1ZZKA

Crystal structure of the third kh domain of hnrnp k at 0.95a resolution
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
80
structure length
80
Chain Sequence
b'MGPIITTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDEPLEGSEDRIITITGTQDQIQNAQYLLQNSVKQYSGKFF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heterogeneous nuclear ribonucleoprotein K
molecule tags Dna binding protein
source organism Homo sapiens
publication title X-Ray Crystallographic and NMR Studies of the Third KH Domain of hnRNP K in Complex with Single-Stranded Nucleic Acids
pubmed doi rcsb
total genus 26
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2005-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 1zzkA00
2CTMA 2BL5A 4AIMA 2CTKA 3VKEA 2PQUA 4AM3A 4BA1I 4OO1G 1ZTGA 1X4MA 2HH2A 2JVZA 2JEBI 1ZZJA 1ZZKA 2OPUA 2OPVA 4NBQA 2CPQA 4WALA 4LIJA 3L7ZC 4IFDG 2MJHA 1KHMA 2CTFA 2NN6G 2ANNA 1WVNA 2CTLA 1DT4A 1VIGA 1J4WA 2JEAI 2JA9A 2FMRA 2YQRA 2PY9A 2ANRA 1VIHA 2DGRA 4B8TA 1DTJA 4QMFB 4JVHA 1EC6A 4WANA 5JEAG 1ZZIA 3U1KA 1TUAA 2Z0SA 2CTEA 1WE8A 2BA0A 2QNDA 5C0XG 1K1GA 2E3UA 2JZXA 2JE6I 2AXYA 3V69A 1J5KA 1X4NA 4BA2I 2P2RA 4JVYA 2CTJA 2HH3A 5K36G 3AEVB
chains in the Genus database with same CATH superfamily
2BL5A 2CWFA 4AIMA 5IWAH 2PQUA 1XNRH 4AM3A 3SB1A 4FJSA 1SEIA 1ZTGA 4OO1G 1X4MA 1N36H 1I6UA 1WTJA 4NXMH 2OPUA 2LTMA 4DV4H 4LIJA 2MJHA 4G08A 1VIGA 4B3MH 5BR8H 3OETA 2ZM6H 4H8AA 4LF7H 1WHRA 1VIHA 2CWHA 3GKUA 4OX9H 4DR6H 4NXNH 4DV0H 4JVHA 1X9ZA 4YHHH 1HNXH 4LFAH 3RF2A 3J80W 1S20A 1F0XA 3J81W 4DR3H 2BA0A 4JI1H 4AQYH 4LF5H 2E3UA 1XNQH 2JE6I 1J5KA 4JI7H 4BA2I 4B3RH 1NXUA 2UXDH 3AEVB 1J5EH 4NZRM 1XMOH 4LFBH 1IBKH 4E9JA 1HNWH 3KDGA 4X65H 1N33H 4OD6A 4DR2H 4EC5A 3FAUA 4NBQA 4WALA 4B8CD 1ODHA 2ZQEA 2M8WA 2UUBH 2FPHX 1WVNA 1VBIA 2CTLA 1S03G 4FJUA 2PY9A 2M6QA 4JI5H 4DR4H 2DGRA 4B8TA 2LRRA 2PT7G 3KDKA 2Y3MA 3GABA 4QMFB 4DR5H 4K0KH 4JI6H 3T1HH 2FFMA 3U1KA 2E5LH 2Z0SA 5LMNH 4LFCH 2O4CA 2VKCA 2CPMA 2AXYA 3UOEA 1HNZH 2VQEH 2P2RA 4JI0H 1IBMH 1V9NA 4JVYA 2NN6G 3NCVA 4LF8H 2CTMA 2LF0A 4JI2H 3VKEA 5K36G 1X0AA 1AN7A 3QD7X 1V8CA 4BA1I 2HH2A 1MSZA 1ZZKA 4JI4H 4KHPH 4IFDG 4JV5H 3L7ZC 1KHMA 4YY3H 2CTFA 2ANNA 4DV3H 2UUAH 2JEAI 2JA9A 2YQRA 2LTLA 2ANRA 1I94H 4GKKH 5LMUH 2G8YA 1DTJA 4WANA 4PDBA 1ZZIA 4DUYH 1TUAA 1XMQH 2CTEA 2F4VH 1K1GA 5IT9W 1FJGH 1PQXA 5FLXW 3T1YH 3V69A 1X4NA 4DV1H 5A2QW 4B3SH 2CTJA 4NZTM 4DV2H 2CTKA 4LF9H 4X62H 2A1SA 4LF6H 4DR7H 2X06A 1HR0H 1IBLH 2VQFH 2JVZA 2JEBI 1ZZJA 2OPVA 2CPQA 3I0PA 2UXCH 4LF4H 4DV6H 3OTOH 3J7AK 4JI8H 1DT4A 4DV7H 1J4WA 2FMRA 4GKJH 4JYAH 2HHHH 4DUZH 4OCHA 1Z2IA 1UG8A 4X66H 4DR1H 1FKAH 2UU9H 1EC6A 1XRHA 2UUCH 1N32H 3JAMW 5JEAG 1WE8A 2K1HA 4JI3H 2QNDA 3GR5A 3OSSD 5C0XG 1N34H 2UXBH 4B3TH 2JZXA 5DT9A 4DV5H 2D9IA 3EZJA 4X64H 5LL6b 2HH3A
chains in the Genus database with same CATH topology
2CTMA 2BL5A 4AIMA 2CTKA 3VKEA 2PQUA 4AM3A 4BA1I 4OO1G 1ZTGA 1X4MA 2HH2A 2JVZA 2JEBI 1ZZJA 1ZZKA 2OPUA 2OPVA 4NBQA 2CPQA 4WALA 4LIJA 3L7ZC 4IFDG 2MJHA 1KHMA 2CTFA 2NN6G 2ANNA 1WVNA 2CTLA 1DT4A 1VIGA 1J4WA 2JEAI 2JA9A 2FMRA 2YQRA 2PY9A 2ANRA 1VIHA 2DGRA 4B8TA 1DTJA 4QMFB 4JVHA 1EC6A 4WANA 5JEAG 1ZZIA 3U1KA 1TUAA 2Z0SA 2CTEA 1WE8A 2BA0A 2QNDA 5C0XG 1K1GA 2E3UA 2JZXA 2JE6I 2AXYA 3V69A 1J5KA 1X4NA 4BA2I 2P2RA 4JVYA 2CTJA 2HH3A 5K36G 3AEVB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CTM A;  2BL5 A;  4AIM A;  2CTK A;  3VKE A;  2PQU A;  4AM3 A;  4BA1 I;  4OO1 G;  1ZTG A;  1X4M A;  2HH2 A;  2JVZ A;  2JEB I;  1ZZJ A;  1ZZK A;  2OPU A;  2OPV A;  4NBQ A;  2CPQ A;  4WAL A;  4LIJ A;  3L7Z C;  4IFD G;  2MJH A;  1KHM A;  2CTF A;  2NN6 G;  2ANN A;  1WVN A;  2CTL A;  1DT4 A;  1VIG A;  1J4W A;  2JEA I;  2JA9 A;  2FMR A;  2YQR A;  2PY9 A;  2ANR A;  1VIH A;  2DGR A;  4B8T A;  1DTJ A;  4QMF B;  4JVH A;  1EC6 A;  4WAN A;  5JEA G;  1ZZI A;  3U1K A;  1TUA A;  2Z0S A;  2CTE A;  1WE8 A;  2BA0 A;  2QND A;  5C0X G;  1K1G A;  2E3U A;  2JZX A;  2JE6 I;  2AXY A;  3V69 A;  1J5K A;  1X4N A;  4BA2 I;  2P2R A;  4JVY A;  2CTJ A;  2HH3 A;  5K36 G;  3AEV B; 
#chains in the Genus database with same CATH topology
 2BL5 A;  2CWF A;  4AIM A;  5IWA H;  2PQU A;  1XNR H;  4AM3 A;  3SB1 A;  4FJS A;  1SEI A;  1ZTG A;  4OO1 G;  1X4M A;  1N36 H;  1I6U A;  1WTJ A;  4NXM H;  2OPU A;  2LTM A;  4DV4 H;  4LIJ A;  2MJH A;  4G08 A;  1VIG A;  4B3M H;  5BR8 H;  3OET A;  2ZM6 H;  4H8A A;  4LF7 H;  1WHR A;  1VIH A;  2CWH A;  3GKU A;  4OX9 H;  4DR6 H;  4NXN H;  4DV0 H;  4JVH A;  1X9Z A;  4YHH H;  1HNX H;  4LFA H;  3RF2 A;  3J80 W;  1S20 A;  1F0X A;  3J81 W;  4DR3 H;  2BA0 A;  4JI1 H;  4AQY H;  4LF5 H;  2E3U A;  1XNQ H;  2JE6 I;  1J5K A;  4JI7 H;  4BA2 I;  4B3R H;  1NXU A;  2UXD H;  3AEV B;  1J5E H;  4NZR M;  1XMO H;  4LFB H;  1IBK H;  4E9J A;  1HNW H;  3KDG A;  4X65 H;  1N33 H;  4OD6 A;  4DR2 H;  4EC5 A;  3FAU A;  4NBQ A;  4WAL A;  4B8C D;  1ODH A;  2ZQE A;  2M8W A;  2UUB H;  2FPH X;  1WVN A;  1VBI A;  2CTL A;  1S03 G;  4FJU A;  2PY9 A;  2M6Q A;  4JI5 H;  4DR4 H;  2DGR A;  4B8T A;  2LRR A;  2PT7 G;  3KDK A;  2Y3M A;  3GAB A;  4QMF B;  4DR5 H;  4K0K H;  4JI6 H;  3T1H H;  2FFM A;  3U1K A;  2E5L H;  2Z0S A;  5LMN H;  4LFC H;  2O4C A;  2VKC A;  2CPM A;  2AXY A;  3UOE A;  1HNZ H;  2VQE H;  2P2R A;  4JI0 H;  1IBM H;  1V9N A;  4JVY A;  2NN6 G;  3NCV A;  4LF8 H;  2CTM A;  2LF0 A;  4JI2 H;  3VKE A;  5K36 G;  1X0A A;  1AN7 A;  3QD7 X;  1V8C A;  4BA1 I;  2HH2 A;  1MSZ A;  1ZZK A;  4JI4 H;  4KHP H;  4IFD G;  4JV5 H;  3L7Z C;  1KHM A;  4YY3 H;  2CTF A;  2ANN A;  4DV3 H;  2UUA H;  2JEA I;  2JA9 A;  2YQR A;  2LTL A;  2ANR A;  1I94 H;  4GKK H;  5LMU H;  2G8Y A;  1DTJ A;  4WAN A;  4PDB A;  1ZZI A;  4DUY H;  1TUA A;  1XMQ H;  2CTE A;  2F4V H;  1K1G A;  5IT9 W;  1FJG H;  1PQX A;  5FLX W;  3T1Y H;  3V69 A;  1X4N A;  4DV1 H;  5A2Q W;  4B3S H;  2CTJ A;  4NZT M;  4DV2 H;  2CTK A;  4LF9 H;  4X62 H;  2A1S A;  4LF6 H;  4DR7 H;  2X06 A;  1HR0 H;  1IBL H;  2VQF H;  2JVZ A;  2JEB I;  1ZZJ A;  2OPV A;  2CPQ A;  3I0P A;  2UXC H;  4LF4 H;  4DV6 H;  3OTO H;  3J7A K;  4JI8 H;  1DT4 A;  4DV7 H;  1J4W A;  2FMR A;  4GKJ H;  4JYA H;  2HHH H;  4DUZ H;  4OCH A;  1Z2I A;  1UG8 A;  4X66 H;  4DR1 H;  1FKA H;  2UU9 H;  1EC6 A;  1XRH A;  2UUC H;  1N32 H;  3JAM W;  5JEA G;  1WE8 A;  2K1H A;  4JI3 H;  2QND A;  3GR5 A;  3OSS D;  5C0X G;  1N34 H;  2UXB H;  4B3T H;  2JZX A;  5DT9 A;  4DV5 H;  2D9I A;  3EZJ A;  4X64 H;  5LL6 b;  2HH3 A; 
#chains in the Genus database with same CATH homology
 2CTM A;  2BL5 A;  4AIM A;  2CTK A;  3VKE A;  2PQU A;  4AM3 A;  4BA1 I;  4OO1 G;  1ZTG A;  1X4M A;  2HH2 A;  2JVZ A;  2JEB I;  1ZZJ A;  1ZZK A;  2OPU A;  2OPV A;  4NBQ A;  2CPQ A;  4WAL A;  4LIJ A;  3L7Z C;  4IFD G;  2MJH A;  1KHM A;  2CTF A;  2NN6 G;  2ANN A;  1WVN A;  2CTL A;  1DT4 A;  1VIG A;  1J4W A;  2JEA I;  2JA9 A;  2FMR A;  2YQR A;  2PY9 A;  2ANR A;  1VIH A;  2DGR A;  4B8T A;  1DTJ A;  4QMF B;  4JVH A;  1EC6 A;  4WAN A;  5JEA G;  1ZZI A;  3U1K A;  1TUA A;  2Z0S A;  2CTE A;  1WE8 A;  2BA0 A;  2QND A;  5C0X G;  1K1G A;  2E3U A;  2JZX A;  2JE6 I;  2AXY A;  3V69 A;  1J5K A;  1X4N A;  4BA2 I;  2P2R A;  4JVY A;  2CTJ A;  2HH3 A;  5K36 G;  3AEV B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...