3CYGA

Crystal structure of an uncharacterized protein from fervidobacterium nodosum rt17-b1
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
215
structure length
215
Chain Sequence
LRMKVFEIVKSSTENEIVRIHVELPRLKYLKDSNFEEKFNSEVEEKIKKFVNEVKGIAQEDHDKDVQHTPYEAYVSVDVRYEGKDFLSFVVYYYQFTGGAHGITFFETYNIDLKNSKVLKLYDIIKEEAEDTIKSNILKQIEQNNTDFFPDAPMNILKDDIFSREFTISKDGLIIMYPHYDLAPYASGMPEFVIPWNVIEKFLKYDILSLLKEGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an uncharacterized protein from Fervidobacterium nodosum Rt17-B1.
rcsb
source organism Fervidobacterium nodosum rt17-b1
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein
total genus 56
structure length 215
sequence length 215
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11738 DUF3298 Protein of unknown function (DUF3298)
A PF13739 PdaC Deacetylase PdaC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.40 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Fervidobacterium nodosum Rt17-B1 like 3cygA01
3.90.640.20 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Heat-shock cognate protein, ATPase 3cygA02
4E72A 3S5TA 5JENA 3CYGA 2HHIA
chains in the Genus database with same CATH superfamily
2Q8HA 4HZ5A 5D7DA 4B1VA 5BN8A 4ZVIA 4KQVA 1HLUA 2YKBA 3IEDA 2A41A 2YEEA 5FPMA 4EGIA 3ZKBA 2GWKA 2YE7A 2WI7A 5L3JA 2QG0A 3CJCA 4J8FA 1UYMA 1R62A 2ZDYA 1GKXA 2HF4A 3HZ1A 4Q20A 5AQVA 3U9ZA 3GIGB 5CPHA 1NWKA 2VYPA 2HKJA 1YESA 2XABA 2YEGA 3A0TA 3U9DA 4XD8A 3HBTA 4H5RA 3KE6A 4CZJA 5M4NA 4JN4A 1DEJA 4KFGA 4YKZA 2Q97A 2OANA 4XIQA 3U4LA 5AQHA 1ESVA 1Z59A 1U0ZA 4PL7A 4LWGA 3C0EA 2YK9A 2FWYA 2H55A 4H0XB 3A5LC 2YE4A 2JKIA 4EGKA 1J6ZA 3PEJA 4URNA 4U7OA 4XDMA 2P9KB 2VCIA 2QWQA 1H1VA 4XJXA 2QWLA 3JZ3A 2BTFA 4HWIA 1MX0A 5D6QA 2XD6A 2CCSA 1RDWX 2IWXA 4P8OA 2QWPA 4Z94A 3TZ4A 1LOTB 1EQYA 3C7NB 5M4EA 3OWBA 4HXZA 4EFTA 5AQMA 1NHHA 3VHCA 2GFDA 1MU5A 2YEAA 3EKOA 4YKRA 3ZM7A 3MN9A 1UY7A 5J6AA 4IO8A 2P9UB 4BECA 4FCRA 5BODA 4FSVA 4NH9A 1UYGA 1AJ6A 4H81A 4CWSA 1SQKA 2CCUA 4B1XB 3LMMA 2Q8GA 2YE8A 3MMVA 1YT1A 4PL8A 3T0HA 2V7YA 4JQLA 1TYQA 5AQFA 3TU5A 2BU2A 1JM6A 1EA6A 3O2FA 3EL2A 1UYEA 3IUCA 4GT8A 3FZFA 1H7SA 2QF6A 2ZDXA 1JCGA 1KXPA 1GJVA 1UYDA 3FFKB 3BMYA 4YKQA 4GEEA 5AQKA 3EKRA 2YJWA 4H0VB 4XITA 5FNCA 1NGDA 2YEDA 4FO0A 4B1UB 4LWIA 1KAZA 2YE3A 4AM6A 2E0AA 2YEBA 1YAGA 3CI5A 4CWOA 1TILA 2CG9A 3MN6A 3D2RA 5AQRA 3OW6A 1IXMA 3EHJA 2P9NA 2A40A 3U2DA 2E88A 3KVGA 3CGZA 1C0GA 4GQTA 5CTUA 3JXUA 4H5VA 1NGAA 2YKJA 2WI3A 4FCQA 3K60A 2IORA 1ZXMA 2ASMA 2W00A 4R3AA 4CE3A 4HY1A 1MDUB 1B62A 2BU6A 2P9KA 5E84A 3RLPA 2ZWHA 1B3QA 2QWNA 4M63C 1L0OA 4XC0A 5F0XA 1I5DA 3H4LA 4MBCA 1I58A 3UB5A 3T1KA 1NLVA 4DUHA 4GNIA 1ID0A 2XDXA 5AQSA 4B1WB 3LPSA 4AM7A 3G75A 4B6CA 3A0YA 4EFUA 3BUZB 3ULEA 3INWA 5CTWA 4BIUA 2A3ZA 2XK2A 1Y64A 2YI5A 4XKKA 2PBDA 1E4FT 4XKAA 1NGFA 1LCUA 1D4XA 2P9UA 3DXKA 4FCPA 3UKRA 3T10A 3QTFA 2YEHA 2YGEA 4X9LA 1ATRA 3A0XA 3I33A 4GY2B 3UKUB 2P9IA 2WERA 1NGIA 3D2EB 3GL1A 4P7AA 5D6PA 3HYZA 3DGEA 4ASGA 3GIFA 1JCFA 5BPLA 5C93A 1S3XA 2YJEA 3B27A 4JHDA 5AQIA 2QWRA 2XHRA 4FMTA 2XJXA 1DKGD 4V25A 3LDNA 2WI6A 4E00A 4R1FA 2GQPA 2XHTA 4PRVA 2Q36A 3EKSA 4L8ZA 4XCJA 2Q0RA 4ASBA 4CBWA 4GCZA 1NGEA 3TZ0A 4URLA 4HXWA 1Z5CA 2BZ5A 1BYQA 4MPCA 2CH4A 1S22A 3R4OA 4AWQA 3O6OA 3D0BA 2P9SA 3OWDA 3M3ZA 2WEQA 3WQ9A 4BAEA 2YGFA 4B1ZA 1Y8PA 5D7RA 4BQGA 4BQJA 3TZ2A 2P9PB 4JD2A 3QDDA 4MP2A 2P9NB 3MNRP 2BU8A 3O0IA 1NGHA 3LDLA 3QFUA 3CRKA 2HG1A 3FZLA 2P9LA 1S16A 3WEEB 3OMUA 3ZKDA 4H03B 3RLQA 3RKZA 3U2KA 4FL9A 2JJCA 1BKNA 1YVNA 5FPNA 2XX5A 3A5NC 5JENA 2A42A 2YE5A 2EXLA 2YEJA 4L91A 3WHAA 3NMQA 4ZKIA 4JNEA 4B7PA 3DXMA 2Q8IA 3C11A 2ASPA 4H5TA 4EAHD 5CTXA 4FPPA 4CWFA 3M6GA 4H0TB 2XX2A 2YECA 4GGLA 2WI5A 3QB0A 3PEHA 1XQSC 3TPQA 4CE2A 3K98A 4LWFA 3B24A 4PL9A 3Q5LA 1BXDA 2Q0UA 2V7ZA 2FXUA 3CWVA 3D36A 1C0FA 3A0WA 2XDSA 3R4NA 3ZXOA 4H85A 3LDPA 4CWPA 4O09A 3SL2A 4L90A 3CYGA 4L93A 1TBWA 2FYPA 2YJXA 5AQXA 5AQYA 3Q5JA 3LDOA 4H7QA 4LP0A 2UWDA 2WI1A 3CHWA 2BREA 1U2OA 2YEFA 5J71A 1E4GT 3HSCA 1U2VB 1F51A 1YT0A 2BU5A 4NH7A 2YE2A 3TTZA 5BOCA 3GIGA 4KSGA 3G7EA 3VHAA 4BXIA 1NGCA 5IDJA 1Z5BA 2QXLA 4HZ0A 4HYPA 1QQMA 2KHOA 2C2AA 2ESAA 1YC3A 1HX1A 3R92A 2P9SB 5AFUH 2HHIA 2BSMA 2XCMA 3HHUA 3ATVA 2WEPA 1UY6A 5IN9A 2Q31A 4UROA 3S5TA 4EGHA 2P9PA 5GGZA 4KBOA 4A2BA 2Q8FA 3LNUA 4PKHA 1I5BA 3HYYA 2XDKA 2Q2EB 3T2SA 4W7TA 3UE5A 4WUDA 3TZ5A 2O1WA 1QYEA 4CZLA 1BA0A 4KP4A 1JCEA 4CZKA 2D1KA 1NMDA 4WUBA 3FZKA 1KAYA 5FWKA 3DWLA 1WUAA 3EKUA 4JAVA 3C7NA 3B25A 3CJBA 1H7UA 2YI7A 2BRCA 2BUPA 4PRXA 3AY9A 1TC6A 1YERA 1AMWA 4CZEA 5CE3A 3L6QA 4RWTA 2BU7A 3R4MA 1UYLA 4MB9A 5CF0A 5AQLA 5M4MA 4CWQA 3RLRA 3VADA 4YKXA 2GWJA 2HF3A 1TH8A 5JLFA 2YJFA 5AQJA 2YE6A 2ZBKB 2C1IA 3HEKA 2VCPA 3QFPA 1UYHA 5M4HA 1YC1A 2XHXA 3T0ZA 3FV5A 4DZYA 3U67A 2V52B 4HYMA 5F5RA 3B26A 2BYIA 5AQGA 3INXA 5AQOA 5JLHA 5D7CA 4KSHA 2FF6A 3W3DA 2BT0A 3K99A 4MPEA 2IOPA 4O04A 4O07A 1IJJA 1U2VA 3A5OC 3L4IA 5EY4A 3FE1A 4CWTA 1A4HA 1OSFA 1ATNA 2O1UA 1KIJA 4EEHA 3B28A 1AH8A 2QWMA 4YKUA 4YKWA 4CE1A 2HMPA 2VCJA 2FF3B 2QG2A 4B1YB 5AR0A 3SJHA 5IDMA 1I5AA 2Q1NA 5AQQA 3A0RA 4B9QA 1I5CA 4XIPA 4K4OA 4QPJA 3EHHA 4MOTA 1TIDA 1YSRA 4ASFA 2YGAA 3CRLA 1US7A 3RSEA 2V51B 3A0ZA 4XCLA 2ASOA 1YXQA 5EVZA 5AQZA 4MPNA 3A8YA 1QZRA 4PKIA 3GIEA 1YETA 1BA1A 3CIPA 3G7BA 5F2RA 3MN5A 1QZ5A 4R3MA 1UYKA 5TKYA 1YT2A 1S14A 1NGBA 4PKGA 1AM1A 1I59A 2QFOA 3FT5A 4I6MB 5FPDA 4CI6A 3EHFA 4XE2A 1GKZA 2YI6A 1AH6A 4AWOA 2VW5A 1YS3A 2WI4A 1Y8NA 1ATSA 3GDQA 4E01A 2A5XA 3DXKB 4XIRA 3UKRB 4CZIA 1NM1A 2QW9A 3UKUA 1QQNA 4BEBA 1UY8A 2AKPA 4YKYA 4XEIA 2FXSA 3Q5KA 2YKIA 1ZW9A 2FWZA 4EFHA 5FNDA 3TUHA 3K97A 5EX5A 4JHDB 1EI1A 5I9EB 4ASAA 2E8AA 5F1XA 4CZFA 2ZKJA 1P8ZA 1BGQA 2XDUA 4CBUA 1UY9A 4I3HA 1T44A 2K5BA 4URMA 4LWEA 5AQUA 4EM7A 2YKEA 3ULEB 1Y8OA 2XJGA 5BPMA 4BE7B 5FPEA 1RGIA 2CGFA 4LPBA 1KZNA 2XDLA 1K8KB 5AQWA 2QWOA 3QMLA 2P9IB 1ZWHA 3D2FB 4JD2B 3MN7A 4WYBA 3D2EA 1QY8A 1THNA 1KAXA 4WUCA 1RFQA 2WI2A 4JAUA 4CWNA 1YUWA 1MA9B 3WEEA 5CTYA 3FZHA 2H8MA 2VWCA 5BPNA 4KTNA 4O0BA 2XX4A 3EHGA 1Y4UA 3U8XA 5FNFA 2O1VA 3RSEB 3R91A 4K43A 4K42A 2YK2A 4H0YB 1YC4A 2FTKA 4RTFD 3CGYA 1QZ6A 4GFNA 2C1GA 3FZMA 5M4PA 1TC0A 4E72A 4YKTA 3DAWA 3CQXA 3M1FA 4LWHA 2HCHA 4O05A 5AQTA 1NHJA 4BIZA 4HY6A 2IOQA 3ATUA 4CZGA 4I6MA 1Y4SA 3ZXQA 1NGJA 2BYHA 2BTZA 3H80A 2P9LB 4H5NA 1QQOA 3OPDA 2XJJA 1Z5AA 4CWRA 1BUPA 4NH8A 2YI0A 5AQNA 4CZHA 3BM9A 4XTJA 4QPKA 2YEIA 2IWUA 4E02A 4CZMA 3FT8A 5ADXH 2IWSA 4A2AA 4AWPA 4U7NA 4K41A 4MP7A 5M4KA 3VHDA 4I5SA 1HJOA 5EXWA 3HZ5A 4PU9A 3A5MC 3DXMB 5AQPA 4AS9A 3LDQA 1UYCA 4V26A 2CCTA 1B63A 1UYFA 4H5WA 1UYIA 1ZXNA 5AFUA 2PAVA 2YKCA 4EMVA 2YE9A 1NGGA 2WUSA 4XKOA 4JASA 5BN9A 2PNRA 1YSZA 4L94A 5F3KA 1K8KA 1TYQB 3R4PA 4CBXA 3D2FA 1PVGA 5ADXA 1NHIA 4U93A 3J8AA 1HPMA
chains in the Genus database with same CATH topology
4E72A 3S5TA 5JENA 3CYGA 2HHIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E72 A;  3S5T A;  5JEN A;  3CYG A;  2HHI A; 
#chains in the Genus database with same CATH topology
 2Q8H A;  4HZ5 A;  5D7D A;  4B1V A;  5BN8 A;  4ZVI A;  4KQV A;  1HLU A;  2YKB A;  3IED A;  2A41 A;  2YEE A;  5FPM A;  4EGI A;  3ZKB A;  2GWK A;  2YE7 A;  2WI7 A;  5L3J A;  2QG0 A;  3CJC A;  4J8F A;  1UYM A;  1R62 A;  2ZDY A;  1GKX A;  2HF4 A;  3HZ1 A;  4Q20 A;  5AQV A;  3U9Z A;  3GIG B;  5CPH A;  1NWK A;  2VYP A;  2HKJ A;  1YES A;  2XAB A;  2YEG A;  3A0T A;  3U9D A;  4XD8 A;  3HBT A;  4H5R A;  3KE6 A;  4CZJ A;  5M4N A;  4JN4 A;  1DEJ A;  4KFG A;  4YKZ A;  2Q97 A;  2OAN A;  4XIQ A;  3U4L A;  5AQH A;  1ESV A;  1Z59 A;  1U0Z A;  4PL7 A;  4LWG A;  3C0E A;  2YK9 A;  2FWY A;  2H55 A;  4H0X B;  3A5L C;  2YE4 A;  2JKI A;  4EGK A;  1J6Z A;  3PEJ A;  4URN A;  4U7O A;  4XDM A;  2P9K B;  2VCI A;  2QWQ A;  1H1V A;  4XJX A;  2QWL A;  3JZ3 A;  2BTF A;  4HWI A;  1MX0 A;  5D6Q A;  2XD6 A;  2CCS A;  1RDW X;  2IWX A;  4P8O A;  2QWP A;  4Z94 A;  3TZ4 A;  1LOT B;  1EQY A;  3C7N B;  5M4E A;  3OWB A;  4HXZ A;  4EFT A;  5AQM A;  1NHH A;  3VHC A;  2GFD A;  1MU5 A;  2YEA A;  3EKO A;  4YKR A;  3ZM7 A;  3MN9 A;  1UY7 A;  5J6A A;  4IO8 A;  2P9U B;  4BEC A;  4FCR A;  5BOD A;  4FSV A;  4NH9 A;  1UYG A;  1AJ6 A;  4H81 A;  4CWS A;  1SQK A;  2CCU A;  4B1X B;  3LMM A;  2Q8G A;  2YE8 A;  3MMV A;  1YT1 A;  4PL8 A;  3T0H A;  2V7Y A;  4JQL A;  1TYQ A;  5AQF A;  3TU5 A;  2BU2 A;  1JM6 A;  1EA6 A;  3O2F A;  3EL2 A;  1UYE A;  3IUC A;  4GT8 A;  3FZF A;  1H7S A;  2QF6 A;  2ZDX A;  1JCG A;  1KXP A;  1GJV A;  1UYD A;  3FFK B;  3BMY A;  4YKQ A;  4GEE A;  5AQK A;  3EKR A;  2YJW A;  4H0V B;  4XIT A;  5FNC A;  1NGD A;  2YED A;  4FO0 A;  4B1U B;  4LWI A;  1KAZ A;  2YE3 A;  4AM6 A;  2E0A A;  2YEB A;  1YAG A;  3CI5 A;  4CWO A;  1TIL A;  2CG9 A;  3MN6 A;  3D2R A;  5AQR A;  3OW6 A;  1IXM A;  3EHJ A;  2P9N A;  2A40 A;  3U2D A;  2E88 A;  3KVG A;  3CGZ A;  1C0G A;  4GQT A;  5CTU A;  3JXU A;  4H5V A;  1NGA A;  2YKJ A;  2WI3 A;  4FCQ A;  3K60 A;  2IOR A;  1ZXM A;  2ASM A;  2W00 A;  4R3A A;  4CE3 A;  4HY1 A;  1MDU B;  1B62 A;  2BU6 A;  2P9K A;  5E84 A;  3RLP A;  2ZWH A;  1B3Q A;  2QWN A;  4M63 C;  1L0O A;  4XC0 A;  5F0X A;  1I5D A;  3H4L A;  4MBC A;  1I58 A;  3UB5 A;  3T1K A;  1NLV A;  4DUH A;  4GNI A;  1ID0 A;  2XDX A;  5AQS A;  4B1W B;  3LPS A;  4AM7 A;  3G75 A;  4B6C A;  3A0Y A;  4EFU A;  3BUZ B;  3ULE A;  3INW A;  5CTW A;  4BIU A;  2A3Z A;  2XK2 A;  1Y64 A;  2YI5 A;  4XKK A;  2PBD A;  1E4F T;  4XKA A;  1NGF A;  1LCU A;  1D4X A;  2P9U A;  3DXK A;  4FCP A;  3UKR A;  3T10 A;  3QTF A;  2YEH A;  2YGE A;  4X9L A;  1ATR A;  3A0X A;  3I33 A;  4GY2 B;  3UKU B;  2P9I A;  2WER A;  1NGI A;  3D2E B;  3GL1 A;  4P7A A;  5D6P A;  3HYZ A;  3DGE A;  4ASG A;  3GIF A;  1JCF A;  5BPL A;  5C93 A;  1S3X A;  2YJE A;  3B27 A;  4JHD A;  5AQI A;  2QWR A;  2XHR A;  4FMT A;  2XJX A;  1DKG D;  4V25 A;  3LDN A;  2WI6 A;  4E00 A;  4R1F A;  2GQP A;  2XHT A;  4PRV A;  2Q36 A;  3EKS A;  4L8Z A;  4XCJ A;  2Q0R A;  4ASB A;  4CBW A;  4GCZ A;  1NGE A;  3TZ0 A;  4URL A;  4HXW A;  1Z5C A;  2BZ5 A;  1BYQ A;  4MPC A;  2CH4 A;  1S22 A;  3R4O A;  4AWQ A;  3O6O A;  3D0B A;  2P9S A;  3OWD A;  3M3Z A;  2WEQ A;  3WQ9 A;  4BAE A;  2YGF A;  4B1Z A;  1Y8P A;  5D7R A;  4BQG A;  4BQJ A;  3TZ2 A;  2P9P B;  4JD2 A;  3QDD A;  4MP2 A;  2P9N B;  3MNR P;  2BU8 A;  3O0I A;  1NGH A;  3LDL A;  3QFU A;  3CRK A;  2HG1 A;  3FZL A;  2P9L A;  1S16 A;  3WEE B;  3OMU A;  3ZKD A;  4H03 B;  3RLQ A;  3RKZ A;  3U2K A;  4FL9 A;  2JJC A;  1BKN A;  1YVN A;  5FPN A;  2XX5 A;  3A5N C;  5JEN A;  2A42 A;  2YE5 A;  2EXL A;  2YEJ A;  4L91 A;  3WHA A;  3NMQ A;  4ZKI A;  4JNE A;  4B7P A;  3DXM A;  2Q8I A;  3C11 A;  2ASP A;  4H5T A;  4EAH D;  5CTX A;  4FPP A;  4CWF A;  3M6G A;  4H0T B;  2XX2 A;  2YEC A;  4GGL A;  2WI5 A;  3QB0 A;  3PEH A;  1XQS C;  3TPQ A;  4CE2 A;  3K98 A;  4LWF A;  3B24 A;  4PL9 A;  3Q5L A;  1BXD A;  2Q0U A;  2V7Z A;  2FXU A;  3CWV A;  3D36 A;  1C0F A;  3A0W A;  2XDS A;  3R4N A;  3ZXO A;  4H85 A;  3LDP A;  4CWP A;  4O09 A;  3SL2 A;  4L90 A;  3CYG A;  4L93 A;  1TBW A;  2FYP A;  2YJX A;  5AQX A;  5AQY A;  3Q5J A;  3LDO A;  4H7Q A;  4LP0 A;  2UWD A;  2WI1 A;  3CHW A;  2BRE A;  1U2O A;  2YEF A;  5J71 A;  1E4G T;  3HSC A;  1U2V B;  1F51 A;  1YT0 A;  2BU5 A;  4NH7 A;  2YE2 A;  3TTZ A;  5BOC A;  3GIG A;  4KSG A;  3G7E A;  3VHA A;  4BXI A;  1NGC A;  5IDJ A;  1Z5B A;  2QXL A;  4HZ0 A;  4HYP A;  1QQM A;  2KHO A;  2C2A A;  2ESA A;  1YC3 A;  1HX1 A;  3R92 A;  2P9S B;  5AFU H;  2HHI A;  2BSM A;  2XCM A;  3HHU A;  3ATV A;  2WEP A;  1UY6 A;  5IN9 A;  2Q31 A;  4URO A;  3S5T A;  4EGH A;  2P9P A;  5GGZ A;  4KBO A;  4A2B A;  2Q8F A;  3LNU A;  4PKH A;  1I5B A;  3HYY A;  2XDK A;  2Q2E B;  3T2S A;  4W7T A;  3UE5 A;  4WUD A;  3TZ5 A;  2O1W A;  1QYE A;  4CZL A;  1BA0 A;  4KP4 A;  1JCE A;  4CZK A;  2D1K A;  1NMD A;  4WUB A;  3FZK A;  1KAY A;  5FWK A;  3DWL A;  1WUA A;  3EKU A;  4JAV A;  3C7N A;  3B25 A;  3CJB A;  1H7U A;  2YI7 A;  2BRC A;  2BUP A;  4PRX A;  3AY9 A;  1TC6 A;  1YER A;  1AMW A;  4CZE A;  5CE3 A;  3L6Q A;  4RWT A;  2BU7 A;  3R4M A;  1UYL A;  4MB9 A;  5CF0 A;  5AQL A;  5M4M A;  4CWQ A;  3RLR A;  3VAD A;  4YKX A;  2GWJ A;  2HF3 A;  1TH8 A;  5JLF A;  2YJF A;  5AQJ A;  2YE6 A;  2ZBK B;  2C1I A;  3HEK A;  2VCP A;  3QFP A;  1UYH A;  5M4H A;  1YC1 A;  2XHX A;  3T0Z A;  3FV5 A;  4DZY A;  3U67 A;  2V52 B;  4HYM A;  5F5R A;  3B26 A;  2BYI A;  5AQG A;  3INX A;  5AQO A;  5JLH A;  5D7C A;  4KSH A;  2FF6 A;  3W3D A;  2BT0 A;  3K99 A;  4MPE A;  2IOP A;  4O04 A;  4O07 A;  1IJJ A;  1U2V A;  3A5O C;  3L4I A;  5EY4 A;  3FE1 A;  4CWT A;  1A4H A;  1OSF A;  1ATN A;  2O1U A;  1KIJ A;  4EEH A;  3B28 A;  1AH8 A;  2QWM A;  4YKU A;  4YKW A;  4CE1 A;  2HMP A;  2VCJ A;  2FF3 B;  2QG2 A;  4B1Y B;  5AR0 A;  3SJH A;  5IDM A;  1I5A A;  2Q1N A;  5AQQ A;  3A0R A;  4B9Q A;  1I5C A;  4XIP A;  4K4O A;  4QPJ A;  3EHH A;  4MOT A;  1TID A;  1YSR A;  4ASF A;  2YGA A;  3CRL A;  1US7 A;  3RSE A;  2V51 B;  3A0Z A;  4XCL A;  2ASO A;  1YXQ A;  5EVZ A;  5AQZ A;  4MPN A;  3A8Y A;  1QZR A;  4PKI A;  3GIE A;  1YET A;  1BA1 A;  3CIP A;  3G7B A;  5F2R A;  3MN5 A;  1QZ5 A;  4R3M A;  1UYK A;  5TKY A;  1YT2 A;  1S14 A;  1NGB A;  4PKG A;  1AM1 A;  1I59 A;  2QFO A;  3FT5 A;  4I6M B;  5FPD A;  4CI6 A;  3EHF A;  4XE2 A;  1GKZ A;  2YI6 A;  1AH6 A;  4AWO A;  2VW5 A;  1YS3 A;  2WI4 A;  1Y8N A;  1ATS A;  3GDQ A;  4E01 A;  2A5X A;  3DXK B;  4XIR A;  3UKR B;  4CZI A;  1NM1 A;  2QW9 A;  3UKU A;  1QQN A;  4BEB A;  1UY8 A;  2AKP A;  4YKY A;  4XEI A;  2FXS A;  3Q5K A;  2YKI A;  1ZW9 A;  2FWZ A;  4EFH A;  5FND A;  3TUH A;  3K97 A;  5EX5 A;  4JHD B;  1EI1 A;  5I9E B;  4ASA A;  2E8A A;  5F1X A;  4CZF A;  2ZKJ A;  1P8Z A;  1BGQ A;  2XDU A;  4CBU A;  1UY9 A;  4I3H A;  1T44 A;  2K5B A;  4URM A;  4LWE A;  5AQU A;  4EM7 A;  2YKE A;  3ULE B;  1Y8O A;  2XJG A;  5BPM A;  4BE7 B;  5FPE A;  1RGI A;  2CGF A;  4LPB A;  1KZN A;  2XDL A;  1K8K B;  5AQW A;  2QWO A;  3QML A;  2P9I B;  1ZWH A;  3D2F B;  4JD2 B;  3MN7 A;  4WYB A;  3D2E A;  1QY8 A;  1THN A;  1KAX A;  4WUC A;  1RFQ A;  2WI2 A;  4JAU A;  4CWN A;  1YUW A;  1MA9 B;  3WEE A;  5CTY A;  3FZH A;  2H8M A;  2VWC A;  5BPN A;  4KTN A;  4O0B A;  2XX4 A;  3EHG A;  1Y4U A;  3U8X A;  5FNF A;  2O1V A;  3RSE B;  3R91 A;  4K43 A;  4K42 A;  2YK2 A;  4H0Y B;  1YC4 A;  2FTK A;  4RTF D;  3CGY A;  1QZ6 A;  4GFN A;  2C1G A;  3FZM A;  5M4P A;  1TC0 A;  4E72 A;  4YKT A;  3DAW A;  3CQX A;  3M1F A;  4LWH A;  2HCH A;  4O05 A;  5AQT A;  1NHJ A;  4BIZ A;  4HY6 A;  2IOQ A;  3ATU A;  4CZG A;  4I6M A;  1Y4S A;  3ZXQ A;  1NGJ A;  2BYH A;  2BTZ A;  3H80 A;  2P9L B;  4H5N A;  1QQO A;  3OPD A;  2XJJ A;  1Z5A A;  4CWR A;  1BUP A;  4NH8 A;  2YI0 A;  5AQN A;  4CZH A;  3BM9 A;  4XTJ A;  4QPK A;  2YEI A;  2IWU A;  4E02 A;  4CZM A;  3FT8 A;  5ADX H;  2IWS A;  4A2A A;  4AWP A;  4U7N A;  4K41 A;  4MP7 A;  5M4K A;  3VHD A;  4I5S A;  1HJO A;  5EXW A;  3HZ5 A;  4PU9 A;  3A5M C;  3DXM B;  5AQP A;  4AS9 A;  3LDQ A;  1UYC A;  4V26 A;  2CCT A;  1B63 A;  1UYF A;  4H5W A;  1UYI A;  1ZXN A;  5AFU A;  2PAV A;  2YKC A;  4EMV A;  2YE9 A;  1NGG A;  2WUS A;  4XKO A;  4JAS A;  5BN9 A;  2PNR A;  1YSZ A;  4L94 A;  5F3K A;  1K8K A;  1TYQ B;  3R4P A;  4CBX A;  3D2F A;  1PVG A;  5ADX A;  1NHI A;  4U93 A;  3J8A A;  1HPM A; 
#chains in the Genus database with same CATH homology
 4E72 A;  3S5T A;  5JEN A;  3CYG A;  2HHI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...