3CYGA

Crystal structure of an uncharacterized protein from fervidobacterium nodosum rt17-b1
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
215
structure length
215
Chain Sequence
LRMKVFEIVKSSTENEIVRIHVELPRLKYLKDSNFEEKFNSEVEEKIKKFVNEVKGIAQEDHDKDVQHTPYEAYVSVDVRYEGKDFLSFVVYYYQFTGGAHGITFFETYNIDLKNSKVLKLYDIIKEEAEDTIKSNILKQIEQNNTDFFPDAPMNILKDDIFSREFTISKDGLIIMYPHYDLAPYASGMPEFVIPWNVIEKFLKYDILSLLKEGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Crystal structure of an uncharacterized protein from Fervidobacterium nodosum Rt17-B1.
rcsb
source organism Fervidobacterium nodosum rt17-b1
molecule tags Structural genomics, unknown function
total genus 56
structure length 215
sequence length 215
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11738 DUF3298 Protein of unknown function (DUF3298)
A PF13739 PdaC Deacetylase PdaC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.40 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Fervidobacterium nodosum Rt17-B1 like 3cygA01
3.90.640.20 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Heat-shock cognate protein, ATPase 3cygA02
3S5TA 3CYGA 4E72A 5JENA 2HHIA
chains in the Genus database with same CATH superfamily
3A0YA 2XJXA 4MPNA 4CWNA 2D1KA 4U93A 3FZFA 3R4PA 4R3MA 3C7NA 2YKCA 4J8FA 3LNUA 5AQWA 4PL7A 4EFUA 4YKYA 3I33A 2GQPA 1ATSA 4GFNA 3PEJA 1ZXMA 4EFTA 2FWZA 1YT0A 3BM9A 2VW5A 4KSHA 4NH7A 2YGEA 2O1VA 5JLHA 3TZ5A 1YC3A 3EKUA 4JQLA 1I5DA 2P9LA 2CH4A 2WI5A 1IXMA 3CJCA 3DXMB 1AM1A 2YEBA 3C0EA 1ATRA 3LDLA 4FL9A 4XEIA 1YUWA 3TU5A 4EFHA 1U2OA 5F0XA 4GGLA 4LWFA 2H55A 2QWLA 3K97A 2FTKA 4BIUA 2YJWA 2P9NB 2BU2A 3CQXA 4PRXA 4CWQA 4JN4A 5AQLA 4JASA 4GEEA 2P9PA 5AQXA 4XJXA 4RTFD 1YS3A 3G7BA 4CBXA 3MNRP 3PEHA 3FZMA 5EY4A 4URLA 5C93A 3LMMA 2BU7A 3ULEA 4B1ZA 3B25A 4XCLA 2ASMA 2Q8FA 3CHWA 3FZKA 5BPLA 4U7OA 5AQNA 3A8YA 4BE7B 3ATUA 4GNIA 2QF6A 4CWRA 2VWCA 3DGEA 3TPQA 1B62A 4EGIA 1HX1A 2GFDA 2V7ZA 2YE8A 2IWUA 1NMDA 4AWOA 4L94A 4KTNA 2QG2A 3S5TA 3GL1A 4YKQA 1NHIA 4CWPA 4ASFA 3GIEA 5E84A 2V52B 3INWA 4B1VA 5J71A 4H5NA 1UYCA 2PBDA 1UY6A 3T0ZA 1T44A 2FF3B 5F1XA 2HCHA 1Y8OA 1MA9B 4KFGA 5TKYA 4HXZA 3IEDA 3Q5LA 4XITA 2A5XA 5AQGA 5AQQA 1YC1A 4XCJA 2Q0UA 1U2VB 3R4NA 4CWTA 3OW6A 4PL9A 1S16A 4B1UB 3D0BA 4AM6A 2WUSA 3HSCA 4B1WB 4BECA 3T2SA 1YESA 2Q1NA 3RSEA 3CI5A 4GQTA 2GWJA 3D2FB 4A2BA 1AMWA 1TIDA 5AQYA 2QXLA 4CWOA 4P8OA 1RDWX 1NWKA 4HY1A 4E72A 2P9UA 5AR0A 2P9KA 3RLPA 2YE3A 2BU8A 2Q2EB 3HHUA 4EGHA 3CYGA 3OWBA 1S3XA 4EAHD 5CTXA 2BREA 2JJCA 4L93A 4H7QA 4GCZA 4XIQA 2Q8GA 2CCTA 2XK2A 3UKUA 5FPEA 1A4HA 3NMQA 4PU9A 1TH8A 2XCMA 1ZW9A 2XX4A 3LDQA 4CZMA 4K41A 1UYIA 3SJHA 5AQJA 4O07A 4EEHA 2V7YA 1H7SA 2VCJA 1Z5CA 3D2RA 1SQKA 2HG1A 3EHFA 1I5BA 5AQFA 4LWHA 4QPJA 5AFUH 1AH8A 2XDLA 5D7DA 2YI5A 4CZLA 3ZKDA 5JENA 2QWOA 1K8KB 1RGIA 4KSGA 3DXMA 2C2AA 2BT0A 5M4HA 2Q97A 2P9IB 5BODA 2YEHA 1E4GT 3O2FA 3KE6A 1YSZA 4MP7A 4V26A 2P9NA 5I9EB 1MU5A 1IJJA 4HWIA 4ASGA 1ESVA 1BGQA 1B63A 1EI1A 2FWYA 4B6CA 1UYFA 2E88A 5CTUA 4YKWA 5ADXH 4H5RA 2GWKA 1TILA 1KAZA 3TZ0A 1NGBA 3A0TA 3O6OA 4XKKA 3INXA 1RFQA 1J6ZA 2P9SA 1YXQA 3DXKB 3TZ4A 3EKRA 2OANA 4XD8A 4LWEA 1GKXA 3MN5A 2BSMA 3M6GA 4CZIA 3OPDA 3LDOA 5AQHA 2WEPA 1UYMA 2O1UA 4XTJA 3D36A 5L3JA 1UY7A 4CZJA 3O0IA 2BRCA 1YSRA 3ZKBA 1NGAA 2XDKA 1UYGA 1UY9A 4ASBA 5FNDA 1NHHA 4MOTA 4KBOA 1YT2A 1U2VA 3KVGA 3R92A 4CWFA 1EQYA 4FCRA 1NGHA 4M63C 1TC6A 1JCFA 4WUDA 5EXWA 1QYEA 2O1WA 3R4OA 2HMPA 5AQZA 5BPMA 2BUPA 5M4PA 2YEGA 3A5NC 2W00A 3D2FA 5CE3A 1TYQB 3CRLA 4O04A 5D6PA 2V51B 2XJJA 4HXWA 3B26A 1Y64A 2WERA 2YK2A 5M4KA 3UE5A 1WUAA 1LOTB 1GJVA 1QZ6A 1YC4A 4XC0A 5F3KA 5AQTA 3U9ZA 1F51A 3U2DA 4FMTA 3SL2A 2H8MA 3WEEA 4B1XB 4WUCA 4DZYA 3D2EB 5BOCA 2BYHA 4LWIA 3MN9A 4BQGA 2A3ZA 3BUZB 3ATVA 3M3ZA 3CRKA 3TTZA 1L0OA 3CWVA 2YE9A 4R1FA 1S22A 3H80A 1Y8NA 5FPNA 5D6QA 5M4MA 4MP2A 2Q8IA 4MBCA 1C0FA 3FT8A 5J6AA 1UYLA 3A0ZA 1NGJA 3EKSA 2XX2A 4WUBA 3RLQA 1ATNA 2VCIA 4HY6A 2XHXA 1K8KA 1UYDA 2IWSA 1YERA 5D7RA 4ZVIA 2FXSA 4U7NA 2P9IA 3U4LA 1TC0A 2BTFA 1NGFA 2XDXA 3Q5KA 3DAWA 1NGIA 1YT1A 4GT8A 1QZRA 5AQMA 4KP4A 2YE4A 4H0VB 3K99A 5EVZA 1UYHA 2YKEA 1ZXNA 2ZBKB 1Z5AA 4BIZA 2YKBA 5AQPA 3HYYA 4CE2A 2XABA 5IDJA 1AH6A 3B28A 3U9DA 2BZ5A 3QFPA 3W3DA 2P9PB 4URMA 3EKOA 4YKTA 5IN9A 1Y4UA 5AQKA 3UB5A 3DXKA 2WI4A 5EX5A 4CI6A 4JAVA 1I59A 4Z94A 3HZ1A 1BUPA 2HF3A 4PKHA 3R4MA 4PKGA 5AQIA 4P7AA 5JLFA 1BXDA 2CG9A 4H03B 4H5TA 2XDSA 4K43A 5AQOA 4A2AA 3VHCA 2YEAA 3B24A 3JZ3A 4H5WA 1Y4SA 1XQSC 4CBUA 2Q36A 4KQVA 3CIPA 3L6QA 1B3QA 2CCSA 1Z5BA 2YEDA 4I3HA 2XHRA 1HLUA 4JNEA 4EGKA 3M1FA 4B1YB 1YVNA 5FPDA 2KHOA 4AWQA 2ZKJA 4Q20A 2YJEA 1KXPA 5CTYA 5M4NA 1TYQA 3UKRB 2ESAA 2E8AA 2JKIA 4MB9A 3HYZA 2QWQA 2YI7A 4MPCA 4XE2A 2CCUA 2YE7A 1QY8A 2IWXA 3GIGB 2QWNA 1JM6A 1MX0A 2QFOA 4JD2B 5F2RA 3RSEB 4JHDB 3JXUA 3T10A 4DUHA 4LWGA 2P9UB 4NH9A 4HZ0A 4CZFA 5FWKA 3T0HA 4B9QA 2QWRA 3ZXQA 2BU5A 3A5OC 1KZNA 3D2EA 1HJOA 5CTWA 3TUHA 1BYQA 3K60A 5AQVA 1C0GA 4H0XB 1QQOA 3LDNA 2FYPA 4V25A 2ZDYA 5CPHA 3FZHA 3EHJA 3AY9A 1MDUB 4FCPA 1UYEA 3UKUB 2WEQA 3T1KA 4BEBA 4I6MB 4X9LA 2BTZA 2XHTA 4GY2B 4B7PA 3L4IA 4ASAA 4CE3A 5AQUA 4PKIA 4EM7A 4L90A 2K5BA 1ID0A 1NLVA 4FSVA 4O0BA 3FFKB 4XKOA 4CZKA 3RKZA 2QWPA 2C1IA 4H85A 2YEFA 3R91A 2BU6A 3G75A 5CF0A 4WYBA 4YKZA 2YE2A 5AQRA 1I5CA 3QTFA 2Q0RA 2YGFA 4YKUA 2QG0A 3ZM7A 4LP0A 1PVGA 1GKZA 2FXUA 4K4OA 1YETA 2EXLA 3G7EA 3K98A 2YEJA 2E0AA 2YKJA 4XKAA 1BA0A 1H1VA 4HYMA 1OSFA 1BA1A 2XX5A 1S14A 4FO0A 5AFUA 1JCGA 3A5MC 4UROA 3EL2A 4H0YB 1ZWHA 2HHIA 1KIJA 4YKXA 1UY8A 3QDDA 5GGZA 4E02A 4E01A 4HZ5A 2P9SB 1P8ZA 4NH8A 3QMLA 2QW9A 2YJXA 3C7NB 1R62A 3U67A 4CE1A 1UYKA 2ASPA 4O05A 3FT5A 3U2KA 4CBWA 3ZXOA 3VHDA 1I58A 3A0XA 1Z59A 3VHAA 2XJGA 2YEIA 1U0ZA 2WI6A 2XD6A 2P9LB 2YJFA 4IO8A 2A41A 2CGFA 5D7CA 1E4FT 4AWPA 5ADXA 4H81A 2ZWHA 5IDMA 1QQMA 2HF4A 2A42A 4YKRA 1H7UA 1NHJA 3UKRA 5FNFA 3QFUA 1HPMA 1KAXA 4L91A 3MMVA 4W7TA 2ASOA 1THNA 4URNA 1KAYA 2YKIA 1NGCA 1NGGA 3DWLA 2PNRA 3GIGA 3ULEB 2Q8HA 4E00A 4JD2A 2IOPA 3WHAA 3OMUA 3CGZA 4JHDA 3HZ5A 3LPSA 3FZLA 2YI6A 4XDMA 1DKGD 1NGDA 2QWMA 4CZGA 2HKJA 4BXIA 2BYIA 4HYPA 4JAUA 1BKNA 5BN8A 1LCUA 2VYPA 4RWTA 1QQNA 3B27A 1US7A 4I5SA 2PAVA 4AM7A 3WEEB 3U8XA 3H4LA 2YI0A 3A0RA 3WQ9A 4BAEA 3IUCA 4EMVA 4I6MA 2YECA 4XIRA 4O09A 4QPKA 2A40A 5BPNA 1I5AA 4XIPA 4H0TB 2WI1A 3GIFA 3FE1A 4PL8A 2IORA 4BQJA 4CWSA 1QZ5A 5BN9A 3EHGA 2FF6A 2VCPA 4K42A 1Y8PA 4CZHA 4L8ZA 2WI2A 4FCQA 3LDPA 5FNCA 4FPPA 3QB0A 3RLRA 2UWDA 4CZEA 3A0WA 2XDUA 1NM1A 1TBWA 1AJ6A 2YE5A 2YE6A 3MN6A 3OWDA 1D4XA 2C1GA 1EA6A 4AS9A 3GDQA 3HEKA 2AKPA 2YGAA 2WI7A 5AQSA 3EHHA 3C11A 5F5RA 2WI3A 4LPBA 3CGYA 2P9KB 3VADA 3CJBA 4H5VA 3HBTA 1JCEA 4PRVA 3TZ2A 2ZDXA 3FV5A 2YK9A 1YAGA 3A5LC 2Q31A 5FPMA 2IOQA 2YEEA 3BMYA 4ZKIA 1DEJA 1NGEA 3MN7A 5M4EA 3Q5JA 4R3AA 4MPEA 3J8AA
chains in the Genus database with same CATH topology
3S5TA 3CYGA 4E72A 5JENA 2HHIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S5T A;  3CYG A;  4E72 A;  5JEN A;  2HHI A; 
#chains in the Genus database with same CATH topology
 3A0Y A;  2XJX A;  4MPN A;  4CWN A;  2D1K A;  4U93 A;  3FZF A;  3R4P A;  4R3M A;  3C7N A;  2YKC A;  4J8F A;  3LNU A;  5AQW A;  4PL7 A;  4EFU A;  4YKY A;  3I33 A;  2GQP A;  1ATS A;  4GFN A;  3PEJ A;  1ZXM A;  4EFT A;  2FWZ A;  1YT0 A;  3BM9 A;  2VW5 A;  4KSH A;  4NH7 A;  2YGE A;  2O1V A;  5JLH A;  3TZ5 A;  1YC3 A;  3EKU A;  4JQL A;  1I5D A;  2P9L A;  2CH4 A;  2WI5 A;  1IXM A;  3CJC A;  3DXM B;  1AM1 A;  2YEB A;  3C0E A;  1ATR A;  3LDL A;  4FL9 A;  4XEI A;  1YUW A;  3TU5 A;  4EFH A;  1U2O A;  5F0X A;  4GGL A;  4LWF A;  2H55 A;  2QWL A;  3K97 A;  2FTK A;  4BIU A;  2YJW A;  2P9N B;  2BU2 A;  3CQX A;  4PRX A;  4CWQ A;  4JN4 A;  5AQL A;  4JAS A;  4GEE A;  2P9P A;  5AQX A;  4XJX A;  4RTF D;  1YS3 A;  3G7B A;  4CBX A;  3MNR P;  3PEH A;  3FZM A;  5EY4 A;  4URL A;  5C93 A;  3LMM A;  2BU7 A;  3ULE A;  4B1Z A;  3B25 A;  4XCL A;  2ASM A;  2Q8F A;  3CHW A;  3FZK A;  5BPL A;  4U7O A;  5AQN A;  3A8Y A;  4BE7 B;  3ATU A;  4GNI A;  2QF6 A;  4CWR A;  2VWC A;  3DGE A;  3TPQ A;  1B62 A;  4EGI A;  1HX1 A;  2GFD A;  2V7Z A;  2YE8 A;  2IWU A;  1NMD A;  4AWO A;  4L94 A;  4KTN A;  2QG2 A;  3S5T A;  3GL1 A;  4YKQ A;  1NHI A;  4CWP A;  4ASF A;  3GIE A;  5E84 A;  2V52 B;  3INW A;  4B1V A;  5J71 A;  4H5N A;  1UYC A;  2PBD A;  1UY6 A;  3T0Z A;  1T44 A;  2FF3 B;  5F1X A;  2HCH A;  1Y8O A;  1MA9 B;  4KFG A;  5TKY A;  4HXZ A;  3IED A;  3Q5L A;  4XIT A;  2A5X A;  5AQG A;  5AQQ A;  1YC1 A;  4XCJ A;  2Q0U A;  1U2V B;  3R4N A;  4CWT A;  3OW6 A;  4PL9 A;  1S16 A;  4B1U B;  3D0B A;  4AM6 A;  2WUS A;  3HSC A;  4B1W B;  4BEC A;  3T2S A;  1YES A;  2Q1N A;  3RSE A;  3CI5 A;  4GQT A;  2GWJ A;  3D2F B;  4A2B A;  1AMW A;  1TID A;  5AQY A;  2QXL A;  4CWO A;  4P8O A;  1RDW X;  1NWK A;  4HY1 A;  4E72 A;  2P9U A;  5AR0 A;  2P9K A;  3RLP A;  2YE3 A;  2BU8 A;  2Q2E B;  3HHU A;  4EGH A;  3CYG A;  3OWB A;  1S3X A;  4EAH D;  5CTX A;  2BRE A;  2JJC A;  4L93 A;  4H7Q A;  4GCZ A;  4XIQ A;  2Q8G A;  2CCT A;  2XK2 A;  3UKU A;  5FPE A;  1A4H A;  3NMQ A;  4PU9 A;  1TH8 A;  2XCM A;  1ZW9 A;  2XX4 A;  3LDQ A;  4CZM A;  4K41 A;  1UYI A;  3SJH A;  5AQJ A;  4O07 A;  4EEH A;  2V7Y A;  1H7S A;  2VCJ A;  1Z5C A;  3D2R A;  1SQK A;  2HG1 A;  3EHF A;  1I5B A;  5AQF A;  4LWH A;  4QPJ A;  5AFU H;  1AH8 A;  2XDL A;  5D7D A;  2YI5 A;  4CZL A;  3ZKD A;  5JEN A;  2QWO A;  1K8K B;  1RGI A;  4KSG A;  3DXM A;  2C2A A;  2BT0 A;  5M4H A;  2Q97 A;  2P9I B;  5BOD A;  2YEH A;  1E4G T;  3O2F A;  3KE6 A;  1YSZ A;  4MP7 A;  4V26 A;  2P9N A;  5I9E B;  1MU5 A;  1IJJ A;  4HWI A;  4ASG A;  1ESV A;  1BGQ A;  1B63 A;  1EI1 A;  2FWY A;  4B6C A;  1UYF A;  2E88 A;  5CTU A;  4YKW A;  5ADX H;  4H5R A;  2GWK A;  1TIL A;  1KAZ A;  3TZ0 A;  1NGB A;  3A0T A;  3O6O A;  4XKK A;  3INX A;  1RFQ A;  1J6Z A;  2P9S A;  1YXQ A;  3DXK B;  3TZ4 A;  3EKR A;  2OAN A;  4XD8 A;  4LWE A;  1GKX A;  3MN5 A;  2BSM A;  3M6G A;  4CZI A;  3OPD A;  3LDO A;  5AQH A;  2WEP A;  1UYM A;  2O1U A;  4XTJ A;  3D36 A;  5L3J A;  1UY7 A;  4CZJ A;  3O0I A;  2BRC A;  1YSR A;  3ZKB A;  1NGA A;  2XDK A;  1UYG A;  1UY9 A;  4ASB A;  5FND A;  1NHH A;  4MOT A;  4KBO A;  1YT2 A;  1U2V A;  3KVG A;  3R92 A;  4CWF A;  1EQY A;  4FCR A;  1NGH A;  4M63 C;  1TC6 A;  1JCF A;  4WUD A;  5EXW A;  1QYE A;  2O1W A;  3R4O A;  2HMP A;  5AQZ A;  5BPM A;  2BUP A;  5M4P A;  2YEG A;  3A5N C;  2W00 A;  3D2F A;  5CE3 A;  1TYQ B;  3CRL A;  4O04 A;  5D6P A;  2V51 B;  2XJJ A;  4HXW A;  3B26 A;  1Y64 A;  2WER A;  2YK2 A;  5M4K A;  3UE5 A;  1WUA A;  1LOT B;  1GJV A;  1QZ6 A;  1YC4 A;  4XC0 A;  5F3K A;  5AQT A;  3U9Z A;  1F51 A;  3U2D A;  4FMT A;  3SL2 A;  2H8M A;  3WEE A;  4B1X B;  4WUC A;  4DZY A;  3D2E B;  5BOC A;  2BYH A;  4LWI A;  3MN9 A;  4BQG A;  2A3Z A;  3BUZ B;  3ATV A;  3M3Z A;  3CRK A;  3TTZ A;  1L0O A;  3CWV A;  2YE9 A;  4R1F A;  1S22 A;  3H80 A;  1Y8N A;  5FPN A;  5D6Q A;  5M4M A;  4MP2 A;  2Q8I A;  4MBC A;  1C0F A;  3FT8 A;  5J6A A;  1UYL A;  3A0Z A;  1NGJ A;  3EKS A;  2XX2 A;  4WUB A;  3RLQ A;  1ATN A;  2VCI A;  4HY6 A;  2XHX A;  1K8K A;  1UYD A;  2IWS A;  1YER A;  5D7R A;  4ZVI A;  2FXS A;  4U7N A;  2P9I A;  3U4L A;  1TC0 A;  2BTF A;  1NGF A;  2XDX A;  3Q5K A;  3DAW A;  1NGI A;  1YT1 A;  4GT8 A;  1QZR A;  5AQM A;  4KP4 A;  2YE4 A;  4H0V B;  3K99 A;  5EVZ A;  1UYH A;  2YKE A;  1ZXN A;  2ZBK B;  1Z5A A;  4BIZ A;  2YKB A;  5AQP A;  3HYY A;  4CE2 A;  2XAB A;  5IDJ A;  1AH6 A;  3B28 A;  3U9D A;  2BZ5 A;  3QFP A;  3W3D A;  2P9P B;  4URM A;  3EKO A;  4YKT A;  5IN9 A;  1Y4U A;  5AQK A;  3UB5 A;  3DXK A;  2WI4 A;  5EX5 A;  4CI6 A;  4JAV A;  1I59 A;  4Z94 A;  3HZ1 A;  1BUP A;  2HF3 A;  4PKH A;  3R4M A;  4PKG A;  5AQI A;  4P7A A;  5JLF A;  1BXD A;  2CG9 A;  4H03 B;  4H5T A;  2XDS A;  4K43 A;  5AQO A;  4A2A A;  3VHC A;  2YEA A;  3B24 A;  3JZ3 A;  4H5W A;  1Y4S A;  1XQS C;  4CBU A;  2Q36 A;  4KQV A;  3CIP A;  3L6Q A;  1B3Q A;  2CCS A;  1Z5B A;  2YED A;  4I3H A;  2XHR A;  1HLU A;  4JNE A;  4EGK A;  3M1F A;  4B1Y B;  1YVN A;  5FPD A;  2KHO A;  4AWQ A;  2ZKJ A;  4Q20 A;  2YJE A;  1KXP A;  5CTY A;  5M4N A;  1TYQ A;  3UKR B;  2ESA A;  2E8A A;  2JKI A;  4MB9 A;  3HYZ A;  2QWQ A;  2YI7 A;  4MPC A;  4XE2 A;  2CCU A;  2YE7 A;  1QY8 A;  2IWX A;  3GIG B;  2QWN A;  1JM6 A;  1MX0 A;  2QFO A;  4JD2 B;  5F2R A;  3RSE B;  4JHD B;  3JXU A;  3T10 A;  4DUH A;  4LWG A;  2P9U B;  4NH9 A;  4HZ0 A;  4CZF A;  5FWK A;  3T0H A;  4B9Q A;  2QWR A;  3ZXQ A;  2BU5 A;  3A5O C;  1KZN A;  3D2E A;  1HJO A;  5CTW A;  3TUH A;  1BYQ A;  3K60 A;  5AQV A;  1C0G A;  4H0X B;  1QQO A;  3LDN A;  2FYP A;  4V25 A;  2ZDY A;  5CPH A;  3FZH A;  3EHJ A;  3AY9 A;  1MDU B;  4FCP A;  1UYE A;  3UKU B;  2WEQ A;  3T1K A;  4BEB A;  4I6M B;  4X9L A;  2BTZ A;  2XHT A;  4GY2 B;  4B7P A;  3L4I A;  4ASA A;  4CE3 A;  5AQU A;  4PKI A;  4EM7 A;  4L90 A;  2K5B A;  1ID0 A;  1NLV A;  4FSV A;  4O0B A;  3FFK B;  4XKO A;  4CZK A;  3RKZ A;  2QWP A;  2C1I A;  4H85 A;  2YEF A;  3R91 A;  2BU6 A;  3G75 A;  5CF0 A;  4WYB A;  4YKZ A;  2YE2 A;  5AQR A;  1I5C A;  3QTF A;  2Q0R A;  2YGF A;  4YKU A;  2QG0 A;  3ZM7 A;  4LP0 A;  1PVG A;  1GKZ A;  2FXU A;  4K4O A;  1YET A;  2EXL A;  3G7E A;  3K98 A;  2YEJ A;  2E0A A;  2YKJ A;  4XKA A;  1BA0 A;  1H1V A;  4HYM A;  1OSF A;  1BA1 A;  2XX5 A;  1S14 A;  4FO0 A;  5AFU A;  1JCG A;  3A5M C;  4URO A;  3EL2 A;  4H0Y B;  1ZWH A;  2HHI A;  1KIJ A;  4YKX A;  1UY8 A;  3QDD A;  5GGZ A;  4E02 A;  4E01 A;  4HZ5 A;  2P9S B;  1P8Z A;  4NH8 A;  3QML A;  2QW9 A;  2YJX A;  3C7N B;  1R62 A;  3U67 A;  4CE1 A;  1UYK A;  2ASP A;  4O05 A;  3FT5 A;  3U2K A;  4CBW A;  3ZXO A;  3VHD A;  1I58 A;  3A0X A;  1Z59 A;  3VHA A;  2XJG A;  2YEI A;  1U0Z A;  2WI6 A;  2XD6 A;  2P9L B;  2YJF A;  4IO8 A;  2A41 A;  2CGF A;  5D7C A;  1E4F T;  4AWP A;  5ADX A;  4H81 A;  2ZWH A;  5IDM A;  1QQM A;  2HF4 A;  2A42 A;  4YKR A;  1H7U A;  1NHJ A;  3UKR A;  5FNF A;  3QFU A;  1HPM A;  1KAX A;  4L91 A;  3MMV A;  4W7T A;  2ASO A;  1THN A;  4URN A;  1KAY A;  2YKI A;  1NGC A;  1NGG A;  3DWL A;  2PNR A;  3GIG A;  3ULE B;  2Q8H A;  4E00 A;  4JD2 A;  2IOP A;  3WHA A;  3OMU A;  3CGZ A;  4JHD A;  3HZ5 A;  3LPS A;  3FZL A;  2YI6 A;  4XDM A;  1DKG D;  1NGD A;  2QWM A;  4CZG A;  2HKJ A;  4BXI A;  2BYI A;  4HYP A;  4JAU A;  1BKN A;  5BN8 A;  1LCU A;  2VYP A;  4RWT A;  1QQN A;  3B27 A;  1US7 A;  4I5S A;  2PAV A;  4AM7 A;  3WEE B;  3U8X A;  3H4L A;  2YI0 A;  3A0R A;  3WQ9 A;  4BAE A;  3IUC A;  4EMV A;  4I6M A;  2YEC A;  4XIR A;  4O09 A;  4QPK A;  2A40 A;  5BPN A;  1I5A A;  4XIP A;  4H0T B;  2WI1 A;  3GIF A;  3FE1 A;  4PL8 A;  2IOR A;  4BQJ A;  4CWS A;  1QZ5 A;  5BN9 A;  3EHG A;  2FF6 A;  2VCP A;  4K42 A;  1Y8P A;  4CZH A;  4L8Z A;  2WI2 A;  4FCQ A;  3LDP A;  5FNC A;  4FPP A;  3QB0 A;  3RLR A;  2UWD A;  4CZE A;  3A0W A;  2XDU A;  1NM1 A;  1TBW A;  1AJ6 A;  2YE5 A;  2YE6 A;  3MN6 A;  3OWD A;  1D4X A;  2C1G A;  1EA6 A;  4AS9 A;  3GDQ A;  3HEK A;  2AKP A;  2YGA A;  2WI7 A;  5AQS A;  3EHH A;  3C11 A;  5F5R A;  2WI3 A;  4LPB A;  3CGY A;  2P9K B;  3VAD A;  3CJB A;  4H5V A;  3HBT A;  1JCE A;  4PRV A;  3TZ2 A;  2ZDX A;  3FV5 A;  2YK9 A;  1YAG A;  3A5L C;  2Q31 A;  5FPM A;  2IOQ A;  2YEE A;  3BMY A;  4ZKI A;  1DEJ A;  1NGE A;  3MN7 A;  5M4E A;  3Q5J A;  4R3A A;  4MPE A;  3J8A A; 
#chains in the Genus database with same CATH homology
 3S5T A;  3CYG A;  4E72 A;  5JEN A;  2HHI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...