1V8CA

Crystal structure of moad related protein from thermus thermophilus hb8
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
165
structure length
165
Chain Sequence
PKVNLYATFRDLTGKSQLELPGATVGEVLENLVRAYPALKEELFEGEGLAERVSVFLEGRDVRYLQGLSTPLSPGATLDLFPPVAGGGFERTFGAFPPWLLERYLEEWGGTREGEGVYRLPGAVVRFREVEPLKVGSLSIPQLRVEVEGEEAERWFERIAFAASR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of MoaD related protein from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Protein binding
molecule keywords MoaD related protein
total genus 47
structure length 165
sequence length 165
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02597 ThiS ThiS family
A PF09189 DUF1952 Domain of unknown function (DUF1952)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1v8cA01
3.30.1370.80 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Molybdopterin cofactor biosynthesis MoaD-related, C-terminal domain 1v8cA02
1FM0D 1E6EB 1V8CA 1ZOYB 3W9CB 1QF6A 2W3SA 3AEBB 2WU5B 1KRHA 1N5WA 4US9A 1IUEA 2PVGC 2FBWB 1QOAA 3FAHA 1L6UA 1N63A 1FXAA 1XLNA 2CJNA 5H92C 1J7CA 3AEAB 4JX1C 3L4PA 1FMAD 2WS3B 1FIQA 1QOFA 3W5VB 1DOYA 2WDQB 3NVWA 1ZXIA 2MJDA 1CZPA 1TKGA 3AH7A 2K9XA 5C3JB 2HTME 1TYGB 3VR9B 2OHFA 3W5UB 3HRDD 4YXDB 1ROEA 3AE2B 1QOGA 5EE1A 2BT6A 4P6VF 4ZHPA 5AUKA 1XO3A 4C7YA 3AE5B 3AE6B 4US8A 1WXQA 1N60A 2B76B 1FRRA 3AE9B 3P4PB 4HRSA 2KMMA 3LXFA 3HVZA 3P63A 2DBYA 1OQQA 1NVID 1WRIA 3AE4B 4YTNB 5EE3A 5G5GA 1F0ZA 3DWGC 2CJOA 1E0ZA 1WGKA 4LTUA 1N61A 1DOXA 3FC4A 1VJKA 3KWLA 3AE7B 3EUB2 3P1MA 1TKYA 2JX5A 4FXCA 1ZUD2 3SFEB 2PKOA 4ITKA 1B9RA 3P4SB 2MH7A 3LB8C 5EE9A 1RWSA 1XLQA 2QIEB 3VR8B 1XLPA 1TJEA 1DOIA 1JRPA 3BIID 1KFYB 2PVOD 4WQMA 1OFFA 1DGJA 3AE1B 1YJJA 1GPXA 1AWDA 1V97A 1QOBA 1JW9D 4YSYB 2M19A 5G5HA 2L83A 1SIJA 1N62A 2G1EA 1J7AA 2BS4B 4C80A 3AEFB 5C2TB 3SR6A 2DWQA 3B2FA 1VDVA 3B9JA 4C7ZA 5H8YE 1FRDA 1QLBB 3AEEB 2BS3B 3DWMA 2MJ3A 1RFKA 2CU3A 2MJEA 4A9AA 1JALA 3NVZA 4YSZB 1FO4A 3ETRA 1VLBA 2W55A 4IDIA 1WYGA 2LEKA 1PFDA 3CWIA 1SB3C 1L0VB 2WQYB 2WU2B 2Y5CA 1E7PB 2JQRB 2WDRB 1JWBD 1OQRA 3AEGB 3NS1A 4ZHOA 5MPOA 1CJEA 1JROA 1RYJA 4WWMA 1GAQB 1JQ4A 3VRBB 2BS2B 2H88B 2KAJA 1AYFA 2WP9B 3AV8A 3PO0A 4KX6B 2E3TA 4YT0B 1R7SA 4ZOHC 3SFDB 2WDVB 1FXIA 1TKEA 2WLBA 3AE8B 3NVVA 3P4RB 5EE0A 3AMZA 4N6EB 1T3QA 1EWYC 2W3RA 1WWTA 1NYRA 5GXGB 1L5PA 2W54A 3B2GA 3AN1A 3RPFC 1PDXA 5AUIA 3ZYYX 1E10A 3AB5A 3HUIA 1YQ4B 1YQ3B 4YSXB 1E9MA 1NEKB 3ABVB 4YTMB 4JWSC 1PUTA 3AE3B 4JWUC 3NVYA 1I7HA 3P4QB 4YTPB 2ACZB 1QT9A 2H89B 3CIRB 2K5PA 3AM9A 3NRZA 3VRAB 2PIAA 2K22A 1RM6C 3AEDB 1XLOA 2M56B 4N58A 3AECB 1N5XA 1NYQA 1J7BA 4HROA 3WCQA 1NENB 1NI3A 2QJLA 2Q5WD 1KF6B 1A70A 1ZP0B 2EKIA 2N0SB 1FFVA 1UWMA 1FFUA 2L52A 1SF0A 1YJIA 4N59A 2AX5A 1L6VA 1JWAD 4USAA
chains in the Genus database with same CATH superfamily
1E8WA 2LXAA 2WXPA 1N5WA 4KDLB 4K7WA 2OJWA 3VFKA 1YMHE 3APFA 3L4PA 3CF6E 3C8YA 4TV3A 2KMCA 2CTKA 3PS6A 2MJDA 3AH7A 3I63C 2A4ZA 2B3AA 3TUOA 3W5UB 1WMHB 2V0GA 1G6JA 1MHHE 4TKNA 1FEHA 2BW2A 2J0JA 4PS7A 2OOBB 3HVZA 3P63A 4WALA 5G5GA 1Q0WB 3V3XA 1C4CA 2KJ6A 4NAMA 1L0YB 1RAXA 5IOIA 2KFKA 1V9NA 2BB6A 3KWLA 3DBSA 4FXCA 3DBHB 3W1SC 3OWEB 1B1ZA 3WAPA 3H1UA 4IWPA 3A9KB 4ANXA 2JA9A 2VKCA 4W9FA 3ZKJC 1QZEA 1WX8A 2FE8A 3N32A 4R3DA 3Q8BA 3RNCC 1WZ3A 1KJTA 2AWTA 4FLHA 4IUMB 2PMVA 2BYTA 3ETRA 4WWOA 2FAZA 2IDYA 2L00B 3L10B 4RGNA 1ZTGA 4KX6B 1AYFA 1D5ZC 1JRUA 4ANVA 1VRAB 2WLBA 1JWSD 4RM8A 1XF5L 1PQSA 2W54A 2RGFA 2WXIA 1N33H 2IGGA 3NS8A 2NPTB 2NTSA 2QSDA 2DZIA 1I6UA 4DDID 2RR9A 1QQRA 3CIRB 1F77A 1GOZA 3TL5A 1NI3A 2N7EA 1MJDA 1UWMA 4HKQA 4BVUC 1WE7A 1VZ6A 3UGBB 2Z0EB 1ACCA 1WI0A 3AU5A 2RPQA 1YD8U 4AP4C 1L0XB 2KC1A 2BL5A 2UU7A 4JI7H 2LRUA 4HVBA 3VTWA 3OG5A 4AS1A 4NZRM 3GOEA 4LNOA 1UG8A 4DR7H 1NXUA 1I4HA 4CYEA 1IBKH 2LMCA 2N9PC 2CTJA 2MBEA 4NZTM 2C7MB 3PZ7A 2XEWA 4LJOB 1XNQH 1GB4A 4GDLB 4FJVB 2KK8A 4M02A 2DGRA 2WGSA 2CHWA 5JEAG 3B1LX 1PQXA 2GRIA 4DK5A 3U52E 3U30A 1AWDA 2D3GA 3Q3OC 1I4RA 4DHZE 2INPE 2FUHB 1D3ZA 4D2KA 4H8AA 1S1QB 5G2NA 2XN9C 4ARIA 1RFKA 2CU3A 1EWCA 1TTNA 3PLUA 4MGYE 4YL8A 4FADA 5I4DA 4DV6H 4ZDVA 1FNUA 1OQRA 3JVZX 3IXSA 1R4MB 2LF0A 1ET6A 2D3CA 1TKEA 3NVVA 4KSKC 5GMVA 1A5RA 4LF9H 1ZE3D 3APDA 4P1CC 4RGOS 4MM3B 3AB5A 1YQ4B 2AQ3B 3Q8AA 4YTMB 4JWSC 1HTOA 1PUTA 3J9CA 1N36H 3P4QB 3U7DA 2ONQA 1LXDA 1XXGA 1K53A 4JPSA 3VRAB 3BWUD 2V3SA 4N58A 3RNGC 4JGHB 4C56C 2Q5WD 3EECA 1KF6B 2RSUA 2Z8LA 3BVGA 2UU9H 2DZJA 2PW9A 2AX5A 4FJYA 4GDKB 1WIAA 5IP4D 2Y3AA 3BINA 5FLXW 3AEBB 2WU5B 4BBNC 1HZ6A 2OEDA 2CJNA 2C60A 2GBNA 2PJHA 1ISNA 2HTME 2ZZPB 1TS3A 2OHFA 1IGCA 2NTTA 4GXBA 4KGSA 3WAMA 4YXDB 4E3CA 2FPHX 1ZZIA 2QILA 3AE6B 4OVVA 2LUMA 1MHXA 4PS3A 5E6NA 3H8HA 1EF5A 2LZ6A 5IT9W 4NJ6A 2I2YA 4DR3H 1GNUA 4DV0H 2HTHA 2GB1A 2QIEB 4NBQA 2LGSA 1EM7A 2JZ3B 4BKSD 4BKGA 1TY0A 1KM7A 3TEYA 1C4AA 2JZXA 1GJZA 1P3QU 4W9KA 2OPVA 3VDZA 3T1YH 3FKYA 4NZLB 5FR6A 3DWMA 3RZFA 3NVZA 4AIMA 1IBXA 2XBBC 3JYUA 3A9JA 4ZYNA 4TQ1A 2DNFA 1JQ4A 3VUXA 4W9LA 4EKUA 1I4GA 3VRBB 3EFCA 1P1AA 4YT0B 3HM6X 2FMRA 2R2QA 5EE0A 2WXMA 3WA0A 3S2AA 4PS8A 2KNBA 2G4SA 3NZUA 4JI2H 2DHZA 2NPTA 4PDBA 3R7RA 1WMHA 2JEAI 2D5GA 3TEXA 4DHJB 3MC0B 2MRPA 2YEPF 2BWFA 2JXXA 3ZO5B 4LJPB 3C19A 1UD7A 4WJOA 1XLOA 1V2YA 2RDBC 4HROA 3O13A 4ACFA 4X64H 3VTUA 3NZ3A 2LGIA 2WXFA 1GG3A 3KVFB 1XMOH 1TUAA 1ZOYB 1DT4A 1J0GA 3ZW3A 2QEJC 4B0MA 4JV5H 4OX9H 1EO6A 3LDZE 3AEAB 4XYCA 1FIQA 4MEMA 4XDCA 2VZKD 2ZCCA 2LJ5A 3DVNU 3OAWA 2GBRA 1E7VA 4PT5A 4C7YA 4S0RA 4A20A 2KMMA 3RNEC 1Q10A 2KLGA 4LK0M 4FJZA 4W9DA 4NY0A 4FA6A 2AQ2B 5DPWA 3B08A 4E9JA 3K9PB 1V5TA 1TJEA 3AU4A 1OFFA 4HWIB 2M1MA 1YJJA 1TT5B 4BA1I 4YSYB 3RN9C 2L83A 3RULA 2FCNA 3GABA 4KGRA 4EEWA 3K9OB 3KW5B 5DPRA 1MI0A 1WRDB 2MJEA 3RCZA 4OZBA 2HDEA 1PFDA 3ZVVA 1SB3C 2WU2B 5JZEB 3V61A 5E6OA 2JQRB 1I4QA 3DDCB 3LJ3A 3A4SC 4HDOA 4WWMA 2UXBH 4M0WB 3TMPB 3SHQA 4DR4H 2L7RA 2D3BA 2IBIB 1HZ5A 4RF1A 1FXIA 3AE8B 2KDIA 2I1JA 1SSNA 1NYRA 1WZ0A 3VQIA 2JSVX 5TSSA 1C1YB 3X23A 1FD6A 4C4VB 1I7HA 3VH3B 2PQUA 5BO4B 2GLSA 2H89B 4ANWA 4BZAA 2O4CA 3AM9A 4JI1H 1RM6C 2JPHA 4II2B 2BKRB 1XRHA 1KOTA 3BYTB 1WGHA 5G55A 4WIPA 3Q8FA 3VKEA 2K25A 1MG4A 3FAUA 3ZUNA 3PZDA 4DBGA 4JI4H 2L8JA 4DR2H 4KDIC 4K7SA 4B0EA 2ON8A 2ZNVC 2N9EB 1JCKB 2WXOA 3ML8A 2WWZA 1TGZB 2AQ1B 5DPSA 3ZRCA 1YJ1A 4WWNA 5D94A 2O6VB 4JI3H 1PGAA 2LTMA 1K51A 1C3TA 1MFWA 2AEHA 4US8A 2P2RA 1GB1A 1I4XA 2JUOA 5LXHA 2LUEA 1EU4A 1WM3A 1UGMA 2M8WA 3BK2A 2O6VA 2KDFB 4WAAA 1WY8A 1HE8A 3Q8EA 4IC7B 4BBNF 3UQBA 4ZRQA 3R66C 2EMTA 2HH2A 4I6PA 3UQAA 5E6PA 1GUAB 5BYSA 4GU2A 3HVDA 1JWMD 4DUYH 2ZW1A 3FILB 3GS2A 1N6ZA 1E8YA 2ZNVB 3QIJA 4MJSA 3JSVA 3GE3C 3PV1A 2PEAA 1QLBB 2V3NA 2MJ3A 2L05A 4RCOA 2WXLA 3IHPC 3CWIA 4IOIE 1ZDXA 3ZJUA 3RI7C 2KMAA 3C0RB 4HJKA 2J0MA 1RLFA 1EU3A 3DVGY 2JYTA 3IFWB 1T0QC 3N1YC 2G4DB 2V1YA 2IO1B 1N34H 1H4RA 4E74A 1HNXH 5CTRC 3VUWA 2LRRA 2KXJA 3CMMB 2JY6A 3NVYA 3WALA 3OSSD 2CPQA 1C79A 2ZVNA 3H7PB 2C9WB 1J5KA 4MDKE 3U4EG 3AEDB 3L16A 2ANNA 4ICVA 3R2IA 1X9ZA 2QJLA 1WM2A 4Q2JA 3Q6BA 3ZNHB 1JWAD 4NXNH 2J42A 1UBQA 5BR8H 5FKAC 2KJRA 4G08A 2YEPB 1L6UA 2O2VB 1WSPA 3DHHC 2WDQB 5L95C 2XK5B 1YN4A 1E8ZA 3NHEB 3TSSA 4A90A 3H7SA 1LGRA 3UF8A 2G9HD 2B76B 1XD3B 3AE9B 3ZIMA 2SEBD 4IG7B 4KHPH 4BFRA 2WXKA 1WJ4A 3RNAC 1XEEA 2L76A 3A1QA 4EOYA 3DHGC 4B3SH 4P16A 2MH7A 3LB8C 4DV5H 3VR8B 1DOIA 3MFGA 3DBRI 3AE1B 3ZDMC 4OVUA 2CWHA 4DHZB 5G5HA 4X65H 2N7DA 2BS4B 3VHTC 1EC6A 5C2TB 4EC5A 3VUYA 1IP9A 2DYBA 3M62B 4JIOU 2MBOA 4RH6A 4O1NA 3URYA 1UH6A 3QA8A 1WX7A 5MPOA 4K1RB 2KQ4X 4LF7H 2IZVB 1KHMA 2C7HA 3J80W 3ZYYX 1E90A 1SE2A 1ENFA 1E9MA 2ZCBA 3ABVB 2AL3A 2LI5A 4MACA 2F4VH 3ONSA 3RZWC 2PIAA 4LF5H 3QC8B 4AOFA 3AECB 3BVZA 1ODHA 1VR9A 4KIKB 4ICUA 1SF0A 4K0KH 3R7QA 4IM2A 1ZPSA 4XZ4A 3WAOA 2NS5A 3CSFA 3A4RA 2M4NA 2VRRB 2W3SA 3T9LA 2NVUI 3KUDB 1V1PA 1SIFA 2ZW0A 4IW0A 1CZPA 4UDUC 3JAMW 2DLBA 4HPLB 4B3TH 1V1PB 5EE1A 1ZDVA 5JXVA 4W9EA 4RM9A 1L4ZB 4URKA 4MSMB 3LXFA 2V9HA 2QNDA 3QHTA 4L23A 2MA9B 1E5WA 2C5LC 4XX5A 3VTVA 1WR6E 2R2OA 2LASA 5FR3A 4LDTB 2Y3MA 4LNFA 3V05A 3EUB2 1GC7A 1ZUD2 5J2RA 2FCQA 2KOXA 4DHJD 1YX6B 1Y56A 3IAM1 3NG0A 4WQMA 1ZZJA 1WF9A 2L0TA 5IO9A 2RMMA 3ZJVA 3OTOH 1SIJA 2BF8B 2AYOB 2DWQA 2KDEB 2BS3B 4G11A 4TQ0A 2N9KA 4MT5A 1KTKA 2X8XX 3ZXVA 3M3JA 2CR5A 4MSQB 2E3UA 2JZZA 4DQOC 1JROA 3KH0A 4OD6A 4OW0A 3N3KB 3SFDB 3PZ8A 3B0AA 3L54A 1S03G 2EELA 4EFOA 1K1GA 2IO0B 3N30A 1NEKB 1F1HA 2FCMA 2GI9A 2MQJA 3ZGZA 5C0XG 4EE2A 4GOCA 4GN1A 3PGEA 3NUHB 2OJRA 4YY3H 2ZM6H 2M17A 1LFDA 5D7GA 2N0SB 2HD5B 1FFVA 2NR2A 3O65B 4LNKA 3KUZA 4NNJB 3DHIC 4MJSB 2MSED 4US9A 3RT3B 2PVGC 3Q69A 1RFAA 4NQKE 5DCNA 2UUBH 2JXTA 4LNNA 2KANA 5C3JB 3Q3NC 1TYGB 4DR1H 2KN4A 2UUAH 1ZKHA 3ML9A 1J8CA 2LVPA 4MGIE 4DV4H 1CK1A 4OVZA 2DX5B 1WJUA 1N60A 3N1ZC 3KDKA 3RMKC 4RMAA 3OJ4B 2QC8A 1V6EA 4DXAB 2K1HA 2PPHA 2LXCA 3R2TA 3L0WB 1TBEA 2LWPA 2WYQA 1IBLH 4TUUA 3QD7X 4HEA1 4JYAH 3NOBA 3ALBA 5CHVC 5CHWA 3IVFA 1R4NB 3VVWB 2KWUB 3P42A 1VDVA 3AEEB 4NAWB 4WJNA 4TSSA 1VLBA 1MSZA 4W9GA 4IWQA 1ZZKA 1I94H 4JVYA 2WDRB 3AEGB 4LFBH 2NMQA 2N4FA 3MHSD 2WXHA 2J53A 4NAWA 3J7AK 3ECIA 3PRMB 5T8IA 3TEZA 2LVQA 1V49A 2A5UA 3DQVA 3ZTDA 2LGDA 4B3MH 4LNIA 2K6DB 2CPMA 2K22A 1MPEA 1J7BA 1NYQA 4WANA 2N7JA 1P7EA 2DAFA 1T0YA 4DDGD 1T0RC 5AZGA 1FNVA 4PYZA 1L6VA 1WFYA 1LQBA 3OJ3A 3W9CB 2KTRA 3W1SA 1SE3A 4DV7H 4CHKA 3DVGX 4HCNB 2KN5A 5H92C 3WIMA 4ZYSA 4JX1C 3LYYA 2DYOA 1DOYA 1HXYD 1BUIC 4LIJA 1WX9A 4RFBA 2X38A 3KUCB 3MTNB 3U8ZA 3QWZB 2K0PA 1KLVA 2CHXA 1XNRH 1WJ6A 5EE3A 2N9LA 1TZ1A 1WGKA 1N61A 3PHWB 2IY0B 1VJKA 3FILA 3V6CB 2VH1A 2JRIB 1SEBD 1ESFA 3P4SB 2UXDH 4ZRPA 1XLPA 4FBJB 1F52A 2PVOD 1OEYJ 3GE8C 1DGJA 2MEKA 3Q3FA 3IG3A 4REZA 2CTMA 2W82A 2KKCA 4HDQA 4KV2A 1S3SG 1V5OA 1DYQA 4DWFA 4C7ZA 4W9CA 2I1KA 3PRZA 2LRWA 4HLEA 4XE0A 2LTLA 1WYGA 5K36G 4RGMA 4RGTA 4OCHA 4DUZH 1WJNA 4EZLA 2LD9A 2WX1A 1SJHD 2KAJA 3AV8A 3RNBC 2GBMA 4WURA 3DPDA 3A1QB 3AMZA 4KSLC 1L5PA 3AN1A 5IKCM 2IY1B 4F8CB 1E10A 2Y5PA 3HUIA 1FCCC 5D3IB 4LDTD 3NRZA 1N32H 5CHFA 3ZLZA 1WE8A 3QJZA 3JSVB 4H2AA 1HTQA 2MX2A 2OPUA 5LNK1 2PTLA 4MH0E 3SEBA 3L08A 1FM0D 5IN7A 4ANUA 3GR5A 1V8CA 3I0PA 4DR5H 3RFZB 1KRHA 1P98A 3N1XC 1N63A 1FXAA 2BYFA 2W9NA 3GKUA 3KYDD 1BT0A 2KYWA 2NBWB 2ZPNA 1P9DU 2BTEA 1V80A 4M01A 2CTEA 2M0XA 1SBBB 3DOWA 1HNZH 3P4PB 3ZTCA 3Q3MC 4DR6H 1ZXHA 3DWGC 1SJED 3BVMA 1I42A 1EUVB 2WXGA 3AE7B 3Q8CA 3RNFC 4ITKA 1C9FA 5EE9A 1VIGA 3PRPB 1YNTE 2D10A 1KFYB 5J17A 1YOVB 1V97A 5BMHA 4F7ZA 2MLBA 2M19A 1N62A 3RF2A 2G8YA 2JVZA 3EA6A 3SR6A 1TY2A 1WXSA 2IO2B 3ZNZB 4B9KA 3W2DA 5BMIA 4GKKH 2W55A 4XC2A 4FHKA 3OETA 2Y5CA 3NS1A 4WQOB 2BS2B 1R7SA 2WDVB 1E8XA 2K1FA 4WAFA 1HQRD 5LMNH 2FIFA 4JQWC 3PLVA 2V4IB 4LF6H 4MM3A 3ZNID 1M4VA 2UWQA 5CX3A 1AN8A 1KLUD 5LMUH 3GZNI 1NDDA 2MBHA 2AXYA 5JHBA 2LJIA 2DZMA 1A70A 1UZXB 2TSSA 2WDTB 4WWPA 2GBKA 1C4PA 1MVKA 3IAS1 4AM3A 1UBIA 2WXJA 5J18A 4OZCA 2V4LA 2HHHH 1QF6A 1WVNA 1ZGUB 1VZ7A 2BPSA 2D3AA 2I38A 3QK0A 5LXIB 2KC2A 1QOAA 1NI2A 1XLNA 3ZNGC 4JI5H 2WS3B 1TKGA 4B3RH 2ZQEA 2MJHA 4OO1G 5AZFA 4B8CD 1ROEA 4P6VF 4HKZE 2CKHB 3DBLI 3RUIB 1WXQA 4JI8H 3A9JB 1WRIA 1NVID 3VH4B 1F0ZA 1V1OA 2L32A 4FJUA 2CJOA 1HNWH 2LGYA 1BXTA 2GBJA 4W9IA 3SB1A 3HM3A 1UWXA 1B9RA 2IGDA 2INCC 4EUTA 4DV1H 1XCQL 2JZPA 2KWCA 1WGRA 1Z2MA 4BOZB 2KDMA 3IBEA 2L3ZA 2XNAC 4B6WA 1QOBA 1JW9D 3H6NA 1XCTL 5L83A 2PLPA 2MCNB 2G1EA 1FXTB 3PSEB 2DYMA 4L2YA 5IAAC 3A9KA 3NZSA 4A9AA 2WXQA 2RDGA 1L0VB 2K39A 2HH3A 2KX0A 5EDSA 4HCPB 1YN5A 2N1VA 1IPGA 5LLIA 4G0NB 1PYWD 2E6XA 1D6EC 4HXDA 4IWOA 5BYRA 1Z5SB 1SXTA 3ZDTA 3QARA 2ZPYA 3DBRB 1AARA 1VIHA 2SAKA 4CQNA 2KX3A 3U1KA 2VZKB 4DV2H 1FPYA 1VCBA 1JWUD 4P1BC 2BA0A 1SGHA 4YHHH 1FNWA 2YVCA 5HI1A 2KD0A 4JL9A 2KVZA 3FAHA 4CO7A 3H7PA 2RDHA 3I5JC 4M8NA 3KDGA 2K9XA 4MGZE 2LGXA 5BYQA 5A2QW 1V81A 3PT2B 2IGHA 3AE2B 2RPVA 2BT6A 5HG2A 4ZHPA 5HFYA 1FRRA 1KH0A 2DBYA 1OQQA 3AE4B 4RNAA 1X4NA 4FJSA 4AJWA 1E0ZA 4X62H 4LTUA 1ZW7A 1WE6A 1Q5WB 2G45B 1C76A 1E7UA 2YQRA 1IBMH 3DCGA 2WX0A 1UGJA 1HEZE 4GDKA 4GIVA 2KDBA 3Q3JA 4WJQA 4IFDG 4OZAA 1FO4A 3RD2A 2BYEA 3V60A 3GP7A 3MHZA 1L2NA 3IT4B 3UOEA 4BA2I 1JWBD 1TZOA 2Z0SA 3Q14C 2WNMA 4BOSC 4ZOHC 2VQFH 2J4XA 2QDFA 4K7UA 4N6EB 2D11A 2MP2A 4B8TA 2W3RA 2CTLA 3RPFC 2EKEC 1JMLA 1YQBA 3VXWA 1H8CA 2C7NB 3AE3B 4M00A 1T0SC 2BQQA 2UXCH 4EZKA 3L7ZC 1N5XA 4A8XC 1ZP0B 4AQYH 1K50A 4M8MA 4OHJA 3W1YA 1YJIA 2JRHA 3EZJA 3V69A 2O6VD 3R8BA 1I35A 3Q2AC 4IKGA 4HPMB 1YX5B 2IO3B 3J81W 1J7CA 3CSTA 1WR1A 3DBLB 1NBFC 4HK2A 2KHWB 3PVLA 3T1HH 4DV3H 3VR9B 2K8CA 3EC8A 2KVRA 4C4VA 3BZDB 2PT7G 1J19A 2DZKA 3KQ4A 2ASQA 3E9SA 2KJHB 2KFJA 4K81A 4M0WA 1P0RA 3HHMA 3NJTA 1DOXA 2CS4A 4DXFA 2FNJB 1C78A 2UUCH 1SEIA 2VQEH 2YLMA 1XLQA 2KZRA 1SE4A 4GB9A 1WTJA 5DT9A 3APCA 1UELA 3RYTA 3PPAA 1S20A 2K3UA 4C80A 1L7YA 3AEFB 4NJ7A 5H8YE 1HR0H 2MW5A 1PGXA 1JALA 3UI3A 4IDIA 4X66H 1ET9A 1OGWA 2BWES 4GGQA 1WHRA 1CJEA 1RYJA 2H88B 2E3TA 4JI0H 4WJPA 1I4PA 4ZRKA 1WWTA 3TIXA 4EZJA 2R61A 4JWUC 2KTFA 2ANRA 1YN3A 1UUPA 3N9YC 4GMVA 4NJCA 4JE3B 4ZRIA 2UYZB 2JE6I 1R4NI 3DBHI 2EKIA 4BKSA 3BY4B 3KYCD 2FFMA 1FFUA 1T5XD 2V3PA 2L52A 3PREA 2QMTA 4F1SA 1XQQA 3QX1A 3H9DA 3I57A 2CTFA 2WXNA 5HHDG 1DTJA 2FBWB 2ZVOA 1V9JA 4KKJA 1SE9A 2PE9A 1FMAD 1VBIA 3PTFC 3NVWA 4NPNA 4AWJA 3T3OA 4NXMH 3ZXRA 4W9JA 1K52A 2WXRA 4MGKE 5DPTA 3VAWA 2FCSA 3V6EB 1Q1OA 1XO3A 3AE5B 2NCNA 4IM3A 1D5MC 4YTNB 5KHOA 5HKHA 3M63B 4G50A 2KWDA 1Y8RC 2GOWA 2D07B 3SU8X 4LCDE 4MELA 2NBVB 3KLSX 2X06A 1RWSA 1R4MI 3A33B 1JRPA 3EGRA 2J0KA 3R3MA 1GPXA 3TBLD 4GSWA 4L1BA 2ICIA 2LHEA 5KHQA 3B9JA 4ZHOA 4KZ0A 4JLCA 1TS5A 4YSZB 3NY5A 2LEKA 4G3XB 3MP9A 2WQYB 4X57B 3UINB 2E5LH 1MG8A 2DAJA 1GAQB 4KGTA 2K8BA 2Z59B 2AL6A 2MBBB 5LL6b 3X0WA 1EWYC 1LO5D 2HE7A 2JWZA 2QCZA 2DENB 4II3B 5GXGB 3T8MA 5TR5A 5AUIA 4YSXB 1YQ3B 2JF5A 1K8RB 2EMSA 4QAYA 4HJGE 1GC6A 3KWVA 4A6QA 4FULA 4YTPB 2JEBI 2ACZB 4KZCA 1BMLC 2QHOA 3AEVB 5FK9C 1F2RI 4K3CA 3MJ5A 1IGDA 4XGAB 3P2BA 4GDLA 4DXGA 2MP2B 2HJ1A 2BBCA 1VD2A 2BVCA 4USAA 3NCVA 3UIOB 2KTRB 1E6EB 3ENEA 4J6IA 5BMGA 5IWAH 1IUEA 2KACA 4P7IA 4A3PA 3QAQA 2IYDB 3W5VB 3TEWA 2M6QA 1ZXIA 2KQ7A 2D9IA 3PHXB 3M95A 3HRDD 1J4WA 1WH3A 1L4DB 2WHIA 2MWSB 1Z2IA 5IA7A 4ZRJA 5E6JA 5AUKA 3I9V1 2Y5BB 3AXCA 2KLCA 4HRSA 3MC9A 2KWVB 1QILA 5D2MB 3ZJTA 2IJ0A 2M8SA 2RD0A 4KIKA 3FC4A 1M94A 3MJWA 1TKYA 2LHDA 3SFEB 2A1SA 4A3OA 1WYWB 3BIID 4ASWC 2INNE 1HA5A 2FIDA 5AZHA 4GLSC 1P7FA 1WGDA 2L0FA 3B2FA 2JWUA 1C77A 1WXMA 3D32A 2BB5A 1IYFA 4AQ7A 1T6BX 1V86A 1IBXB 2N1WA 4J3OD 2ZJDA 2LFIA 2FUG1 1VZ8A 3BYYB 3PO0A 4ARCA 4JVHA 1CMXB 4NQLB 4RF0A 1STEA 1KLGD 1WGYA 3P4RB 1J5EH 1TS2A 3B2GA 1PDXA 3HIZA 5C1ZA 2K6QA 4B95A 4BAXA 5JHAA 3HK0A 4GKJH 1D5XC 1X0AA 1QT9A 4FHJA 4K3BA 1OTRB 2J7QB 4KVGB 2M56B 1X4MA 2PE6B 3TJPA 4WH4A 1YIWA 3WCQA 1NENB 2NBUA 2CHZA 1WGGA 2KFKB 1EF1A 2BYVE 3QCAA 3SD5A 1CQVA 1QKZA 1LM8B 4S17A 5D6JB 4KKIA 4XWWA 4LF8H 2KT7A 2ZEQA 2LVOA 3E56A 2D2QA 2INDC 5AEKB 2O2VA 2REXA 1OQYA 4LFAH 2MBQA 1AW7A 1QOFA 4A55A 1D4BA 1OEYA 2XK5A 1RRBA 3WANA 4N9F4 5JH5C 3BK1A 1AN7A 3T3NA 2BKFA 1X1MA 2KQSA 1QOGA 3QQ8B 3L17A 1FCLA 2JU6X 1FJGH 1XT9B 1F2RC 3U2SC 5D3DA 3ZQ4A 4IM0A 2M0AA 3EFUA 1UNSA 4LFCH 4HPPA 3P1MA 2JX5A 2PKOA 1F9JA 1F0XA 1TIFA 4XDDA 4FN2A 4MH8A 1U4AA 2PY9A 4E71A 4I6LB 2CWFA 2J52A 3OLMD 4AJYB 2HJ8A 1J7AA 3N20C 3UIPB 3SDLC 3IT6B 2Z0DB 2L1AA 1TS4A 2GMIC 1FRDA 3GZNB 4QMFB 4XWTA 3GB1A 1PGBA 3EHVA 1E7PB 1UF0A 4JI6H 2WP9B 4PYUA 4C00A 2NN6G 4BKTA 2N9XA 2JT4B 2K8HA 2G3QB 1T3QA 4W9HA 3V62A 2VH2A 2IPKD 4AUQC 4LLGM 4YWGG 3L13A 3U7ZA 2CU1A 2MHJA 2K5PA 1XMQH 4I6NB 2BGFA 4TMAB 2JYEA 2KO3A 3MC8A 3JW0X 3AULA 1FKAH 3I3TB 5C23A 4LF4H 3TCAA 3DVNV 1WXVA 4N59A 3AI5A 1WXAA 2JVCA 4PK1A 3ZRFA
chains in the Genus database with same CATH topology
3W9CB 3W1SA 4IKGA 1SE3A 2WXPA 1N5WA 4B0EA 2ON8A 1JCKB 2WXOA 5H92C 4ZYSA 1YMHE 1J7CA 4JX1C 3LYYA 3L4PA 2DYOA 3C8YA 1DOYA 1HXYD 1BUIC 2AQ1B 2MJDA 3AH7A 4RFBA 2X38A 3VR9B 3TUOA 3W5UB 1PGAA 2V0GA 1MHHE 1K51A 2K0PA 3BZDB 1FEHA 2BW2A 3KQ4A 4US8A 3E9SA 1GB1A 1I4XA 3HVZA 3P63A 5EE3A 5G5GA 2N9LA 1EU4A 4M0WA 3V3XA 1C4CA 3BK2A 4NAMA 1WGKA 1L0YB 1N61A 1DOXA 1VJKA 2BB6A 3KWLA 3Q8EA 3FILA 4DXFA 4FXCA 1C78A 1SEBD 1ESFA 3OWEB 1B1ZA 3P4SB 4ZRQA 4ZRPA 1XLQA 1XLPA 1SE4A 2PVOD 5BYSA 3HVDA 1JWMD 1DGJA 2MEKA 4REZA 2ZW1A 2W82A 3FILB 3GS2A 4R3DA 2FE8A 3Q8BA 2K3UA 1DYQA 4C80A 3AEFB 4C7ZA 5H8YE 1QLBB 2V3NA 2PMVA 2MJ3A 1PGXA 2BYTA 1JALA 4RCOA 2WXLA 3ETRA 4XE0A 3UI3A 4IDIA 1WYGA 3CWIA 4RGMA 2IDYA 4IOIE 1ET9A 4RGTA 1ZDXA 3ZJUA 1CJEA 1RYJA 4RGNA 1SJHD 2H88B 4KX6B 2KAJA 1AYFA 1D5ZC 3AV8A 2E3TA 4WURA 1VRAB 1I4PA 2WLBA 1JWSD 1EU3A 3AMZA 1XF5L 2JYTA 1WWTA 1L5PA 2W54A 3AN1A 2WXIA 1E10A 2IGGA 2Y5PA 3HUIA 2NTSA 1FCCC 2QSDA 5D3IB 2R61A 4JWUC 3NVYA 1QQRA 1C79A 3CIRB 3NRZA 1F77A 1UUPA 1YN3A 3N9YC 4NJCA 3U4EG 3AEDB 4JE3B 1GOZA 1NI3A 3R2IA 2QJLA 2EKIA 4H2AA 1UWMA 4HKQA 1FFUA 1T5XD 2V3PA 2L52A 4Q2JA 2QMTA 1VZ6A 5LNK1 1JWAD 1ACCA 2PTLA 3SEBA 2J42A 1FM0D 1V8CA 3RFZB 3I57A 1L0XB 1KRHA 2WXNA 5FKAC 5HHDG 2YEPB 2FBWB 1L6UA 1N63A 1FXAA 4KKJA 1FMAD 1WSPA 2WDQB 3NVWA 1YN4A 4AS1A 3T3OA 3TSSA 4A90A 2BTEA 1K52A 2WXRA 1I4HA 2LMCA 1SBBB 1XO3A 2G9HD 3AE5B 2B76B 3P4PB 3AE9B 3PZ7A 2SEBD 1ZXHA 1D5MC 4YTNB 3DWGC 1SJED 2KWDA 2WXKA 3BVMA 1GB4A 1XEEA 4GDLB 2WXGA 3AE7B 3Q8CA 4ITKA 3KLSX 1C9FA 4P16A 2MH7A 3LB8C 5EE9A 1RWSA 3VR8B 1DOIA 1JRPA 2GRIA 1YNTE 3MFGA 3EGRA 1KFYB 3U52E 3AE1B 1GPXA 1AWDA 1V97A 5BMHA 2M19A 5G5HA 1I4RA 1N62A 2INPE 4L1BA 2BS4B 3EA6A 2ICIA 3SR6A 5C2TB 4D2KA 1TY2A 2LHEA 3B9JA 2XN9C 4ZHOA 4ARIA 1RFKA 2CU3A 1EWCA 1TS5A 4YSZB 5BMIA 3W2DA 2W55A 5I4DA 2LEKA 3MP9A 4RH6A 2WQYB 4O1NA 3URYA 2Y5CA 3NS1A 5MPOA 1FNUA 1OQRA 3IXSA 1GAQB 4KGTA 2KQ4X 2BS2B 1ET6A 1R7SA 2WDVB 1TKEA 3NVVA 1EWYC 1LO5D 4WAFA 1HQRD 1ZE3D 5GXGB 5AUIA 3ZYYX 1SE2A 2V4IB 4MM3B 3AB5A 4RGOS 1ENFA 1YQ3B 1YQ4B 4YSXB 1E9MA 2AQ3B 3Q8AA 3ABVB 1M4VA 3J9CA 1PUTA 4HJGE 4JWSC 3KWVA 4MACA 4A6QA 4YTMB 3P4QB 4YTPB 2ACZB 2ONQA 1AN8A 1KLUD 1XXGA 1K53A 1BMLC 4JPSA 3BWUD 3VRAB 2PIAA 5FK9C 1F2RI 3MJ5A 4N58A 1IGDA 3AECB 2LJIA 4C56C 2Q5WD 1KF6B 2Z8LA 1A70A 3BVGA 3BVZA 2TSSA 1VR9A 4DXGA 1C4PA 1MVKA 1SF0A 1ZPSA 2PW9A 2AX5A 3IAS1 2BBCA 4GDKB 2WXJA 4USAA 2Y3AA 4OZCA 1E6EB 1QF6A 1VZ7A 2W3SA 3AEBB 2WU5B 1HZ6A 2I38A 5BMGA 1IUEA 2KACA 1V1PA 1QOAA 2OEDA 2CJNA 1XLNA 2ZW0A 2WS3B 3W5VB 3TEWA 1ZXIA 1CZPA 1TKGA 4UDUC 2HTME 1TS3A 2OHFA 1IGCA 2NTTA 4KGSA 3HRDD 4YXDB 1L4DB 2DLBA 1V1PB 1ROEA 5EE1A 1ZDVA 4P6VF 4HKZE 5JXVA 5E6JA 2QILA 3I9V1 5AUKA 3AE6B 1L4ZB 1WXQA 4HRSA 3LXFA 1QILA 1WRIA 1NVID 2LUMA 1MHXA 4L23A 1F0ZA 1V1OA 2L32A 2CJOA 3H8HA 3ZJTA 2IJ0A 5FR3A 1BXTA 3FC4A 3V05A 2I2YA 3EUB2 1TKYA 1UWXA 1ZUD2 2LHDA 3SFEB 1B9RA 2IGDA 2GB1A 2QIEB 1EM7A 3IAM1 1XCQL 1Y56A 2JZPA 3BIID 4WQMA 2KDMA 2INNE 2XNAC 1HA5A 1QOBA 1JW9D 1TY0A 2RMMA 3ZJVA 3TEYA 1C4AA 1XCTL 1SIJA 2PLPA 2G1EA 2DYMA 4GLSC 1P7FA 4L2YA 4NZLB 2DWQA 3B2FA 2JWUA 3DWMA 2BS3B 4A9AA 1C77A 4TQ0A 2BB5A 3NVZA 4AQ7A 2N9KA 2WXQA 1T6BX 2RDGA 4MT5A 1KTKA 1IBXB 1L0VB 1IBXA 4J3OD 2LFIA 2FUG1 1VZ8A 4TQ1A 4DQOC 1JROA 3BYYB 1JQ4A 1I4GA 3VRBB 1YN5A 3PO0A 4OW0A 4YT0B 4ARCA 4RF0A 1STEA 1KLGD 3SFDB 3PZ8A 5EE0A 2WXMA 3P4RB 1PYWD 2E6XA 1D6EC 1TS2A 3B2GA 1PDXA 2EELA 5BYRA 1NEKB 3ZGZA 1SXTA 2GI9A 2D5GA 3TEXA 4EE2A 1D5XC 3MC0B 1QT9A 2YEPF 3NUHB 1XLOA 2M56B 2SAKA 4WH4A 4HROA 3WCQA 1NENB 3O13A 4CQNA 5D7GA 2N0SB 2VZKB 3NZ3A 1FFVA 2LGIA 2WXFA 1CQVA 1JWUD 1QKZA 1FNWA 1ZOYB 4KKIA 5HI1A 4XWWA 4US9A 2QEJC 4B0MA 3E56A 2PVGC 3Q69A 3FAHA 3AEAB 2RDHA 1AW7A 1FIQA 1QOFA 4A55A 2JXTA 1D4BA 4XDCA 2VZKD 2K9XA 5C3JB 1TYGB 5BYQA 2KN4A 3BK1A 3T3NA 2RPVA 2IGHA 3AE2B 1QOGA 4PT5A 1FCLA 2BT6A 5HG2A 2JU6X 4ZHPA 1CK1A 5HFYA 4OVZA 4C7YA 1F2RC 1N60A 3U2SC 1FRRA 5D3DA 2KMMA 1KH0A 3ZQ4A 2DBYA 1Q10A 1OQQA 3AE4B 4RNAA 2M0AA 4LK0M 1E0ZA 1UNSA 4LTUA 3R2TA 3P1MA 2AQ2B 2JX5A 1C76A 2PKOA 4HEA1 1TJEA 1UGJA 4XDDA 4MH8A 1OFFA 1YJJA 1HEZE 4YSYB 2L83A 2J52A 1J7AA 3IT6B 3P42A 4KGRA 2L1AA 1TS4A 1VDVA 1FRDA 3AEEB 4NAWB 4OZAA 1MI0A 2MJEA 4XWTA 1FO4A 4TSSA 4OZBA 2HDEA 3GB1A 1VLBA 1PGBA 1PFDA 1SB3C 3GP7A 2WU2B 3MHZA 3IT4B 1E7PB 2JQRB 2WDRB 1JWBD 3AEGB 1TZOA 1I4QA 4WWMA 2NMQA 2WNMA 2WP9B 2WXHA 2J53A 4ZOHC 1HZ5A 4RF1A 1FXIA 3AE8B 2J4XA 5T8IA 4N6EB 1T3QA 3TEZA 2W3RA 1SSNA 1NYRA 3VQIA 3RPFC 2JSVX 1JMLA 5TSSA 1FD6A 2IPKD 3AE3B 4LLGM 1I7HA 4YWGG 3U7ZA 2H89B 2K5PA 3AM9A 4TMAB 2JYEA 2K22A 1RM6C 1N5XA 1MPEA 1J7BA 1NYQA 2N7JA 1P7EA 3BYTB 4A8XC 1ZP0B 4WIPA 1K50A 4OHJA 3Q8FA 1YJIA 4N59A 1FNVA 1L6VA 3R8BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FM0 D;  1E6E B;  1V8C A;  1ZOY B;  3W9C B;  1QF6 A;  2W3S A;  3AEB B;  2WU5 B;  1KRH A;  1N5W A;  4US9 A;  1IUE A;  2PVG C;  2FBW B;  1QOA A;  3FAH A;  1L6U A;  1N63 A;  1FXA A;  1XLN A;  2CJN A;  5H92 C;  1J7C A;  3AEA B;  4JX1 C;  3L4P A;  1FMA D;  2WS3 B;  1FIQ A;  1QOF A;  3W5V B;  1DOY A;  2WDQ B;  3NVW A;  1ZXI A;  2MJD A;  1CZP A;  1TKG A;  3AH7 A;  2K9X A;  5C3J B;  2HTM E;  1TYG B;  3VR9 B;  2OHF A;  3W5U B;  3HRD D;  4YXD B;  1ROE A;  3AE2 B;  1QOG A;  5EE1 A;  2BT6 A;  4P6V F;  4ZHP A;  5AUK A;  1XO3 A;  4C7Y A;  3AE5 B;  3AE6 B;  4US8 A;  1WXQ A;  1N60 A;  2B76 B;  1FRR A;  3AE9 B;  3P4P B;  4HRS A;  2KMM A;  3LXF A;  3HVZ A;  3P63 A;  2DBY A;  1OQQ A;  1NVI D;  1WRI A;  3AE4 B;  4YTN B;  5EE3 A;  5G5G A;  1F0Z A;  3DWG C;  2CJO A;  1E0Z A;  1WGK A;  4LTU A;  1N61 A;  1DOX A;  3FC4 A;  1VJK A;  3KWL A;  3AE7 B;  3EUB 2;  3P1M A;  1TKY A;  2JX5 A;  4FXC A;  1ZUD 2;  3SFE B;  2PKO A;  4ITK A;  1B9R A;  3P4S B;  2MH7 A;  3LB8 C;  5EE9 A;  1RWS A;  1XLQ A;  2QIE B;  3VR8 B;  1XLP A;  1TJE A;  1DOI A;  1JRP A;  3BII D;  1KFY B;  2PVO D;  4WQM A;  1OFF A;  1DGJ A;  3AE1 B;  1YJJ A;  1GPX A;  1AWD A;  1V97 A;  1QOB A;  1JW9 D;  4YSY B;  2M19 A;  5G5H A;  2L83 A;  1SIJ A;  1N62 A;  2G1E A;  1J7A A;  2BS4 B;  4C80 A;  3AEF B;  5C2T B;  3SR6 A;  2DWQ A;  3B2F A;  1VDV A;  3B9J A;  4C7Z A;  5H8Y E;  1FRD A;  1QLB B;  3AEE B;  2BS3 B;  3DWM A;  2MJ3 A;  1RFK A;  2CU3 A;  2MJE A;  4A9A A;  1JAL A;  3NVZ A;  4YSZ B;  1FO4 A;  3ETR A;  1VLB A;  2W55 A;  4IDI A;  1WYG A;  2LEK A;  1PFD A;  3CWI A;  1SB3 C;  1L0V B;  2WQY B;  2WU2 B;  2Y5C A;  1E7P B;  2JQR B;  2WDR B;  1JWB D;  1OQR A;  3AEG B;  3NS1 A;  4ZHO A;  5MPO A;  1CJE A;  1JRO A;  1RYJ A;  4WWM A;  1GAQ B;  1JQ4 A;  3VRB B;  2BS2 B;  2H88 B;  2KAJ A;  1AYF A;  2WP9 B;  3AV8 A;  3PO0 A;  4KX6 B;  2E3T A;  4YT0 B;  1R7S A;  4ZOH C;  3SFD B;  2WDV B;  1FXI A;  1TKE A;  2WLB A;  3AE8 B;  3NVV A;  3P4R B;  5EE0 A;  3AMZ A;  4N6E B;  1T3Q A;  1EWY C;  2W3R A;  1WWT A;  1NYR A;  5GXG B;  1L5P A;  2W54 A;  3B2G A;  3AN1 A;  3RPF C;  1PDX A;  5AUI A;  3ZYY X;  1E10 A;  3AB5 A;  3HUI A;  1YQ4 B;  1YQ3 B;  4YSX B;  1E9M A;  1NEK B;  3ABV B;  4YTM B;  4JWS C;  1PUT A;  3AE3 B;  4JWU C;  3NVY A;  1I7H A;  3P4Q B;  4YTP B;  2ACZ B;  1QT9 A;  2H89 B;  3CIR B;  2K5P A;  3AM9 A;  3NRZ A;  3VRA B;  2PIA A;  2K22 A;  1RM6 C;  3AED B;  1XLO A;  2M56 B;  4N58 A;  3AEC B;  1N5X A;  1NYQ A;  1J7B A;  4HRO A;  3WCQ A;  1NEN B;  1NI3 A;  2QJL A;  2Q5W D;  1KF6 B;  1A70 A;  1ZP0 B;  2EKI A;  2N0S B;  1FFV A;  1UWM A;  1FFU A;  2L52 A;  1SF0 A;  1YJI A;  4N59 A;  2AX5 A;  1L6V A;  1JWA D;  4USA A; 
#chains in the Genus database with same CATH topology
 1E8W A;  2LXA A;  2WXP A;  1N5W A;  4KDL B;  4K7W A;  2OJW A;  3VFK A;  1YMH E;  3APF A;  3L4P A;  3CF6 E;  3C8Y A;  4TV3 A;  2KMC A;  2CTK A;  3PS6 A;  2MJD A;  3AH7 A;  3I63 C;  2A4Z A;  2B3A A;  3TUO A;  3W5U B;  1WMH B;  2V0G A;  1G6J A;  1MHH E;  4TKN A;  1FEH A;  2BW2 A;  2J0J A;  4PS7 A;  2OOB B;  3HVZ A;  3P63 A;  4WAL A;  5G5G A;  1Q0W B;  3V3X A;  1C4C A;  2KJ6 A;  4NAM A;  1L0Y B;  1RAX A;  5IOI A;  2KFK A;  1V9N A;  2BB6 A;  3KWL A;  3DBS A;  4FXC A;  3DBH B;  3W1S C;  3OWE B;  1B1Z A;  3WAP A;  3H1U A;  4IWP A;  3A9K B;  4ANX A;  2JA9 A;  2VKC A;  4W9F A;  3ZKJ C;  1QZE A;  1WX8 A;  2FE8 A;  3N32 A;  4R3D A;  3Q8B A;  3RNC C;  1WZ3 A;  1KJT A;  2AWT A;  4FLH A;  4IUM B;  2PMV A;  2BYT A;  3ETR A;  4WWO A;  2FAZ A;  2IDY A;  2L00 B;  3L10 B;  4RGN A;  1ZTG A;  4KX6 B;  1AYF A;  1D5Z C;  1JRU A;  4ANV A;  1VRA B;  2WLB A;  1JWS D;  4RM8 A;  1XF5 L;  1PQS A;  2W54 A;  2RGF A;  2WXI A;  1N33 H;  2IGG A;  3NS8 A;  2NPT B;  2NTS A;  2QSD A;  2DZI A;  1I6U A;  4DDI D;  2RR9 A;  1QQR A;  3CIR B;  1F77 A;  1GOZ A;  3TL5 A;  1NI3 A;  2N7E A;  1MJD A;  1UWM A;  4HKQ A;  4BVU C;  1WE7 A;  1VZ6 A;  3UGB B;  2Z0E B;  1ACC A;  1WI0 A;  3AU5 A;  2RPQ A;  1YD8 U;  4AP4 C;  1L0X B;  2KC1 A;  2BL5 A;  2UU7 A;  4JI7 H;  2LRU A;  4HVB A;  3VTW A;  3OG5 A;  4AS1 A;  4NZR M;  3GOE A;  4LNO A;  1UG8 A;  4DR7 H;  1NXU A;  1I4H A;  4CYE A;  1IBK H;  2LMC A;  2N9P C;  2CTJ A;  2MBE A;  4NZT M;  2C7M B;  3PZ7 A;  2XEW A;  4LJO B;  1XNQ H;  1GB4 A;  4GDL B;  4FJV B;  2KK8 A;  4M02 A;  2DGR A;  2WGS A;  2CHW A;  5JEA G;  3B1L X;  1PQX A;  2GRI A;  4DK5 A;  3U52 E;  3U30 A;  1AWD A;  2D3G A;  3Q3O C;  1I4R A;  4DHZ E;  2INP E;  2FUH B;  1D3Z A;  4D2K A;  4H8A A;  1S1Q B;  5G2N A;  2XN9 C;  4ARI A;  1RFK A;  2CU3 A;  1EWC A;  1TTN A;  3PLU A;  4MGY E;  4YL8 A;  4FAD A;  5I4D A;  4DV6 H;  4ZDV A;  1FNU A;  1OQR A;  3JVZ X;  3IXS A;  1R4M B;  2LF0 A;  1ET6 A;  2D3C A;  1TKE A;  3NVV A;  4KSK C;  5GMV A;  1A5R A;  4LF9 H;  1ZE3 D;  3APD A;  4P1C C;  4RGO S;  4MM3 B;  3AB5 A;  1YQ4 B;  2AQ3 B;  3Q8A A;  4YTM B;  4JWS C;  1HTO A;  1PUT A;  3J9C A;  1N36 H;  3P4Q B;  3U7D A;  2ONQ A;  1LXD A;  1XXG A;  1K53 A;  4JPS A;  3VRA B;  3BWU D;  2V3S A;  4N58 A;  3RNG C;  4JGH B;  4C56 C;  2Q5W D;  3EEC A;  1KF6 B;  2RSU A;  2Z8L A;  3BVG A;  2UU9 H;  2DZJ A;  2PW9 A;  2AX5 A;  4FJY A;  4GDK B;  1WIA A;  5IP4 D;  2Y3A A;  3BIN A;  5FLX W;  3AEB B;  2WU5 B;  4BBN C;  1HZ6 A;  2OED A;  2CJN A;  2C60 A;  2GBN A;  2PJH A;  1ISN A;  2HTM E;  2ZZP B;  1TS3 A;  2OHF A;  1IGC A;  2NTT A;  4GXB A;  4KGS A;  3WAM A;  4YXD B;  4E3C A;  2FPH X;  1ZZI A;  2QIL A;  3AE6 B;  4OVV A;  2LUM A;  1MHX A;  4PS3 A;  5E6N A;  3H8H A;  1EF5 A;  2LZ6 A;  5IT9 W;  4NJ6 A;  2I2Y A;  4DR3 H;  1GNU A;  4DV0 H;  2HTH A;  2GB1 A;  2QIE B;  4NBQ A;  2LGS A;  1EM7 A;  2JZ3 B;  4BKS D;  4BKG A;  1TY0 A;  1KM7 A;  3TEY A;  1C4A A;  2JZX A;  1GJZ A;  1P3Q U;  4W9K A;  2OPV A;  3VDZ A;  3T1Y H;  3FKY A;  4NZL B;  5FR6 A;  3DWM A;  3RZF A;  3NVZ A;  4AIM A;  1IBX A;  2XBB C;  3JYU A;  3A9J A;  4ZYN A;  4TQ1 A;  2DNF A;  1JQ4 A;  3VUX A;  4W9L A;  4EKU A;  1I4G A;  3VRB B;  3EFC A;  1P1A A;  4YT0 B;  3HM6 X;  2FMR A;  2R2Q A;  5EE0 A;  2WXM A;  3WA0 A;  3S2A A;  4PS8 A;  2KNB A;  2G4S A;  3NZU A;  4JI2 H;  2DHZ A;  2NPT A;  4PDB A;  3R7R A;  1WMH A;  2JEA I;  2D5G A;  3TEX A;  4DHJ B;  3MC0 B;  2MRP A;  2YEP F;  2BWF A;  2JXX A;  3ZO5 B;  4LJP B;  3C19 A;  1UD7 A;  4WJO A;  1XLO A;  1V2Y A;  2RDB C;  4HRO A;  3O13 A;  4ACF A;  4X64 H;  3VTU A;  3NZ3 A;  2LGI A;  2WXF A;  1GG3 A;  3KVF B;  1XMO H;  1TUA A;  1ZOY B;  1DT4 A;  1J0G A;  3ZW3 A;  2QEJ C;  4B0M A;  4JV5 H;  4OX9 H;  1EO6 A;  3LDZ E;  3AEA B;  4XYC A;  1FIQ A;  4MEM A;  4XDC A;  2VZK D;  2ZCC A;  2LJ5 A;  3DVN U;  3OAW A;  2GBR A;  1E7V A;  4PT5 A;  4C7Y A;  4S0R A;  4A20 A;  2KMM A;  3RNE C;  1Q10 A;  2KLG A;  4LK0 M;  4FJZ A;  4W9D A;  4NY0 A;  4FA6 A;  2AQ2 B;  5DPW A;  3B08 A;  4E9J A;  3K9P B;  1V5T A;  1TJE A;  3AU4 A;  1OFF A;  4HWI B;  2M1M A;  1YJJ A;  1TT5 B;  4BA1 I;  4YSY B;  3RN9 C;  2L83 A;  3RUL A;  2FCN A;  3GAB A;  4KGR A;  4EEW A;  3K9O B;  3KW5 B;  5DPR A;  1MI0 A;  1WRD B;  2MJE A;  3RCZ A;  4OZB A;  2HDE A;  1PFD A;  3ZVV A;  1SB3 C;  2WU2 B;  5JZE B;  3V61 A;  5E6O A;  2JQR B;  1I4Q A;  3DDC B;  3LJ3 A;  3A4S C;  4HDO A;  4WWM A;  2UXB H;  4M0W B;  3TMP B;  3SHQ A;  4DR4 H;  2L7R A;  2D3B A;  2IBI B;  1HZ5 A;  4RF1 A;  1FXI A;  3AE8 B;  2KDI A;  2I1J A;  1SSN A;  1NYR A;  1WZ0 A;  3VQI A;  2JSV X;  5TSS A;  1C1Y B;  3X23 A;  1FD6 A;  4C4V B;  1I7H A;  3VH3 B;  2PQU A;  5BO4 B;  2GLS A;  2H89 B;  4ANW A;  4BZA A;  2O4C A;  3AM9 A;  4JI1 H;  1RM6 C;  2JPH A;  4II2 B;  2BKR B;  1XRH A;  1KOT A;  3BYT B;  1WGH A;  5G55 A;  4WIP A;  3Q8F A;  3VKE A;  2K25 A;  1MG4 A;  3FAU A;  3ZUN A;  3PZD A;  4DBG A;  4JI4 H;  2L8J A;  4DR2 H;  4KDI C;  4K7S A;  4B0E A;  2ON8 A;  2ZNV C;  2N9E B;  1JCK B;  2WXO A;  3ML8 A;  2WWZ A;  1TGZ B;  2AQ1 B;  5DPS A;  3ZRC A;  1YJ1 A;  4WWN A;  5D94 A;  2O6V B;  4JI3 H;  1PGA A;  2LTM A;  1K51 A;  1C3T A;  1MFW A;  2AEH A;  4US8 A;  2P2R A;  1GB1 A;  1I4X A;  2JUO A;  5LXH A;  2LUE A;  1EU4 A;  1WM3 A;  1UGM A;  2M8W A;  3BK2 A;  2O6V A;  2KDF B;  4WAA A;  1WY8 A;  1HE8 A;  3Q8E A;  4IC7 B;  4BBN F;  3UQB A;  4ZRQ A;  3R66 C;  2EMT A;  2HH2 A;  4I6P A;  3UQA A;  5E6P A;  1GUA B;  5BYS A;  4GU2 A;  3HVD A;  1JWM D;  4DUY H;  2ZW1 A;  3FIL B;  3GS2 A;  1N6Z A;  1E8Y A;  2ZNV B;  3QIJ A;  4MJS A;  3JSV A;  3GE3 C;  3PV1 A;  2PEA A;  1QLB B;  2V3N A;  2MJ3 A;  2L05 A;  4RCO A;  2WXL A;  3IHP C;  3CWI A;  4IOI E;  1ZDX A;  3ZJU A;  3RI7 C;  2KMA A;  3C0R B;  4HJK A;  2J0M A;  1RLF A;  1EU3 A;  3DVG Y;  2JYT A;  3IFW B;  1T0Q C;  3N1Y C;  2G4D B;  2V1Y A;  2IO1 B;  1N34 H;  1H4R A;  4E74 A;  1HNX H;  5CTR C;  3VUW A;  2LRR A;  2KXJ A;  3CMM B;  2JY6 A;  3NVY A;  3WAL A;  3OSS D;  2CPQ A;  1C79 A;  2ZVN A;  3H7P B;  2C9W B;  1J5K A;  4MDK E;  3U4E G;  3AED B;  3L16 A;  2ANN A;  4ICV A;  3R2I A;  1X9Z A;  2QJL A;  1WM2 A;  4Q2J A;  3Q6B A;  3ZNH B;  1JWA D;  4NXN H;  2J42 A;  1UBQ A;  5BR8 H;  5FKA C;  2KJR A;  4G08 A;  2YEP B;  1L6U A;  2O2V B;  1WSP A;  3DHH C;  2WDQ B;  5L95 C;  2XK5 B;  1YN4 A;  1E8Z A;  3NHE B;  3TSS A;  4A90 A;  3H7S A;  1LGR A;  3UF8 A;  2G9H D;  2B76 B;  1XD3 B;  3AE9 B;  3ZIM A;  2SEB D;  4IG7 B;  4KHP H;  4BFR A;  2WXK A;  1WJ4 A;  3RNA C;  1XEE A;  2L76 A;  3A1Q A;  4EOY A;  3DHG C;  4B3S H;  4P16 A;  2MH7 A;  3LB8 C;  4DV5 H;  3VR8 B;  1DOI A;  3MFG A;  3DBR I;  3AE1 B;  3ZDM C;  4OVU A;  2CWH A;  4DHZ B;  5G5H A;  4X65 H;  2N7D A;  2BS4 B;  3VHT C;  1EC6 A;  5C2T B;  4EC5 A;  3VUY A;  1IP9 A;  2DYB A;  3M62 B;  4JIO U;  2MBO A;  4RH6 A;  4O1N A;  3URY A;  1UH6 A;  3QA8 A;  1WX7 A;  5MPO A;  4K1R B;  2KQ4 X;  4LF7 H;  2IZV B;  1KHM A;  2C7H A;  3J80 W;  3ZYY X;  1E90 A;  1SE2 A;  1ENF A;  1E9M A;  2ZCB A;  3ABV B;  2AL3 A;  2LI5 A;  4MAC A;  2F4V H;  3ONS A;  3RZW C;  2PIA A;  4LF5 H;  3QC8 B;  4AOF A;  3AEC B;  3BVZ A;  1ODH A;  1VR9 A;  4KIK B;  4ICU A;  1SF0 A;  4K0K H;  3R7Q A;  4IM2 A;  1ZPS A;  4XZ4 A;  3WAO A;  2NS5 A;  3CSF A;  3A4R A;  2M4N A;  2VRR B;  2W3S A;  3T9L A;  2NVU I;  3KUD B;  1V1P A;  1SIF A;  2ZW0 A;  4IW0 A;  1CZP A;  4UDU C;  3JAM W;  2DLB A;  4HPL B;  4B3T H;  1V1P B;  5EE1 A;  1ZDV A;  5JXV A;  4W9E A;  4RM9 A;  1L4Z B;  4URK A;  4MSM B;  3LXF A;  2V9H A;  2QND A;  3QHT A;  4L23 A;  2MA9 B;  1E5W A;  2C5L C;  4XX5 A;  3VTV A;  1WR6 E;  2R2O A;  2LAS A;  5FR3 A;  4LDT B;  2Y3M A;  4LNF A;  3V05 A;  3EUB 2;  1GC7 A;  1ZUD 2;  5J2R A;  2FCQ A;  2KOX A;  4DHJ D;  1YX6 B;  1Y56 A;  3IAM 1;  3NG0 A;  4WQM A;  1ZZJ A;  1WF9 A;  2L0T A;  5IO9 A;  2RMM A;  3ZJV A;  3OTO H;  1SIJ A;  2BF8 B;  2AYO B;  2DWQ A;  2KDE B;  2BS3 B;  4G11 A;  4TQ0 A;  2N9K A;  4MT5 A;  1KTK A;  2X8X X;  3ZXV A;  3M3J A;  2CR5 A;  4MSQ B;  2E3U A;  2JZZ A;  4DQO C;  1JRO A;  3KH0 A;  4OD6 A;  4OW0 A;  3N3K B;  3SFD B;  3PZ8 A;  3B0A A;  3L54 A;  1S03 G;  2EEL A;  4EFO A;  1K1G A;  2IO0 B;  3N30 A;  1NEK B;  1F1H A;  2FCM A;  2GI9 A;  2MQJ A;  3ZGZ A;  5C0X G;  4EE2 A;  4GOC A;  4GN1 A;  3PGE A;  3NUH B;  2OJR A;  4YY3 H;  2ZM6 H;  2M17 A;  1LFD A;  5D7G A;  2N0S B;  2HD5 B;  1FFV A;  2NR2 A;  3O65 B;  4LNK A;  3KUZ A;  4NNJ B;  3DHI C;  4MJS B;  2MSE D;  4US9 A;  3RT3 B;  2PVG C;  3Q69 A;  1RFA A;  4NQK E;  5DCN A;  2UUB H;  2JXT A;  4LNN A;  2KAN A;  5C3J B;  3Q3N C;  1TYG B;  4DR1 H;  2KN4 A;  2UUA H;  1ZKH A;  3ML9 A;  1J8C A;  2LVP A;  4MGI E;  4DV4 H;  1CK1 A;  4OVZ A;  2DX5 B;  1WJU A;  1N60 A;  3N1Z C;  3KDK A;  3RMK C;  4RMA A;  3OJ4 B;  2QC8 A;  1V6E A;  4DXA B;  2K1H A;  2PPH A;  2LXC A;  3R2T A;  3L0W B;  1TBE A;  2LWP A;  2WYQ A;  1IBL H;  4TUU A;  3QD7 X;  4HEA 1;  4JYA H;  3NOB A;  3ALB A;  5CHV C;  5CHW A;  3IVF A;  1R4N B;  3VVW B;  2KWU B;  3P42 A;  1VDV A;  3AEE B;  4NAW B;  4WJN A;  4TSS A;  1VLB A;  1MSZ A;  4W9G A;  4IWQ A;  1ZZK A;  1I94 H;  4JVY A;  2WDR B;  3AEG B;  4LFB H;  2NMQ A;  2N4F A;  3MHS D;  2WXH A;  2J53 A;  4NAW A;  3J7A K;  3ECI A;  3PRM B;  5T8I A;  3TEZ A;  2LVQ A;  1V49 A;  2A5U A;  3DQV A;  3ZTD A;  2LGD A;  4B3M H;  4LNI A;  2K6D B;  2CPM A;  2K22 A;  1MPE A;  1J7B A;  1NYQ A;  4WAN A;  2N7J A;  1P7E A;  2DAF A;  1T0Y A;  4DDG D;  1T0R C;  5AZG A;  1FNV A;  4PYZ A;  1L6V A;  1WFY A;  1LQB A;  3OJ3 A;  3W9C B;  2KTR A;  3W1S A;  1SE3 A;  4DV7 H;  4CHK A;  3DVG X;  4HCN B;  2KN5 A;  5H92 C;  3WIM A;  4ZYS A;  4JX1 C;  3LYY A;  2DYO A;  1DOY A;  1HXY D;  1BUI C;  4LIJ A;  1WX9 A;  4RFB A;  2X38 A;  3KUC B;  3MTN B;  3U8Z A;  3QWZ B;  2K0P A;  1KLV A;  2CHX A;  1XNR H;  1WJ6 A;  5EE3 A;  2N9L A;  1TZ1 A;  1WGK A;  1N61 A;  3PHW B;  2IY0 B;  1VJK A;  3FIL A;  3V6C B;  2VH1 A;  2JRI B;  1SEB D;  1ESF A;  3P4S B;  2UXD H;  4ZRP A;  1XLP A;  4FBJ B;  1F52 A;  2PVO D;  1OEY J;  3GE8 C;  1DGJ A;  2MEK A;  3Q3F A;  3IG3 A;  4REZ A;  2CTM A;  2W82 A;  2KKC A;  4HDQ A;  4KV2 A;  1S3S G;  1V5O A;  1DYQ A;  4DWF A;  4C7Z A;  4W9C A;  2I1K A;  3PRZ A;  2LRW A;  4HLE A;  4XE0 A;  2LTL A;  1WYG A;  5K36 G;  4RGM A;  4RGT A;  4OCH A;  4DUZ H;  1WJN A;  4EZL A;  2LD9 A;  2WX1 A;  1SJH D;  2KAJ A;  3AV8 A;  3RNB C;  2GBM A;  4WUR A;  3DPD A;  3A1Q B;  3AMZ A;  4KSL C;  1L5P A;  3AN1 A;  5IKC M;  2IY1 B;  4F8C B;  1E10 A;  2Y5P A;  3HUI A;  1FCC C;  5D3I B;  4LDT D;  3NRZ A;  1N32 H;  5CHF A;  3ZLZ A;  1WE8 A;  3QJZ A;  3JSV B;  4H2A A;  1HTQ A;  2MX2 A;  2OPU A;  5LNK 1;  2PTL A;  4MH0 E;  3SEB A;  3L08 A;  1FM0 D;  5IN7 A;  4ANU A;  3GR5 A;  1V8C A;  3I0P A;  4DR5 H;  3RFZ B;  1KRH A;  1P98 A;  3N1X C;  1N63 A;  1FXA A;  2BYF A;  2W9N A;  3GKU A;  3KYD D;  1BT0 A;  2KYW A;  2NBW B;  2ZPN A;  1P9D U;  2BTE A;  1V80 A;  4M01 A;  2CTE A;  2M0X A;  1SBB B;  3DOW A;  1HNZ H;  3P4P B;  3ZTC A;  3Q3M C;  4DR6 H;  1ZXH A;  3DWG C;  1SJE D;  3BVM A;  1I42 A;  1EUV B;  2WXG A;  3AE7 B;  3Q8C A;  3RNF C;  4ITK A;  1C9F A;  5EE9 A;  1VIG A;  3PRP B;  1YNT E;  2D10 A;  1KFY B;  5J17 A;  1YOV B;  1V97 A;  5BMH A;  4F7Z A;  2MLB A;  2M19 A;  1N62 A;  3RF2 A;  2G8Y A;  2JVZ A;  3EA6 A;  3SR6 A;  1TY2 A;  1WXS A;  2IO2 B;  3ZNZ B;  4B9K A;  3W2D A;  5BMI A;  4GKK H;  2W55 A;  4XC2 A;  4FHK A;  3OET A;  2Y5C A;  3NS1 A;  4WQO B;  2BS2 B;  1R7S A;  2WDV B;  1E8X A;  2K1F A;  4WAF A;  1HQR D;  5LMN H;  2FIF A;  4JQW C;  3PLV A;  2V4I B;  4LF6 H;  4MM3 A;  3ZNI D;  1M4V A;  2UWQ A;  5CX3 A;  1AN8 A;  1KLU D;  5LMU H;  3GZN I;  1NDD A;  2MBH A;  2AXY A;  5JHB A;  2LJI A;  2DZM A;  1A70 A;  1UZX B;  2TSS A;  2WDT B;  4WWP A;  2GBK A;  1C4P A;  1MVK A;  3IAS 1;  4AM3 A;  1UBI A;  2WXJ A;  5J18 A;  4OZC A;  2V4L A;  2HHH H;  1QF6 A;  1WVN A;  1ZGU B;  1VZ7 A;  2BPS A;  2D3A A;  2I38 A;  3QK0 A;  5LXI B;  2KC2 A;  1QOA A;  1NI2 A;  1XLN A;  3ZNG C;  4JI5 H;  2WS3 B;  1TKG A;  4B3R H;  2ZQE A;  2MJH A;  4OO1 G;  5AZF A;  4B8C D;  1ROE A;  4P6V F;  4HKZ E;  2CKH B;  3DBL I;  3RUI B;  1WXQ A;  4JI8 H;  3A9J B;  1WRI A;  1NVI D;  3VH4 B;  1F0Z A;  1V1O A;  2L32 A;  4FJU A;  2CJO A;  1HNW H;  2LGY A;  1BXT A;  2GBJ A;  4W9I A;  3SB1 A;  3HM3 A;  1UWX A;  1B9R A;  2IGD A;  2INC C;  4EUT A;  4DV1 H;  1XCQ L;  2JZP A;  2KWC A;  1WGR A;  1Z2M A;  4BOZ B;  2KDM A;  3IBE A;  2L3Z A;  2XNA C;  4B6W A;  1QOB A;  1JW9 D;  3H6N A;  1XCT L;  5L83 A;  2PLP A;  2MCN B;  2G1E A;  1FXT B;  3PSE B;  2DYM A;  4L2Y A;  5IAA C;  3A9K A;  3NZS A;  4A9A A;  2WXQ A;  2RDG A;  1L0V B;  2K39 A;  2HH3 A;  2KX0 A;  5EDS A;  4HCP B;  1YN5 A;  2N1V A;  1IPG A;  5LLI A;  4G0N B;  1PYW D;  2E6X A;  1D6E C;  4HXD A;  4IWO A;  5BYR A;  1Z5S B;  1SXT A;  3ZDT A;  3QAR A;  2ZPY A;  3DBR B;  1AAR A;  1VIH A;  2SAK A;  4CQN A;  2KX3 A;  3U1K A;  2VZK B;  4DV2 H;  1FPY A;  1VCB A;  1JWU D;  4P1B C;  2BA0 A;  1SGH A;  4YHH H;  1FNW A;  2YVC A;  5HI1 A;  2KD0 A;  4JL9 A;  2KVZ A;  3FAH A;  4CO7 A;  3H7P A;  2RDH A;  3I5J C;  4M8N A;  3KDG A;  2K9X A;  4MGZ E;  2LGX A;  5BYQ A;  5A2Q W;  1V81 A;  3PT2 B;  2IGH A;  3AE2 B;  2RPV A;  2BT6 A;  5HG2 A;  4ZHP A;  5HFY A;  1FRR A;  1KH0 A;  2DBY A;  1OQQ A;  3AE4 B;  4RNA A;  1X4N A;  4FJS A;  4AJW A;  1E0Z A;  4X62 H;  4LTU A;  1ZW7 A;  1WE6 A;  1Q5W B;  2G45 B;  1C76 A;  1E7U A;  2YQR A;  1IBM H;  3DCG A;  2WX0 A;  1UGJ A;  1HEZ E;  4GDK A;  4GIV A;  2KDB A;  3Q3J A;  4WJQ A;  4IFD G;  4OZA A;  1FO4 A;  3RD2 A;  2BYE A;  3V60 A;  3GP7 A;  3MHZ A;  1L2N A;  3IT4 B;  3UOE A;  4BA2 I;  1JWB D;  1TZO A;  2Z0S A;  3Q14 C;  2WNM A;  4BOS C;  4ZOH C;  2VQF H;  2J4X A;  2QDF A;  4K7U A;  4N6E B;  2D11 A;  2MP2 A;  4B8T A;  2W3R A;  2CTL A;  3RPF C;  2EKE C;  1JML A;  1YQB A;  3VXW A;  1H8C A;  2C7N B;  3AE3 B;  4M00 A;  1T0S C;  2BQQ A;  2UXC H;  4EZK A;  3L7Z C;  1N5X A;  4A8X C;  1ZP0 B;  4AQY H;  1K50 A;  4M8M A;  4OHJ A;  3W1Y A;  1YJI A;  2JRH A;  3EZJ A;  3V69 A;  2O6V D;  3R8B A;  1I35 A;  3Q2A C;  4IKG A;  4HPM B;  1YX5 B;  2IO3 B;  3J81 W;  1J7C A;  3CST A;  1WR1 A;  3DBL B;  1NBF C;  4HK2 A;  2KHW B;  3PVL A;  3T1H H;  4DV3 H;  3VR9 B;  2K8C A;  3EC8 A;  2KVR A;  4C4V A;  3BZD B;  2PT7 G;  1J19 A;  2DZK A;  3KQ4 A;  2ASQ A;  3E9S A;  2KJH B;  2KFJ A;  4K81 A;  4M0W A;  1P0R A;  3HHM A;  3NJT A;  1DOX A;  2CS4 A;  4DXF A;  2FNJ B;  1C78 A;  2UUC H;  1SEI A;  2VQE H;  2YLM A;  1XLQ A;  2KZR A;  1SE4 A;  4GB9 A;  1WTJ A;  5DT9 A;  3APC A;  1UEL A;  3RYT A;  3PPA A;  1S20 A;  2K3U A;  4C80 A;  1L7Y A;  3AEF B;  4NJ7 A;  5H8Y E;  1HR0 H;  2MW5 A;  1PGX A;  1JAL A;  3UI3 A;  4IDI A;  4X66 H;  1ET9 A;  1OGW A;  2BWE S;  4GGQ A;  1WHR A;  1CJE A;  1RYJ A;  2H88 B;  2E3T A;  4JI0 H;  4WJP A;  1I4P A;  4ZRK A;  1WWT A;  3TIX A;  4EZJ A;  2R61 A;  4JWU C;  2KTF A;  2ANR A;  1YN3 A;  1UUP A;  3N9Y C;  4GMV A;  4NJC A;  4JE3 B;  4ZRI A;  2UYZ B;  2JE6 I;  1R4N I;  3DBH I;  2EKI A;  4BKS A;  3BY4 B;  3KYC D;  2FFM A;  1FFU A;  1T5X D;  2V3P A;  2L52 A;  3PRE A;  2QMT A;  4F1S A;  1XQQ A;  3QX1 A;  3H9D A;  3I57 A;  2CTF A;  2WXN A;  5HHD G;  1DTJ A;  2FBW B;  2ZVO A;  1V9J A;  4KKJ A;  1SE9 A;  2PE9 A;  1FMA D;  1VBI A;  3PTF C;  3NVW A;  4NPN A;  4AWJ A;  3T3O A;  4NXM H;  3ZXR A;  4W9J A;  1K52 A;  2WXR A;  4MGK E;  5DPT A;  3VAW A;  2FCS A;  3V6E B;  1Q1O A;  1XO3 A;  3AE5 B;  2NCN A;  4IM3 A;  1D5M C;  4YTN B;  5KHO A;  5HKH A;  3M63 B;  4G50 A;  2KWD A;  1Y8R C;  2GOW A;  2D07 B;  3SU8 X;  4LCD E;  4MEL A;  2NBV B;  3KLS X;  2X06 A;  1RWS A;  1R4M I;  3A33 B;  1JRP A;  3EGR A;  2J0K A;  3R3M A;  1GPX A;  3TBL D;  4GSW A;  4L1B A;  2ICI A;  2LHE A;  5KHQ A;  3B9J A;  4ZHO A;  4KZ0 A;  4JLC A;  1TS5 A;  4YSZ B;  3NY5 A;  2LEK A;  4G3X B;  3MP9 A;  2WQY B;  4X57 B;  3UIN B;  2E5L H;  1MG8 A;  2DAJ A;  1GAQ B;  4KGT A;  2K8B A;  2Z59 B;  2AL6 A;  2MBB B;  5LL6 b;  3X0W A;  1EWY C;  1LO5 D;  2HE7 A;  2JWZ A;  2QCZ A;  2DEN B;  4II3 B;  5GXG B;  3T8M A;  5TR5 A;  5AUI A;  4YSX B;  1YQ3 B;  2JF5 A;  1K8R B;  2EMS A;  4QAY A;  4HJG E;  1GC6 A;  3KWV A;  4A6Q A;  4FUL A;  4YTP B;  2JEB I;  2ACZ B;  4KZC A;  1BML C;  2QHO A;  3AEV B;  5FK9 C;  1F2R I;  4K3C A;  3MJ5 A;  1IGD A;  4XGA B;  3P2B A;  4GDL A;  4DXG A;  2MP2 B;  2HJ1 A;  2BBC A;  1VD2 A;  2BVC A;  4USA A;  3NCV A;  3UIO B;  2KTR B;  1E6E B;  3ENE A;  4J6I A;  5BMG A;  5IWA H;  1IUE A;  2KAC A;  4P7I A;  4A3P A;  3QAQ A;  2IYD B;  3W5V B;  3TEW A;  2M6Q A;  1ZXI A;  2KQ7 A;  2D9I A;  3PHX B;  3M95 A;  3HRD D;  1J4W A;  1WH3 A;  1L4D B;  2WHI A;  2MWS B;  1Z2I A;  5IA7 A;  4ZRJ A;  5E6J A;  5AUK A;  3I9V 1;  2Y5B B;  3AXC A;  2KLC A;  4HRS A;  3MC9 A;  2KWV B;  1QIL A;  5D2M B;  3ZJT A;  2IJ0 A;  2M8S A;  2RD0 A;  4KIK A;  3FC4 A;  1M94 A;  3MJW A;  1TKY A;  2LHD A;  3SFE B;  2A1S A;  4A3O A;  1WYW B;  3BII D;  4ASW C;  2INN E;  1HA5 A;  2FID A;  5AZH A;  4GLS C;  1P7F A;  1WGD A;  2L0F A;  3B2F A;  2JWU A;  1C77 A;  1WXM A;  3D32 A;  2BB5 A;  1IYF A;  4AQ7 A;  1T6B X;  1V86 A;  1IBX B;  2N1W A;  4J3O D;  2ZJD A;  2LFI A;  2FUG 1;  1VZ8 A;  3BYY B;  3PO0 A;  4ARC A;  4JVH A;  1CMX B;  4NQL B;  4RF0 A;  1STE A;  1KLG D;  1WGY A;  3P4R B;  1J5E H;  1TS2 A;  3B2G A;  1PDX A;  3HIZ A;  5C1Z A;  2K6Q A;  4B95 A;  4BAX A;  5JHA A;  3HK0 A;  4GKJ H;  1D5X C;  1X0A A;  1QT9 A;  4FHJ A;  4K3B A;  1OTR B;  2J7Q B;  4KVG B;  2M56 B;  1X4M A;  2PE6 B;  3TJP A;  4WH4 A;  1YIW A;  3WCQ A;  1NEN B;  2NBU A;  2CHZ A;  1WGG A;  2KFK B;  1EF1 A;  2BYV E;  3QCA A;  3SD5 A;  1CQV A;  1QKZ A;  1LM8 B;  4S17 A;  5D6J B;  4KKI A;  4XWW A;  4LF8 H;  2KT7 A;  2ZEQ A;  2LVO A;  3E56 A;  2D2Q A;  2IND C;  5AEK B;  2O2V A;  2REX A;  1OQY A;  4LFA H;  2MBQ A;  1AW7 A;  1QOF A;  4A55 A;  1D4B A;  1OEY A;  2XK5 A;  1RRB A;  3WAN A;  4N9F 4;  5JH5 C;  3BK1 A;  1AN7 A;  3T3N A;  2BKF A;  1X1M A;  2KQS A;  1QOG A;  3QQ8 B;  3L17 A;  1FCL A;  2JU6 X;  1FJG H;  1XT9 B;  1F2R C;  3U2S C;  5D3D A;  3ZQ4 A;  4IM0 A;  2M0A A;  3EFU A;  1UNS A;  4LFC H;  4HPP A;  3P1M A;  2JX5 A;  2PKO A;  1F9J A;  1F0X A;  1TIF A;  4XDD A;  4FN2 A;  4MH8 A;  1U4A A;  2PY9 A;  4E71 A;  4I6L B;  2CWF A;  2J52 A;  3OLM D;  4AJY B;  2HJ8 A;  1J7A A;  3N20 C;  3UIP B;  3SDL C;  3IT6 B;  2Z0D B;  2L1A A;  1TS4 A;  2GMI C;  1FRD A;  3GZN B;  4QMF B;  4XWT A;  3GB1 A;  1PGB A;  3EHV A;  1E7P B;  1UF0 A;  4JI6 H;  2WP9 B;  4PYU A;  4C00 A;  2NN6 G;  4BKT A;  2N9X A;  2JT4 B;  2K8H A;  2G3Q B;  1T3Q A;  4W9H A;  3V62 A;  2VH2 A;  2IPK D;  4AUQ C;  4LLG M;  4YWG G;  3L13 A;  3U7Z A;  2CU1 A;  2MHJ A;  2K5P A;  1XMQ H;  4I6N B;  2BGF A;  4TMA B;  2JYE A;  2KO3 A;  3MC8 A;  3JW0 X;  3AUL A;  1FKA H;  3I3T B;  5C23 A;  4LF4 H;  3TCA A;  3DVN V;  1WXV A;  4N59 A;  3AI5 A;  1WXA A;  2JVC A;  4PK1 A;  3ZRF A; 
#chains in the Genus database with same CATH homology
 3W9C B;  3W1S A;  4IKG A;  1SE3 A;  2WXP A;  1N5W A;  4B0E A;  2ON8 A;  1JCK B;  2WXO A;  5H92 C;  4ZYS A;  1YMH E;  1J7C A;  4JX1 C;  3LYY A;  3L4P A;  2DYO A;  3C8Y A;  1DOY A;  1HXY D;  1BUI C;  2AQ1 B;  2MJD A;  3AH7 A;  4RFB A;  2X38 A;  3VR9 B;  3TUO A;  3W5U B;  1PGA A;  2V0G A;  1MHH E;  1K51 A;  2K0P A;  3BZD B;  1FEH A;  2BW2 A;  3KQ4 A;  4US8 A;  3E9S A;  1GB1 A;  1I4X A;  3HVZ A;  3P63 A;  5EE3 A;  5G5G A;  2N9L A;  1EU4 A;  4M0W A;  3V3X A;  1C4C A;  3BK2 A;  4NAM A;  1WGK A;  1L0Y B;  1N61 A;  1DOX A;  1VJK A;  2BB6 A;  3KWL A;  3Q8E A;  3FIL A;  4DXF A;  4FXC A;  1C78 A;  1SEB D;  1ESF A;  3OWE B;  1B1Z A;  3P4S B;  4ZRQ A;  4ZRP A;  1XLQ A;  1XLP A;  1SE4 A;  2PVO D;  5BYS A;  3HVD A;  1JWM D;  1DGJ A;  2MEK A;  4REZ A;  2ZW1 A;  2W82 A;  3FIL B;  3GS2 A;  4R3D A;  2FE8 A;  3Q8B A;  2K3U A;  1DYQ A;  4C80 A;  3AEF B;  4C7Z A;  5H8Y E;  1QLB B;  2V3N A;  2PMV A;  2MJ3 A;  1PGX A;  2BYT A;  1JAL A;  4RCO A;  2WXL A;  3ETR A;  4XE0 A;  3UI3 A;  4IDI A;  1WYG A;  3CWI A;  4RGM A;  2IDY A;  4IOI E;  1ET9 A;  4RGT A;  1ZDX A;  3ZJU A;  1CJE A;  1RYJ A;  4RGN A;  1SJH D;  2H88 B;  4KX6 B;  2KAJ A;  1AYF A;  1D5Z C;  3AV8 A;  2E3T A;  4WUR A;  1VRA B;  1I4P A;  2WLB A;  1JWS D;  1EU3 A;  3AMZ A;  1XF5 L;  2JYT A;  1WWT A;  1L5P A;  2W54 A;  3AN1 A;  2WXI A;  1E10 A;  2IGG A;  2Y5P A;  3HUI A;  2NTS A;  1FCC C;  2QSD A;  5D3I B;  2R61 A;  4JWU C;  3NVY A;  1QQR A;  1C79 A;  3CIR B;  3NRZ A;  1F77 A;  1UUP A;  1YN3 A;  3N9Y C;  4NJC A;  3U4E G;  3AED B;  4JE3 B;  1GOZ A;  1NI3 A;  3R2I A;  2QJL A;  2EKI A;  4H2A A;  1UWM A;  4HKQ A;  1FFU A;  1T5X D;  2V3P A;  2L52 A;  4Q2J A;  2QMT A;  1VZ6 A;  5LNK 1;  1JWA D;  1ACC A;  2PTL A;  3SEB A;  2J42 A;  1FM0 D;  1V8C A;  3RFZ B;  3I57 A;  1L0X B;  1KRH A;  2WXN A;  5FKA C;  5HHD G;  2YEP B;  2FBW B;  1L6U A;  1N63 A;  1FXA A;  4KKJ A;  1FMA D;  1WSP A;  2WDQ B;  3NVW A;  1YN4 A;  4AS1 A;  3T3O A;  3TSS A;  4A90 A;  2BTE A;  1K52 A;  2WXR A;  1I4H A;  2LMC A;  1SBB B;  1XO3 A;  2G9H D;  3AE5 B;  2B76 B;  3P4P B;  3AE9 B;  3PZ7 A;  2SEB D;  1ZXH A;  1D5M C;  4YTN B;  3DWG C;  1SJE D;  2KWD A;  2WXK A;  3BVM A;  1GB4 A;  1XEE A;  4GDL B;  2WXG A;  3AE7 B;  3Q8C A;  4ITK A;  3KLS X;  1C9F A;  4P16 A;  2MH7 A;  3LB8 C;  5EE9 A;  1RWS A;  3VR8 B;  1DOI A;  1JRP A;  2GRI A;  1YNT E;  3MFG A;  3EGR A;  1KFY B;  3U52 E;  3AE1 B;  1GPX A;  1AWD A;  1V97 A;  5BMH A;  2M19 A;  5G5H A;  1I4R A;  1N62 A;  2INP E;  4L1B A;  2BS4 B;  3EA6 A;  2ICI A;  3SR6 A;  5C2T B;  4D2K A;  1TY2 A;  2LHE A;  3B9J A;  2XN9 C;  4ZHO A;  4ARI A;  1RFK A;  2CU3 A;  1EWC A;  1TS5 A;  4YSZ B;  5BMI A;  3W2D A;  2W55 A;  5I4D A;  2LEK A;  3MP9 A;  4RH6 A;  2WQY B;  4O1N A;  3URY A;  2Y5C A;  3NS1 A;  5MPO A;  1FNU A;  1OQR A;  3IXS A;  1GAQ B;  4KGT A;  2KQ4 X;  2BS2 B;  1ET6 A;  1R7S A;  2WDV B;  1TKE A;  3NVV A;  1EWY C;  1LO5 D;  4WAF A;  1HQR D;  1ZE3 D;  5GXG B;  5AUI A;  3ZYY X;  1SE2 A;  2V4I B;  4MM3 B;  3AB5 A;  4RGO S;  1ENF A;  1YQ3 B;  1YQ4 B;  4YSX B;  1E9M A;  2AQ3 B;  3Q8A A;  3ABV B;  1M4V A;  3J9C A;  1PUT A;  4HJG E;  4JWS C;  3KWV A;  4MAC A;  4A6Q A;  4YTM B;  3P4Q B;  4YTP B;  2ACZ B;  2ONQ A;  1AN8 A;  1KLU D;  1XXG A;  1K53 A;  1BML C;  4JPS A;  3BWU D;  3VRA B;  2PIA A;  5FK9 C;  1F2R I;  3MJ5 A;  4N58 A;  1IGD A;  3AEC B;  2LJI A;  4C56 C;  2Q5W D;  1KF6 B;  2Z8L A;  1A70 A;  3BVG A;  3BVZ A;  2TSS A;  1VR9 A;  4DXG A;  1C4P A;  1MVK A;  1SF0 A;  1ZPS A;  2PW9 A;  2AX5 A;  3IAS 1;  2BBC A;  4GDK B;  2WXJ A;  4USA A;  2Y3A A;  4OZC A;  1E6E B;  1QF6 A;  1VZ7 A;  2W3S A;  3AEB B;  2WU5 B;  1HZ6 A;  2I38 A;  5BMG A;  1IUE A;  2KAC A;  1V1P A;  1QOA A;  2OED A;  2CJN A;  1XLN A;  2ZW0 A;  2WS3 B;  3W5V B;  3TEW A;  1ZXI A;  1CZP A;  1TKG A;  4UDU C;  2HTM E;  1TS3 A;  2OHF A;  1IGC A;  2NTT A;  4KGS A;  3HRD D;  4YXD B;  1L4D B;  2DLB A;  1V1P B;  1ROE A;  5EE1 A;  1ZDV A;  4P6V F;  4HKZ E;  5JXV A;  5E6J A;  2QIL A;  3I9V 1;  5AUK A;  3AE6 B;  1L4Z B;  1WXQ A;  4HRS A;  3LXF A;  1QIL A;  1WRI A;  1NVI D;  2LUM A;  1MHX A;  4L23 A;  1F0Z A;  1V1O A;  2L32 A;  2CJO A;  3H8H A;  3ZJT A;  2IJ0 A;  5FR3 A;  1BXT A;  3FC4 A;  3V05 A;  2I2Y A;  3EUB 2;  1TKY A;  1UWX A;  1ZUD 2;  2LHD A;  3SFE B;  1B9R A;  2IGD A;  2GB1 A;  2QIE B;  1EM7 A;  3IAM 1;  1XCQ L;  1Y56 A;  2JZP A;  3BII D;  4WQM A;  2KDM A;  2INN E;  2XNA C;  1HA5 A;  1QOB A;  1JW9 D;  1TY0 A;  2RMM A;  3ZJV A;  3TEY A;  1C4A A;  1XCT L;  1SIJ A;  2PLP A;  2G1E A;  2DYM A;  4GLS C;  1P7F A;  4L2Y A;  4NZL B;  2DWQ A;  3B2F A;  2JWU A;  3DWM A;  2BS3 B;  4A9A A;  1C77 A;  4TQ0 A;  2BB5 A;  3NVZ A;  4AQ7 A;  2N9K A;  2WXQ A;  1T6B X;  2RDG A;  4MT5 A;  1KTK A;  1IBX B;  1L0V B;  1IBX A;  4J3O D;  2LFI A;  2FUG 1;  1VZ8 A;  4TQ1 A;  4DQO C;  1JRO A;  3BYY B;  1JQ4 A;  1I4G A;  3VRB B;  1YN5 A;  3PO0 A;  4OW0 A;  4YT0 B;  4ARC A;  4RF0 A;  1STE A;  1KLG D;  3SFD B;  3PZ8 A;  5EE0 A;  2WXM A;  3P4R B;  1PYW D;  2E6X A;  1D6E C;  1TS2 A;  3B2G A;  1PDX A;  2EEL A;  5BYR A;  1NEK B;  3ZGZ A;  1SXT A;  2GI9 A;  2D5G A;  3TEX A;  4EE2 A;  1D5X C;  3MC0 B;  1QT9 A;  2YEP F;  3NUH B;  1XLO A;  2M56 B;  2SAK A;  4WH4 A;  4HRO A;  3WCQ A;  1NEN B;  3O13 A;  4CQN A;  5D7G A;  2N0S B;  2VZK B;  3NZ3 A;  1FFV A;  2LGI A;  2WXF A;  1CQV A;  1JWU D;  1QKZ A;  1FNW A;  1ZOY B;  4KKI A;  5HI1 A;  4XWW A;  4US9 A;  2QEJ C;  4B0M A;  3E56 A;  2PVG C;  3Q69 A;  3FAH A;  3AEA B;  2RDH A;  1AW7 A;  1FIQ A;  1QOF A;  4A55 A;  2JXT A;  1D4B A;  4XDC A;  2VZK D;  2K9X A;  5C3J B;  1TYG B;  5BYQ A;  2KN4 A;  3BK1 A;  3T3N A;  2RPV A;  2IGH A;  3AE2 B;  1QOG A;  4PT5 A;  1FCL A;  2BT6 A;  5HG2 A;  2JU6 X;  4ZHP A;  1CK1 A;  5HFY A;  4OVZ A;  4C7Y A;  1F2R C;  1N60 A;  3U2S C;  1FRR A;  5D3D A;  2KMM A;  1KH0 A;  3ZQ4 A;  2DBY A;  1Q10 A;  1OQQ A;  3AE4 B;  4RNA A;  2M0A A;  4LK0 M;  1E0Z A;  1UNS A;  4LTU A;  3R2T A;  3P1M A;  2AQ2 B;  2JX5 A;  1C76 A;  2PKO A;  4HEA 1;  1TJE A;  1UGJ A;  4XDD A;  4MH8 A;  1OFF A;  1YJJ A;  1HEZ E;  4YSY B;  2L83 A;  2J52 A;  1J7A A;  3IT6 B;  3P42 A;  4KGR A;  2L1A A;  1TS4 A;  1VDV A;  1FRD A;  3AEE B;  4NAW B;  4OZA A;  1MI0 A;  2MJE A;  4XWT A;  1FO4 A;  4TSS A;  4OZB A;  2HDE A;  3GB1 A;  1VLB A;  1PGB A;  1PFD A;  1SB3 C;  3GP7 A;  2WU2 B;  3MHZ A;  3IT4 B;  1E7P B;  2JQR B;  2WDR B;  1JWB D;  3AEG B;  1TZO A;  1I4Q A;  4WWM A;  2NMQ A;  2WNM A;  2WP9 B;  2WXH A;  2J53 A;  4ZOH C;  1HZ5 A;  4RF1 A;  1FXI A;  3AE8 B;  2J4X A;  5T8I A;  4N6E B;  1T3Q A;  3TEZ A;  2W3R A;  1SSN A;  1NYR A;  3VQI A;  3RPF C;  2JSV X;  1JML A;  5TSS A;  1FD6 A;  2IPK D;  3AE3 B;  4LLG M;  1I7H A;  4YWG G;  3U7Z A;  2H89 B;  2K5P A;  3AM9 A;  4TMA B;  2JYE A;  2K22 A;  1RM6 C;  1N5X A;  1MPE A;  1J7B A;  1NYQ A;  2N7J A;  1P7E A;  3BYT B;  4A8X C;  1ZP0 B;  4WIP A;  1K50 A;  4OHJ A;  3Q8F A;  1YJI A;  4N59 A;  1FNV A;  1L6V A;  3R8B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...