1DT4A

Crystal structure of nova-1 kh3 k-homology rna-binding domain
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
73
structure length
73
Chain Sequence
MKDVVEIAVPENLVGAILGKGGKTLVEYQELTGCRIQISKKGEFLPGTRNRKVTITGTPAATQAAQYLITQRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords NEURO-ONCOLOGICAL VENTRAL ANTIGEN 1
publication title Crystal structures of Nova-1 and Nova-2 K-homology RNA-binding domains.
pubmed doi rcsb
source organism Homo sapiens
total genus 18
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2000-01-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 1dt4A00
2HH2A 1X4MA 2JA9A 2CTJA 2E3UA 4IFDG 2CTKA 2Z0SA 4AIMA 1EC6A 5C0XG 2YQRA 1ZZJA 2DGRA 2P2RA 2JVZA 2CTFA 1ZZIA 4WANA 5K36G 2ANRA 4QMFB 2CTMA 1TUAA 4JVYA 4JVHA 2QNDA 1WVNA 4BA1I 2AXYA 3U1KA 4OO1G 4B8TA 1KHMA 2BL5A 2JEAI 2JZXA 4BA2I 4NBQA 2JE6I 1VIGA 2OPUA 2OPVA 3L7ZC 2ANNA 3V69A 4LIJA 5JEAG 2PQUA 2CTLA 2MJHA 3AEVB 1ZZKA 2CTEA 2HH3A 1X4NA 1WE8A 2FMRA 2CPQA 1DT4A 4WALA 2NN6G 1K1GA 1DTJA 1J5KA 3VKEA 1VIHA 4AM3A 2PY9A 2JEBI 1ZTGA 1J4WA 2BA0A
chains in the Genus database with same CATH superfamily
4GKKH 4X65H 2CTJA 3J7AK 1SEIA 2CTKA 4AIMA 1EC6A 1ZZJA 2CWFA 2YQRA 1XNRH 4KHPH 1V8CA 4LFCH 4QMFB 5K36G 1IBLH 4K0KH 1WVNA 3U1KA 4LFBH 3EZJA 4LF9H 4JI2H 2K1HA 4JI6H 2M8WA 1V9NA 5IWAH 2CPMA 3V69A 4JI8H 1ZZKA 2HH3A 1X4NA 4FJUA 4NZTM 2FMRA 4LF5H 2PT7G 1DT4A 2FFMA 1FJGH 1Z2IA 5LMNH 1DTJA 1J5KA 4LF7H 1N34H 2M6QA 3VKEA 3OTOH 2FPHX 1FKAH 2X06A 3RF2A 3KDGA 4DV1H 1NXUA 2ZM6H 2UUCH 4OCHA 3JAMW 4JI7H 3J80W 2P2RA 2JVZA 3FAUA 1ZZIA 1HNZH 2ANRA 4JI1H 1MSZA 2VQFH 1XMOH 1AN7A 4DV6H 4E9JA 1N33H 4B8TA 1F0XA 4OX9H 2JEAI 4JYAH 2UXBH 2JE6I 2ANNA 3L7ZC 4LIJA 1UG8A 1IBMH 4LFAH 2CTLA 2UUAH 2CTEA 1WTJA 4DV4H 3OSSD 4WALA 2G8YA 3OETA 3GR5A 1I94H 1XNQH 1IBKH 3T1YH 4YHHH 4AM3A 2JEBI 1VBIA 1J4WA 4JI0H 1XRHA 3UOEA 2HH2A 5LMUH 1X4MA 2JA9A 4H8AA 3J81W 4DR4H 2E3UA 5BR8H 1HR0H 2Z0SA 5C0XG 4WANA 2DGRA 4AQYH 1XMQH 2UU9H 2E5LH 3I0PA 4G08A 4JVYA 4JVHA 4NXMH 2UXCH 2QNDA 2VKCA 5A2QW 2Y3MA 4DV5H 4OO1G 1KHMA 2BL5A 1X0AA 4JI4H 1J5EH 4DV2H 1VIGA 2LTMA 2PQUA 4X64H 2MJHA 3KDKA 2LF0A 4DV0H 5DT9A 4B3RH 4NZRM 1K1GA 1HNWH 3GABA 1S20A 4LF8H 4EC5A 4NXNH 4DUZH 1ZTGA 5LL6b 2BA0A 4X62H 4JI3H 4DR2H 3GKUA 1ODHA 4DR5H 4IFDG 4B3TH 4DV7H 2HHHH 1PQXA 2CTFA 4LF6H 4DR3H 1S03G 4YY3H 4LF4H 2CTMA 4FJSA 1TUAA 4B3SH 4BA1I 2ZQEA 2AXYA 4B3MH 1I6UA 4DR1H 4JV5H 4BA2I 2JZXA 2O4CA 1HNXH 5FLXW 4NBQA 4JI5H 4DR6H 2OPUA 2UXDH 2OPVA 5IT9W 1X9ZA 2UUBH 2D9IA 5JEAG 4DV3H 3AEVB 1N36H 2LTLA 3NCVA 2A1SA 2F4VH 4PDBA 1WE8A 2CPQA 2LRRA 4OD6A 1WHRA 3SB1A 2NN6G 4DR7H 4GKJH 4DUYH 1N32H 2CWHA 4X66H 1VIHA 3QD7X 2PY9A 3T1HH 4B8CD 2VQEH
chains in the Genus database with same CATH topology
2HH2A 1X4MA 2JA9A 2CTJA 2E3UA 4IFDG 2CTKA 2Z0SA 4AIMA 1EC6A 5C0XG 2YQRA 1ZZJA 2DGRA 2P2RA 2JVZA 2CTFA 1ZZIA 4WANA 5K36G 2ANRA 4QMFB 2CTMA 1TUAA 4JVYA 4JVHA 2QNDA 1WVNA 4BA1I 2AXYA 3U1KA 4OO1G 4B8TA 1KHMA 2BL5A 2JEAI 2JZXA 4BA2I 4NBQA 2JE6I 1VIGA 2OPUA 2OPVA 3L7ZC 2ANNA 3V69A 4LIJA 5JEAG 2PQUA 2CTLA 2MJHA 3AEVB 1ZZKA 2CTEA 2HH3A 1X4NA 1WE8A 2FMRA 2CPQA 1DT4A 4WALA 2NN6G 1K1GA 1DTJA 1J5KA 3VKEA 1VIHA 4AM3A 2PY9A 2JEBI 1ZTGA 1J4WA 2BA0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HH2 A;  1X4M A;  2JA9 A;  2CTJ A;  2E3U A;  4IFD G;  2CTK A;  2Z0S A;  4AIM A;  1EC6 A;  5C0X G;  2YQR A;  1ZZJ A;  2DGR A;  2P2R A;  2JVZ A;  2CTF A;  1ZZI A;  4WAN A;  5K36 G;  2ANR A;  4QMF B;  2CTM A;  1TUA A;  4JVY A;  4JVH A;  2QND A;  1WVN A;  4BA1 I;  2AXY A;  3U1K A;  4OO1 G;  4B8T A;  1KHM A;  2BL5 A;  2JEA I;  2JZX A;  4BA2 I;  4NBQ A;  2JE6 I;  1VIG A;  2OPU A;  2OPV A;  3L7Z C;  2ANN A;  3V69 A;  4LIJ A;  5JEA G;  2PQU A;  2CTL A;  2MJH A;  3AEV B;  1ZZK A;  2CTE A;  2HH3 A;  1X4N A;  1WE8 A;  2FMR A;  2CPQ A;  1DT4 A;  4WAL A;  2NN6 G;  1K1G A;  1DTJ A;  1J5K A;  3VKE A;  1VIH A;  4AM3 A;  2PY9 A;  2JEB I;  1ZTG A;  1J4W A;  2BA0 A; 
#chains in the Genus database with same CATH topology
 4GKK H;  4X65 H;  2CTJ A;  3J7A K;  1SEI A;  2CTK A;  4AIM A;  1EC6 A;  1ZZJ A;  2CWF A;  2YQR A;  1XNR H;  4KHP H;  1V8C A;  4LFC H;  4QMF B;  5K36 G;  1IBL H;  4K0K H;  1WVN A;  3U1K A;  4LFB H;  3EZJ A;  4LF9 H;  4JI2 H;  2K1H A;  4JI6 H;  2M8W A;  1V9N A;  5IWA H;  2CPM A;  3V69 A;  4JI8 H;  1ZZK A;  2HH3 A;  1X4N A;  4FJU A;  4NZT M;  2FMR A;  4LF5 H;  2PT7 G;  1DT4 A;  2FFM A;  1FJG H;  1Z2I A;  5LMN H;  1DTJ A;  1J5K A;  4LF7 H;  1N34 H;  2M6Q A;  3VKE A;  3OTO H;  2FPH X;  1FKA H;  2X06 A;  3RF2 A;  3KDG A;  4DV1 H;  1NXU A;  2ZM6 H;  2UUC H;  4OCH A;  3JAM W;  4JI7 H;  3J80 W;  2P2R A;  2JVZ A;  3FAU A;  1ZZI A;  1HNZ H;  2ANR A;  4JI1 H;  1MSZ A;  2VQF H;  1XMO H;  1AN7 A;  4DV6 H;  4E9J A;  1N33 H;  4B8T A;  1F0X A;  4OX9 H;  2JEA I;  4JYA H;  2UXB H;  2JE6 I;  2ANN A;  3L7Z C;  4LIJ A;  1UG8 A;  1IBM H;  4LFA H;  2CTL A;  2UUA H;  2CTE A;  1WTJ A;  4DV4 H;  3OSS D;  4WAL A;  2G8Y A;  3OET A;  3GR5 A;  1I94 H;  1XNQ H;  1IBK H;  3T1Y H;  4YHH H;  4AM3 A;  2JEB I;  1VBI A;  1J4W A;  4JI0 H;  1XRH A;  3UOE A;  2HH2 A;  5LMU H;  1X4M A;  2JA9 A;  4H8A A;  3J81 W;  4DR4 H;  2E3U A;  5BR8 H;  1HR0 H;  2Z0S A;  5C0X G;  4WAN A;  2DGR A;  4AQY H;  1XMQ H;  2UU9 H;  2E5L H;  3I0P A;  4G08 A;  4JVY A;  4JVH A;  4NXM H;  2UXC H;  2QND A;  2VKC A;  5A2Q W;  2Y3M A;  4DV5 H;  4OO1 G;  1KHM A;  2BL5 A;  1X0A A;  4JI4 H;  1J5E H;  4DV2 H;  1VIG A;  2LTM A;  2PQU A;  4X64 H;  2MJH A;  3KDK A;  2LF0 A;  4DV0 H;  5DT9 A;  4B3R H;  4NZR M;  1K1G A;  1HNW H;  3GAB A;  1S20 A;  4LF8 H;  4EC5 A;  4NXN H;  4DUZ H;  1ZTG A;  5LL6 b;  2BA0 A;  4X62 H;  4JI3 H;  4DR2 H;  3GKU A;  1ODH A;  4DR5 H;  4IFD G;  4B3T H;  4DV7 H;  2HHH H;  1PQX A;  2CTF A;  4LF6 H;  4DR3 H;  1S03 G;  4YY3 H;  4LF4 H;  2CTM A;  4FJS A;  1TUA A;  4B3S H;  4BA1 I;  2ZQE A;  2AXY A;  4B3M H;  1I6U A;  4DR1 H;  4JV5 H;  4BA2 I;  2JZX A;  2O4C A;  1HNX H;  5FLX W;  4NBQ A;  4JI5 H;  4DR6 H;  2OPU A;  2UXD H;  2OPV A;  5IT9 W;  1X9Z A;  2UUB H;  2D9I A;  5JEA G;  4DV3 H;  3AEV B;  1N36 H;  2LTL A;  3NCV A;  2A1S A;  2F4V H;  4PDB A;  1WE8 A;  2CPQ A;  2LRR A;  4OD6 A;  1WHR A;  3SB1 A;  2NN6 G;  4DR7 H;  4GKJ H;  4DUY H;  1N32 H;  2CWH A;  4X66 H;  1VIH A;  3QD7 X;  2PY9 A;  3T1H H;  4B8C D;  2VQE H; 
#chains in the Genus database with same CATH homology
 2HH2 A;  1X4M A;  2JA9 A;  2CTJ A;  2E3U A;  4IFD G;  2CTK A;  2Z0S A;  4AIM A;  1EC6 A;  5C0X G;  2YQR A;  1ZZJ A;  2DGR A;  2P2R A;  2JVZ A;  2CTF A;  1ZZI A;  4WAN A;  5K36 G;  2ANR A;  4QMF B;  2CTM A;  1TUA A;  4JVY A;  4JVH A;  2QND A;  1WVN A;  4BA1 I;  2AXY A;  3U1K A;  4OO1 G;  4B8T A;  1KHM A;  2BL5 A;  2JEA I;  2JZX A;  4BA2 I;  4NBQ A;  2JE6 I;  1VIG A;  2OPU A;  2OPV A;  3L7Z C;  2ANN A;  3V69 A;  4LIJ A;  5JEA G;  2PQU A;  2CTL A;  2MJH A;  3AEV B;  1ZZK A;  2CTE A;  2HH3 A;  1X4N A;  1WE8 A;  2FMR A;  2CPQ A;  1DT4 A;  4WAL A;  2NN6 G;  1K1G A;  1DTJ A;  1J5K A;  3VKE A;  1VIH A;  4AM3 A;  2PY9 A;  2JEB I;  1ZTG A;  1J4W A;  2BA0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...