2JVZA

Solution nmr structure of the second and third kh domains of ksrp
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
164
structure length
164
Chain Sequence
GTVQEIMIPAGKAGLVIGKGGETIKQLQERAGVKMILIQDGSQNTNVDKPLRIIGDPYKVQQACEMVMDILRERDQGGFGDRNEYGSRIGGGIDVPVPRHSVGVVIGRSGEMIKKIQNDAGVRIQFKQDDGTGPEKIAHIMGPPDRCEHAARIINDLLQSLRSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Splicing
molecule keywords Far upstream element-binding protein 2
publication title Solution NMR Structure of the Second and Third KH Domains of KSRP
rcsb
source organism Homo sapiens
total genus 40
structure length 164
sequence length 164
ec nomenclature
pdb deposition date 2007-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 2jvzA02
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 2jvzA01
2JZXA 3V69A 1ZZIA 1VIHA 4JVHA 5K36G 2CPQA 5JEAG 1EC6A 3L7ZC 2JE6I 1TUAA 1WVNA 4QMFB 5C0XG 2QNDA 1ZZJA 2PQUA 3U1KA 2Z0SA 2OPUA 4WANA 4WALA 2DGRA 2CTEA 4NBQA 4B8TA 2E3UA 1X4MA 1WE8A 2PY9A 2JVZA 1K1GA 2OPVA 4LIJA 1VIGA 2JA9A 2BL5A 2AXYA 2CTLA 4IFDG 3VKEA 2YQRA 3AEVB 2CTJA 2NN6G 2P2RA 2JEAI 1ZZKA 4AIMA 1J4WA 2CTFA 1J5KA 4AM3A 4JVYA 2FMRA 4BA1I 1KHMA 1ZTGA 2CTKA 2HH3A 2JEBI 1DTJA 4OO1G 1X4NA 2ANNA 2MJHA 2ANRA 4BA2I 1DT4A 2HH2A 2BA0A 2CTMA
chains in the Genus database with same CATH superfamily
4NZTM 3OETA 3GKUA 4X66H 2LTMA 1XNQH 4DV2H 2CPQA 1MSZA 5JEAG 4DR1H 2HHHH 5K36G 2JE6I 1IBKH 3GR5A 4OCHA 4QMFB 5LMNH 2PQUA 5C0XG 1HR0H 2VQEH 1N33H 1V9NA 4NXMH 2PT7G 4JI1H 1X9ZA 2CTEA 4B3MH 4LF5H 1X4MA 1WE8A 4H8AA 4B8CD 3T1HH 1Z2IA 4LFAH 4LF9H 5A2QW 2CWHA 2CTJA 2NN6G 2VQFH 1J4WA 4JVYA 1HNZH 4B3SH 4BA1I 4LF8H 2CPMA 4LF4H 3J7AK 5LMUH 1PQXA 4FJSA 4DR7H 1SEIA 1X4NA 2ANNA 2VKCA 3I0PA 4BA2I 1DT4A 4G08A 4DV3H 2CTMA 4KHPH 3V69A 3OTOH 4JVHA 3J80W 4LF7H 1EC6A 5DT9A 3SB1A 1TUAA 2QNDA 4JI2H 4JI8H 2O4CA 2D9IA 2OPUA 2Z0SA 2UUBH 4GKJH 4JI5H 1HNWH 2DGRA 2G8YA 4DR6H 4JYAH 2PY9A 2JVZA 2LRRA 4DR3H 2E5LH 1WHRA 3KDKA 2F4VH 2CTFA 2Y3MA 4AQYH 4X62H 1KHMA 1FKAH 1ZTGA 2CTKA 4X64H 3RF2A 4K0KH 4OD6A 4DV1H 4OX9H 4OO1G 1WTJA 4DV0H 1I6UA 3GABA 3EZJA 2HH2A 2UU9H 4LFCH 2UUCH 1ZZIA 1HNXH 4EC5A 2CWFA 4PDBA 3KDGA 2K1HA 1XNRH 4WANA 3U1KA 1NXUA 2M6QA 2UXDH 1AN7A 4DV4H 1VBIA 2X06A 3FAUA 4WALA 1N34H 3UOEA 4B8TA 2E3UA 4DR4H 4JI7H 3T1YH 2LTLA 2OPVA 4LIJA 2UXCH 1IBLH 2BL5A 1ODHA 2CTLA 1UG8A 4JI6H 2YQRA 4FJUA 4DR2H 2ZM6H 3AEVB 1X0AA 4AIMA 1S20A 1J5KA 4DV5H 4JV5H 2FFMA 4NZRM 4LFBH 5IT9W 5FLXW 1J5EH 1I94H 4X65H 1IBMH 2BA0A 5LL6b 1V8CA 4DV6H 1VIHA 2UUAH 4B3RH 3L7ZC 4YHHH 4JI0H 3JAMW 4LF6H 3QD7X 1WVNA 1ZZJA 3J81W 2LF0A 2M8WA 3NCVA 2FPHX 2ZQEA 4NBQA 4B3TH 5IWAH 4DV7H 1XRHA 4YY3H 4DUYH 1K1GA 4IFDG 1VIGA 2JA9A 2AXYA 3OSSD 4NXNH 4DUZH 3VKEA 4GKKH 1S03G 1F0XA 1XMOH 2P2RA 2JEAI 1ZZKA 5BR8H 2A1SA 4JI3H 4AM3A 1N32H 2FMRA 4E9JA 1N36H 2UXBH 2HH3A 2JEBI 1DTJA 2MJHA 2ANRA 4JI4H 1FJGH 1XMQH 4DR5H 2JZXA
chains in the Genus database with same CATH topology
2JZXA 3V69A 1ZZIA 1VIHA 4JVHA 5K36G 2CPQA 5JEAG 1EC6A 3L7ZC 2JE6I 1TUAA 1WVNA 4QMFB 5C0XG 2QNDA 1ZZJA 2PQUA 3U1KA 2Z0SA 2OPUA 4WANA 4WALA 2DGRA 2CTEA 4NBQA 4B8TA 2E3UA 1X4MA 1WE8A 2PY9A 2JVZA 1K1GA 2OPVA 4LIJA 1VIGA 2JA9A 2BL5A 2AXYA 2CTLA 4IFDG 3VKEA 2YQRA 3AEVB 2CTJA 2NN6G 2P2RA 2JEAI 1ZZKA 4AIMA 1J4WA 2CTFA 1J5KA 4AM3A 4JVYA 2FMRA 4BA1I 1KHMA 1ZTGA 2CTKA 2HH3A 2JEBI 1DTJA 4OO1G 1X4NA 2ANNA 2MJHA 2ANRA 4BA2I 1DT4A 2HH2A 2BA0A 2CTMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JZX A;  3V69 A;  1ZZI A;  1VIH A;  4JVH A;  5K36 G;  2CPQ A;  5JEA G;  1EC6 A;  3L7Z C;  2JE6 I;  1TUA A;  1WVN A;  4QMF B;  5C0X G;  2QND A;  1ZZJ A;  2PQU A;  3U1K A;  2Z0S A;  2OPU A;  4WAN A;  4WAL A;  2DGR A;  2CTE A;  4NBQ A;  4B8T A;  2E3U A;  1X4M A;  1WE8 A;  2PY9 A;  2JVZ A;  1K1G A;  2OPV A;  4LIJ A;  1VIG A;  2JA9 A;  2BL5 A;  2AXY A;  2CTL A;  4IFD G;  3VKE A;  2YQR A;  3AEV B;  2CTJ A;  2NN6 G;  2P2R A;  2JEA I;  1ZZK A;  4AIM A;  1J4W A;  2CTF A;  1J5K A;  4AM3 A;  4JVY A;  2FMR A;  4BA1 I;  1KHM A;  1ZTG A;  2CTK A;  2HH3 A;  2JEB I;  1DTJ A;  4OO1 G;  1X4N A;  2ANN A;  2MJH A;  2ANR A;  4BA2 I;  1DT4 A;  2HH2 A;  2BA0 A;  2CTM A; 
#chains in the Genus database with same CATH topology
 4NZT M;  3OET A;  3GKU A;  4X66 H;  2LTM A;  1XNQ H;  4DV2 H;  2CPQ A;  1MSZ A;  5JEA G;  4DR1 H;  2HHH H;  5K36 G;  2JE6 I;  1IBK H;  3GR5 A;  4OCH A;  4QMF B;  5LMN H;  2PQU A;  5C0X G;  1HR0 H;  2VQE H;  1N33 H;  1V9N A;  4NXM H;  2PT7 G;  4JI1 H;  1X9Z A;  2CTE A;  4B3M H;  4LF5 H;  1X4M A;  1WE8 A;  4H8A A;  4B8C D;  3T1H H;  1Z2I A;  4LFA H;  4LF9 H;  5A2Q W;  2CWH A;  2CTJ A;  2NN6 G;  2VQF H;  1J4W A;  4JVY A;  1HNZ H;  4B3S H;  4BA1 I;  4LF8 H;  2CPM A;  4LF4 H;  3J7A K;  5LMU H;  1PQX A;  4FJS A;  4DR7 H;  1SEI A;  1X4N A;  2ANN A;  2VKC A;  3I0P A;  4BA2 I;  1DT4 A;  4G08 A;  4DV3 H;  2CTM A;  4KHP H;  3V69 A;  3OTO H;  4JVH A;  3J80 W;  4LF7 H;  1EC6 A;  5DT9 A;  3SB1 A;  1TUA A;  2QND A;  4JI2 H;  4JI8 H;  2O4C A;  2D9I A;  2OPU A;  2Z0S A;  2UUB H;  4GKJ H;  4JI5 H;  1HNW H;  2DGR A;  2G8Y A;  4DR6 H;  4JYA H;  2PY9 A;  2JVZ A;  2LRR A;  4DR3 H;  2E5L H;  1WHR A;  3KDK A;  2F4V H;  2CTF A;  2Y3M A;  4AQY H;  4X62 H;  1KHM A;  1FKA H;  1ZTG A;  2CTK A;  4X64 H;  3RF2 A;  4K0K H;  4OD6 A;  4DV1 H;  4OX9 H;  4OO1 G;  1WTJ A;  4DV0 H;  1I6U A;  3GAB A;  3EZJ A;  2HH2 A;  2UU9 H;  4LFC H;  2UUC H;  1ZZI A;  1HNX H;  4EC5 A;  2CWF A;  4PDB A;  3KDG A;  2K1H A;  1XNR H;  4WAN A;  3U1K A;  1NXU A;  2M6Q A;  2UXD H;  1AN7 A;  4DV4 H;  1VBI A;  2X06 A;  3FAU A;  4WAL A;  1N34 H;  3UOE A;  4B8T A;  2E3U A;  4DR4 H;  4JI7 H;  3T1Y H;  2LTL A;  2OPV A;  4LIJ A;  2UXC H;  1IBL H;  2BL5 A;  1ODH A;  2CTL A;  1UG8 A;  4JI6 H;  2YQR A;  4FJU A;  4DR2 H;  2ZM6 H;  3AEV B;  1X0A A;  4AIM A;  1S20 A;  1J5K A;  4DV5 H;  4JV5 H;  2FFM A;  4NZR M;  4LFB H;  5IT9 W;  5FLX W;  1J5E H;  1I94 H;  4X65 H;  1IBM H;  2BA0 A;  5LL6 b;  1V8C A;  4DV6 H;  1VIH A;  2UUA H;  4B3R H;  3L7Z C;  4YHH H;  4JI0 H;  3JAM W;  4LF6 H;  3QD7 X;  1WVN A;  1ZZJ A;  3J81 W;  2LF0 A;  2M8W A;  3NCV A;  2FPH X;  2ZQE A;  4NBQ A;  4B3T H;  5IWA H;  4DV7 H;  1XRH A;  4YY3 H;  4DUY H;  1K1G A;  4IFD G;  1VIG A;  2JA9 A;  2AXY A;  3OSS D;  4NXN H;  4DUZ H;  3VKE A;  4GKK H;  1S03 G;  1F0X A;  1XMO H;  2P2R A;  2JEA I;  1ZZK A;  5BR8 H;  2A1S A;  4JI3 H;  4AM3 A;  1N32 H;  2FMR A;  4E9J A;  1N36 H;  2UXB H;  2HH3 A;  2JEB I;  1DTJ A;  2MJH A;  2ANR A;  4JI4 H;  1FJG H;  1XMQ H;  4DR5 H;  2JZX A; 
#chains in the Genus database with same CATH homology
 2JZX A;  3V69 A;  1ZZI A;  1VIH A;  4JVH A;  5K36 G;  2CPQ A;  5JEA G;  1EC6 A;  3L7Z C;  2JE6 I;  1TUA A;  1WVN A;  4QMF B;  5C0X G;  2QND A;  1ZZJ A;  2PQU A;  3U1K A;  2Z0S A;  2OPU A;  4WAN A;  4WAL A;  2DGR A;  2CTE A;  4NBQ A;  4B8T A;  2E3U A;  1X4M A;  1WE8 A;  2PY9 A;  2JVZ A;  1K1G A;  2OPV A;  4LIJ A;  1VIG A;  2JA9 A;  2BL5 A;  2AXY A;  2CTL A;  4IFD G;  3VKE A;  2YQR A;  3AEV B;  2CTJ A;  2NN6 G;  2P2R A;  2JEA I;  1ZZK A;  4AIM A;  1J4W A;  2CTF A;  1J5K A;  4AM3 A;  4JVY A;  2FMR A;  4BA1 I;  1KHM A;  1ZTG A;  2CTK A;  2HH3 A;  2JEB I;  1DTJ A;  4OO1 G;  1X4N A;  2ANN A;  2MJH A;  2ANR A;  4BA2 I;  1DT4 A;  2HH2 A;  2BA0 A;  2CTM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...