1DT4A

Crystal structure of nova-1 kh3 k-homology rna-binding domain
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
73
structure length
73
Chain Sequence
b'MKDVVEIAVPENLVGAILGKGGKTLVEYQELTGCRIQISKKGEFLPGTRNRKVTITGTPAATQAAQYLITQRI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NEURO-ONCOLOGICAL VENTRAL ANTIGEN 1
publication title Crystal structures of Nova-1 and Nova-2 K-homology RNA-binding domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 18
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2000-01-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 1dt4A00
1J5KA 2OPUA 4BA1I 3AEVB 1DT4A 2FMRA 2YQRA 4QMFB 4JVHA 2HH3A 1J4WA 2CTKA 1EC6A 2JEBI 4NBQA 2ANNA 2JEAI 2JE6I 2P2RA 2CTEA 2JVZA 4JVYA 1K1GA 4BA2I 2OPVA 1KHMA 4LIJA 3VKEA 1VIGA 1ZZJA 1WE8A 2Z0SA 2NN6G 2AXYA 1TUAA 1VIHA 4IFDG 2HH2A 2CTLA 5JEAG 2ANRA 2BA0A 2MJHA 1ZZIA 1ZTGA 1WVNA 2BL5A 3U1KA 5K36G 4AIMA 2JZXA 2QNDA 3L7ZC 4WALA 4B8TA 1DTJA 2E3UA 1ZZKA 2JA9A 2PQUA 1X4MA 2PY9A 2CTFA 2CTMA 4OO1G 3V69A 1X4NA 5C0XG 2DGRA 4WANA 2CTJA 4AM3A 2CPQA
chains in the Genus database with same CATH superfamily
1AN7A 2OPUA 4BA1I 1Z2IA 1EC6A 4JI1H 3QD7X 5IWAH 2ANNA 2K1HA 2CWHA 5LMNH 2UUAH 1UG8A 1WTJA 4DUYH 4DUZH 4JVYA 2VKCA 4DV3H 4DV5H 4DV7H 4BA2I 4DR2H 4JI5H 4NXNH 1N33H 1N34H 2Z0SA 2UUCH 1F0XA 5LL6b 1IBMH 4DR5H 1ZZIA 1WVNA 1X0AA 3U1KA 4LF5H 2LRRA 4JI0H 3J81W 4E9JA 4B8TA 2VQEH 4B3RH 3J80W 1N32H 4JYAH 2JA9A 4X65H 4JI8H 4GKKH 1HNWH 2PY9A 3V69A 2FPHX 5C0XG 4LFAH 3FAUA 3UOEA 4DR3H 1J5KA 2UXBH 4EC5A 4DR1H 4B3SH 2CTKA 3NCVA 4NBQA 2JVZA 4JI4H 1I94H 4LFCH 2FFMA 4DV0H 1K1GA 2OPVA 1KHMA 4LIJA 2UUBH 4OD6A 4DV1H 4DR7H 4JI6H 4LF4H 1WE8A 4YY3H 3GR5A 2CPMA 2F4VH 1VIHA 4IFDG 2X06A 1XNRH 2CTLA 5JEAG 2BA0A 2E5LH 2LF0A 1ZTGA 5K36G 2BL5A 2JZXA 1XMOH 1I6UA 3JAMW 4JI3H 3SB1A 1HR0H 4X62H 4GKJH 4FJSA 1XNQH 4DV6H 2CWFA 1VBIA 4LF7H 2MJHA 2O4CA 2CPQA 1MSZA 3RF2A 3AEVB 4DV4H 5A2QW 1DT4A 2FMRA 4LF8H 3T1HH 4G08A 1J4WA 1FKAH 4LF9H 3GKUA 4DR6H 1N36H 4NZRM 2JEAI 2P2RA 1XRHA 5FLXW 1S20A 3OTOH 3VKEA 3EZJA 1VIGA 3T1YH 1ZZJA 4B3TH 2ZQEA 4H8AA 4JI2H 2NN6G 1HNZH 2LTLA 5BR8H 4B3MH 2HH2A 2A1SA 2ANRA 2PT7G 4AQYH 1V9NA 4AIMA 2QNDA 3L7ZC 4YHHH 4PDBA 1NXUA 2G8YA 2M8WA 1FJGH 4KHPH 3KDGA 4X66H 2PQUA 2UXDH 2CTFA 2CTMA 4OO1G 1X4NA 4WANA 1SEIA 2DGRA 2VQFH 2JE6I 2CTJA 4AM3A 2UXCH 2D9IA 3I0PA 2YQRA 4QMFB 4JI7H 4JVHA 2HH3A 2JEBI 4OCHA 1WHRA 2CTEA 2LTMA 3KDKA 2M6QA 4X64H 2UU9H 4LFBH 2ZM6H 4NZTM 3J7AK 4DR4H 2AXYA 1TUAA 1V8CA 3OETA 4NXMH 4JV5H 1IBKH 4OX9H 1XMQH 4B8CD 1PQXA 1X9ZA 3OSSD 4DV2H 4K0KH 5LMUH 4WALA 1DTJA 2E3UA 2HHHH 5IT9W 1ZZKA 5DT9A 1J5EH 2Y3MA 1S03G 4LF6H 1X4MA 1ODHA 1IBLH 3GABA 4FJUA 1HNXH
chains in the Genus database with same CATH topology
1J5KA 2OPUA 4BA1I 3AEVB 1DT4A 2FMRA 2YQRA 4QMFB 4JVHA 2HH3A 1J4WA 2CTKA 1EC6A 2JEBI 4NBQA 2ANNA 2JEAI 2JE6I 2P2RA 2CTEA 2JVZA 4JVYA 1K1GA 4BA2I 2OPVA 1KHMA 4LIJA 3VKEA 1VIGA 1ZZJA 1WE8A 2Z0SA 2NN6G 2AXYA 1TUAA 1VIHA 4IFDG 2HH2A 2CTLA 5JEAG 2ANRA 2BA0A 2MJHA 1ZZIA 1ZTGA 1WVNA 2BL5A 3U1KA 5K36G 4AIMA 2JZXA 2QNDA 3L7ZC 4WALA 4B8TA 1DTJA 2E3UA 1ZZKA 2JA9A 2PQUA 1X4MA 2PY9A 2CTFA 2CTMA 4OO1G 3V69A 1X4NA 5C0XG 2DGRA 4WANA 2CTJA 4AM3A 2CPQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J5K A;  2OPU A;  4BA1 I;  3AEV B;  1DT4 A;  2FMR A;  2YQR A;  4QMF B;  4JVH A;  2HH3 A;  1J4W A;  2CTK A;  1EC6 A;  2JEB I;  4NBQ A;  2ANN A;  2JEA I;  2JE6 I;  2P2R A;  2CTE A;  2JVZ A;  4JVY A;  1K1G A;  4BA2 I;  2OPV A;  1KHM A;  4LIJ A;  3VKE A;  1VIG A;  1ZZJ A;  1WE8 A;  2Z0S A;  2NN6 G;  2AXY A;  1TUA A;  1VIH A;  4IFD G;  2HH2 A;  2CTL A;  5JEA G;  2ANR A;  2BA0 A;  2MJH A;  1ZZI A;  1ZTG A;  1WVN A;  2BL5 A;  3U1K A;  5K36 G;  4AIM A;  2JZX A;  2QND A;  3L7Z C;  4WAL A;  4B8T A;  1DTJ A;  2E3U A;  1ZZK A;  2JA9 A;  2PQU A;  1X4M A;  2PY9 A;  2CTF A;  2CTM A;  4OO1 G;  3V69 A;  1X4N A;  5C0X G;  2DGR A;  4WAN A;  2CTJ A;  4AM3 A;  2CPQ A; 
#chains in the Genus database with same CATH topology
 1AN7 A;  2OPU A;  4BA1 I;  1Z2I A;  1EC6 A;  4JI1 H;  3QD7 X;  5IWA H;  2ANN A;  2K1H A;  2CWH A;  5LMN H;  2UUA H;  1UG8 A;  1WTJ A;  4DUY H;  4DUZ H;  4JVY A;  2VKC A;  4DV3 H;  4DV5 H;  4DV7 H;  4BA2 I;  4DR2 H;  4JI5 H;  4NXN H;  1N33 H;  1N34 H;  2Z0S A;  2UUC H;  1F0X A;  5LL6 b;  1IBM H;  4DR5 H;  1ZZI A;  1WVN A;  1X0A A;  3U1K A;  4LF5 H;  2LRR A;  4JI0 H;  3J81 W;  4E9J A;  4B8T A;  2VQE H;  4B3R H;  3J80 W;  1N32 H;  4JYA H;  2JA9 A;  4X65 H;  4JI8 H;  4GKK H;  1HNW H;  2PY9 A;  3V69 A;  2FPH X;  5C0X G;  4LFA H;  3FAU A;  3UOE A;  4DR3 H;  1J5K A;  2UXB H;  4EC5 A;  4DR1 H;  4B3S H;  2CTK A;  3NCV A;  4NBQ A;  2JVZ A;  4JI4 H;  1I94 H;  4LFC H;  2FFM A;  4DV0 H;  1K1G A;  2OPV A;  1KHM A;  4LIJ A;  2UUB H;  4OD6 A;  4DV1 H;  4DR7 H;  4JI6 H;  4LF4 H;  1WE8 A;  4YY3 H;  3GR5 A;  2CPM A;  2F4V H;  1VIH A;  4IFD G;  2X06 A;  1XNR H;  2CTL A;  5JEA G;  2BA0 A;  2E5L H;  2LF0 A;  1ZTG A;  5K36 G;  2BL5 A;  2JZX A;  1XMO H;  1I6U A;  3JAM W;  4JI3 H;  3SB1 A;  1HR0 H;  4X62 H;  4GKJ H;  4FJS A;  1XNQ H;  4DV6 H;  2CWF A;  1VBI A;  4LF7 H;  2MJH A;  2O4C A;  2CPQ A;  1MSZ A;  3RF2 A;  3AEV B;  4DV4 H;  5A2Q W;  1DT4 A;  2FMR A;  4LF8 H;  3T1H H;  4G08 A;  1J4W A;  1FKA H;  4LF9 H;  3GKU A;  4DR6 H;  1N36 H;  4NZR M;  2JEA I;  2P2R A;  1XRH A;  5FLX W;  1S20 A;  3OTO H;  3VKE A;  3EZJ A;  1VIG A;  3T1Y H;  1ZZJ A;  4B3T H;  2ZQE A;  4H8A A;  4JI2 H;  2NN6 G;  1HNZ H;  2LTL A;  5BR8 H;  4B3M H;  2HH2 A;  2A1S A;  2ANR A;  2PT7 G;  4AQY H;  1V9N A;  4AIM A;  2QND A;  3L7Z C;  4YHH H;  4PDB A;  1NXU A;  2G8Y A;  2M8W A;  1FJG H;  4KHP H;  3KDG A;  4X66 H;  2PQU A;  2UXD H;  2CTF A;  2CTM A;  4OO1 G;  1X4N A;  4WAN A;  1SEI A;  2DGR A;  2VQF H;  2JE6 I;  2CTJ A;  4AM3 A;  2UXC H;  2D9I A;  3I0P A;  2YQR A;  4QMF B;  4JI7 H;  4JVH A;  2HH3 A;  2JEB I;  4OCH A;  1WHR A;  2CTE A;  2LTM A;  3KDK A;  2M6Q A;  4X64 H;  2UU9 H;  4LFB H;  2ZM6 H;  4NZT M;  3J7A K;  4DR4 H;  2AXY A;  1TUA A;  1V8C A;  3OET A;  4NXM H;  4JV5 H;  1IBK H;  4OX9 H;  1XMQ H;  4B8C D;  1PQX A;  1X9Z A;  3OSS D;  4DV2 H;  4K0K H;  5LMU H;  4WAL A;  1DTJ A;  2E3U A;  2HHH H;  5IT9 W;  1ZZK A;  5DT9 A;  1J5E H;  2Y3M A;  1S03 G;  4LF6 H;  1X4M A;  1ODH A;  1IBL H;  3GAB A;  4FJU A;  1HNX H; 
#chains in the Genus database with same CATH homology
 1J5K A;  2OPU A;  4BA1 I;  3AEV B;  1DT4 A;  2FMR A;  2YQR A;  4QMF B;  4JVH A;  2HH3 A;  1J4W A;  2CTK A;  1EC6 A;  2JEB I;  4NBQ A;  2ANN A;  2JEA I;  2JE6 I;  2P2R A;  2CTE A;  2JVZ A;  4JVY A;  1K1G A;  4BA2 I;  2OPV A;  1KHM A;  4LIJ A;  3VKE A;  1VIG A;  1ZZJ A;  1WE8 A;  2Z0S A;  2NN6 G;  2AXY A;  1TUA A;  1VIH A;  4IFD G;  2HH2 A;  2CTL A;  5JEA G;  2ANR A;  2BA0 A;  2MJH A;  1ZZI A;  1ZTG A;  1WVN A;  2BL5 A;  3U1K A;  5K36 G;  4AIM A;  2JZX A;  2QND A;  3L7Z C;  4WAL A;  4B8T A;  1DTJ A;  2E3U A;  1ZZK A;  2JA9 A;  2PQU A;  1X4M A;  2PY9 A;  2CTF A;  2CTM A;  4OO1 G;  3V69 A;  1X4N A;  5C0X G;  2DGR A;  4WAN A;  2CTJ A;  4AM3 A;  2CPQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...