2JVZA

Solution nmr structure of the second and third kh domains of ksrp
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
164
structure length
164
Chain Sequence
GTVQEIMIPAGKAGLVIGKGGETIKQLQERAGVKMILIQDGSQNTNVDKPLRIIGDPYKVQQACEMVMDILRERDQGGFGDRNEYGSRIGGGIDVPVPRHSVGVVIGRSGEMIKKIQNDAGVRIQFKQDDGTGPEKIAHIMGPPDRCEHAARIINDLLQSLRSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Far upstream element-binding protein 2
publication title Solution NMR Structure of the Second and Third KH Domains of KSRP
rcsb
source organism Homo sapiens
molecule tags Splicing
total genus 40
structure length 164
sequence length 164
ec nomenclature
pdb deposition date 2007-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 2jvzA02
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 2jvzA01
4IFDG 4AIMA 4NBQA 4BA1I 1X4MA 1ZZIA 2AXYA 2HH3A 1ZZKA 3U1KA 3AEVB 2CPQA 4BA2I 4AM3A 2P2RA 4OO1G 2JZXA 2CTKA 2CTLA 4JVYA 2BL5A 1VIHA 2MJHA 4B8TA 4JVHA 2JEBI 2YQRA 4QMFB 5C0XG 2JE6I 2JVZA 2PQUA 5JEAG 2OPVA 4WANA 2Z0SA 2CTJA 2E3UA 2CTFA 2FMRA 2CTEA 2ANNA 1WVNA 3L7ZC 1K1GA 1DT4A 4LIJA 2BA0A 2JEAI 1WE8A 1EC6A 2DGRA 1X4NA 1J5KA 1VIGA 2NN6G 1DTJA 2OPUA 2JA9A 2PY9A 4WALA 1ZZJA 3VKEA 5K36G 2ANRA 2HH2A 1TUAA 2QNDA 1J4WA 3V69A 1ZTGA 1KHMA 2CTMA
chains in the Genus database with same CATH superfamily
2HHHH 4NBQA 1N34H 3RF2A 4JI5H 4NXMH 2FPHX 4DV2H 3GR5A 2VQFH 1ZZKA 1ODHA 2CPQA 3J7AK 2UXCH 4FJSA 2CTLA 4DV6H 3GKUA 4YY3H 4JVHA 3SB1A 4LFBH 2YQRA 2CWFA 2JE6I 5JEAG 4EC5A 1UG8A 3OTOH 2ANNA 3L7ZC 4DV0H 4LIJA 2BA0A 4LF6H 2UXBH 1WE8A 1X4NA 1HNWH 2NN6G 4FJUA 2LTLA 4B3TH 1X0AA 2PT7G 3EZJA 1S03G 3VKEA 4G08A 4DR3H 2X06A 4NXNH 1WHRA 3V69A 4DR7H 2CTMA 4B8CD 2UUAH 1KHMA 2CPMA 3T1YH 1X4MA 2AXYA 1VBIA 2HH3A 4PDBA 2O4CA 3U1KA 3UOEA 4OD6A 2G8YA 4AQYH 3NCVA 4YHHH 4DR2H 4NZTM 4OO1G 2JZXA 2CTKA 2UU9H 2MJHA 4JYAH 3GABA 1WTJA 2Y3MA 5C0XG 3J80W 2Z0SA 2CWHA 2E3UA 2CTFA 1HR0H 1HNXH 2JEAI 4OCHA 4LFAH 4DV3H 4DR6H 1F0XA 3QD7X 1XMQH 4JI8H 2F4VH 1XRHA 4LF5H 2PY9A 1ZZJA 4JI0H 4B3SH 2ANRA 1I6UA 1TUAA 1HNZH 3KDGA 4H8AA 1AN7A 4IFDG 4AIMA 4B3MH 4GKKH 2K1HA 1ZZIA 1XMOH 4NZRM 2VQEH 2A1SA 1IBLH 1N36H 1IBMH 5DT9A 3AEVB 3KDKA 4AM3A 1PQXA 5IWAH 4JVYA 4DV7H 2BL5A 4E9JA 5FLXW 4DV4H 4LF7H 5LMNH 2JEBI 3OSSD 4QMFB 4X64H 1I94H 4DV5H 1Z2IA 3J81W 2PQUA 5LL6b 2OPVA 4DUZH 2CTJA 2FMRA 4LF8H 2FFMA 1WVNA 2ZM6H 1DT4A 4DR5H 3I0PA 2ZQEA 4LFCH 1N33H 4JI2H 1EC6A 1J5KA 1VIGA 1XNQH 4B3RH 4X66H 1DTJA 2OPUA 4K0KH 4WALA 4DUYH 4JI1H 2UXDH 5K36G 1J4WA 4DR4H 4X62H 4JI7H 4BA1I 3OETA 2LF0A 1XNRH 4BA2I 1SEIA 2P2RA 5A2QW 2VKCA 4DV1H 1MSZA 1IBKH 2UUBH 1VIHA 4B8TA 4JI3H 2M6QA 4JI6H 2JVZA 4X65H 1X9ZA 1V8CA 2LTMA 2CTEA 1K1GA 1NXUA 2LRRA 1J5EH 2UUCH 2DGRA 4LF4H 1FKAH 2E5LH 1V9NA 4JI4H 1S20A 4OX9H 5LMUH 1FJGH 4JV5H 5IT9W 5BR8H 2JA9A 4KHPH 4LF9H 2M8WA 4GKJH 4DR1H 2HH2A 2QNDA 3T1HH 4WANA 2D9IA 1ZTGA 1N32H 3FAUA 3JAMW
chains in the Genus database with same CATH topology
4IFDG 4AIMA 4NBQA 4BA1I 1X4MA 1ZZIA 2AXYA 2HH3A 1ZZKA 3U1KA 3AEVB 2CPQA 4BA2I 4AM3A 2P2RA 4OO1G 2JZXA 2CTKA 2CTLA 4JVYA 2BL5A 1VIHA 2MJHA 4B8TA 4JVHA 2JEBI 2YQRA 4QMFB 5C0XG 2JE6I 2JVZA 2PQUA 5JEAG 2OPVA 4WANA 2Z0SA 2CTJA 2E3UA 2CTFA 2FMRA 2CTEA 2ANNA 1WVNA 3L7ZC 1K1GA 1DT4A 4LIJA 2BA0A 2JEAI 1WE8A 1EC6A 2DGRA 1X4NA 1J5KA 1VIGA 2NN6G 1DTJA 2OPUA 2JA9A 2PY9A 4WALA 1ZZJA 3VKEA 5K36G 2ANRA 2HH2A 1TUAA 2QNDA 1J4WA 3V69A 1ZTGA 1KHMA 2CTMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IFD G;  4AIM A;  4NBQ A;  4BA1 I;  1X4M A;  1ZZI A;  2AXY A;  2HH3 A;  1ZZK A;  3U1K A;  3AEV B;  2CPQ A;  4BA2 I;  4AM3 A;  2P2R A;  4OO1 G;  2JZX A;  2CTK A;  2CTL A;  4JVY A;  2BL5 A;  1VIH A;  2MJH A;  4B8T A;  4JVH A;  2JEB I;  2YQR A;  4QMF B;  5C0X G;  2JE6 I;  2JVZ A;  2PQU A;  5JEA G;  2OPV A;  4WAN A;  2Z0S A;  2CTJ A;  2E3U A;  2CTF A;  2FMR A;  2CTE A;  2ANN A;  1WVN A;  3L7Z C;  1K1G A;  1DT4 A;  4LIJ A;  2BA0 A;  2JEA I;  1WE8 A;  1EC6 A;  2DGR A;  1X4N A;  1J5K A;  1VIG A;  2NN6 G;  1DTJ A;  2OPU A;  2JA9 A;  2PY9 A;  4WAL A;  1ZZJ A;  3VKE A;  5K36 G;  2ANR A;  2HH2 A;  1TUA A;  2QND A;  1J4W A;  3V69 A;  1ZTG A;  1KHM A;  2CTM A; 
#chains in the Genus database with same CATH topology
 2HHH H;  4NBQ A;  1N34 H;  3RF2 A;  4JI5 H;  4NXM H;  2FPH X;  4DV2 H;  3GR5 A;  2VQF H;  1ZZK A;  1ODH A;  2CPQ A;  3J7A K;  2UXC H;  4FJS A;  2CTL A;  4DV6 H;  3GKU A;  4YY3 H;  4JVH A;  3SB1 A;  4LFB H;  2YQR A;  2CWF A;  2JE6 I;  5JEA G;  4EC5 A;  1UG8 A;  3OTO H;  2ANN A;  3L7Z C;  4DV0 H;  4LIJ A;  2BA0 A;  4LF6 H;  2UXB H;  1WE8 A;  1X4N A;  1HNW H;  2NN6 G;  4FJU A;  2LTL A;  4B3T H;  1X0A A;  2PT7 G;  3EZJ A;  1S03 G;  3VKE A;  4G08 A;  4DR3 H;  2X06 A;  4NXN H;  1WHR A;  3V69 A;  4DR7 H;  2CTM A;  4B8C D;  2UUA H;  1KHM A;  2CPM A;  3T1Y H;  1X4M A;  2AXY A;  1VBI A;  2HH3 A;  4PDB A;  2O4C A;  3U1K A;  3UOE A;  4OD6 A;  2G8Y A;  4AQY H;  3NCV A;  4YHH H;  4DR2 H;  4NZT M;  4OO1 G;  2JZX A;  2CTK A;  2UU9 H;  2MJH A;  4JYA H;  3GAB A;  1WTJ A;  2Y3M A;  5C0X G;  3J80 W;  2Z0S A;  2CWH A;  2E3U A;  2CTF A;  1HR0 H;  1HNX H;  2JEA I;  4OCH A;  4LFA H;  4DV3 H;  4DR6 H;  1F0X A;  3QD7 X;  1XMQ H;  4JI8 H;  2F4V H;  1XRH A;  4LF5 H;  2PY9 A;  1ZZJ A;  4JI0 H;  4B3S H;  2ANR A;  1I6U A;  1TUA A;  1HNZ H;  3KDG A;  4H8A A;  1AN7 A;  4IFD G;  4AIM A;  4B3M H;  4GKK H;  2K1H A;  1ZZI A;  1XMO H;  4NZR M;  2VQE H;  2A1S A;  1IBL H;  1N36 H;  1IBM H;  5DT9 A;  3AEV B;  3KDK A;  4AM3 A;  1PQX A;  5IWA H;  4JVY A;  4DV7 H;  2BL5 A;  4E9J A;  5FLX W;  4DV4 H;  4LF7 H;  5LMN H;  2JEB I;  3OSS D;  4QMF B;  4X64 H;  1I94 H;  4DV5 H;  1Z2I A;  3J81 W;  2PQU A;  5LL6 b;  2OPV A;  4DUZ H;  2CTJ A;  2FMR A;  4LF8 H;  2FFM A;  1WVN A;  2ZM6 H;  1DT4 A;  4DR5 H;  3I0P A;  2ZQE A;  4LFC H;  1N33 H;  4JI2 H;  1EC6 A;  1J5K A;  1VIG A;  1XNQ H;  4B3R H;  4X66 H;  1DTJ A;  2OPU A;  4K0K H;  4WAL A;  4DUY H;  4JI1 H;  2UXD H;  5K36 G;  1J4W A;  4DR4 H;  4X62 H;  4JI7 H;  4BA1 I;  3OET A;  2LF0 A;  1XNR H;  4BA2 I;  1SEI A;  2P2R A;  5A2Q W;  2VKC A;  4DV1 H;  1MSZ A;  1IBK H;  2UUB H;  1VIH A;  4B8T A;  4JI3 H;  2M6Q A;  4JI6 H;  2JVZ A;  4X65 H;  1X9Z A;  1V8C A;  2LTM A;  2CTE A;  1K1G A;  1NXU A;  2LRR A;  1J5E H;  2UUC H;  2DGR A;  4LF4 H;  1FKA H;  2E5L H;  1V9N A;  4JI4 H;  1S20 A;  4OX9 H;  5LMU H;  1FJG H;  4JV5 H;  5IT9 W;  5BR8 H;  2JA9 A;  4KHP H;  4LF9 H;  2M8W A;  4GKJ H;  4DR1 H;  2HH2 A;  2QND A;  3T1H H;  4WAN A;  2D9I A;  1ZTG A;  1N32 H;  3FAU A;  3JAM W; 
#chains in the Genus database with same CATH homology
 4IFD G;  4AIM A;  4NBQ A;  4BA1 I;  1X4M A;  1ZZI A;  2AXY A;  2HH3 A;  1ZZK A;  3U1K A;  3AEV B;  2CPQ A;  4BA2 I;  4AM3 A;  2P2R A;  4OO1 G;  2JZX A;  2CTK A;  2CTL A;  4JVY A;  2BL5 A;  1VIH A;  2MJH A;  4B8T A;  4JVH A;  2JEB I;  2YQR A;  4QMF B;  5C0X G;  2JE6 I;  2JVZ A;  2PQU A;  5JEA G;  2OPV A;  4WAN A;  2Z0S A;  2CTJ A;  2E3U A;  2CTF A;  2FMR A;  2CTE A;  2ANN A;  1WVN A;  3L7Z C;  1K1G A;  1DT4 A;  4LIJ A;  2BA0 A;  2JEA I;  1WE8 A;  1EC6 A;  2DGR A;  1X4N A;  1J5K A;  1VIG A;  2NN6 G;  1DTJ A;  2OPU A;  2JA9 A;  2PY9 A;  4WAL A;  1ZZJ A;  3VKE A;  5K36 G;  2ANR A;  2HH2 A;  1TUA A;  2QND A;  1J4W A;  3V69 A;  1ZTG A;  1KHM A;  2CTM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...