3CYGA

Crystal structure of an uncharacterized protein from fervidobacterium nodosum rt17-b1
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
215
structure length
215
Chain Sequence
b'LRMKVFEIVKSSTENEIVRIHVELPRLKYLKDSNFEEKFNSEVEEKIKKFVNEVKGIAQEDHDKDVQHTPYEAYVSVDVRYEGKDFLSFVVYYYQFTGGAHGITFFETYNIDLKNSKVLKLYDIIKEEAEDTIKSNILKQIEQNNTDFFPDAPMNILKDDIFSREFTISKDGLIIMYPHYDLAPYASGMPEFVIPWNVIEKFLKYDILSLLKEGH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Crystal structure of an uncharacterized protein from Fervidobacterium nodosum Rt17-B1.
rcsb
source organism Fervidobacterium nodosum rt17-b1
molecule tags Structural genomics, unknown function
total genus 56
structure length 215
sequence length 215
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11738 DUF3298 Protein of unknown function (DUF3298)
A PF13739 PdaC Deacetylase PdaC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.40 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Fervidobacterium nodosum Rt17-B1 like 3cygA01
3.90.640.20 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Heat-shock cognate protein, ATPase 3cygA02
4E72A 3CYGA 3S5TA 5JENA 2HHIA
chains in the Genus database with same CATH superfamily
4KQVA 3IUCA 2BSMA 4JNEA 4XEIA 3ZXQA 1C0FA 3FFKB 4NH9A 2XHRA 2P9NA 2E88A 3D0BA 4B1VA 1ZWHA 1US7A 2P9PA 5EVZA 4J8FA 4EFHA 2E0AA 4E00A 3UKRA 3G7EA 2YKBA 4HXWA 4EGKA 5M4NA 2P9LB 2YEIA 5BPMA 1RGIA 4AM7A 2K5BA 2YE8A 2QWPA 3VHDA 1TILA 3DXMB 3FZMA 3J8AA 2GFDA 3MN6A 1NGCA 4MB9A 5CTXA 2P9LA 2XHTA 3SJHA 5FNCA 5IDJA 5L3JA 1E4FT 5AQKA 4L91A 2VCIA 3ZM7A 2XX2A 2CGFA 1YC1A 2YEFA 5CTYA 2FF6A 1YVNA 4I6MB 4L8ZA 2O1WA 2Q1NA 3SL2A 3A5NC 3DXMA 3EHFA 3C7NB 3TZ5A 4JHDB 4MPNA 3LDLA 3EHHA 2YI0A 1U2OA 1TC6A 3GIGA 4YKUA 4AWOA 1NLVA 1NHIA 2IORA 4XDMA 3QDDA 1TH8A 1A4HA 3AY9A 3I33A 1D4XA 1AH8A 1KIJA 4LWEA 2IOPA 4I6MA 3CIPA 3FZHA 1UY8A 1WUAA 2VCPA 4BQJA 5F2RA 3TZ2A 3EKRA 4E01A 1QQNA 2IWSA 4JHDA 4LWIA 2FWYA 2ZDYA 2QXLA 4Z94A 4GEEA 2BU5A 3BM9A 2Q8IA 2ASOA 1AMWA 2QG2A 2WUSA 1S3XA 3MN9A 5AQRA 3LMMA 4MOTA 3T10A 4B1UB 2Q2EB 5BODA 3ZKDA 3DXKB 1KXPA 4ZVIA 2V7YA 2C2AA 2ZKJA 2P9KB 3ULEB 1QZ5A 2PNRA 2YE7A 4BQGA 2YI7A 4HWIA 4B1XB 2VYPA 4CWSA 4H85A 4H03B 4LWFA 3DXKA 4WUDA 1PVGA 1YC4A 1YT0A 2WI4A 4XD8A 2A5XA 2CCTA 1B62A 4KP4A 4YKYA 4YKZA 1P8ZA 3ATUA 4CE1A 4H0TB 1UY6A 2VCJA 5FWKA 2P9KA 3ULEA 3U9ZA 3B28A 4FCRA 5AQFA 1UYHA 1YS3A 2YEJA 3RSEB 3D2RA 3IEDA 5BOCA 2QF6A 1NGAA 3INWA 4BIUA 1BKNA 3HZ1A 2BYHA 3LDNA 1YC3A 3Q5JA 1NGIA 1I5BA 3OPDA 1KAXA 1U2VB 3VHAA 4RWTA 2QWRA 3B24A 3Q5LA 3HYZA 3A0RA 3DWLA 1BA0A 4EEHA 3U67A 2FYPA 2FF3B 3A5OC 1B63A 2FTKA 5D6PA 2YEGA 1U2VA 3RLRA 1IJJA 1ZXMA 4PL9A 4I3HA 5FNDA 3K97A 4BAEA 2A40A 1JM6A 5D7DA 4CE3A 1QQOA 4URLA 4H0YB 4LP0A 1HX1A 4CZEA 1TIDA 4XKAA 2XDUA 1H7SA 1Y8PA 1HPMA 4CWRA 4MPCA 4M63C 2E8AA 1HJOA 3M6GA 1BGQA 2WI6A 4O0BA 4B1YB 1RDWX 4CE2A 4CBWA 4CZHA 4O07A 2YI5A 1QZRA 3CJCA 4JQLA 1B3QA 2QFOA 3DGEA 5M4PA 2BTFA 3LDQA 3HBTA 2P9PB 2YEEA 4GQTA 4B1ZA 3BMYA 4CZMA 4P7AA 3A0ZA 3U8XA 3UB5A 3T1KA 1NGHA 2HHIA 5M4EA 1ATSA 3K60A 4KSHA 3TU5A 5AQNA 3A8YA 2YGEA 2XHXA 5AR0A 4B7PA 2OANA 1YERA 3UKUB 1LCUA 2BUPA 2Q0RA 2XJXA 1BA1A 2Q8HA 3D2EB 1Z5BA 3H4LA 4JAVA 3VADA 4HY6A 2HCHA 2ASPA 2QG0A 1YUWA 2P9UB 3UKUA 1YSZA 4KSGA 4JD2A 5FPNA 1AJ6A 5EY4A 5CTUA 4XJXA 3K99A 3GIGB 2ESAA 3D2EA 4JAUA 3HZ5A 3T0ZA 3UE5A 4MBCA 2YE4A 1UYCA 4CWFA 3H80A 4HZ5A 4MPEA 2P9UA 3B26A 3U9DA 1KAYA 2BU7A 3FV5A 2XCMA 4W7TA 4BEBA 5ADXH 4CBXA 2D1KA 4H0VB 3TZ0A 2JKIA 1QZ6A 4EGHA 4CBUA 5CTWA 3GL1A 3EKSA 2YEDA 1YESA 3O0IA 2P9IA 2YE5A 5F3KA 2VWCA 2CH4A 1KAZA 1NHJA 2GWJA 5AQLA 5CE3A 1RFQA 3U2DA 1JCEA 4URMA 3PEJA 1K8KB 1J6ZA 1NM1A 2YGFA 2YKCA 2BTZA 5BN9A 5JLHA 1UYDA 2H55A 2WI2A 2YE3A 2QWNA 1MU5A 5IN9A 4CZLA 2EXLA 3L4IA 2PAVA 2QWLA 2BZ5A 3HHUA 3TPQA 4E72A 1K8KA 4Q20A 3TTZA 4EMVA 5EXWA 4YKRA 5BN8A 5AQIA 5AQSA 2YJXA 4H81A 3QFUA 4V25A 4XCLA 4ASGA 1ATNA 3CYGA 1UYMA 4H7QA 2YK2A 2FXUA 4XKOA 2GWKA 1NMDA 4A2BA 2YKEA 1THNA 1SQKA 1I5DA 4AS9A 1T44A 5JENA 1TBWA 2IWUA 2XDLA 5AQMA 1BYQA 2Q8GA 5J71A 1AM1A 4JN4A 4K4OA 5FPMA 3FZLA 4U7OA 1NGBA 3QMLA 3QTFA 4P8OA 5M4KA 1QYEA 1H1VA 1BXDA 3LDOA 2ZBKB 4O09A 1OSFA 1UYLA 4DZYA 3WEEA 3QFPA 3B27A 4JASA 3PEHA 5AQHA 3T2SA 2YE6A 4XITA 5F0XA 3W3DA 3OWBA 2ZWHA 4QPJA 5AQQA 3GIFA 2WI5A 4GFNA 4LPBA 2A3ZA 5FPEA 5M4MA 1GJVA 3A0TA 5ADXA 4H5TA 1UYIA 4CZIA 1UYKA 2WEPA 3CGYA 2WI1A 5E84A 2WERA 4R1FA 3VHCA 3CRLA 4AWQA 2HF4A 3MNRP 4CZFA 4B6CA 3EHJA 3CI5A 4HY1A 4H5VA 4ASAA 3BUZB 4BE7B 3CWVA 4YKWA 1QY8A 5AQJA 4AWPA 3U4LA 1DKGD 2HMPA 1I58A 1LOTB 4GCZA 2FWZA 4PU9A 3ATVA 4R3AA 4GT8A 5CPHA 3FZFA 3JZ3A 5AQPA 3CJBA 5AQOA 2BU2A 4I5SA 3ZKBA 2XD6A 1NGGA 2AKPA 2CG9A 3R92A 5AFUA 4FSVA 1R62A 3G75A 2ASMA 1EI1A 3FE1A 4EFTA 4L94A 3R4PA 1NHHA 3KVGA 3HYYA 1Y4UA 4XIQA 2XX4A 5C93A 1TYQB 5AQUA 3RLPA 3LNUA 5GGZA 4JD2B 5M4HA 4FCPA 1ESVA 2YI6A 4H5WA 2XK2A 2A42A 4B1WB 4FMTA 1Z5CA 4L93A 1YETA 2H8MA 4EGIA 3JXUA 1ATRA 3Q5KA 3K98A 2BU8A 1S22A 1TYQA 5AQXA 3G7BA 4NH7A 4XIPA 1XQSC 5AQZA 1YAGA 1Y8OA 4EAHD 1JCGA 2O1VA 2V51B 4HYPA 2HKJA 4H5RA 2XJGA 3EKUA 3C0EA 5BPNA 3A0XA 2YJEA 3R4MA 4ASBA 2GQPA 2XX5A 3EKOA 3TUHA 3LPSA 5D6QA 2P9IB 4CWPA 5AQWA 1NGFA 1NGEA 3O2FA 4FO0A 1YT1A 2V7ZA 1KZNA 5JLFA 3HSCA 4CZGA 2YE9A 1MDUB 5BPLA 3CHWA 4XKKA 1ZXNA 4WYBA 1L0OA 2BU6A 2Q36A 2Q8FA 2FXSA 5AQGA 4KFGA 2O1UA 1EA6A 3TZ4A 3GIEA 5FPDA 3R4OA 3FZKA 4ASFA 2YKJA 4PL8A 3R4NA 1Y8NA 4PKGA 4KBOA 3OWDA 1F51A 4K43A 1QQMA 2W00A 2KHOA 1BUPA 2YJFA 4K42A 4HZ0A 4R3MA 4A2AA 1YSRA 4EFUA 4B9QA 4K41A 5AFUH 4XE2A 2YEAA 2YEBA 4CI6A 3MN7A 3C7NA 3L6QA 3CQXA 3C11A 1I5CA 4CZKA 1DEJA 4CWTA 2BREA 2YK9A 3FT8A 4GGLA 1MX0A 5D7CA 3U2KA 2P9SB 5AQVA 1UYGA 2IWXA 4KTNA 1Y64A 3O6OA 2ZDXA 2QWMA 1YXQA 4BECA 1MA9B 2QWQA 2JJCA 4PRXA 5F5RA 4GNIA 4PKHA 4U7NA 1Z5AA 3WEEB 4ZKIA 3WHAA 4MP2A 2C1GA 4X9LA 1Y4SA 2XJJA 3M1FA 2P9SA 4H5NA 4XCJA 2WEQA 1EQYA 2XDKA 4RTFD 3T0HA 3LDPA 4GY2B 5D7RA 1UY7A 1YT2A 1GKZA 2YGAA 2HG1A 4O04A 3A5MC 1ID0A 2QW9A 4XTJA 4FL9A 3D2FB 2Q0UA 4WUBA 1S14A 4PL7A 4FCQA 4V26A 1NGJA 4H0XB 2Q97A 1ZW9A 3HEKA 3A0YA 2UWDA 3OW6A 4U93A 2YJWA 4O05A 3ZXOA 2CCSA 2HF3A 4L90A 3DAWA 4CWNA 2YKIA 1C0GA 1JCFA 4HXZA 3D2FA 4MP7A 5CF0A 1E4GT 3CGZA 4BXIA 3D36A 4FPPA 2IOQA 4HYMA 1S16A 1UYEA 3RSEA 2BYIA 2CCUA 4YKTA 2YECA 2V52B 3CRKA 1Z59A 1AH6A 4XC0A 1UY9A 2QWOA 4EM7A 5TKYA 5IDMA 4UROA 2BT0A 4NH8A 4YKQA 4LWGA 3S5TA 1HLUA 2XABA 2XDSA 2VW5A 4DUHA 2YE2A 3WQ9A 3EHGA 2Q31A 1U0ZA 4E02A 2PBDA 1UYFA 3A5LC 2A41A 4AM6A 3R91A 2BRCA 4PRVA 1I5AA 5J6AA 1NGDA 2WI3A 3A0WA 3UKRB 4LWHA 4CWOA 2WI7A 3INXA 3FT5A 5I9EB 4URNA 1NWKA 3RKZA 3GDQA 4IO8A 5F1XA 5AQYA 2XDXA 4QPKA 2YEHA 2C1IA 4BIZA 4CWQA 1H7UA 3OMUA 3MN5A 4WUCA 3NMQA 3QB0A 3B25A 1GKXA 5AQTA 5FNFA 4YKXA 2P9NB 4PKIA 5EX5A 1I59A 4CZJA 3M3ZA 3MMVA 3RLQA 1IXMA 4XIRA 3KE6A 1TC0A 3EL2A
chains in the Genus database with same CATH topology
4E72A 3CYGA 3S5TA 5JENA 2HHIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E72 A;  3CYG A;  3S5T A;  5JEN A;  2HHI A; 
#chains in the Genus database with same CATH topology
 4KQV A;  3IUC A;  2BSM A;  4JNE A;  4XEI A;  3ZXQ A;  1C0F A;  3FFK B;  4NH9 A;  2XHR A;  2P9N A;  2E88 A;  3D0B A;  4B1V A;  1ZWH A;  1US7 A;  2P9P A;  5EVZ A;  4J8F A;  4EFH A;  2E0A A;  4E00 A;  3UKR A;  3G7E A;  2YKB A;  4HXW A;  4EGK A;  5M4N A;  2P9L B;  2YEI A;  5BPM A;  1RGI A;  4AM7 A;  2K5B A;  2YE8 A;  2QWP A;  3VHD A;  1TIL A;  3DXM B;  3FZM A;  3J8A A;  2GFD A;  3MN6 A;  1NGC A;  4MB9 A;  5CTX A;  2P9L A;  2XHT A;  3SJH A;  5FNC A;  5IDJ A;  5L3J A;  1E4F T;  5AQK A;  4L91 A;  2VCI A;  3ZM7 A;  2XX2 A;  2CGF A;  1YC1 A;  2YEF A;  5CTY A;  2FF6 A;  1YVN A;  4I6M B;  4L8Z A;  2O1W A;  2Q1N A;  3SL2 A;  3A5N C;  3DXM A;  3EHF A;  3C7N B;  3TZ5 A;  4JHD B;  4MPN A;  3LDL A;  3EHH A;  2YI0 A;  1U2O A;  1TC6 A;  3GIG A;  4YKU A;  4AWO A;  1NLV A;  1NHI A;  2IOR A;  4XDM A;  3QDD A;  1TH8 A;  1A4H A;  3AY9 A;  3I33 A;  1D4X A;  1AH8 A;  1KIJ A;  4LWE A;  2IOP A;  4I6M A;  3CIP A;  3FZH A;  1UY8 A;  1WUA A;  2VCP A;  4BQJ A;  5F2R A;  3TZ2 A;  3EKR A;  4E01 A;  1QQN A;  2IWS A;  4JHD A;  4LWI A;  2FWY A;  2ZDY A;  2QXL A;  4Z94 A;  4GEE A;  2BU5 A;  3BM9 A;  2Q8I A;  2ASO A;  1AMW A;  2QG2 A;  2WUS A;  1S3X A;  3MN9 A;  5AQR A;  3LMM A;  4MOT A;  3T10 A;  4B1U B;  2Q2E B;  5BOD A;  3ZKD A;  3DXK B;  1KXP A;  4ZVI A;  2V7Y A;  2C2A A;  2ZKJ A;  2P9K B;  3ULE B;  1QZ5 A;  2PNR A;  2YE7 A;  4BQG A;  2YI7 A;  4HWI A;  4B1X B;  2VYP A;  4CWS A;  4H85 A;  4H03 B;  4LWF A;  3DXK A;  4WUD A;  1PVG A;  1YC4 A;  1YT0 A;  2WI4 A;  4XD8 A;  2A5X A;  2CCT A;  1B62 A;  4KP4 A;  4YKY A;  4YKZ A;  1P8Z A;  3ATU A;  4CE1 A;  4H0T B;  1UY6 A;  2VCJ A;  5FWK A;  2P9K A;  3ULE A;  3U9Z A;  3B28 A;  4FCR A;  5AQF A;  1UYH A;  1YS3 A;  2YEJ A;  3RSE B;  3D2R A;  3IED A;  5BOC A;  2QF6 A;  1NGA A;  3INW A;  4BIU A;  1BKN A;  3HZ1 A;  2BYH A;  3LDN A;  1YC3 A;  3Q5J A;  1NGI A;  1I5B A;  3OPD A;  1KAX A;  1U2V B;  3VHA A;  4RWT A;  2QWR A;  3B24 A;  3Q5L A;  3HYZ A;  3A0R A;  3DWL A;  1BA0 A;  4EEH A;  3U67 A;  2FYP A;  2FF3 B;  3A5O C;  1B63 A;  2FTK A;  5D6P A;  2YEG A;  1U2V A;  3RLR A;  1IJJ A;  1ZXM A;  4PL9 A;  4I3H A;  5FND A;  3K97 A;  4BAE A;  2A40 A;  1JM6 A;  5D7D A;  4CE3 A;  1QQO A;  4URL A;  4H0Y B;  4LP0 A;  1HX1 A;  4CZE A;  1TID A;  4XKA A;  2XDU A;  1H7S A;  1Y8P A;  1HPM A;  4CWR A;  4MPC A;  4M63 C;  2E8A A;  1HJO A;  3M6G A;  1BGQ A;  2WI6 A;  4O0B A;  4B1Y B;  1RDW X;  4CE2 A;  4CBW A;  4CZH A;  4O07 A;  2YI5 A;  1QZR A;  3CJC A;  4JQL A;  1B3Q A;  2QFO A;  3DGE A;  5M4P A;  2BTF A;  3LDQ A;  3HBT A;  2P9P B;  2YEE A;  4GQT A;  4B1Z A;  3BMY A;  4CZM A;  4P7A A;  3A0Z A;  3U8X A;  3UB5 A;  3T1K A;  1NGH A;  2HHI A;  5M4E A;  1ATS A;  3K60 A;  4KSH A;  3TU5 A;  5AQN A;  3A8Y A;  2YGE A;  2XHX A;  5AR0 A;  4B7P A;  2OAN A;  1YER A;  3UKU B;  1LCU A;  2BUP A;  2Q0R A;  2XJX A;  1BA1 A;  2Q8H A;  3D2E B;  1Z5B A;  3H4L A;  4JAV A;  3VAD A;  4HY6 A;  2HCH A;  2ASP A;  2QG0 A;  1YUW A;  2P9U B;  3UKU A;  1YSZ A;  4KSG A;  4JD2 A;  5FPN A;  1AJ6 A;  5EY4 A;  5CTU A;  4XJX A;  3K99 A;  3GIG B;  2ESA A;  3D2E A;  4JAU A;  3HZ5 A;  3T0Z A;  3UE5 A;  4MBC A;  2YE4 A;  1UYC A;  4CWF A;  3H80 A;  4HZ5 A;  4MPE A;  2P9U A;  3B26 A;  3U9D A;  1KAY A;  2BU7 A;  3FV5 A;  2XCM A;  4W7T A;  4BEB A;  5ADX H;  4CBX A;  2D1K A;  4H0V B;  3TZ0 A;  2JKI A;  1QZ6 A;  4EGH A;  4CBU A;  5CTW A;  3GL1 A;  3EKS A;  2YED A;  1YES A;  3O0I A;  2P9I A;  2YE5 A;  5F3K A;  2VWC A;  2CH4 A;  1KAZ A;  1NHJ A;  2GWJ A;  5AQL A;  5CE3 A;  1RFQ A;  3U2D A;  1JCE A;  4URM A;  3PEJ A;  1K8K B;  1J6Z A;  1NM1 A;  2YGF A;  2YKC A;  2BTZ A;  5BN9 A;  5JLH A;  1UYD A;  2H55 A;  2WI2 A;  2YE3 A;  2QWN A;  1MU5 A;  5IN9 A;  4CZL A;  2EXL A;  3L4I A;  2PAV A;  2QWL A;  2BZ5 A;  3HHU A;  3TPQ A;  4E72 A;  1K8K A;  4Q20 A;  3TTZ A;  4EMV A;  5EXW A;  4YKR A;  5BN8 A;  5AQI A;  5AQS A;  2YJX A;  4H81 A;  3QFU A;  4V25 A;  4XCL A;  4ASG A;  1ATN A;  3CYG A;  1UYM A;  4H7Q A;  2YK2 A;  2FXU A;  4XKO A;  2GWK A;  1NMD A;  4A2B A;  2YKE A;  1THN A;  1SQK A;  1I5D A;  4AS9 A;  1T44 A;  5JEN A;  1TBW A;  2IWU A;  2XDL A;  5AQM A;  1BYQ A;  2Q8G A;  5J71 A;  1AM1 A;  4JN4 A;  4K4O A;  5FPM A;  3FZL A;  4U7O A;  1NGB A;  3QML A;  3QTF A;  4P8O A;  5M4K A;  1QYE A;  1H1V A;  1BXD A;  3LDO A;  2ZBK B;  4O09 A;  1OSF A;  1UYL A;  4DZY A;  3WEE A;  3QFP A;  3B27 A;  4JAS A;  3PEH A;  5AQH A;  3T2S A;  2YE6 A;  4XIT A;  5F0X A;  3W3D A;  3OWB A;  2ZWH A;  4QPJ A;  5AQQ A;  3GIF A;  2WI5 A;  4GFN A;  4LPB A;  2A3Z A;  5FPE A;  5M4M A;  1GJV A;  3A0T A;  5ADX A;  4H5T A;  1UYI A;  4CZI A;  1UYK A;  2WEP A;  3CGY A;  2WI1 A;  5E84 A;  2WER A;  4R1F A;  3VHC A;  3CRL A;  4AWQ A;  2HF4 A;  3MNR P;  4CZF A;  4B6C A;  3EHJ A;  3CI5 A;  4HY1 A;  4H5V A;  4ASA A;  3BUZ B;  4BE7 B;  3CWV A;  4YKW A;  1QY8 A;  5AQJ A;  4AWP A;  3U4L A;  1DKG D;  2HMP A;  1I58 A;  1LOT B;  4GCZ A;  2FWZ A;  4PU9 A;  3ATV A;  4R3A A;  4GT8 A;  5CPH A;  3FZF A;  3JZ3 A;  5AQP A;  3CJB A;  5AQO A;  2BU2 A;  4I5S A;  3ZKB A;  2XD6 A;  1NGG A;  2AKP A;  2CG9 A;  3R92 A;  5AFU A;  4FSV A;  1R62 A;  3G75 A;  2ASM A;  1EI1 A;  3FE1 A;  4EFT A;  4L94 A;  3R4P A;  1NHH A;  3KVG A;  3HYY A;  1Y4U A;  4XIQ A;  2XX4 A;  5C93 A;  1TYQ B;  5AQU A;  3RLP A;  3LNU A;  5GGZ A;  4JD2 B;  5M4H A;  4FCP A;  1ESV A;  2YI6 A;  4H5W A;  2XK2 A;  2A42 A;  4B1W B;  4FMT A;  1Z5C A;  4L93 A;  1YET A;  2H8M A;  4EGI A;  3JXU A;  1ATR A;  3Q5K A;  3K98 A;  2BU8 A;  1S22 A;  1TYQ A;  5AQX A;  3G7B A;  4NH7 A;  4XIP A;  1XQS C;  5AQZ A;  1YAG A;  1Y8O A;  4EAH D;  1JCG A;  2O1V A;  2V51 B;  4HYP A;  2HKJ A;  4H5R A;  2XJG A;  3EKU A;  3C0E A;  5BPN A;  3A0X A;  2YJE A;  3R4M A;  4ASB A;  2GQP A;  2XX5 A;  3EKO A;  3TUH A;  3LPS A;  5D6Q A;  2P9I B;  4CWP A;  5AQW A;  1NGF A;  1NGE A;  3O2F A;  4FO0 A;  1YT1 A;  2V7Z A;  1KZN A;  5JLF A;  3HSC A;  4CZG A;  2YE9 A;  1MDU B;  5BPL A;  3CHW A;  4XKK A;  1ZXN A;  4WYB A;  1L0O A;  2BU6 A;  2Q36 A;  2Q8F A;  2FXS A;  5AQG A;  4KFG A;  2O1U A;  1EA6 A;  3TZ4 A;  3GIE A;  5FPD A;  3R4O A;  3FZK A;  4ASF A;  2YKJ A;  4PL8 A;  3R4N A;  1Y8N A;  4PKG A;  4KBO A;  3OWD A;  1F51 A;  4K43 A;  1QQM A;  2W00 A;  2KHO A;  1BUP A;  2YJF A;  4K42 A;  4HZ0 A;  4R3M A;  4A2A A;  1YSR A;  4EFU A;  4B9Q A;  4K41 A;  5AFU H;  4XE2 A;  2YEA A;  2YEB A;  4CI6 A;  3MN7 A;  3C7N A;  3L6Q A;  3CQX A;  3C11 A;  1I5C A;  4CZK A;  1DEJ A;  4CWT A;  2BRE A;  2YK9 A;  3FT8 A;  4GGL A;  1MX0 A;  5D7C A;  3U2K A;  2P9S B;  5AQV A;  1UYG A;  2IWX A;  4KTN A;  1Y64 A;  3O6O A;  2ZDX A;  2QWM A;  1YXQ A;  4BEC A;  1MA9 B;  2QWQ A;  2JJC A;  4PRX A;  5F5R A;  4GNI A;  4PKH A;  4U7N A;  1Z5A A;  3WEE B;  4ZKI A;  3WHA A;  4MP2 A;  2C1G A;  4X9L A;  1Y4S A;  2XJJ A;  3M1F A;  2P9S A;  4H5N A;  4XCJ A;  2WEQ A;  1EQY A;  2XDK A;  4RTF D;  3T0H A;  3LDP A;  4GY2 B;  5D7R A;  1UY7 A;  1YT2 A;  1GKZ A;  2YGA A;  2HG1 A;  4O04 A;  3A5M C;  1ID0 A;  2QW9 A;  4XTJ A;  4FL9 A;  3D2F B;  2Q0U A;  4WUB A;  1S14 A;  4PL7 A;  4FCQ A;  4V26 A;  1NGJ A;  4H0X B;  2Q97 A;  1ZW9 A;  3HEK A;  3A0Y A;  2UWD A;  3OW6 A;  4U93 A;  2YJW A;  4O05 A;  3ZXO A;  2CCS A;  2HF3 A;  4L90 A;  3DAW A;  4CWN A;  2YKI A;  1C0G A;  1JCF A;  4HXZ A;  3D2F A;  4MP7 A;  5CF0 A;  1E4G T;  3CGZ A;  4BXI A;  3D36 A;  4FPP A;  2IOQ A;  4HYM A;  1S16 A;  1UYE A;  3RSE A;  2BYI A;  2CCU A;  4YKT A;  2YEC A;  2V52 B;  3CRK A;  1Z59 A;  1AH6 A;  4XC0 A;  1UY9 A;  2QWO A;  4EM7 A;  5TKY A;  5IDM A;  4URO A;  2BT0 A;  4NH8 A;  4YKQ A;  4LWG A;  3S5T A;  1HLU A;  2XAB A;  2XDS A;  2VW5 A;  4DUH A;  2YE2 A;  3WQ9 A;  3EHG A;  2Q31 A;  1U0Z A;  4E02 A;  2PBD A;  1UYF A;  3A5L C;  2A41 A;  4AM6 A;  3R91 A;  2BRC A;  4PRV A;  1I5A A;  5J6A A;  1NGD A;  2WI3 A;  3A0W A;  3UKR B;  4LWH A;  4CWO A;  2WI7 A;  3INX A;  3FT5 A;  5I9E B;  4URN A;  1NWK A;  3RKZ A;  3GDQ A;  4IO8 A;  5F1X A;  5AQY A;  2XDX A;  4QPK A;  2YEH A;  2C1I A;  4BIZ A;  4CWQ A;  1H7U A;  3OMU A;  3MN5 A;  4WUC A;  3NMQ A;  3QB0 A;  3B25 A;  1GKX A;  5AQT A;  5FNF A;  4YKX A;  2P9N B;  4PKI A;  5EX5 A;  1I59 A;  4CZJ A;  3M3Z A;  3MMV A;  3RLQ A;  1IXM A;  4XIR A;  3KE6 A;  1TC0 A;  3EL2 A; 
#chains in the Genus database with same CATH homology
 4E72 A;  3CYG A;  3S5T A;  5JEN A;  2HHI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...