2JVZA

Solution nmr structure of the second and third kh domains of ksrp
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
164
structure length
164
Chain Sequence
b'GTVQEIMIPAGKAGLVIGKGGETIKQLQERAGVKMILIQDGSQNTNVDKPLRIIGDPYKVQQACEMVMDILRERDQGGFGDRNEYGSRIGGGIDVPVPRHSVGVVIGRSGEMIKKIQNDAGVRIQFKQDDGTGPEKIAHIMGPPDRCEHAARIINDLLQSLRSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Far upstream element-binding protein 2
publication title Solution NMR Structure of the Second and Third KH Domains of KSRP
rcsb
source organism Homo sapiens
molecule tags Splicing
total genus 40
structure length 164
sequence length 164
ec nomenclature
pdb deposition date 2007-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 2jvzA02
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 2jvzA01
4B8TA 4BA2I 2OPVA 2CTJA 1TUAA 2HH2A 1VIHA 3U1KA 1ZZJA 1ZTGA 5C0XG 1WE8A 4AM3A 4JVYA 1DT4A 4OO1G 5K36G 2BL5A 2CTKA 2JZXA 1K1GA 1WVNA 4JVHA 1VIGA 2E3UA 2ANNA 2JA9A 4WANA 2MJHA 1X4MA 2HH3A 2QNDA 3AEVB 2Z0SA 4BA1I 2JEAI 4NBQA 2CTMA 2CTLA 2CTEA 2PY9A 2DGRA 1J5KA 1X4NA 2YQRA 4AIMA 1ZZIA 2BA0A 2JE6I 2AXYA 3L7ZC 2PQUA 2JEBI 2P2RA 1J4WA 2CTFA 3VKEA 2FMRA 2CPQA 2NN6G 1DTJA 4LIJA 3V69A 1EC6A 1ZZKA 4QMFB 4WALA 2ANRA 1KHMA 2JVZA 5JEAG 2OPUA 4IFDG
chains in the Genus database with same CATH superfamily
4NXMH 3J7AK 1TUAA 1HNZH 1VIHA 4AM3A 1N32H 3GR5A 3T1HH 1WE8A 4DV6H 2JZXA 1V8CA 3KDKA 3SB1A 1K1GA 3EZJA 4B3MH 4JVHA 1VIGA 4DUZH 2UXDH 4DR3H 4WANA 4K0KH 2PT7G 4FJUA 4OX9H 2FPHX 4BA1I 2UXCH 3UOEA 3FAUA 1ODHA 2Y3MA 3T1YH 2M8WA 1HNWH 4G08A 1UG8A 4GKKH 2O4CA 2JE6I 2JEBI 2P2RA 1VBIA 4NZRM 4DR4H 4AQYH 1I6UA 4LF6H 1ZZKA 4JI1H 5IWAH 4DV7H 2VKCA 4X64H 4B3RH 4LFBH 1DT4A 5A2QW 4OO1G 2BL5A 2CTKA 2E3UA 1FJGH 2JA9A 4JI0H 2UUCH 4JI5H 2QNDA 3KDGA 3AEVB 1Z2IA 4DV1H 2JEAI 4KHPH 2D9IA 4X62H 1S20A 3NCVA 1N36H 3OSSD 3QD7X 2HHHH 4LF5H 4LF7H 1J5KA 1X9ZA 3RF2A 1ZZIA 1HNXH 2BA0A 2F4VH 2UUBH 1J4WA 2CTFA 4DR5H 2CWFA 2FMRA 2UUAH 4FJSA 1DTJA 4LIJA 4LF4H 3V69A 4X66H 5DT9A 4DR2H 5LL6b 1S03G 5JEAG 2OPUA 1PQXA 4IFDG 3U1KA 2HH2A 4NXNH 1ZTGA 4DR1H 2E5LH 1IBLH 5C0XG 5K36G 4NZTM 1XNRH 4DUYH 1NXUA 1X4MA 2HH3A 2LRRA 4LF8H 3GABA 4DV3H 4NBQA 2CTMA 2CTLA 4JI4H 4B3TH 1N34H 1XMOH 3J81W 4GKJH 1WHRA 1XRHA 2CWHA 1X4NA 1WTJA 2YQRA 5FLXW 2PQUA 2LTLA 4DR6H 1XNQH 5LMUH 1I94H 1V9NA 4JI8H 2LTMA 4JI6H 2CPQA 2NN6G 2ZQEA 4LF9H 1AN7A 2UXBH 1XMQH 1SEIA 1HR0H 2M6QA 4B3SH 4JYAH 1X0AA 4QMFB 3GKUA 4WALA 4OD6A 2JVZA 2ANRA 4LFAH 1EC6A 4PDBA 1KHMA 4B8TA 4E9JA 4YY3H 2OPVA 2CTJA 3OTOH 4BA2I 2LF0A 1ZZJA 2VQEH 4OCHA 2VQFH 4JVYA 1N33H 4DR7H 2X06A 1WVNA 3OETA 2ANNA 4DV5H 2FFMA 1IBKH 2MJHA 4JV5H 2G8YA 2Z0SA 4JI7H 1F0XA 4DV0H 4JI3H 2CTEA 2ZM6H 2PY9A 3JAMW 2CPMA 1J5EH 2DGRA 4H8AA 4YHHH 4AIMA 3J80W 2AXYA 5BR8H 4X65H 5IT9W 5LMNH 4DV2H 3VKEA 4LFCH 1FKAH 1MSZA 2A1SA 4DV4H 3I0PA 1IBMH 2K1HA 2UU9H 4B8CD 4EC5A 3L7ZC 4JI2H
chains in the Genus database with same CATH topology
4B8TA 4BA2I 2OPVA 2CTJA 1TUAA 2HH2A 1VIHA 3U1KA 1ZZJA 1ZTGA 5C0XG 1WE8A 4AM3A 4JVYA 1DT4A 4OO1G 5K36G 2BL5A 2CTKA 2JZXA 1K1GA 1WVNA 4JVHA 1VIGA 2E3UA 2ANNA 2JA9A 4WANA 2MJHA 1X4MA 2HH3A 2QNDA 3AEVB 2Z0SA 4BA1I 2JEAI 4NBQA 2CTMA 2CTLA 2CTEA 2PY9A 2DGRA 1J5KA 1X4NA 2YQRA 4AIMA 1ZZIA 2BA0A 2JE6I 2AXYA 3L7ZC 2PQUA 2JEBI 2P2RA 1J4WA 2CTFA 3VKEA 2FMRA 2CPQA 2NN6G 1DTJA 4LIJA 3V69A 1EC6A 1ZZKA 4QMFB 4WALA 2ANRA 1KHMA 2JVZA 5JEAG 2OPUA 4IFDG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B8T A;  4BA2 I;  2OPV A;  2CTJ A;  1TUA A;  2HH2 A;  1VIH A;  3U1K A;  1ZZJ A;  1ZTG A;  5C0X G;  1WE8 A;  4AM3 A;  4JVY A;  1DT4 A;  4OO1 G;  5K36 G;  2BL5 A;  2CTK A;  2JZX A;  1K1G A;  1WVN A;  4JVH A;  1VIG A;  2E3U A;  2ANN A;  2JA9 A;  4WAN A;  2MJH A;  1X4M A;  2HH3 A;  2QND A;  3AEV B;  2Z0S A;  4BA1 I;  2JEA I;  4NBQ A;  2CTM A;  2CTL A;  2CTE A;  2PY9 A;  2DGR A;  1J5K A;  1X4N A;  2YQR A;  4AIM A;  1ZZI A;  2BA0 A;  2JE6 I;  2AXY A;  3L7Z C;  2PQU A;  2JEB I;  2P2R A;  1J4W A;  2CTF A;  3VKE A;  2FMR A;  2CPQ A;  2NN6 G;  1DTJ A;  4LIJ A;  3V69 A;  1EC6 A;  1ZZK A;  4QMF B;  4WAL A;  2ANR A;  1KHM A;  2JVZ A;  5JEA G;  2OPU A;  4IFD G; 
#chains in the Genus database with same CATH topology
 4NXM H;  3J7A K;  1TUA A;  1HNZ H;  1VIH A;  4AM3 A;  1N32 H;  3GR5 A;  3T1H H;  1WE8 A;  4DV6 H;  2JZX A;  1V8C A;  3KDK A;  3SB1 A;  1K1G A;  3EZJ A;  4B3M H;  4JVH A;  1VIG A;  4DUZ H;  2UXD H;  4DR3 H;  4WAN A;  4K0K H;  2PT7 G;  4FJU A;  4OX9 H;  2FPH X;  4BA1 I;  2UXC H;  3UOE A;  3FAU A;  1ODH A;  2Y3M A;  3T1Y H;  2M8W A;  1HNW H;  4G08 A;  1UG8 A;  4GKK H;  2O4C A;  2JE6 I;  2JEB I;  2P2R A;  1VBI A;  4NZR M;  4DR4 H;  4AQY H;  1I6U A;  4LF6 H;  1ZZK A;  4JI1 H;  5IWA H;  4DV7 H;  2VKC A;  4X64 H;  4B3R H;  4LFB H;  1DT4 A;  5A2Q W;  4OO1 G;  2BL5 A;  2CTK A;  2E3U A;  1FJG H;  2JA9 A;  4JI0 H;  2UUC H;  4JI5 H;  2QND A;  3KDG A;  3AEV B;  1Z2I A;  4DV1 H;  2JEA I;  4KHP H;  2D9I A;  4X62 H;  1S20 A;  3NCV A;  1N36 H;  3OSS D;  3QD7 X;  2HHH H;  4LF5 H;  4LF7 H;  1J5K A;  1X9Z A;  3RF2 A;  1ZZI A;  1HNX H;  2BA0 A;  2F4V H;  2UUB H;  1J4W A;  2CTF A;  4DR5 H;  2CWF A;  2FMR A;  2UUA H;  4FJS A;  1DTJ A;  4LIJ A;  4LF4 H;  3V69 A;  4X66 H;  5DT9 A;  4DR2 H;  5LL6 b;  1S03 G;  5JEA G;  2OPU A;  1PQX A;  4IFD G;  3U1K A;  2HH2 A;  4NXN H;  1ZTG A;  4DR1 H;  2E5L H;  1IBL H;  5C0X G;  5K36 G;  4NZT M;  1XNR H;  4DUY H;  1NXU A;  1X4M A;  2HH3 A;  2LRR A;  4LF8 H;  3GAB A;  4DV3 H;  4NBQ A;  2CTM A;  2CTL A;  4JI4 H;  4B3T H;  1N34 H;  1XMO H;  3J81 W;  4GKJ H;  1WHR A;  1XRH A;  2CWH A;  1X4N A;  1WTJ A;  2YQR A;  5FLX W;  2PQU A;  2LTL A;  4DR6 H;  1XNQ H;  5LMU H;  1I94 H;  1V9N A;  4JI8 H;  2LTM A;  4JI6 H;  2CPQ A;  2NN6 G;  2ZQE A;  4LF9 H;  1AN7 A;  2UXB H;  1XMQ H;  1SEI A;  1HR0 H;  2M6Q A;  4B3S H;  4JYA H;  1X0A A;  4QMF B;  3GKU A;  4WAL A;  4OD6 A;  2JVZ A;  2ANR A;  4LFA H;  1EC6 A;  4PDB A;  1KHM A;  4B8T A;  4E9J A;  4YY3 H;  2OPV A;  2CTJ A;  3OTO H;  4BA2 I;  2LF0 A;  1ZZJ A;  2VQE H;  4OCH A;  2VQF H;  4JVY A;  1N33 H;  4DR7 H;  2X06 A;  1WVN A;  3OET A;  2ANN A;  4DV5 H;  2FFM A;  1IBK H;  2MJH A;  4JV5 H;  2G8Y A;  2Z0S A;  4JI7 H;  1F0X A;  4DV0 H;  4JI3 H;  2CTE A;  2ZM6 H;  2PY9 A;  3JAM W;  2CPM A;  1J5E H;  2DGR A;  4H8A A;  4YHH H;  4AIM A;  3J80 W;  2AXY A;  5BR8 H;  4X65 H;  5IT9 W;  5LMN H;  4DV2 H;  3VKE A;  4LFC H;  1FKA H;  1MSZ A;  2A1S A;  4DV4 H;  3I0P A;  1IBM H;  2K1H A;  2UU9 H;  4B8C D;  4EC5 A;  3L7Z C;  4JI2 H; 
#chains in the Genus database with same CATH homology
 4B8T A;  4BA2 I;  2OPV A;  2CTJ A;  1TUA A;  2HH2 A;  1VIH A;  3U1K A;  1ZZJ A;  1ZTG A;  5C0X G;  1WE8 A;  4AM3 A;  4JVY A;  1DT4 A;  4OO1 G;  5K36 G;  2BL5 A;  2CTK A;  2JZX A;  1K1G A;  1WVN A;  4JVH A;  1VIG A;  2E3U A;  2ANN A;  2JA9 A;  4WAN A;  2MJH A;  1X4M A;  2HH3 A;  2QND A;  3AEV B;  2Z0S A;  4BA1 I;  2JEA I;  4NBQ A;  2CTM A;  2CTL A;  2CTE A;  2PY9 A;  2DGR A;  1J5K A;  1X4N A;  2YQR A;  4AIM A;  1ZZI A;  2BA0 A;  2JE6 I;  2AXY A;  3L7Z C;  2PQU A;  2JEB I;  2P2R A;  1J4W A;  2CTF A;  3VKE A;  2FMR A;  2CPQ A;  2NN6 G;  1DTJ A;  4LIJ A;  3V69 A;  1EC6 A;  1ZZK A;  4QMF B;  4WAL A;  2ANR A;  1KHM A;  2JVZ A;  5JEA G;  2OPU A;  4IFD G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...