 A;  2Q0U A;  5BPN A;  2YJW A;  2ZBK B;  2Q97 A;  2PNR A;  3TZ4 A;  3T10 A;  3INX A;  3NMQ A;  4XDM A;  4LP0 A;  4MP7 A;  4BIU A;  3CGY A;  4YKU A;  5D7D A;  3UKU A;  1Y64 A;  5FWK A;  1Y4U A;  5TKY A;  3QTF A;  5CTU A;  2YEF A;  3EKU A;  1ZXM A;  3ZM7 A; 
#chains in the Genus database with same CATH homology
 3S5T A;  5JEN A;  2HHI A;  3CYG A;  4E72 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...