1ZZKA

Crystal structure of the third kh domain of hnrnp k at 0.95a resolution
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
80
structure length
80
Chain Sequence
MGPIITTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDEPLEGSEDRIITITGTQDQIQNAQYLLQNSVKQYSGKFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heterogeneous nuclear ribonucleoprotein K
publication title X-Ray Crystallographic and NMR Studies of the Third KH Domain of hnRNP K in Complex with Single-Stranded Nucleic Acids
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 26
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2005-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 1zzkA00
2E3UA 4LIJA 3AEVB 4JVHA 1VIHA 5JEAG 1J4WA 2CTFA 2CTLA 2JEBI 2HH2A 4BA1I 1X4MA 2AXYA 3L7ZC 2PY9A 4B8TA 1WE8A 1DT4A 4WALA 1K1GA 2JEAI 4IFDG 3V69A 5C0XG 1ZZJA 2PQUA 4WANA 2YQRA 2FMRA 2JA9A 2Z0SA 3VKEA 2ANRA 2P2RA 2BL5A 2JZXA 4AM3A 2CTMA 2CPQA 1WVNA 4BA2I 1KHMA 1ZZKA 2BA0A 2CTEA 2MJHA 2HH3A 1EC6A 2CTKA 1ZTGA 4JVYA 2ANNA 2JE6I 2CTJA 1X4NA 4NBQA 3U1KA 5K36G 2DGRA 2OPVA 2QNDA 2NN6G 1J5KA 4QMFB 4AIMA 1DTJA 1ZZIA 2OPUA 1TUAA 2JVZA 1VIGA 4OO1G
chains in the Genus database with same CATH superfamily
1UG8A 4YY3H 3GABA 2FPHX 2CTFA 3T1YH 2PY9A 2HH2A 4K0KH 1X4MA 2X06A 3L7ZC 4JI2H 4B8TA 1WE8A 1S03G 1K1GA 5LL6b 2M8WA 4JI6H 5IT9W 4PDBA 1X0AA 2UXDH 2O4CA 1XNRH 2JZXA 2F4VH 1WVNA 4X62H 1IBKH 3KDKA 2G8YA 1N33H 4JI5H 4DV2H 2CWHA 4FJSA 4JYAH 4JVYA 3EZJA 2A1SA 2ANNA 2D9IA 4JI0H 1WTJA 4NXMH 1J5KA 2QNDA 4H8AA 4DR5H 4LFCH 2E5LH 3SB1A 2VQEH 1TUAA 2PT7G 4G08A 2E3UA 1PQXA 3OETA 4JVHA 1J4WA 3UOEA 2UUBH 2LF0A 5FLXW 4DV6H 2JEAI 4NZRM 4E9JA 4B3SH 4LF4H 2HHHH 2VQFH 1ZZJA 2PQUA 3JAMW 1HNWH 1V9NA 2Z0SA 2P2RA 1I94H 3FAUA 2BL5A 1VBIA 4NZTM 2UUAH 4LF7H 2CTMA 2CPQA 4DR2H 4B3RH 3I0PA 1XNQH 1XMQH 1V8CA 1ODHA 1HNXH 4GKJH 4DV3H 2CTKA 4DV0H 4AQYH 4X64H 4X66H 3NCVA 4NBQA 2LRRA 5LMUH 2CWFA 4QMFB 3OSSD 1DTJA 1XRHA 2K1HA 1IBLH 5A2QW 2LTLA 4B8CD 3T1HH 2LTMA 1XMOH 4JI7H 4LF6H 3J80W 2JEBI 2VKCA 1MSZA 4DR7H 4DV4H 4EC5A 2ZM6H 3V69A 4B3TH 4DR3H 4DV7H 1X9ZA 4DR4H 4JV5H 2FMRA 2FFMA 1SEIA 2JA9A 1N34H 2ANRA 4JI3H 3J7AK 4AM3A 4BA2I 1FJGH 3KDGA 1ZZKA 2CTEA 4YHHH 1FKAH 1N36H 1ZTGA 4DR1H 2JE6I 4DUZH 1WHRA 2UU9H 4LF9H 3U1KA 5K36G 2DGRA 1I6UA 2NN6G 3J81W 4AIMA 5IWAH 4JI4H 2OPUA 4OCHA 2CPMA 5BR8H 2UUCH 4OX9H 4LIJA 1HNZH 3AEVB 1VIHA 5JEAG 4FJUA 2CTLA 1Z2IA 4BA1I 2AXYA 1F0XA 4LF5H 4OO1G 1AN7A 3QD7X 1DT4A 4WALA 1IBMH 4IFDG 4LFBH 2UXCH 5C0XG 2Y3MA 4DUYH 1HR0H 2YQRA 4WANA 1S20A 4DV5H 3VKEA 3RF2A 4GKKH 4KHPH 1KHMA 4JI1H 2BA0A 1J5EH 2MJHA 2HH3A 5LMNH 3GKUA 4B3MH 4NXNH 1EC6A 4LFAH 4OD6A 1N32H 2M6QA 4DV1H 2CTJA 1NXUA 2UXBH 1X4NA 3GR5A 4JI8H 4X65H 2OPVA 5DT9A 1ZZIA 2JVZA 2ZQEA 4LF8H 3OTOH 1VIGA 4DR6H
chains in the Genus database with same CATH topology
2E3UA 4LIJA 3AEVB 4JVHA 1VIHA 5JEAG 1J4WA 2CTFA 2CTLA 2JEBI 2HH2A 4BA1I 1X4MA 2AXYA 3L7ZC 2PY9A 4B8TA 1WE8A 1DT4A 4WALA 1K1GA 2JEAI 4IFDG 3V69A 5C0XG 1ZZJA 2PQUA 4WANA 2YQRA 2FMRA 2JA9A 2Z0SA 3VKEA 2ANRA 2P2RA 2BL5A 2JZXA 4AM3A 2CTMA 2CPQA 1WVNA 4BA2I 1KHMA 1ZZKA 2BA0A 2CTEA 2MJHA 2HH3A 1EC6A 2CTKA 1ZTGA 4JVYA 2ANNA 2JE6I 2CTJA 1X4NA 4NBQA 3U1KA 5K36G 2DGRA 2OPVA 2QNDA 2NN6G 1J5KA 4QMFB 4AIMA 1DTJA 1ZZIA 2OPUA 1TUAA 2JVZA 1VIGA 4OO1G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E3U A;  4LIJ A;  3AEV B;  4JVH A;  1VIH A;  5JEA G;  1J4W A;  2CTF A;  2CTL A;  2JEB I;  2HH2 A;  4BA1 I;  1X4M A;  2AXY A;  3L7Z C;  2PY9 A;  4B8T A;  1WE8 A;  1DT4 A;  4WAL A;  1K1G A;  2JEA I;  4IFD G;  3V69 A;  5C0X G;  1ZZJ A;  2PQU A;  4WAN A;  2YQR A;  2FMR A;  2JA9 A;  2Z0S A;  3VKE A;  2ANR A;  2P2R A;  2BL5 A;  2JZX A;  4AM3 A;  2CTM A;  2CPQ A;  1WVN A;  4BA2 I;  1KHM A;  1ZZK A;  2BA0 A;  2CTE A;  2MJH A;  2HH3 A;  1EC6 A;  2CTK A;  1ZTG A;  4JVY A;  2ANN A;  2JE6 I;  2CTJ A;  1X4N A;  4NBQ A;  3U1K A;  5K36 G;  2DGR A;  2OPV A;  2QND A;  2NN6 G;  1J5K A;  4QMF B;  4AIM A;  1DTJ A;  1ZZI A;  2OPU A;  1TUA A;  2JVZ A;  1VIG A;  4OO1 G; 
#chains in the Genus database with same CATH topology
 1UG8 A;  4YY3 H;  3GAB A;  2FPH X;  2CTF A;  3T1Y H;  2PY9 A;  2HH2 A;  4K0K H;  1X4M A;  2X06 A;  3L7Z C;  4JI2 H;  4B8T A;  1WE8 A;  1S03 G;  1K1G A;  5LL6 b;  2M8W A;  4JI6 H;  5IT9 W;  4PDB A;  1X0A A;  2UXD H;  2O4C A;  1XNR H;  2JZX A;  2F4V H;  1WVN A;  4X62 H;  1IBK H;  3KDK A;  2G8Y A;  1N33 H;  4JI5 H;  4DV2 H;  2CWH A;  4FJS A;  4JYA H;  4JVY A;  3EZJ A;  2A1S A;  2ANN A;  2D9I A;  4JI0 H;  1WTJ A;  4NXM H;  1J5K A;  2QND A;  4H8A A;  4DR5 H;  4LFC H;  2E5L H;  3SB1 A;  2VQE H;  1TUA A;  2PT7 G;  4G08 A;  2E3U A;  1PQX A;  3OET A;  4JVH A;  1J4W A;  3UOE A;  2UUB H;  2LF0 A;  5FLX W;  4DV6 H;  2JEA I;  4NZR M;  4E9J A;  4B3S H;  4LF4 H;  2HHH H;  2VQF H;  1ZZJ A;  2PQU A;  3JAM W;  1HNW H;  1V9N A;  2Z0S A;  2P2R A;  1I94 H;  3FAU A;  2BL5 A;  1VBI A;  4NZT M;  2UUA H;  4LF7 H;  2CTM A;  2CPQ A;  4DR2 H;  4B3R H;  3I0P A;  1XNQ H;  1XMQ H;  1V8C A;  1ODH A;  1HNX H;  4GKJ H;  4DV3 H;  2CTK A;  4DV0 H;  4AQY H;  4X64 H;  4X66 H;  3NCV A;  4NBQ A;  2LRR A;  5LMU H;  2CWF A;  4QMF B;  3OSS D;  1DTJ A;  1XRH A;  2K1H A;  1IBL H;  5A2Q W;  2LTL A;  4B8C D;  3T1H H;  2LTM A;  1XMO H;  4JI7 H;  4LF6 H;  3J80 W;  2JEB I;  2VKC A;  1MSZ A;  4DR7 H;  4DV4 H;  4EC5 A;  2ZM6 H;  3V69 A;  4B3T H;  4DR3 H;  4DV7 H;  1X9Z A;  4DR4 H;  4JV5 H;  2FMR A;  2FFM A;  1SEI A;  2JA9 A;  1N34 H;  2ANR A;  4JI3 H;  3J7A K;  4AM3 A;  4BA2 I;  1FJG H;  3KDG A;  1ZZK A;  2CTE A;  4YHH H;  1FKA H;  1N36 H;  1ZTG A;  4DR1 H;  2JE6 I;  4DUZ H;  1WHR A;  2UU9 H;  4LF9 H;  3U1K A;  5K36 G;  2DGR A;  1I6U A;  2NN6 G;  3J81 W;  4AIM A;  5IWA H;  4JI4 H;  2OPU A;  4OCH A;  2CPM A;  5BR8 H;  2UUC H;  4OX9 H;  4LIJ A;  1HNZ H;  3AEV B;  1VIH A;  5JEA G;  4FJU A;  2CTL A;  1Z2I A;  4BA1 I;  2AXY A;  1F0X A;  4LF5 H;  4OO1 G;  1AN7 A;  3QD7 X;  1DT4 A;  4WAL A;  1IBM H;  4IFD G;  4LFB H;  2UXC H;  5C0X G;  2Y3M A;  4DUY H;  1HR0 H;  2YQR A;  4WAN A;  1S20 A;  4DV5 H;  3VKE A;  3RF2 A;  4GKK H;  4KHP H;  1KHM A;  4JI1 H;  2BA0 A;  1J5E H;  2MJH A;  2HH3 A;  5LMN H;  3GKU A;  4B3M H;  4NXN H;  1EC6 A;  4LFA H;  4OD6 A;  1N32 H;  2M6Q A;  4DV1 H;  2CTJ A;  1NXU A;  2UXB H;  1X4N A;  3GR5 A;  4JI8 H;  4X65 H;  2OPV A;  5DT9 A;  1ZZI A;  2JVZ A;  2ZQE A;  4LF8 H;  3OTO H;  1VIG A;  4DR6 H; 
#chains in the Genus database with same CATH homology
 2E3U A;  4LIJ A;  3AEV B;  4JVH A;  1VIH A;  5JEA G;  1J4W A;  2CTF A;  2CTL A;  2JEB I;  2HH2 A;  4BA1 I;  1X4M A;  2AXY A;  3L7Z C;  2PY9 A;  4B8T A;  1WE8 A;  1DT4 A;  4WAL A;  1K1G A;  2JEA I;  4IFD G;  3V69 A;  5C0X G;  1ZZJ A;  2PQU A;  4WAN A;  2YQR A;  2FMR A;  2JA9 A;  2Z0S A;  3VKE A;  2ANR A;  2P2R A;  2BL5 A;  2JZX A;  4AM3 A;  2CTM A;  2CPQ A;  1WVN A;  4BA2 I;  1KHM A;  1ZZK A;  2BA0 A;  2CTE A;  2MJH A;  2HH3 A;  1EC6 A;  2CTK A;  1ZTG A;  4JVY A;  2ANN A;  2JE6 I;  2CTJ A;  1X4N A;  4NBQ A;  3U1K A;  5K36 G;  2DGR A;  2OPV A;  2QND A;  2NN6 G;  1J5K A;  4QMF B;  4AIM A;  1DTJ A;  1ZZI A;  2OPU A;  1TUA A;  2JVZ A;  1VIG A;  4OO1 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...