1DT4A

Crystal structure of nova-1 kh3 k-homology rna-binding domain
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
73
structure length
73
Chain Sequence
MKDVVEIAVPENLVGAILGKGGKTLVEYQELTGCRIQISKKGEFLPGTRNRKVTITGTPAATQAAQYLITQRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NEURO-ONCOLOGICAL VENTRAL ANTIGEN 1
publication title Crystal structures of Nova-1 and Nova-2 K-homology RNA-binding domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 18
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2000-01-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 1dt4A00
2JEAI 2BL5A 1DTJA 2AXYA 2CPQA 1VIGA 2JEBI 2OPUA 1EC6A 2OPVA 1ZTGA 4AM3A 4NBQA 4JVYA 2HH3A 4JVHA 1TUAA 5C0XG 2PY9A 2CTJA 2CTLA 1DT4A 2CTKA 1ZZJA 3VKEA 1WVNA 2JZXA 2P2RA 4OO1G 2JVZA 1KHMA 2HH2A 2CTFA 4AIMA 5K36G 2PQUA 3V69A 4BA1I 2MJHA 2ANNA 1VIHA 2Z0SA 2DGRA 3L7ZC 2FMRA 1X4NA 1ZZIA 1J4WA 2BA0A 2CTMA 1ZZKA 1J5KA 2YQRA 2JA9A 2NN6G 1WE8A 2ANRA 1K1GA 3AEVB 4BA2I 4LIJA 4IFDG 5JEAG 2JE6I 4QMFB 4WALA 4WANA 2QNDA 3U1KA 2CTEA 2E3UA 1X4MA 4B8TA
chains in the Genus database with same CATH superfamily
1HNZH 2JEAI 4NXNH 1S03G 2AXYA 1DTJA 2CPQA 1N32H 4YY3H 4AM3A 1X0AA 2HH3A 4JVHA 2K1HA 1UG8A 4JI7H 1N36H 2G8YA 1ZZJA 4WANA 3VKEA 1N33H 4B3SH 2CWFA 1KHMA 4AIMA 4DV1H 4FJSA 1IBLH 2VKCA 1XNQH 2Z0SA 2DGRA 3L7ZC 2FMRA 4YHHH 1FJGH 3J7AK 2YQRA 1V9NA 4DR1H 1XMQH 3AEVB 4KHPH 4LIJA 5JEAG 2JE6I 3QD7X 4FJUA 2E3UA 2LF0A 2X06A 4DUYH 3OSSD 2VQFH 4X62H 4LF9H 4NXMH 5FLXW 4X64H 4JI0H 4JI5H 3RF2A 4JV5H 5A2QW 4JI6H 1ZTGA 4PDBA 3I0PA 4JVYA 3NCVA 1VBIA 2E5LH 4H8AA 1WTJA 4X66H 2CTKA 5DT9A 2P2RA 4EC5A 4OX9H 4X65H 2HH2A 4JI4H 2PQUA 3V69A 2MJHA 1VIHA 3GABA 4LFAH 1IBMH 3GR5A 4OCHA 2CTMA 4E9JA 4DV5H 1J5KA 2JA9A 4K0KH 2Y3MA 4LF4H 3SB1A 4DV4H 4LF8H 4IFDG 4JYAH 2UUAH 4GKJH 2UXDH 1N34H 5LL6b 4B3RH 4JI8H 2FPHX 2BL5A 1EC6A 2CPMA 2A1SA 4GKKH 2FFMA 2M6QA 4NZRM 2F4VH 3KDKA 4LFCH 2PT7G 4DUZH 3T1HH 1TUAA 2UXCH 3T1YH 1Z2IA 2LTMA 2M8WA 2CTLA 2JZXA 1XRHA 1XNRH 1X9ZA 2CTFA 4LFBH 3KDGA 5BR8H 4JI3H 4B3TH 1IBKH 2ZM6H 1X4NA 1ZZIA 2UUCH 1V8CA 2BA0A 3J81W 1PQXA 4B3MH 1F0XA 1S20A 2VQEH 3J80W 1HNXH 1WHRA 4WALA 1XMOH 2QNDA 3JAMW 2CTEA 4B8TA 5K36G 1NXUA 4DV2H 2O4CA 2D9IA 4OD6A 4DV7H 1FKAH 4B8CD 4DR4H 2JEBI 1VIGA 2OPUA 2HHHH 2OPVA 4JI2H 2UU9H 1HNWH 2UXBH 4NBQA 5LMNH 5C0XG 2PY9A 2CTJA 2CWHA 4LF7H 1SEIA 1DT4A 4G08A 2ZQEA 3OTOH 1WVNA 3EZJA 1I94H 4OO1G 2JVZA 2LTLA 4BA1I 2ANNA 5IWAH 3FAUA 4DV0H 4DV3H 4DR2H 4NZTM 4LF6H 2LRRA 1J4WA 1I6UA 1ZZKA 3UOEA 1J5EH 5IT9W 2NN6G 4DR3H 4DR7H 1AN7A 1WE8A 4DR5H 2ANRA 4AQYH 3OETA 3GKUA 1K1GA 5LMUH 1HR0H 2UUBH 4QMFB 4JI1H 4LF5H 4BA2I 4DR6H 3U1KA 4DV6H 1ODHA 1X4MA 1MSZA
chains in the Genus database with same CATH topology
2JEAI 2BL5A 1DTJA 2AXYA 2CPQA 1VIGA 2JEBI 2OPUA 1EC6A 2OPVA 1ZTGA 4AM3A 4NBQA 4JVYA 2HH3A 4JVHA 1TUAA 5C0XG 2PY9A 2CTJA 2CTLA 1DT4A 2CTKA 1ZZJA 3VKEA 1WVNA 2JZXA 2P2RA 4OO1G 2JVZA 1KHMA 2HH2A 2CTFA 4AIMA 5K36G 2PQUA 3V69A 4BA1I 2MJHA 2ANNA 1VIHA 2Z0SA 2DGRA 3L7ZC 2FMRA 1X4NA 1ZZIA 1J4WA 2BA0A 2CTMA 1ZZKA 1J5KA 2YQRA 2JA9A 2NN6G 1WE8A 2ANRA 1K1GA 3AEVB 4BA2I 4LIJA 4IFDG 5JEAG 2JE6I 4QMFB 4WALA 4WANA 2QNDA 3U1KA 2CTEA 2E3UA 1X4MA 4B8TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JEA I;  2BL5 A;  1DTJ A;  2AXY A;  2CPQ A;  1VIG A;  2JEB I;  2OPU A;  1EC6 A;  2OPV A;  1ZTG A;  4AM3 A;  4NBQ A;  4JVY A;  2HH3 A;  4JVH A;  1TUA A;  5C0X G;  2PY9 A;  2CTJ A;  2CTL A;  1DT4 A;  2CTK A;  1ZZJ A;  3VKE A;  1WVN A;  2JZX A;  2P2R A;  4OO1 G;  2JVZ A;  1KHM A;  2HH2 A;  2CTF A;  4AIM A;  5K36 G;  2PQU A;  3V69 A;  4BA1 I;  2MJH A;  2ANN A;  1VIH A;  2Z0S A;  2DGR A;  3L7Z C;  2FMR A;  1X4N A;  1ZZI A;  1J4W A;  2BA0 A;  2CTM A;  1ZZK A;  1J5K A;  2YQR A;  2JA9 A;  2NN6 G;  1WE8 A;  2ANR A;  1K1G A;  3AEV B;  4BA2 I;  4LIJ A;  4IFD G;  5JEA G;  2JE6 I;  4QMF B;  4WAL A;  4WAN A;  2QND A;  3U1K A;  2CTE A;  2E3U A;  1X4M A;  4B8T A; 
#chains in the Genus database with same CATH topology
 1HNZ H;  2JEA I;  4NXN H;  1S03 G;  2AXY A;  1DTJ A;  2CPQ A;  1N32 H;  4YY3 H;  4AM3 A;  1X0A A;  2HH3 A;  4JVH A;  2K1H A;  1UG8 A;  4JI7 H;  1N36 H;  2G8Y A;  1ZZJ A;  4WAN A;  3VKE A;  1N33 H;  4B3S H;  2CWF A;  1KHM A;  4AIM A;  4DV1 H;  4FJS A;  1IBL H;  2VKC A;  1XNQ H;  2Z0S A;  2DGR A;  3L7Z C;  2FMR A;  4YHH H;  1FJG H;  3J7A K;  2YQR A;  1V9N A;  4DR1 H;  1XMQ H;  3AEV B;  4KHP H;  4LIJ A;  5JEA G;  2JE6 I;  3QD7 X;  4FJU A;  2E3U A;  2LF0 A;  2X06 A;  4DUY H;  3OSS D;  2VQF H;  4X62 H;  4LF9 H;  4NXM H;  5FLX W;  4X64 H;  4JI0 H;  4JI5 H;  3RF2 A;  4JV5 H;  5A2Q W;  4JI6 H;  1ZTG A;  4PDB A;  3I0P A;  4JVY A;  3NCV A;  1VBI A;  2E5L H;  4H8A A;  1WTJ A;  4X66 H;  2CTK A;  5DT9 A;  2P2R A;  4EC5 A;  4OX9 H;  4X65 H;  2HH2 A;  4JI4 H;  2PQU A;  3V69 A;  2MJH A;  1VIH A;  3GAB A;  4LFA H;  1IBM H;  3GR5 A;  4OCH A;  2CTM A;  4E9J A;  4DV5 H;  1J5K A;  2JA9 A;  4K0K H;  2Y3M A;  4LF4 H;  3SB1 A;  4DV4 H;  4LF8 H;  4IFD G;  4JYA H;  2UUA H;  4GKJ H;  2UXD H;  1N34 H;  5LL6 b;  4B3R H;  4JI8 H;  2FPH X;  2BL5 A;  1EC6 A;  2CPM A;  2A1S A;  4GKK H;  2FFM A;  2M6Q A;  4NZR M;  2F4V H;  3KDK A;  4LFC H;  2PT7 G;  4DUZ H;  3T1H H;  1TUA A;  2UXC H;  3T1Y H;  1Z2I A;  2LTM A;  2M8W A;  2CTL A;  2JZX A;  1XRH A;  1XNR H;  1X9Z A;  2CTF A;  4LFB H;  3KDG A;  5BR8 H;  4JI3 H;  4B3T H;  1IBK H;  2ZM6 H;  1X4N A;  1ZZI A;  2UUC H;  1V8C A;  2BA0 A;  3J81 W;  1PQX A;  4B3M H;  1F0X A;  1S20 A;  2VQE H;  3J80 W;  1HNX H;  1WHR A;  4WAL A;  1XMO H;  2QND A;  3JAM W;  2CTE A;  4B8T A;  5K36 G;  1NXU A;  4DV2 H;  2O4C A;  2D9I A;  4OD6 A;  4DV7 H;  1FKA H;  4B8C D;  4DR4 H;  2JEB I;  1VIG A;  2OPU A;  2HHH H;  2OPV A;  4JI2 H;  2UU9 H;  1HNW H;  2UXB H;  4NBQ A;  5LMN H;  5C0X G;  2PY9 A;  2CTJ A;  2CWH A;  4LF7 H;  1SEI A;  1DT4 A;  4G08 A;  2ZQE A;  3OTO H;  1WVN A;  3EZJ A;  1I94 H;  4OO1 G;  2JVZ A;  2LTL A;  4BA1 I;  2ANN A;  5IWA H;  3FAU A;  4DV0 H;  4DV3 H;  4DR2 H;  4NZT M;  4LF6 H;  2LRR A;  1J4W A;  1I6U A;  1ZZK A;  3UOE A;  1J5E H;  5IT9 W;  2NN6 G;  4DR3 H;  4DR7 H;  1AN7 A;  1WE8 A;  4DR5 H;  2ANR A;  4AQY H;  3OET A;  3GKU A;  1K1G A;  5LMU H;  1HR0 H;  2UUB H;  4QMF B;  4JI1 H;  4LF5 H;  4BA2 I;  4DR6 H;  3U1K A;  4DV6 H;  1ODH A;  1X4M A;  1MSZ A; 
#chains in the Genus database with same CATH homology
 2JEA I;  2BL5 A;  1DTJ A;  2AXY A;  2CPQ A;  1VIG A;  2JEB I;  2OPU A;  1EC6 A;  2OPV A;  1ZTG A;  4AM3 A;  4NBQ A;  4JVY A;  2HH3 A;  4JVH A;  1TUA A;  5C0X G;  2PY9 A;  2CTJ A;  2CTL A;  1DT4 A;  2CTK A;  1ZZJ A;  3VKE A;  1WVN A;  2JZX A;  2P2R A;  4OO1 G;  2JVZ A;  1KHM A;  2HH2 A;  2CTF A;  4AIM A;  5K36 G;  2PQU A;  3V69 A;  4BA1 I;  2MJH A;  2ANN A;  1VIH A;  2Z0S A;  2DGR A;  3L7Z C;  2FMR A;  1X4N A;  1ZZI A;  1J4W A;  2BA0 A;  2CTM A;  1ZZK A;  1J5K A;  2YQR A;  2JA9 A;  2NN6 G;  1WE8 A;  2ANR A;  1K1G A;  3AEV B;  4BA2 I;  4LIJ A;  4IFD G;  5JEA G;  2JE6 I;  4QMF B;  4WAL A;  4WAN A;  2QND A;  3U1K A;  2CTE A;  2E3U A;  1X4M A;  4B8T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...