1V8CA

Crystal structure of moad related protein from thermus thermophilus hb8
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
165
structure length
165
Chain Sequence
PKVNLYATFRDLTGKSQLELPGATVGEVLENLVRAYPALKEELFEGEGLAERVSVFLEGRDVRYLQGLSTPLSPGATLDLFPPVAGGGFERTFGAFPPWLLERYLEEWGGTREGEGVYRLPGAVVRFREVEPLKVGSLSIPQLRVEVEGEEAERWFERIAFAASR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of MoaD related protein from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Protein binding
molecule keywords MoaD related protein
total genus 47
structure length 165
sequence length 165
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02597 ThiS ThiS family
A PF09189 DUF1952 Domain of unknown function (DUF1952)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1v8cA01
3.30.1370.80 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Molybdopterin cofactor biosynthesis MoaD-related, C-terminal domain 1v8cA02
2QIEB 1YQ3B 1V8CA 2JX5A 2WDVB 3B2GA 5EE1A 4YSZB 2E3TA 5MPOA 1FMAD 2BT6A 1J7AA 2Q5WD 3AE5B 5EE0A 1DOXA 2CJOA 3AEDB 2WQYB 3B2FA 1ZUD2 2MJDA 3VR8B 4A9AA 1NENB 1E9MA 1ROEA 1XLQA 2G1EA 1KRHA 1NYQA 2BS2B 1YJJA 2W55A 3DWGC 3VR9B 1JWAD 2AX5A 4YSXB 4C7ZA 3AE1B 1FM0D 3W9CB 1JROA 4US9A 3DWMA 1YJIA 4YSYB 3SR6A 2BS4B 4N6EB 5H92C 1E0ZA 4YXDB 3AEAB 1J7CA 1XLOA 2PKOA 1OFFA 3KWLA 5EE3A 1WRIA 1N61A 1KF6B 1N5WA 2MJ3A 2KMMA 2W3SA 3SFDB 3AE6B 3AE4B 4FXCA 1NI3A 2OHFA 1SIJA 5C3JB 1JQ4A 3CIRB 1QT9A 2WP9B 4C7YA 1OQRA 3NVVA 5C2TB 3LXFA 2PVOD 3HRDD 3AV8A 1CJEA 1ZP0B 1NYRA 3NRZA 3HUIA 4ITKA 3P4RB 4US8A 2CU3A 5EE9A 2H89B 4LTUA 1E6EB 2EKIA 3NVYA 3ABVB 3BIID 5AUKA 1FFVA 1RFKA 2MH7A 4IDIA 3ZYYX 2L83A 1QOFA 1OQQA 1QLBB 3P63A 1SF0A 2JQRB 2ACZB 2QJLA 3P4PB 2DWQA 1A70A 3WCQA 4YTMB 4ZHPA 1FRRA 4KX6B 4C80A 1XLNA 1L6VA 2N0SB 5G5GA 3ETRA 1L5PA 2DBYA 1JWBD 3W5UB 3HVZA 1CZPA 2PVGC 1FRDA 1QOBA 1VLBA 2K22A 2FBWB 2WDQB 4JWUC 2CJNA 5GXGB 4HROA 4N58A 1ZXIA 3AH7A 3PO0A 1DGJA 3AE2B 3VRAB 3AEFB 1KFYB 3AN1A 4ZHOA 2M19A 3NVZA 1WGKA 4WWMA 3AE7B 1EWYC 1PUTA 1QF6A 1N60A 1QOGA 1PDXA 1QOAA 2Y5CA 4WQMA 1YQ4B 3P1MA 1FXAA 5G5HA 1FXIA 2WLBA 2LEKA 1T3QA 2K5PA 4P6VF 2M56B 4ZOHC 1DOYA 4JWSC 3FC4A 4N59A 1E10A 3W5VB 1B9RA 1R7SA 3FAHA 1FFUA 1TKYA 1VDVA 1SB3C 3AEEB 3AEBB 1N5XA 2B76B 3B9JA 1AYFA 2W3RA 2WS3B 3SFEB 1TYGB 1WWTA 2MJEA 3AE9B 3AE8B 3AEGB 1F0ZA 2WDRB 2L52A 1XO3A 3EUB2 1AWDA 3AECB 5H8YE 1FIQA 1RYJA 1ZOYB 3NVWA 1JRPA 1RWSA 1GAQB 1I7HA 1VJKA 1XLPA 2WU5B 3P4QB 1NVID 3RPFC 2BS3B 1TKEA 1UWMA 2KAJA 1N63A 3CWIA 3AMZA 3P4SB 2WU2B 4YTNB 2HTME 1L0VB 4HRSA 1TJEA 3VRBB 1WYGA 1J7BA 1GPXA 1DOIA 1JW9D 1RM6C 1L6UA 1NEKB 2H88B 2K9XA 3AE3B 3AM9A 3NS1A 3AB5A 1IUEA 3LB8C 1PFDA 4JX1C 1WXQA 2W54A 2PIAA 1E7PB 4USAA 5AUIA 3L4PA 1TKGA 4YT0B 1N62A 1FO4A 4YTPB 1V97A 1JALA
chains in the Genus database with same CATH superfamily
5EE1A 2MHJA 1F52A 2BT6A 5FR3A 2VQFH 1E8XA 4A3OA 2KDFB 3UI3A 3DBHB 3VR9B 2BKFA 2CTLA 2Z59B 3DWMA 3EECA 2PMVA 4G11A 5H92C 1J7CA 3PZ8A 4P7IA 5FR6A 4DHZE 4LJOB 4AIMA 4W9DA 2MX2A 4PYZA 1L2NA 2AL6A 1ZZJA 4WJPA 3B0AA 1MFWA 2BKRB 1ZP0B 2KHWB 2WXPA 1N6ZA 1N33H 2UUCH 2O2VA 2CU3A 1ZDXA 3U4EG 3VTUA 4AQ7A 5AUKA 1RLFA 3C0RB 1TZ1A 4NAWA 4LF9H 4OO1G 2ZJDA 2M4NA 4KDIC 5IO9A 2KMAA 1CZPA 3HVZA 5BO4B 4IWOA 2J0MA 3VKEA 1UD7A 2KJRA 3P42A 2KC1A 2UUBH 1ENFA 2J52A 4MH8A 4LF8H 2DZIA 4XDDA 2OJWA 2LVPA 1CMXB 3TIXA 4BOZB 3OJ4B 2GBNA 3GS2A 4DR2H 1R4MI 1X1MA 3N9YC 1FFUA 4BBNF 4L1BA 3SEBA 2CKHB 2L52A 1WX8A 4LF7H 1XO3A 4NAMA 1VJKA 3Q69A 2LGXA 3P4SB 3EC8A 1L0VB 1MVKA 4BKTA 1UELA 1JW9D 4KGSA 2FCMA 4RGOS 3J7AK 4C4VA 3W2DA 3AU4A 2GI9A 3BVGA 1NI2A 4ANWA 5E6OA 1TGZB 3TEYA 2CWFA 3MC8A 2QC8A 2FCNA 1HNWH 3VQIA 2CTMA 1SJED 4NZTM 1P0RA 3NUHB 3UIOB 1UZXB 4B3RH 1KH0A 3AEAB 4W9IA 3KWLA 4BZAA 3PV1A 3KYDD 4IC7B 3EHVA 3PLVA 2BBCA 4Q2JA 1K1GA 2ZW0A 4EEWA 2C7MB 2J42A 3I0PA 2LFIA 2Z8LA 3LXFA 3NY5A 4JIOU 1N36H 4NJ6A 1WJ6A 3OWEB 2JXXA 3QJZA 5HKHA 2KDEB 2KMCA 2KTFA 4UDUC 3ZGZA 3MC0B 3UGBB 2WYQA 1WH3A 3K9OB 1P98A 1SF0A 2JQRB 2JZ3B 3H1UA 4BKSD 3W5UB 4GLSC 1QOBA 2G9HD 2UWQA 3Q8FA 1AN8A 4RM9A 2L00B 3UF8A 4JI8H 2WXKA 1LGRA 3R7QA 1C78A 2ZZPB 4WJNA 5LXIB 4X64H 1QOAA 2LVQA 4XE0A 1WX9A 1I4HA 3PREA 2K3UA 4XC2A 4GDKB 3FC4A 5JZEB 1ZE3D 2FAZA 3VUWA 2XN9C 2EMSA 1FCCC 4L2YA 1WWTA 4ANXA 3AEGB 1V80A 2FCQA 4REZA 3GZNB 4HWIB 1JRPA 1V1PA 3IXSA 3MJ5A 3FILA 1LM8B 3DBRI 3E9SA 3B08A 2IBIB 3HHMA 1JWSD 2WXGA 2KNBA 4LDTD 2KN5A 2NPTA 4TMAB 2W54A 2PIAA 2QHOA 4ZYSA 4OX9H 1YIWA 2QIEB 3KVFB 1WX7A 1T5XD 1ZKHA 3OG5A 3KW5B 3OJ3A 1WFYA 1XLQA 3R2IA 2BS2B 5E6JA 2W55A 1J4WA 5L83A 3PHWB 1WJNA 2A5UA 2INNE 3GE3C 4FLHA 4AJYB 3TEXA 3ZLZA 2JVCA 1WGYA 2ZVOA 1SE4A 2WHIA 2SEBD 3PRPB 5DPTA 1E7UA 2D07B 1D3ZA 1YN4A 5J18A 1VRAB 4ZRIA 4B8TA 2BA0A 2RR9A 3NVVA 2PVOD 1IGDA 3RCZA 3V6CB 2Y3MA 3NRZA 1L4DB 3QHTA 3P4RB 2M0AA 3A9JA 1YX6B 3PPAA 4LTUA 4FULA 4H8AA 4LF5H 3P4PB 2QNDA 3T3OA 2N0SB 2MW5A 4NNJB 4B3SH 1K50A 2PVGC 1FRDA 2UYZB 2KD0A 3DPDA 1I4GA 3V60A 4YHHH 2MLBA 4DR1H 4W9EA 1WGKA 2FNJB 1KLGD 1N60A 1WZ3A 1PDXA 3U52E 2Y5CA 5AZHA 2LVOA 1M94A 2JA9A 2LEKA 3BZDB 4HJKA 4HK2A 2JZZA 4N59A 3NHEB 1YMHE 5LMUH 3W1SA 3PZDA 1HTOA 2JWUA 3B9JA 2K39A 1BMLC 2K8HA 2WWZA 3IVFA 2LJ5A 4M8NA 5C1ZA 2M6QA 1D4BA 2WDRB 1K8RB 4KV2A 3QX1A 1AWDA 2MBOA 3UINB 5LNK1 1LO5D 1RWSA 1XLPA 2WXOA 2LGYA 2KTRB 4XWTA 4NBQA 2DGRA 1P1AA 3AM9A 1T0YA 4B3TH 3SU8X 1T0QC 2HTHA 3L7ZC 3APDA 2RPVA 4YT0B 2NS5A 3A4RA 4RNAA 3GKUA 4LNKA 1XCTL 2CR5A 3LDZE 1WR6E 5MPOA 1E5WA 1IP9A 1YD8U 2IY1B 2MBEA 2WX0A 3RNGC 2KX3A 3V3XA 2MBQA 3Q8AA 2JYEA 2M8WA 4LNOA 1NYQA 2V3PA 1JWAD 3I57A 3VDZA 4YSXB 3E56A 1FM0D 2IO1B 4LFAH 1EM7A 2D3AA 4H2AA 5J2RA 3NOBA 3JSVB 4DV4H 2KMMA 2N9EB 4GIVA 4W9LA 3ZJTA 3Q3NC 2KLCA 5FK9C 5IA7A 3ZUNA 2YEPB 1NYRA 1EF1A 2KJHB 1T0RC 3L17A 2EKIA 2L32A 1FFVA 1YQBA 4OHJA 4HDQA 1Q5WB 2GRIA 4KKIA 3WCQA 3N3KB 1SBBB 3WAMA 1L6VA 2BB6A 2REXA 2HE7A 2WXJA 3BWUD 4NQLB 4URKA 2KYWA 4G3XB 5TR5A 2DYBA 4XGAB 3QWZB 4MACA 2ZPYA 4RM8A 4FHJA 3FAUA 4GOCA 3BVZA 3HK0A 4HKZE 4LCDE 2LXAA 2W82A 2NTTA 3J9CA 4ICUA 4EZJA 3RULA 1ZTGA 4ZDVA 2WS3B 1VIGA 4ZRJA 3EGRA 3RNEC 1SSNA 3KYCD 3DHIC 3TL5A 3ZVVA 1NVID 4DUZH 2UU9H 1UG8A 2I1JA 2WXMA 3WAOA 2JRIB 1C76A 2WXQA 2IZVB 4HJGE 4JI6H 2LJIA 3GABA 1TT5B 2XNAC 5DPRA 2BQQA 1JALA 3KUDB 2JEAI 4KZ0A 4JI1H 4K7WA 4A9AA 2L1AA 1HNXH 3DBRB 2K8CA 3BVMA 5I4DA 1EUVB 2XK5A 2AX5A 1PGXA 1YJIA 4ZRKA 1OFFA 3WAPA 4ACFA 3ZKJC 5KHOA 4O1NA 1SIJA 3T1YH 3CIRB 2LASA 1T0SC 2BYTA 1P7EA 1YJ1A 4WAAA 1TS4A 1QZEA 3AEVB 4MGYE 1SE2A 2Z0DB 4DV7H 2QEJC 4XWWA 1ZPSA 1HE8A 3RNAC 3UQBA 4B8CD 4OZCA 4KX6B 1S20A 4ASWC 1VZ6A 4WALA 5EDSA 5FKAC 4BOSC 4N58A 1V1OA 3KH0A 3AH7A 4YWGG 4DV0H 2CTEA 3R8BA 4IFDG 1I35A 3WALA 2LI5A 4ZYNA 1EWYC 1PUTA 2Y5BB 2OPVA 3RZFA 1FNWA 2WXNA 4A6QA 1FXTB 3SDLC 1F9JA 2RGFA 1IYFA 3R7RA 1L7YA 3PLUA 2CWHA 5BYRA 2IY0B 1TYGB 2VZKD 1Z2IA 1PQXA 4AQYH 3IAM1 4E9JA 1FIQA 2B3AA 3RNBC 3I63C 2INPE 4GDLB 3TCAA 3M3JA 4LFBH 1SEBD 3B1LX 4EZKA 4GSWA 4FJVB 2MJHA 1IUEA 3U8ZA 2G3QB 3L4PA 1XD3B 1TKGA 3IAS1 4YL8A 1TUAA 2UXBH 2JE6I 4MGZE 4MJSB 4XDCA 1V9NA 1YX5B 3T1HH 3B2FA 4NXNH 2MJDA 3IG3A 1ROEA 3T8MA 5HHDG 1IBMH 2NN6G 2FUG1 4IG7B 2R2QA 3P2BA 2C7HA 4GB9A 2YQRA 1D5MC 3QD7X 2AWTA 3QARA 2PT7G 1KF6B 2KANA 1UWXA 1J8CA 1E8YA 1KLUD 3N20C 4K3BA 2KWCA 3RZWC 2HD5B 4DDGD 5IN7A 1SE9A 1WF9A 3ALBA 2LWPA 4RGTA 1EU3A 1GC6A 1H4RA 3QK0A 1E90A 4DQOC 1XF5L 4P16A 2UXCH 1L5PA 1MG4A 2EKEC 2WDQB 3TUOA 2ANNA 3ML8A 2DYOA 3AE7B 2QCZA 1MSZA 5DPWA 2KK8A 1L0XB 2L3ZA 3RT3B 2LHEA 3ZTDA 1E10A 1B9RA 2IO3B 5IOIA 3RNFC 4ICVA 3O13A 5JXVA 3WIMA 4HEA1 1MI0A 4KGTA 4LNIA 5CTRC 4KSLC 5AEKB 4QAYA 1TY0A 4NXMH 3Q2AC 4A90A 3VHTC 3P4QB 1TKEA 3AMZA 1G6JA 1ZDVA 4YTNB 1KJTA 1ZXHA 2K9XA 4JI0H 1XEEA 5D7GA 2VRRB 2IO2B 2K1FA 3AXCA 4AJWA 2JUOA 3H6NA 2JX5A 3SD5A 1FEHA 4D2KA 4LLGM 1HNZH 4OCHA 1XCQL 3PVLA 3ZJUA 2PY9A 4MJSA 1HQRD 2JVZA 1DYQA 1KLVA 3VH3B 2X8XX 1E0ZA 2QDFA 3I3TB 1WTJA 2V3SA 2JRHA 2O6VD 3PRMB 2K8BA 4NZRM 4NQKE 1J5EH 4FXCA 1NI3A 2KOXA 2KDMA 3U7DA 3ZO5B 4AUQC 4LNNA 4HPMB 4MEMA 1UBQA 2P2RA 2IGGA 1DTJA 5BMGA 4ANVA 4A20A 2O6VA 1GJZA 3UQAA 1N34H 2VZKB 3ZW3A 4PK1A 3Q8CA 3Q14C 1FCLA 1E6EB 2KO3A 1RFKA 4KZCA 3KDKA 2KC2A 1VZ7A 4R3DA 4K0KH 1WGHA 1I94H 2CHWA 2K22A 4MH0E 3RI7C 2CJNA 2M8SA 2DX5B 3U2SC 3PO0A 3AN1A 4BKGA 1WM3A 2HDEA 4DR3H 2ZM6H 2KVRA 4M00A 1WGDA 4M8MA 4JWSC 1CK1A 2MWSB 1VDVA 1GG3A 1V9JA 1AYFA 2KFKB 2IPKD 4GMVA 3AE9B 1V1PB 2NBWB 1P7FA 1GNUA 3W1YA 1WE6A 3QAQA 3VVWB 2I38A 1UWMA 2TSSA 1WY8A 4HRSA 2WX1A 4ARIA 1TY2A 2RD0A 3DBHI 1NEKB 3QA8A 4EC5A 4JQWC 1UUPA 4FBJB 2PKOA 4IWQA 3M63B 1V8CA 2NBVB 3A1QA 2HJ8A 4GKJH 2E3TA 3A33B 4JI5H 1FMAD 2Q5WD 1J7AA 5D3DA 1DOXA 1ZUD2 4IKGA 4E74A 5D3IB 2V1YA 4EUTA 4TQ1A 4JI7H 4MGIE 4GN1A 4JPSA 2OJRA 4LF6H 1MPEA 2JXTA 5E6PA 3JVZX 1JMLA 3LYYA 3SB1A 1FJGH 4OVUA 4RFBA 1OEYA 1K51A 2JWZA 1JQ4A 1MG8A 1V6EA 3MP9A 4C7YA 3URYA 2J7QB 2KJ6A 1QKZA 2G45B 3S2AA 3PS6A 3ZXVA 4LNFA 2DZKA 2FCSA 4IDIA 1Z5SB 1QLBB 2ACZB 3N1XC 1TS2A 2UXDH 2MCNB 2MBBB 2GLSA 3JYUA 3RFZB 2FFMA 4JI4H 3EFUA 3NZ3A 5JH5C 2G4DB 4XX5A 4DV5H 4BBNC 4YY3H 5IT9W 3V69A 4MM3B 1GB1A 2E3UA 2PPHA 4ANUA 4MDKE 4S17A 2BL5A 4LIJA 3V61A 4FN2A 3EA6A 3P1MA 4K7SA 3N30A 4WURA 2HH2A 4DUYH 3U30A 1PGAA 1QILA 1Z2MA 2O6VB 2WLBA 4W9JA 4C4VB 4EOYA 2K5PA 4PS8A 4W9CA 1B1ZA 3AEBB 4WAFA 4GXBA 2D9IA 1C3TA 4MGKE 1Q0WB 3SFEB 2JZPA 1EC6A 2NMQA 2CPQA 1F0ZA 2ZCBA 4X66H 3N1ZC 5G2NA 1JCKB 3OSSD 1DT4A 4IW0A 4JE3B 3V05A 1ISNA 5IP4D 2FMRA 1DOIA 1L6UA 1L4ZB 4G08A 1PFDA 2J0JA 2LUEA 4HPLB 1F0XA 1XRHA 1LQBA 1N62A 2LXCA 1I4PA 1YQ3B 2DAJA 3R3MA 2WXFA 3ONSA 3MFGA 1XT9B 1YJJA 3DWGC 4RMAA 4E3CA 3RN9C 3DVGY 2GMIC 2BTEA 2ONQA 3T3NA 1HTQA 3J81W 2K1HA 2NTSA 3VFKA 3H9DA 1WE7A 3TMPB 1JRUA 2LGIA 3IBEA 3SFDB 2BB5A 4LK0M 2NCNA 1OQRA 2N7EA 3HRDD 3SHQA 4B0MA 3RD2A 4JLCA 3QQ8B 4HCPB 3OTOH 3UOEA 3ZYYX 3P63A 4YTMB 4ZHPA 4JVYA 2J4XA 1X9ZA 3QC8B 2INCC 2VQEH 1ZW7A 2N7JA 4ZRPA 4EZLA 3DHHC 2NVUI 1VBIA 1OQYA 3AE2B 4DV3H 1KFYB 4W9KA 2M19A 2PJHA 2FE8A 2L05A 4F7ZA 4WWMA 3VTVA 3Q3FA 2UU7A 5HG2A 1UGJA 1FXAA 3GZNI 5BYQA 2A4ZA 3BK2A 2WGSA 4KVGB 2KVZA 3W5VB 4CQNA 3FAHA 5JEAG 1S03G 2KWUB 1C1YB 2LZ6A 1RFAA 2F4VH 4LDTB 2SAKA 1TIFA 4BVUC 4F1SA 3WA0A 3CSTA 1UBIA 1M4VA 3HM6X 5CHWA 4FJUA 5DCNA 1KM7A 2KQSA 3H7SA 2K6DB 2WU2B 4DR4H 4RH6A 2UUAH 2D3CA 3M62B 4PYUA 4YTPB 2JPHA 2GBKA 2MRPA 1X4NA 2WDVB 1FNVA 5EE0A 1ZGUB 1J19A 3ZXRA 1Y8RC 1C79A 4HLEA 1MJDA 2LHDA 4I6LB 4A55A 5D2MB 4DHJD 1ACCA 4OVZA 2BS4B 2QMTA 5G55A 1IBXA 3ZJVA 2LTMA 4DBGA 1FKAH 4IM3A 3N1YC 4XZ4A 1TS3A 3ZNZB 1QT9A 2WP9B 2ZW1A 2LD9A 1BUIC 3AV8A 5D94A 2MA9B 3WANA 3DVNU 3DCGA 1AN7A 5EE9A 3PTFC 4FJYA 3DBLI 3RYTA 3DVGX 3GOEA 4GDLA 1A70A 1C4CA 2M17A 5D6JB 5A2QW 4NJCA 3C8YA 1XLNA 2N9KA 2D10A 2LRRA 3IHPC 2RMMA 1XQQA 2KTRA 1JWMD 2D5GA 3NVZA 4HXDA 1XNQH 2LRWA 1GC7A 1WXAA 5LMNH 4JI3H 1UF0A 2BWES 1A5RA 2ZPNA 1Q10A 1H8CA 2ANRA 1S1QB 1K53A 2L7RA 2W9NA 2GBRA 2L0TA 5K36G 2KFKA 4IM2A 3VUXA 4KGRA 2RDHA 1RYJA 3BYYB 4TUUA 4NJ7A 4HPPA 1STEA 2GOWA 3CWIA 5DPSA 1R4MB 2DYMA 2I1KA 1SE3A 1FPYA 1RM6C 3X0WA 3D32A 3NS1A 3I5JC 3AB5A 2NR2A 2GBJA 3HIZA 4WQOB 4JYAH 3R66C 5BMHA 4DR5H 4II2B 1VCBA 3ZQ4A 1HEZE 4M0WB 3H7PA 1WVNA 1IPGA 3B2GA 2JF5A 4IUMB 2CJOA 4W9HA 2M1MA 4WJOA 3PT2B 1V49A 3A1QB 1E9MA 4OW0A 1X0AA 1WHRA 2ZCCA 1KRHA 4IWPA 2K0PA 3W9CB 1JROA 2E6XA 3EZJA 2JEBI 1C77A 4M01A 1K52A 3DBLB 2AQ1B 5IWAH 2EELA 2NBUA 5IKCM 3TSSA 4AP4C 2JU6X 1XMQH 2KQ7A 2JT4B 4GU2A 2N9PC 3GE8C 2CHXA 4J3OD 2CTJA 4EKUA 1WXSA 1JWUD 1F2RC 1I42A 2MH7A 4EE2A 4JI2H 1OQQA 2LRUA 2DWQA 1AW7A 1VIHA 2XEWA 1JWBD 1HZ5A 4OZAA 4PS3A 5TSSA 2VH2A 3JAMW 1MHHE 2ZQEA 3CMMB 3J80W 3AU5A 2L0FA 2N1VA 2GB1A 3MJWA 3RMKC 2AEHA 1AARA 4WQMA 5FLXW 3A9KA 4RCOA 3MHSD 1L0YB 1Q1OA 2KDIA 2OEDA 4CHKA 4ZOHC 1EWCA 2VKCA 1LFDA 5J17A 2IGDA 1TKYA 2B76B 2C9WB 3ZIMA 4K81A 5BR8H 1R4NB 2XK5B 1FD6A 4PT5A 3KUCB 4TQ0A 1WZ0A 1GAQB 4A3PA 2PE6B 2V3NA 4L23A 1GB4A 2N9XA 1C4AA 2N4FA 1WSPA 1FO4A 2KXJA 2V4IB 5AZGA 3AULA 3JSVA 4PDBA 2K25A 4X65H 4E71A 1V2YA 4HCNB 3V6EB 4DV6H 4NY0A 4KSKC 4C7ZA 1ET9A 4N6EB 4DXFA 1TBEA 3DVNV 1WR1A 1TTNA 4B3MH 1D6EC 4HKQA 1N61A 1EU4A 2ZVNA 3AE4B 1GUAB 4BA1I 1UH6A 5IAAC 3HM3A 4WANA 2A1SA 4WJQA 2V4LA 5C2TB 4M0WA 2INDC 3H8HA 4FA6A 1WIAA 5CX3A 5JHBA 3AI5A 1IBLH 2H89B 3NVYA 2D11A 1VR9A 1WYWB 1E7VA 2ZEQA 3IFWB 2Z0SA 2O4CA 2D3BA 4W9GA 1WXMA 2EMTA 5G5GA 4KHPH 1HXYD 3K9PB 2DBYA 2PEAA 4DHZB 4BA2I 2KWVB 2Z0EB 3NS8A 2DENB 4KKJA 2WDTB 3VRAB 4TKNA 4B9KA 1R4NI 4I6PA 2R61A 2BYFA 3OAWA 1WRDB 1QQRA 4II3B 5L95C 1FXIA 2M56B 3U1KA 2YVCA 4NPNA 1SJHD 2AL3A 4TSSA 1X4MA 2RDGA 1EF5A 4B0EA 3ZRFA 1ZOYB 3NVWA 1OTRB 2R2OA 3NZUA 3RPFC 3ZDTA 2KKCA 3Q6BA 1TJEA 5HI1A 1GPXA 2PW9A 4JV5H 3LB8C 1C9FA 1WXQA 3A4SC 1E7PB 4USAA 2C7NB 2KQ4X 4GKKH 2X38A 3IT4B 1NDDA 3L10B 4KDLB 2WQYB 3VR8B 4JGHB 3KWVA 4AS1A 1KOTA 2G1EA 2PLPA 1UNSA 1PGBA 1ZZIA 1F2RI 3DQVA 1OEYJ 3C19A 4US9A 1SIFA 3ZNID 2Y5PA 3DOWA 3VH4B 5EE3A 4MSQB 1RAXA 2IJ0A 3PRZA 2MJ3A 2PTLA 1OGWA 4J6IA 2D3GA 3MC9A 2MP2A 2RPQA 2JZXA 2CPMA 1D5XC 3IT6B 4DV1H 1SXTA 3ABVB 3RUIB 2ICIA 2AQ2B 4WWOA 4DXGA 5LXHA 4MM3A 5JHAA 2C5LC 5GXGB 3I9V1 4HROA 4OVVA 1D5ZC 4PS7A 2KLGA 4KIKB 1WGGA 4ZHOA 2JSVX 2FUHB 2QILA 5G5HA 1V5TA 4NZLB 4B95A 4K1RB 4P6VF 4BAXA 1F77A 5KHQA 5CHFA 2W3RA 3Q3MC 3V62A 2WXLA 1WM2A 3L54A 2MBHA 2IDYA 3EUB2 5H8YE 4DR7H 3ML9A 1CQVA 1GOZA 3Q8EA 2HTME 4ARCA 3R2TA 4RGMA 3KDGA 3AE3B 5HFYA 2JY6A 3MHZA 2V9HA 4JVHA 1KTKA 4CO7A 2YEPF 4YSZB 5GMVA 3AE5B 3LJ3A 1HA5A 5BMIA 3ZNGC 4P1BC 1C4PA 4DXAB 3AE1B 4FJSA 2DZJA 4YSYB 5CHVC 3JW0X 4YXDB 3RNCC 2J53A 3KLSX 1N5WA 4HDOA 3VXWA 2LGSA 4X57B 4WIPA 1YOVB 4MELA 2DLBA 2KT7A 2BW2A 2LF0A 4C00A 2BYEA 3NZSA 3T9LA 2KN4A 1IBKH 1J0GA 1IGCA 3DBSA 1HZ6A 1WXVA 2VH1A 3UIPB 4US8A 4DWFA 2KZRA 1MHXA 4C56C 3GB1A 1RRBA 4NAWB 3Q8BA 2ON8A 2V0GA 2QJLA 3PGEA 2WNMA 4DDID 1WMHA 4P1CC 3CSFA 4AOFA 4K3CA 1S3SG 3GR5A 3AEFB 3EFCA 4TV3A 1QF6A 4WWPA 2N1WA 4N9F4 2I2YA 5BYSA 1WMHB 4LF4H 2LUMA 2DZMA 5DT9A 3NG0A 1R7SA 4OD6A 1XNRH 1N5XA 4WH4A 5LL6b 4X62H 3L16A 2BYVE 2FIDA 2E5LH 2OPUA 4BFRA 2G4SA 3KUZA 2ZNVC 1I7HA 4F8CB 1ET6A 4M02A 2BS3B 1N63A 3QCAA 3X23A 2OOBB 4G0NB 4FHKA 3TJPA 4A8XC 4JX1C 2AXYA 2BF8B 2QSDA 2LGDA 2BGFA 5AZFA 2BVCA 1TZOA 1NENB 2IYDB 2J0KA 3BYTB 4WWNA 1IBXB 1HR0H 4MT5A 4IM0A 3SR6A 3NCVA 4RF0A 5C23A 1XLOA 2AQ3B 1WRIA 1I4XA 3OLMD 3BY4B 3OETA 2W3SA 3AE6B 1WE8A 5C3JB 2FPHX 1NXUA 2PQUA 2ZNVB 1ZZKA 1UGMA 1J5KA 2KDBA 1YN5A 1WGRA 3VAWA 3BIID 3TBLD 2L83A 1QOFA 2CU1A 1SEIA 4OZBA 3VTWA 1FRRA 4C80A 2HHHH 1V81A 3ETRA 2G8YA 2MQJA 1VLBA 2KX0A 4AM3A 2HJ1A 4ZRQA 4W9FA 1DGJA 3FILB 4LJPB 3L13A 3U7ZA 1V86A 5LLIA 1QOGA 2WXRA 4DV2H 4BKSA 2JYTA 1U4AA 1YQ4B 2ASQA 3L08A 3TEWA 1E8WA 1PYWD 1T3QA 1BXTA 2IGHA 2N9LA 4MSMB 1PQSA 3H7PB 1DOYA 4DHJB 4DK5A 2KACA 2N7DA 2HH3A 3MTNB 1EO6A 3N32A 1SB3C 2L8JA 1T6BX 2RDBC 2IO0B 3TEZA 3NJTA 1N32H 2KWDA 1WJ4A 3ZTCA 3AECB 4IOIE 2DHZA 2LTLA 2DNFA 2WU5B 3DDCB 3QIJA 2KAJA 2BWFA 2NPTB 3VRBB 1WYGA 3A9JB 2H88B 4AWJA 2FIFA 3KQ4A 1YN3A 4JL9A 3W1SC 1P3QU 1V97A 1P9DU 1I4RA 2DAFA 2L76A 3AEDB 2KFJA 1WJUA 2CTKA 1Y56A 3BK1A 4GDKA 1YNTE 1XXGA 3L0WB 1XMOH 2LMCA 3A9KB 4GGQA 4HVBA 3ZRCA 3M95A 1NBFC 2OHFA 4K7UA 1VZ8A 3VUYA 2O2VB 2Y3AA 1CJEA 1SGHA 2BPSA 3HUIA 4ITKA 3PHXB 1V5OA 1ESFA 1WI0A 2CTFA 3ENEA 4EFOA 4DR6H 2C60A 4CYEA 1BT0A 5T8IA 3PZ7A 2MSED 2PE9A 4S0RA 2FBWB 2GBMA 4JWUC 3APFA 3Q3JA 3O65B 3RF2A 1E8ZA 1ZXIA 4XYCA 3DHGC 4QMFB 3ECIA 2WXIA 2MEKA 2X06A 4KIKA 2WXHA 2MP2B 4I6NB 3APCA 4FJZA 5C0XG 3ZNHB 2M0XA 4RGNA 2AYOB 2D2QA 1KHMA 1TS5A 1LXDA 3AEEB 2YLMA 1F1HA 1I4QA 3BINA 3CF6E 1ODHA 1FNUA 2MJEA 3HVDA 3AE8B 2CHZA 2CS4A 4LFCH 3PSEB 3GP7A 4FADA 5E6NA 1J7BA 1I6UA 3FKYA 4B6WA 3ZDMC 1VD2A 2K6QA 2RSUA 4G50A 5AUIA 2XBBC 3Q3OC 4RF1A
chains in the Genus database with same CATH topology
1I4PA 1YQ3B 5EE1A 3IT4B 2WXFA 2BT6A 5FR3A 2WQYB 3VR8B 3MFGA 4A9AA 2L1AA 4AS1A 3KWVA 2G1EA 3BVMA 3UI3A 5I4DA 1YJJA 1UNSA 1PGBA 2PLPA 3DWGC 1F2RI 2AX5A 1PGXA 3VR9B 2BTEA 4US9A 3DWMA 1YJIA 2ONQA 2PMVA 5H92C 2Y5PA 3T3NA 1J7CA 3PZ8A 1OFFA 5EE3A 2NTSA 2IJ0A 2MJ3A 2LGIA 3SFDB 4O1NA 2BB5A 4LK0M 2PTLA 1SIJA 3CIRB 1OQRA 3HRDD 2BYTA 1P7EA 1ZP0B 4B0MA 2WXPA 1TS4A 1D5XC 2CU3A 1ZDXA 3IT6B 3U4EG 4AQ7A 1SXTA 3ABVB 5AUKA 2ICIA 2AQ2B 1SE2A 3ZYYX 2QEJC 4XWWA 1ZPSA 3P63A 4OZCA 4YTMB 4ZHPA 4KX6B 4DXGA 2J4XA 1VZ6A 3HVZA 1CZPA 2N7JA 4ZRPA 5FKAC 5GXGB 3I9V1 4HROA 4N58A 1V1OA 3AH7A 1D5ZC 3P42A 3AE2B 4YWGG 1KFYB 3R8BA 2M19A 1ENFA 4ZHOA 2FE8A 2J52A 2JSVX 4MH8A 4XDDA 4WWMA 1EWYC 1PUTA 1FNWA 2WXNA 4A6QA 5HG2A 1UGJA 1FXAA 2QILA 5BYQA 5G5HA 4NZLB 3BK2A 4P6VF 3GS2A 3N9YC 1F77A 3W5VB 4CQNA 3FAHA 1FFUA 5BYRA 4L1BA 2W3RA 2SAKA 3SEBA 1TYGB 2VZKD 2WXLA 3IAM1 2L52A 1M4VA 1XO3A 2IDYA 3EUB2 5H8YE 1FIQA 4NAMA 1VJKA 3Q69A 2INPE 1CQVA 1GOZA 3P4SB 3Q8EA 2WU2B 2HTME 1L0VB 4GDLB 1MVKA 4ARCA 1SEBD 3R2TA 4RH6A 1JW9D 4RGMA 4KGSA 3AE3B 5HFYA 1IUEA 3MHZA 4RGOS 3L4PA 1TKGA 3IAS1 1KTKA 3W2DA 4YTPB 2GI9A 3BVGA 2WDVB 2YEPF 4YSZB 3AE5B 1FNVA 4XDCA 5EE0A 3B2FA 2MJDA 1HA5A 1ROEA 5BMIA 1C79A 5HHDG 3TEYA 1C4PA 2LHDA 2FUG1 3VQIA 1SJED 4A55A 3AE1B 1ACCA 4OVZA 3NUHB 4YSYB 2BS4B 2QMTA 1IBXA 1KH0A 3ZJVA 4YXDB 3AEAB 3KWLA 1D5MC 2J53A 1KF6B 1UWXA 1N5WA 3KLSX 1TS3A 2BBCA 4Q2JA 4WIPA 2ZW0A 2DLBA 1KLUD 2BW2A 2J42A 1QT9A 2WP9B 2ZW1A 2KN4A 2LFIA 2Z8LA 3LXFA 1IGCA 1BUIC 1HZ6A 3AV8A 3OWEB 4RGTA 4US8A 1EU3A 1MHXA 5EE9A 4C56C 3GB1A 4UDUC 3ZGZA 4NAWB 3MC0B 3Q8BA 2ON8A 2V0GA 1SF0A 2JQRB 2QJLA 2WNMA 1A70A 1C4CA 4DQOC 1XF5L 4NJCA 3C8YA 4P16A 1XLNA 2N9KA 1L5PA 3W5UB 4GLSC 1QOBA 2G9HD 2RMMA 3Q8FA 1AN8A 2WDQB 3TUOA 2WXKA 1JWMD 2D5GA 3AEFB 3NVZA 2DYOA 3AE7B 1C78A 1QF6A 1QOAA 2I2YA 1L0XB 4XE0A 5BYSA 2LUMA 1I4HA 2LHEA 2K3UA 1Q10A 4GDKB 3FC4A 1E10A 1B9RA 1K53A 1R7SA 3O13A 5JXVA 1ZE3D 1N5XA 4WH4A 4HEA1 1MI0A 2XN9C 4KGTA 1FCCC 4L2YA 1WWTA 3AEGB 4REZA 1TY0A 4KGRA 2RDHA 1RYJA 4A90A 1JRPA 1V1PA 3BYYB 1I7HA 3IXSA 3MJ5A 3P4QB 1ET6A 1STEA 2BS3B 1TKEA 3CWIA 3AMZA 1N63A 3FILA 2DYMA 1ZDVA 1SE3A 4YTNB 3E9SA 1ZXHA 1JWSD 1RM6C 2K9XA 2WXGA 3NS1A 3AB5A 4A8XC 1XEEA 4JX1C 2W54A 4TMAB 2PIAA 5BMHA 5D7GA 4ZYSA 3ZQ4A 2QIEB 1HEZE 2JX5A 2QSDA 3B2GA 1T5XD 1FEHA 4D2KA 4LLGM 2CJOA 1XCQL 1TZOA 1NENB 1E9MA 3ZJUA 1XLQA 4OW0A 3R2IA 1HQRD 3BYTB 1KRHA 2BS2B 5E6JA 2W55A 1IBXB 1DYQA 4MT5A 2K0PA 3W9CB 1JROA 2E6XA 2INNE 3SR6A 1C77A 1E0ZA 3TEXA 4RF0A 1K52A 1XLOA 2AQ3B 1SE4A 1WRIA 1I4XA 2AQ1B 2EELA 2SEBD 2W3SA 3AE6B 3TSSA 4FXCA 1NI3A 2JU6X 5C3JB 2KDMA 1YN4A 1VRAB 2IGGA 5BMGA 3NVVA 2PVOD 1IGDA 4J3OD 2VZKB 3NRZA 1L4DB 3P4RB 1YN5A 2M0AA 1JWUD 3Q8CA 1FCLA 1F2RC 1E6EB 4LTUA 3BIID 1RFKA 2MH7A 4EE2A 2L83A 1QOFA 1OQQA 1VZ7A 3P4PB 4OZBA 2DWQA 4R3DA 3T3OA 1FRRA 4C80A 1AW7A 2N0SB 3ETRA 1JWBD 1K50A 2PVGC 1FRDA 1VLBA 2K22A 1HZ5A 2CJNA 1I4GA 4OZAA 4ZRQA 5TSSA 3U2SC 3PO0A 1MHHE 1DGJA 3FILB 3AN1A 1WGKA 3U7ZA 1KLGD 2HDEA 1N60A 1QOGA 2GB1A 2WXRA 1PDXA 3U52E 2Y5CA 2JYTA 4WQMA 1YQ4B 4RCOA 1L0YB 3TEWA 2LEKA 2OEDA 1PYWD 1T3QA 1BXTA 2IGHA 4ZOHC 1EWCA 2N9LA 3BZDB 1DOYA 4JWSC 2KACA 4N59A 1YMHE 1CK1A 2IGDA 1TKYA 1VDVA 1SB3C 3W1SA 2B76B 3B9JA 2JWUA 1AYFA 1T6BX 1BMLC 3TEZA 2IPKD 1FD6A 4PT5A 3AE9B 1V1PB 2KWDA 1D4BA 2WDRB 1P7FA 1AWDA 3AECB 5LNK1 1LO5D 4TQ0A 4IOIE 1RWSA 1GAQB 1XLPA 2WU5B 2WXOA 2I38A 2KAJA 1UWMA 2TSSA 4XWTA 4HRSA 2V3NA 4ARIA 1TY2A 3VRBB 1WYGA 4L23A 1NEKB 2H88B 1GB4A 3AM9A 1C4AA 1UUPA 2RPVA 3KQ4A 1WSPA 4YT0B 1FO4A 4RNAA 1YN3A 1V97A 1XCTL 2PKOA 2V4IB 1I4RA 1V8CA 5MPOA 2E3TA 1FMAD 2Q5WD 1J7AA 5D3DA 1DOXA 3AEDB 1ZUD2 4IKGA 3V3XA 3Q8AA 5D3IB 2JYEA 1Y56A 3BK1A 1NYQA 4TQ1A 2V3PA 1JWAD 3I57A 4YSXB 3E56A 1ET9A 1FM0D 4C7ZA 4JPSA 1EM7A 1MPEA 4N6EB 2JXTA 4DXFA 1YNTE 1XXGA 2LMCA 1D6EC 4H2AA 4HKQA 1N61A 1JMLA 3LYYA 4RFBA 2KMMA 1EU4A 3AE4B 3ZJTA 1K51A 2OHFA 1JQ4A 3MP9A 4C7YA 1VZ8A 2Y3AA 3URYA 5FK9C 5C2TB 1QKZA 4M0WA 2YEPB 1CJEA 1NYRA 3HUIA 3H8HA 4ITKA 2H89B 2L32A 1ESFA 2EKIA 3NVYA 1VR9A 1FFVA 4IDIA 4OHJA 1QLBB 5T8IA 2ACZB 2GRIA 4KKIA 3PZ7A 3WCQA 1TS2A 1SBBB 1L6VA 5G5GA 3RFZB 1HXYD 2BB6A 2DBYA 3NZ3A 2WXJA 3BWUD 2FBWB 4JWUC 4KKJA 4MM3B 1ZXIA 1GB1A 3VRAB 2WXIA 4MACA 2MEKA 2R61A 3EA6A 2WXHA 1QQRA 3P1MA 4WURA 3BVZA 1PGAA 1FXIA 1QILA 4HKZE 2WLBA 2K5PA 2M56B 4RGNA 2W82A 2NTTA 1B1ZA 3J9CA 1TS5A 3AEBB 4WAFA 3AEEB 1I4QA 2WS3B 1SJHD 3SFEB 1FNUA 2JZPA 2MJEA 3HVDA 4TSSA 2NMQA 3AE8B 3EGRA 1F0ZA 2RDGA 4B0EA 1ZOYB 1SSNA 3NVWA 1JCKB 1NVID 3RPFC 2WXMA 3GP7A 1TJEA 4JE3B 3V05A 1J7BA 5HI1A 1GPXA 2PW9A 1DOIA 1C76A 1L6UA 2WXQA 4HJGE 1L4ZB 2LJIA 3LB8C 1PFDA 1C9FA 1WXQA 1E7PB 4USAA 5AUIA 2XNAC 1N62A 4RF1A 2KQ4X 2X38A 1JALA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QIE B;  1YQ3 B;  1V8C A;  2JX5 A;  2WDV B;  3B2G A;  5EE1 A;  4YSZ B;  2E3T A;  5MPO A;  1FMA D;  2BT6 A;  1J7A A;  2Q5W D;  3AE5 B;  5EE0 A;  1DOX A;  2CJO A;  3AED B;  2WQY B;  3B2F A;  1ZUD 2;  2MJD A;  3VR8 B;  4A9A A;  1NEN B;  1E9M A;  1ROE A;  1XLQ A;  2G1E A;  1KRH A;  1NYQ A;  2BS2 B;  1YJJ A;  2W55 A;  3DWG C;  3VR9 B;  1JWA D;  2AX5 A;  4YSX B;  4C7Z A;  3AE1 B;  1FM0 D;  3W9C B;  1JRO A;  4US9 A;  3DWM A;  1YJI A;  4YSY B;  3SR6 A;  2BS4 B;  4N6E B;  5H92 C;  1E0Z A;  4YXD B;  3AEA B;  1J7C A;  1XLO A;  2PKO A;  1OFF A;  3KWL A;  5EE3 A;  1WRI A;  1N61 A;  1KF6 B;  1N5W A;  2MJ3 A;  2KMM A;  2W3S A;  3SFD B;  3AE6 B;  3AE4 B;  4FXC A;  1NI3 A;  2OHF A;  1SIJ A;  5C3J B;  1JQ4 A;  3CIR B;  1QT9 A;  2WP9 B;  4C7Y A;  1OQR A;  3NVV A;  5C2T B;  3LXF A;  2PVO D;  3HRD D;  3AV8 A;  1CJE A;  1ZP0 B;  1NYR A;  3NRZ A;  3HUI A;  4ITK A;  3P4R B;  4US8 A;  2CU3 A;  5EE9 A;  2H89 B;  4LTU A;  1E6E B;  2EKI A;  3NVY A;  3ABV B;  3BII D;  5AUK A;  1FFV A;  1RFK A;  2MH7 A;  4IDI A;  3ZYY X;  2L83 A;  1QOF A;  1OQQ A;  1QLB B;  3P63 A;  1SF0 A;  2JQR B;  2ACZ B;  2QJL A;  3P4P B;  2DWQ A;  1A70 A;  3WCQ A;  4YTM B;  4ZHP A;  1FRR A;  4KX6 B;  4C80 A;  1XLN A;  1L6V A;  2N0S B;  5G5G A;  3ETR A;  1L5P A;  2DBY A;  1JWB D;  3W5U B;  3HVZ A;  1CZP A;  2PVG C;  1FRD A;  1QOB A;  1VLB A;  2K22 A;  2FBW B;  2WDQ B;  4JWU C;  2CJN A;  5GXG B;  4HRO A;  4N58 A;  1ZXI A;  3AH7 A;  3PO0 A;  1DGJ A;  3AE2 B;  3VRA B;  3AEF B;  1KFY B;  3AN1 A;  4ZHO A;  2M19 A;  3NVZ A;  1WGK A;  4WWM A;  3AE7 B;  1EWY C;  1PUT A;  1QF6 A;  1N60 A;  1QOG A;  1PDX A;  1QOA A;  2Y5C A;  4WQM A;  1YQ4 B;  3P1M A;  1FXA A;  5G5H A;  1FXI A;  2WLB A;  2LEK A;  1T3Q A;  2K5P A;  4P6V F;  2M56 B;  4ZOH C;  1DOY A;  4JWS C;  3FC4 A;  4N59 A;  1E10 A;  3W5V B;  1B9R A;  1R7S A;  3FAH A;  1FFU A;  1TKY A;  1VDV A;  1SB3 C;  3AEE B;  3AEB B;  1N5X A;  2B76 B;  3B9J A;  1AYF A;  2W3R A;  2WS3 B;  3SFE B;  1TYG B;  1WWT A;  2MJE A;  3AE9 B;  3AE8 B;  3AEG B;  1F0Z A;  2WDR B;  2L52 A;  1XO3 A;  3EUB 2;  1AWD A;  3AEC B;  5H8Y E;  1FIQ A;  1RYJ A;  1ZOY B;  3NVW A;  1JRP A;  1RWS A;  1GAQ B;  1I7H A;  1VJK A;  1XLP A;  2WU5 B;  3P4Q B;  1NVI D;  3RPF C;  2BS3 B;  1TKE A;  1UWM A;  2KAJ A;  1N63 A;  3CWI A;  3AMZ A;  3P4S B;  2WU2 B;  4YTN B;  2HTM E;  1L0V B;  4HRS A;  1TJE A;  3VRB B;  1WYG A;  1J7B A;  1GPX A;  1DOI A;  1JW9 D;  1RM6 C;  1L6U A;  1NEK B;  2H88 B;  2K9X A;  3AE3 B;  3AM9 A;  3NS1 A;  3AB5 A;  1IUE A;  3LB8 C;  1PFD A;  4JX1 C;  1WXQ A;  2W54 A;  2PIA A;  1E7P B;  4USA A;  5AUI A;  3L4P A;  1TKG A;  4YT0 B;  1N62 A;  1FO4 A;  4YTP B;  1V97 A;  1JAL A; 
#chains in the Genus database with same CATH topology
 5EE1 A;  2MHJ A;  1F52 A;  2BT6 A;  5FR3 A;  2VQF H;  1E8X A;  4A3O A;  2KDF B;  3UI3 A;  3DBH B;  3VR9 B;  2BKF A;  2CTL A;  2Z59 B;  3DWM A;  3EEC A;  2PMV A;  4G11 A;  5H92 C;  1J7C A;  3PZ8 A;  4P7I A;  5FR6 A;  4DHZ E;  4LJO B;  4AIM A;  4W9D A;  2MX2 A;  4PYZ A;  1L2N A;  2AL6 A;  1ZZJ A;  4WJP A;  3B0A A;  1MFW A;  2BKR B;  1ZP0 B;  2KHW B;  2WXP A;  1N6Z A;  1N33 H;  2UUC H;  2O2V A;  2CU3 A;  1ZDX A;  3U4E G;  3VTU A;  4AQ7 A;  5AUK A;  1RLF A;  3C0R B;  1TZ1 A;  4NAW A;  4LF9 H;  4OO1 G;  2ZJD A;  2M4N A;  4KDI C;  5IO9 A;  2KMA A;  1CZP A;  3HVZ A;  5BO4 B;  4IWO A;  2J0M A;  3VKE A;  1UD7 A;  2KJR A;  3P42 A;  2KC1 A;  2UUB H;  1ENF A;  2J52 A;  4MH8 A;  4LF8 H;  2DZI A;  4XDD A;  2OJW A;  2LVP A;  1CMX B;  3TIX A;  4BOZ B;  3OJ4 B;  2GBN A;  3GS2 A;  4DR2 H;  1R4M I;  1X1M A;  3N9Y C;  1FFU A;  4BBN F;  4L1B A;  3SEB A;  2CKH B;  2L52 A;  1WX8 A;  4LF7 H;  1XO3 A;  4NAM A;  1VJK A;  3Q69 A;  2LGX A;  3P4S B;  3EC8 A;  1L0V B;  1MVK A;  4BKT A;  1UEL A;  1JW9 D;  4KGS A;  2FCM A;  4RGO S;  3J7A K;  4C4V A;  3W2D A;  3AU4 A;  2GI9 A;  3BVG A;  1NI2 A;  4ANW A;  5E6O A;  1TGZ B;  3TEY A;  2CWF A;  3MC8 A;  2QC8 A;  2FCN A;  1HNW H;  3VQI A;  2CTM A;  1SJE D;  4NZT M;  1P0R A;  3NUH B;  3UIO B;  1UZX B;  4B3R H;  1KH0 A;  3AEA B;  4W9I A;  3KWL A;  4BZA A;  3PV1 A;  3KYD D;  4IC7 B;  3EHV A;  3PLV A;  2BBC A;  4Q2J A;  1K1G A;  2ZW0 A;  4EEW A;  2C7M B;  2J42 A;  3I0P A;  2LFI A;  2Z8L A;  3LXF A;  3NY5 A;  4JIO U;  1N36 H;  4NJ6 A;  1WJ6 A;  3OWE B;  2JXX A;  3QJZ A;  5HKH A;  2KDE B;  2KMC A;  2KTF A;  4UDU C;  3ZGZ A;  3MC0 B;  3UGB B;  2WYQ A;  1WH3 A;  3K9O B;  1P98 A;  1SF0 A;  2JQR B;  2JZ3 B;  3H1U A;  4BKS D;  3W5U B;  4GLS C;  1QOB A;  2G9H D;  2UWQ A;  3Q8F A;  1AN8 A;  4RM9 A;  2L00 B;  3UF8 A;  4JI8 H;  2WXK A;  1LGR A;  3R7Q A;  1C78 A;  2ZZP B;  4WJN A;  5LXI B;  4X64 H;  1QOA A;  2LVQ A;  4XE0 A;  1WX9 A;  1I4H A;  3PRE A;  2K3U A;  4XC2 A;  4GDK B;  3FC4 A;  5JZE B;  1ZE3 D;  2FAZ A;  3VUW A;  2XN9 C;  2EMS A;  1FCC C;  4L2Y A;  1WWT A;  4ANX A;  3AEG B;  1V80 A;  2FCQ A;  4REZ A;  3GZN B;  4HWI B;  1JRP A;  1V1P A;  3IXS A;  3MJ5 A;  3FIL A;  1LM8 B;  3DBR I;  3E9S A;  3B08 A;  2IBI B;  3HHM A;  1JWS D;  2WXG A;  2KNB A;  4LDT D;  2KN5 A;  2NPT A;  4TMA B;  2W54 A;  2PIA A;  2QHO A;  4ZYS A;  4OX9 H;  1YIW A;  2QIE B;  3KVF B;  1WX7 A;  1T5X D;  1ZKH A;  3OG5 A;  3KW5 B;  3OJ3 A;  1WFY A;  1XLQ A;  3R2I A;  2BS2 B;  5E6J A;  2W55 A;  1J4W A;  5L83 A;  3PHW B;  1WJN A;  2A5U A;  2INN E;  3GE3 C;  4FLH A;  4AJY B;  3TEX A;  3ZLZ A;  2JVC A;  1WGY A;  2ZVO A;  1SE4 A;  2WHI A;  2SEB D;  3PRP B;  5DPT A;  1E7U A;  2D07 B;  1D3Z A;  1YN4 A;  5J18 A;  1VRA B;  4ZRI A;  4B8T A;  2BA0 A;  2RR9 A;  3NVV A;  2PVO D;  1IGD A;  3RCZ A;  3V6C B;  2Y3M A;  3NRZ A;  1L4D B;  3QHT A;  3P4R B;  2M0A A;  3A9J A;  1YX6 B;  3PPA A;  4LTU A;  4FUL A;  4H8A A;  4LF5 H;  3P4P B;  2QND A;  3T3O A;  2N0S B;  2MW5 A;  4NNJ B;  4B3S H;  1K50 A;  2PVG C;  1FRD A;  2UYZ B;  2KD0 A;  3DPD A;  1I4G A;  3V60 A;  4YHH H;  2MLB A;  4DR1 H;  4W9E A;  1WGK A;  2FNJ B;  1KLG D;  1N60 A;  1WZ3 A;  1PDX A;  3U52 E;  2Y5C A;  5AZH A;  2LVO A;  1M94 A;  2JA9 A;  2LEK A;  3BZD B;  4HJK A;  4HK2 A;  2JZZ A;  4N59 A;  3NHE B;  1YMH E;  5LMU H;  3W1S A;  3PZD A;  1HTO A;  2JWU A;  3B9J A;  2K39 A;  1BML C;  2K8H A;  2WWZ A;  3IVF A;  2LJ5 A;  4M8N A;  5C1Z A;  2M6Q A;  1D4B A;  2WDR B;  1K8R B;  4KV2 A;  3QX1 A;  1AWD A;  2MBO A;  3UIN B;  5LNK 1;  1LO5 D;  1RWS A;  1XLP A;  2WXO A;  2LGY A;  2KTR B;  4XWT A;  4NBQ A;  2DGR A;  1P1A A;  3AM9 A;  1T0Y A;  4B3T H;  3SU8 X;  1T0Q C;  2HTH A;  3L7Z C;  3APD A;  2RPV A;  4YT0 B;  2NS5 A;  3A4R A;  4RNA A;  3GKU A;  4LNK A;  1XCT L;  2CR5 A;  3LDZ E;  1WR6 E;  5MPO A;  1E5W A;  1IP9 A;  1YD8 U;  2IY1 B;  2MBE A;  2WX0 A;  3RNG C;  2KX3 A;  3V3X A;  2MBQ A;  3Q8A A;  2JYE A;  2M8W A;  4LNO A;  1NYQ A;  2V3P A;  1JWA D;  3I57 A;  3VDZ A;  4YSX B;  3E56 A;  1FM0 D;  2IO1 B;  4LFA H;  1EM7 A;  2D3A A;  4H2A A;  5J2R A;  3NOB A;  3JSV B;  4DV4 H;  2KMM A;  2N9E B;  4GIV A;  4W9L A;  3ZJT A;  3Q3N C;  2KLC A;  5FK9 C;  5IA7 A;  3ZUN A;  2YEP B;  1NYR A;  1EF1 A;  2KJH B;  1T0R C;  3L17 A;  2EKI A;  2L32 A;  1FFV A;  1YQB A;  4OHJ A;  4HDQ A;  1Q5W B;  2GRI A;  4KKI A;  3WCQ A;  3N3K B;  1SBB B;  3WAM A;  1L6V A;  2BB6 A;  2REX A;  2HE7 A;  2WXJ A;  3BWU D;  4NQL B;  4URK A;  2KYW A;  4G3X B;  5TR5 A;  2DYB A;  4XGA B;  3QWZ B;  4MAC A;  2ZPY A;  4RM8 A;  4FHJ A;  3FAU A;  4GOC A;  3BVZ A;  3HK0 A;  4HKZ E;  4LCD E;  2LXA A;  2W82 A;  2NTT A;  3J9C A;  4ICU A;  4EZJ A;  3RUL A;  1ZTG A;  4ZDV A;  2WS3 B;  1VIG A;  4ZRJ A;  3EGR A;  3RNE C;  1SSN A;  3KYC D;  3DHI C;  3TL5 A;  3ZVV A;  1NVI D;  4DUZ H;  2UU9 H;  1UG8 A;  2I1J A;  2WXM A;  3WAO A;  2JRI B;  1C76 A;  2WXQ A;  2IZV B;  4HJG E;  4JI6 H;  2LJI A;  3GAB A;  1TT5 B;  2XNA C;  5DPR A;  2BQQ A;  1JAL A;  3KUD B;  2JEA I;  4KZ0 A;  4JI1 H;  4K7W A;  4A9A A;  2L1A A;  1HNX H;  3DBR B;  2K8C A;  3BVM A;  5I4D A;  1EUV B;  2XK5 A;  2AX5 A;  1PGX A;  1YJI A;  4ZRK A;  1OFF A;  3WAP A;  4ACF A;  3ZKJ C;  5KHO A;  4O1N A;  1SIJ A;  3T1Y H;  3CIR B;  2LAS A;  1T0S C;  2BYT A;  1P7E A;  1YJ1 A;  4WAA A;  1TS4 A;  1QZE A;  3AEV B;  4MGY E;  1SE2 A;  2Z0D B;  4DV7 H;  2QEJ C;  4XWW A;  1ZPS A;  1HE8 A;  3RNA C;  3UQB A;  4B8C D;  4OZC A;  4KX6 B;  1S20 A;  4ASW C;  1VZ6 A;  4WAL A;  5EDS A;  5FKA C;  4BOS C;  4N58 A;  1V1O A;  3KH0 A;  3AH7 A;  4YWG G;  4DV0 H;  2CTE A;  3R8B A;  4IFD G;  1I35 A;  3WAL A;  2LI5 A;  4ZYN A;  1EWY C;  1PUT A;  2Y5B B;  2OPV A;  3RZF A;  1FNW A;  2WXN A;  4A6Q A;  1FXT B;  3SDL C;  1F9J A;  2RGF A;  1IYF A;  3R7R A;  1L7Y A;  3PLU A;  2CWH A;  5BYR A;  2IY0 B;  1TYG B;  2VZK D;  1Z2I A;  1PQX A;  4AQY H;  3IAM 1;  4E9J A;  1FIQ A;  2B3A A;  3RNB C;  3I63 C;  2INP E;  4GDL B;  3TCA A;  3M3J A;  4LFB H;  1SEB D;  3B1L X;  4EZK A;  4GSW A;  4FJV B;  2MJH A;  1IUE A;  3U8Z A;  2G3Q B;  3L4P A;  1XD3 B;  1TKG A;  3IAS 1;  4YL8 A;  1TUA A;  2UXB H;  2JE6 I;  4MGZ E;  4MJS B;  4XDC A;  1V9N A;  1YX5 B;  3T1H H;  3B2F A;  4NXN H;  2MJD A;  3IG3 A;  1ROE A;  3T8M A;  5HHD G;  1IBM H;  2NN6 G;  2FUG 1;  4IG7 B;  2R2Q A;  3P2B A;  2C7H A;  4GB9 A;  2YQR A;  1D5M C;  3QD7 X;  2AWT A;  3QAR A;  2PT7 G;  1KF6 B;  2KAN A;  1UWX A;  1J8C A;  1E8Y A;  1KLU D;  3N20 C;  4K3B A;  2KWC A;  3RZW C;  2HD5 B;  4DDG D;  5IN7 A;  1SE9 A;  1WF9 A;  3ALB A;  2LWP A;  4RGT A;  1EU3 A;  1GC6 A;  1H4R A;  3QK0 A;  1E90 A;  4DQO C;  1XF5 L;  4P16 A;  2UXC H;  1L5P A;  1MG4 A;  2EKE C;  2WDQ B;  3TUO A;  2ANN A;  3ML8 A;  2DYO A;  3AE7 B;  2QCZ A;  1MSZ A;  5DPW A;  2KK8 A;  1L0X B;  2L3Z A;  3RT3 B;  2LHE A;  3ZTD A;  1E10 A;  1B9R A;  2IO3 B;  5IOI A;  3RNF C;  4ICV A;  3O13 A;  5JXV A;  3WIM A;  4HEA 1;  1MI0 A;  4KGT A;  4LNI A;  5CTR C;  4KSL C;  5AEK B;  4QAY A;  1TY0 A;  4NXM H;  3Q2A C;  4A90 A;  3VHT C;  3P4Q B;  1TKE A;  3AMZ A;  1G6J A;  1ZDV A;  4YTN B;  1KJT A;  1ZXH A;  2K9X A;  4JI0 H;  1XEE A;  5D7G A;  2VRR B;  2IO2 B;  2K1F A;  3AXC A;  4AJW A;  2JUO A;  3H6N A;  2JX5 A;  3SD5 A;  1FEH A;  4D2K A;  4LLG M;  1HNZ H;  4OCH A;  1XCQ L;  3PVL A;  3ZJU A;  2PY9 A;  4MJS A;  1HQR D;  2JVZ A;  1DYQ A;  1KLV A;  3VH3 B;  2X8X X;  1E0Z A;  2QDF A;  3I3T B;  1WTJ A;  2V3S A;  2JRH A;  2O6V D;  3PRM B;  2K8B A;  4NZR M;  4NQK E;  1J5E H;  4FXC A;  1NI3 A;  2KOX A;  2KDM A;  3U7D A;  3ZO5 B;  4AUQ C;  4LNN A;  4HPM B;  4MEM A;  1UBQ A;  2P2R A;  2IGG A;  1DTJ A;  5BMG A;  4ANV A;  4A20 A;  2O6V A;  1GJZ A;  3UQA A;  1N34 H;  2VZK B;  3ZW3 A;  4PK1 A;  3Q8C A;  3Q14 C;  1FCL A;  1E6E B;  2KO3 A;  1RFK A;  4KZC A;  3KDK A;  2KC2 A;  1VZ7 A;  4R3D A;  4K0K H;  1WGH A;  1I94 H;  2CHW A;  2K22 A;  4MH0 E;  3RI7 C;  2CJN A;  2M8S A;  2DX5 B;  3U2S C;  3PO0 A;  3AN1 A;  4BKG A;  1WM3 A;  2HDE A;  4DR3 H;  2ZM6 H;  2KVR A;  4M00 A;  1WGD A;  4M8M A;  4JWS C;  1CK1 A;  2MWS B;  1VDV A;  1GG3 A;  1V9J A;  1AYF A;  2KFK B;  2IPK D;  4GMV A;  3AE9 B;  1V1P B;  2NBW B;  1P7F A;  1GNU A;  3W1Y A;  1WE6 A;  3QAQ A;  3VVW B;  2I38 A;  1UWM A;  2TSS A;  1WY8 A;  4HRS A;  2WX1 A;  4ARI A;  1TY2 A;  2RD0 A;  3DBH I;  1NEK B;  3QA8 A;  4EC5 A;  4JQW C;  1UUP A;  4FBJ B;  2PKO A;  4IWQ A;  3M63 B;  1V8C A;  2NBV B;  3A1Q A;  2HJ8 A;  4GKJ H;  2E3T A;  3A33 B;  4JI5 H;  1FMA D;  2Q5W D;  1J7A A;  5D3D A;  1DOX A;  1ZUD 2;  4IKG A;  4E74 A;  5D3I B;  2V1Y A;  4EUT A;  4TQ1 A;  4JI7 H;  4MGI E;  4GN1 A;  4JPS A;  2OJR A;  4LF6 H;  1MPE A;  2JXT A;  5E6P A;  3JVZ X;  1JML A;  3LYY A;  3SB1 A;  1FJG H;  4OVU A;  4RFB A;  1OEY A;  1K51 A;  2JWZ A;  1JQ4 A;  1MG8 A;  1V6E A;  3MP9 A;  4C7Y A;  3URY A;  2J7Q B;  2KJ6 A;  1QKZ A;  2G45 B;  3S2A A;  3PS6 A;  3ZXV A;  4LNF A;  2DZK A;  2FCS A;  4IDI A;  1Z5S B;  1QLB B;  2ACZ B;  3N1X C;  1TS2 A;  2UXD H;  2MCN B;  2MBB B;  2GLS A;  3JYU A;  3RFZ B;  2FFM A;  4JI4 H;  3EFU A;  3NZ3 A;  5JH5 C;  2G4D B;  4XX5 A;  4DV5 H;  4BBN C;  4YY3 H;  5IT9 W;  3V69 A;  4MM3 B;  1GB1 A;  2E3U A;  2PPH A;  4ANU A;  4MDK E;  4S17 A;  2BL5 A;  4LIJ A;  3V61 A;  4FN2 A;  3EA6 A;  3P1M A;  4K7S A;  3N30 A;  4WUR A;  2HH2 A;  4DUY H;  3U30 A;  1PGA A;  1QIL A;  1Z2M A;  2O6V B;  2WLB A;  4W9J A;  4C4V B;  4EOY A;  2K5P A;  4PS8 A;  4W9C A;  1B1Z A;  3AEB B;  4WAF A;  4GXB A;  2D9I A;  1C3T A;  4MGK E;  1Q0W B;  3SFE B;  2JZP A;  1EC6 A;  2NMQ A;  2CPQ A;  1F0Z A;  2ZCB A;  4X66 H;  3N1Z C;  5G2N A;  1JCK B;  3OSS D;  1DT4 A;  4IW0 A;  4JE3 B;  3V05 A;  1ISN A;  5IP4 D;  2FMR A;  1DOI A;  1L6U A;  1L4Z B;  4G08 A;  1PFD A;  2J0J A;  2LUE A;  4HPL B;  1F0X A;  1XRH A;  1LQB A;  1N62 A;  2LXC A;  1I4P A;  1YQ3 B;  2DAJ A;  3R3M A;  2WXF A;  3ONS A;  3MFG A;  1XT9 B;  1YJJ A;  3DWG C;  4RMA A;  4E3C A;  3RN9 C;  3DVG Y;  2GMI C;  2BTE A;  2ONQ A;  3T3N A;  1HTQ A;  3J81 W;  2K1H A;  2NTS A;  3VFK A;  3H9D A;  1WE7 A;  3TMP B;  1JRU A;  2LGI A;  3IBE A;  3SFD B;  2BB5 A;  4LK0 M;  2NCN A;  1OQR A;  2N7E A;  3HRD D;  3SHQ A;  4B0M A;  3RD2 A;  4JLC A;  3QQ8 B;  4HCP B;  3OTO H;  3UOE A;  3ZYY X;  3P63 A;  4YTM B;  4ZHP A;  4JVY A;  2J4X A;  1X9Z A;  3QC8 B;  2INC C;  2VQE H;  1ZW7 A;  2N7J A;  4ZRP A;  4EZL A;  3DHH C;  2NVU I;  1VBI A;  1OQY A;  3AE2 B;  4DV3 H;  1KFY B;  4W9K A;  2M19 A;  2PJH A;  2FE8 A;  2L05 A;  4F7Z A;  4WWM A;  3VTV A;  3Q3F A;  2UU7 A;  5HG2 A;  1UGJ A;  1FXA A;  3GZN I;  5BYQ A;  2A4Z A;  3BK2 A;  2WGS A;  4KVG B;  2KVZ A;  3W5V B;  4CQN A;  3FAH A;  5JEA G;  1S03 G;  2KWU B;  1C1Y B;  2LZ6 A;  1RFA A;  2F4V H;  4LDT B;  2SAK A;  1TIF A;  4BVU C;  4F1S A;  3WA0 A;  3CST A;  1UBI A;  1M4V A;  3HM6 X;  5CHW A;  4FJU A;  5DCN A;  1KM7 A;  2KQS A;  3H7S A;  2K6D B;  2WU2 B;  4DR4 H;  4RH6 A;  2UUA H;  2D3C A;  3M62 B;  4PYU A;  4YTP B;  2JPH A;  2GBK A;  2MRP A;  1X4N A;  2WDV B;  1FNV A;  5EE0 A;  1ZGU B;  1J19 A;  3ZXR A;  1Y8R C;  1C79 A;  4HLE A;  1MJD A;  2LHD A;  4I6L B;  4A55 A;  5D2M B;  4DHJ D;  1ACC A;  4OVZ A;  2BS4 B;  2QMT A;  5G55 A;  1IBX A;  3ZJV A;  2LTM A;  4DBG A;  1FKA H;  4IM3 A;  3N1Y C;  4XZ4 A;  1TS3 A;  3ZNZ B;  1QT9 A;  2WP9 B;  2ZW1 A;  2LD9 A;  1BUI C;  3AV8 A;  5D94 A;  2MA9 B;  3WAN A;  3DVN U;  3DCG A;  1AN7 A;  5EE9 A;  3PTF C;  4FJY A;  3DBL I;  3RYT A;  3DVG X;  3GOE A;  4GDL A;  1A70 A;  1C4C A;  2M17 A;  5D6J B;  5A2Q W;  4NJC A;  3C8Y A;  1XLN A;  2N9K A;  2D10 A;  2LRR A;  3IHP C;  2RMM A;  1XQQ A;  2KTR A;  1JWM D;  2D5G A;  3NVZ A;  4HXD A;  1XNQ H;  2LRW A;  1GC7 A;  1WXA A;  5LMN H;  4JI3 H;  1UF0 A;  2BWE S;  1A5R A;  2ZPN A;  1Q10 A;  1H8C A;  2ANR A;  1S1Q B;  1K53 A;  2L7R A;  2W9N A;  2GBR A;  2L0T A;  5K36 G;  2KFK A;  4IM2 A;  3VUX A;  4KGR A;  2RDH A;  1RYJ A;  3BYY B;  4TUU A;  4NJ7 A;  4HPP A;  1STE A;  2GOW A;  3CWI A;  5DPS A;  1R4M B;  2DYM A;  2I1K A;  1SE3 A;  1FPY A;  1RM6 C;  3X0W A;  3D32 A;  3NS1 A;  3I5J C;  3AB5 A;  2NR2 A;  2GBJ A;  3HIZ A;  4WQO B;  4JYA H;  3R66 C;  5BMH A;  4DR5 H;  4II2 B;  1VCB A;  3ZQ4 A;  1HEZ E;  4M0W B;  3H7P A;  1WVN A;  1IPG A;  3B2G A;  2JF5 A;  4IUM B;  2CJO A;  4W9H A;  2M1M A;  4WJO A;  3PT2 B;  1V49 A;  3A1Q B;  1E9M A;  4OW0 A;  1X0A A;  1WHR A;  2ZCC A;  1KRH A;  4IWP A;  2K0P A;  3W9C B;  1JRO A;  2E6X A;  3EZJ A;  2JEB I;  1C77 A;  4M01 A;  1K52 A;  3DBL B;  2AQ1 B;  5IWA H;  2EEL A;  2NBU A;  5IKC M;  3TSS A;  4AP4 C;  2JU6 X;  1XMQ H;  2KQ7 A;  2JT4 B;  4GU2 A;  2N9P C;  3GE8 C;  2CHX A;  4J3O D;  2CTJ A;  4EKU A;  1WXS A;  1JWU D;  1F2R C;  1I42 A;  2MH7 A;  4EE2 A;  4JI2 H;  1OQQ A;  2LRU A;  2DWQ A;  1AW7 A;  1VIH A;  2XEW A;  1JWB D;  1HZ5 A;  4OZA A;  4PS3 A;  5TSS A;  2VH2 A;  3JAM W;  1MHH E;  2ZQE A;  3CMM B;  3J80 W;  3AU5 A;  2L0F A;  2N1V A;  2GB1 A;  3MJW A;  3RMK C;  2AEH A;  1AAR A;  4WQM A;  5FLX W;  3A9K A;  4RCO A;  3MHS D;  1L0Y B;  1Q1O A;  2KDI A;  2OED A;  4CHK A;  4ZOH C;  1EWC A;  2VKC A;  1LFD A;  5J17 A;  2IGD A;  1TKY A;  2B76 B;  2C9W B;  3ZIM A;  4K81 A;  5BR8 H;  1R4N B;  2XK5 B;  1FD6 A;  4PT5 A;  3KUC B;  4TQ0 A;  1WZ0 A;  1GAQ B;  4A3P A;  2PE6 B;  2V3N A;  4L23 A;  1GB4 A;  2N9X A;  1C4A A;  2N4F A;  1WSP A;  1FO4 A;  2KXJ A;  2V4I B;  5AZG A;  3AUL A;  3JSV A;  4PDB A;  2K25 A;  4X65 H;  4E71 A;  1V2Y A;  4HCN B;  3V6E B;  4DV6 H;  4NY0 A;  4KSK C;  4C7Z A;  1ET9 A;  4N6E B;  4DXF A;  1TBE A;  3DVN V;  1WR1 A;  1TTN A;  4B3M H;  1D6E C;  4HKQ A;  1N61 A;  1EU4 A;  2ZVN A;  3AE4 B;  1GUA B;  4BA1 I;  1UH6 A;  5IAA C;  3HM3 A;  4WAN A;  2A1S A;  4WJQ A;  2V4L A;  5C2T B;  4M0W A;  2IND C;  3H8H A;  4FA6 A;  1WIA A;  5CX3 A;  5JHB A;  3AI5 A;  1IBL H;  2H89 B;  3NVY A;  2D11 A;  1VR9 A;  1WYW B;  1E7V A;  2ZEQ A;  3IFW B;  2Z0S A;  2O4C A;  2D3B A;  4W9G A;  1WXM A;  2EMT A;  5G5G A;  4KHP H;  1HXY D;  3K9P B;  2DBY A;  2PEA A;  4DHZ B;  4BA2 I;  2KWV B;  2Z0E B;  3NS8 A;  2DEN B;  4KKJ A;  2WDT B;  3VRA B;  4TKN A;  4B9K A;  1R4N I;  4I6P A;  2R61 A;  2BYF A;  3OAW A;  1WRD B;  1QQR A;  4II3 B;  5L95 C;  1FXI A;  2M56 B;  3U1K A;  2YVC A;  4NPN A;  1SJH D;  2AL3 A;  4TSS A;  1X4M A;  2RDG A;  1EF5 A;  4B0E A;  3ZRF A;  1ZOY B;  3NVW A;  1OTR B;  2R2O A;  3NZU A;  3RPF C;  3ZDT A;  2KKC A;  3Q6B A;  1TJE A;  5HI1 A;  1GPX A;  2PW9 A;  4JV5 H;  3LB8 C;  1C9F A;  1WXQ A;  3A4S C;  1E7P B;  4USA A;  2C7N B;  2KQ4 X;  4GKK H;  2X38 A;  3IT4 B;  1NDD A;  3L10 B;  4KDL B;  2WQY B;  3VR8 B;  4JGH B;  3KWV A;  4AS1 A;  1KOT A;  2G1E A;  2PLP A;  1UNS A;  1PGB A;  1ZZI A;  1F2R I;  3DQV A;  1OEY J;  3C19 A;  4US9 A;  1SIF A;  3ZNI D;  2Y5P A;  3DOW A;  3VH4 B;  5EE3 A;  4MSQ B;  1RAX A;  2IJ0 A;  3PRZ A;  2MJ3 A;  2PTL A;  1OGW A;  4J6I A;  2D3G A;  3MC9 A;  2MP2 A;  2RPQ A;  2JZX A;  2CPM A;  1D5X C;  3IT6 B;  4DV1 H;  1SXT A;  3ABV B;  3RUI B;  2ICI A;  2AQ2 B;  4WWO A;  4DXG A;  5LXH A;  4MM3 A;  5JHA A;  2C5L C;  5GXG B;  3I9V 1;  4HRO A;  4OVV A;  1D5Z C;  4PS7 A;  2KLG A;  4KIK B;  1WGG A;  4ZHO A;  2JSV X;  2FUH B;  2QIL A;  5G5H A;  1V5T A;  4NZL B;  4B95 A;  4K1R B;  4P6V F;  4BAX A;  1F77 A;  5KHQ A;  5CHF A;  2W3R A;  3Q3M C;  3V62 A;  2WXL A;  1WM2 A;  3L54 A;  2MBH A;  2IDY A;  3EUB 2;  5H8Y E;  4DR7 H;  3ML9 A;  1CQV A;  1GOZ A;  3Q8E A;  2HTM E;  4ARC A;  3R2T A;  4RGM A;  3KDG A;  3AE3 B;  5HFY A;  2JY6 A;  3MHZ A;  2V9H A;  4JVH A;  1KTK A;  4CO7 A;  2YEP F;  4YSZ B;  5GMV A;  3AE5 B;  3LJ3 A;  1HA5 A;  5BMI A;  3ZNG C;  4P1B C;  1C4P A;  4DXA B;  3AE1 B;  4FJS A;  2DZJ A;  4YSY B;  5CHV C;  3JW0 X;  4YXD B;  3RNC C;  2J53 A;  3KLS X;  1N5W A;  4HDO A;  3VXW A;  2LGS A;  4X57 B;  4WIP A;  1YOV B;  4MEL A;  2DLB A;  2KT7 A;  2BW2 A;  2LF0 A;  4C00 A;  2BYE A;  3NZS A;  3T9L A;  2KN4 A;  1IBK H;  1J0G A;  1IGC A;  3DBS A;  1HZ6 A;  1WXV A;  2VH1 A;  3UIP B;  4US8 A;  4DWF A;  2KZR A;  1MHX A;  4C56 C;  3GB1 A;  1RRB A;  4NAW B;  3Q8B A;  2ON8 A;  2V0G A;  2QJL A;  3PGE A;  2WNM A;  4DDI D;  1WMH A;  4P1C C;  3CSF A;  4AOF A;  4K3C A;  1S3S G;  3GR5 A;  3AEF B;  3EFC A;  4TV3 A;  1QF6 A;  4WWP A;  2N1W A;  4N9F 4;  2I2Y A;  5BYS A;  1WMH B;  4LF4 H;  2LUM A;  2DZM A;  5DT9 A;  3NG0 A;  1R7S A;  4OD6 A;  1XNR H;  1N5X A;  4WH4 A;  5LL6 b;  4X62 H;  3L16 A;  2BYV E;  2FID A;  2E5L H;  2OPU A;  4BFR A;  2G4S A;  3KUZ A;  2ZNV C;  1I7H A;  4F8C B;  1ET6 A;  4M02 A;  2BS3 B;  1N63 A;  3QCA A;  3X23 A;  2OOB B;  4G0N B;  4FHK A;  3TJP A;  4A8X C;  4JX1 C;  2AXY A;  2BF8 B;  2QSD A;  2LGD A;  2BGF A;  5AZF A;  2BVC A;  1TZO A;  1NEN B;  2IYD B;  2J0K A;  3BYT B;  4WWN A;  1IBX B;  1HR0 H;  4MT5 A;  4IM0 A;  3SR6 A;  3NCV A;  4RF0 A;  5C23 A;  1XLO A;  2AQ3 B;  1WRI A;  1I4X A;  3OLM D;  3BY4 B;  3OET A;  2W3S A;  3AE6 B;  1WE8 A;  5C3J B;  2FPH X;  1NXU A;  2PQU A;  2ZNV B;  1ZZK A;  1UGM A;  1J5K A;  2KDB A;  1YN5 A;  1WGR A;  3VAW A;  3BII D;  3TBL D;  2L83 A;  1QOF A;  2CU1 A;  1SEI A;  4OZB A;  3VTW A;  1FRR A;  4C80 A;  2HHH H;  1V81 A;  3ETR A;  2G8Y A;  2MQJ A;  1VLB A;  2KX0 A;  4AM3 A;  2HJ1 A;  4ZRQ A;  4W9F A;  1DGJ A;  3FIL B;  4LJP B;  3L13 A;  3U7Z A;  1V86 A;  5LLI A;  1QOG A;  2WXR A;  4DV2 H;  4BKS A;  2JYT A;  1U4A A;  1YQ4 B;  2ASQ A;  3L08 A;  3TEW A;  1E8W A;  1PYW D;  1T3Q A;  1BXT A;  2IGH A;  2N9L A;  4MSM B;  1PQS A;  3H7P B;  1DOY A;  4DHJ B;  4DK5 A;  2KAC A;  2N7D A;  2HH3 A;  3MTN B;  1EO6 A;  3N32 A;  1SB3 C;  2L8J A;  1T6B X;  2RDB C;  2IO0 B;  3TEZ A;  3NJT A;  1N32 H;  2KWD A;  1WJ4 A;  3ZTC A;  3AEC B;  4IOI E;  2DHZ A;  2LTL A;  2DNF A;  2WU5 B;  3DDC B;  3QIJ A;  2KAJ A;  2BWF A;  2NPT B;  3VRB B;  1WYG A;  3A9J B;  2H88 B;  4AWJ A;  2FIF A;  3KQ4 A;  1YN3 A;  4JL9 A;  3W1S C;  1P3Q U;  1V97 A;  1P9D U;  1I4R A;  2DAF A;  2L76 A;  3AED B;  2KFJ A;  1WJU A;  2CTK A;  1Y56 A;  3BK1 A;  4GDK A;  1YNT E;  1XXG A;  3L0W B;  1XMO H;  2LMC A;  3A9K B;  4GGQ A;  4HVB A;  3ZRC A;  3M95 A;  1NBF C;  2OHF A;  4K7U A;  1VZ8 A;  3VUY A;  2O2V B;  2Y3A A;  1CJE A;  1SGH A;  2BPS A;  3HUI A;  4ITK A;  3PHX B;  1V5O A;  1ESF A;  1WI0 A;  2CTF A;  3ENE A;  4EFO A;  4DR6 H;  2C60 A;  4CYE A;  1BT0 A;  5T8I A;  3PZ7 A;  2MSE D;  2PE9 A;  4S0R A;  2FBW B;  2GBM A;  4JWU C;  3APF A;  3Q3J A;  3O65 B;  3RF2 A;  1E8Z A;  1ZXI A;  4XYC A;  3DHG C;  4QMF B;  3ECI A;  2WXI A;  2MEK A;  2X06 A;  4KIK A;  2WXH A;  2MP2 B;  4I6N B;  3APC A;  4FJZ A;  5C0X G;  3ZNH B;  2M0X A;  4RGN A;  2AYO B;  2D2Q A;  1KHM A;  1TS5 A;  1LXD A;  3AEE B;  2YLM A;  1F1H A;  1I4Q A;  3BIN A;  3CF6 E;  1ODH A;  1FNU A;  2MJE A;  3HVD A;  3AE8 B;  2CHZ A;  2CS4 A;  4LFC H;  3PSE B;  3GP7 A;  4FAD A;  5E6N A;  1J7B A;  1I6U A;  3FKY A;  4B6W A;  3ZDM C;  1VD2 A;  2K6Q A;  2RSU A;  4G50 A;  5AUI A;  2XBB C;  3Q3O C;  4RF1 A; 
#chains in the Genus database with same CATH homology
 1I4P A;  1YQ3 B;  5EE1 A;  3IT4 B;  2WXF A;  2BT6 A;  5FR3 A;  2WQY B;  3VR8 B;  3MFG A;  4A9A A;  2L1A A;  4AS1 A;  3KWV A;  2G1E A;  3BVM A;  3UI3 A;  5I4D A;  1YJJ A;  1UNS A;  1PGB A;  2PLP A;  3DWG C;  1F2R I;  2AX5 A;  1PGX A;  3VR9 B;  2BTE A;  4US9 A;  3DWM A;  1YJI A;  2ONQ A;  2PMV A;  5H92 C;  2Y5P A;  3T3N A;  1J7C A;  3PZ8 A;  1OFF A;  5EE3 A;  2NTS A;  2IJ0 A;  2MJ3 A;  2LGI A;  3SFD B;  4O1N A;  2BB5 A;  4LK0 M;  2PTL A;  1SIJ A;  3CIR B;  1OQR A;  3HRD D;  2BYT A;  1P7E A;  1ZP0 B;  4B0M A;  2WXP A;  1TS4 A;  1D5X C;  2CU3 A;  1ZDX A;  3IT6 B;  3U4E G;  4AQ7 A;  1SXT A;  3ABV B;  5AUK A;  2ICI A;  2AQ2 B;  1SE2 A;  3ZYY X;  2QEJ C;  4XWW A;  1ZPS A;  3P63 A;  4OZC A;  4YTM B;  4ZHP A;  4KX6 B;  4DXG A;  2J4X A;  1VZ6 A;  3HVZ A;  1CZP A;  2N7J A;  4ZRP A;  5FKA C;  5GXG B;  3I9V 1;  4HRO A;  4N58 A;  1V1O A;  3AH7 A;  1D5Z C;  3P42 A;  3AE2 B;  4YWG G;  1KFY B;  3R8B A;  2M19 A;  1ENF A;  4ZHO A;  2FE8 A;  2J52 A;  2JSV X;  4MH8 A;  4XDD A;  4WWM A;  1EWY C;  1PUT A;  1FNW A;  2WXN A;  4A6Q A;  5HG2 A;  1UGJ A;  1FXA A;  2QIL A;  5BYQ A;  5G5H A;  4NZL B;  3BK2 A;  4P6V F;  3GS2 A;  3N9Y C;  1F77 A;  3W5V B;  4CQN A;  3FAH A;  1FFU A;  5BYR A;  4L1B A;  2W3R A;  2SAK A;  3SEB A;  1TYG B;  2VZK D;  2WXL A;  3IAM 1;  2L52 A;  1M4V A;  1XO3 A;  2IDY A;  3EUB 2;  5H8Y E;  1FIQ A;  4NAM A;  1VJK A;  3Q69 A;  2INP E;  1CQV A;  1GOZ A;  3P4S B;  3Q8E A;  2WU2 B;  2HTM E;  1L0V B;  4GDL B;  1MVK A;  4ARC A;  1SEB D;  3R2T A;  4RH6 A;  1JW9 D;  4RGM A;  4KGS A;  3AE3 B;  5HFY A;  1IUE A;  3MHZ A;  4RGO S;  3L4P A;  1TKG A;  3IAS 1;  1KTK A;  3W2D A;  4YTP B;  2GI9 A;  3BVG A;  2WDV B;  2YEP F;  4YSZ B;  3AE5 B;  1FNV A;  4XDC A;  5EE0 A;  3B2F A;  2MJD A;  1HA5 A;  1ROE A;  5BMI A;  1C79 A;  5HHD G;  3TEY A;  1C4P A;  2LHD A;  2FUG 1;  3VQI A;  1SJE D;  4A55 A;  3AE1 B;  1ACC A;  4OVZ A;  3NUH B;  4YSY B;  2BS4 B;  2QMT A;  1IBX A;  1KH0 A;  3ZJV A;  4YXD B;  3AEA B;  3KWL A;  1D5M C;  2J53 A;  1KF6 B;  1UWX A;  1N5W A;  3KLS X;  1TS3 A;  2BBC A;  4Q2J A;  4WIP A;  2ZW0 A;  2DLB A;  1KLU D;  2BW2 A;  2J42 A;  1QT9 A;  2WP9 B;  2ZW1 A;  2KN4 A;  2LFI A;  2Z8L A;  3LXF A;  1IGC A;  1BUI C;  1HZ6 A;  3AV8 A;  3OWE B;  4RGT A;  4US8 A;  1EU3 A;  1MHX A;  5EE9 A;  4C56 C;  3GB1 A;  4UDU C;  3ZGZ A;  4NAW B;  3MC0 B;  3Q8B A;  2ON8 A;  2V0G A;  1SF0 A;  2JQR B;  2QJL A;  2WNM A;  1A70 A;  1C4C A;  4DQO C;  1XF5 L;  4NJC A;  3C8Y A;  4P16 A;  1XLN A;  2N9K A;  1L5P A;  3W5U B;  4GLS C;  1QOB A;  2G9H D;  2RMM A;  3Q8F A;  1AN8 A;  2WDQ B;  3TUO A;  2WXK A;  1JWM D;  2D5G A;  3AEF B;  3NVZ A;  2DYO A;  3AE7 B;  1C78 A;  1QF6 A;  1QOA A;  2I2Y A;  1L0X B;  4XE0 A;  5BYS A;  2LUM A;  1I4H A;  2LHE A;  2K3U A;  1Q10 A;  4GDK B;  3FC4 A;  1E10 A;  1B9R A;  1K53 A;  1R7S A;  3O13 A;  5JXV A;  1ZE3 D;  1N5X A;  4WH4 A;  4HEA 1;  1MI0 A;  2XN9 C;  4KGT A;  1FCC C;  4L2Y A;  1WWT A;  3AEG B;  4REZ A;  1TY0 A;  4KGR A;  2RDH A;  1RYJ A;  4A90 A;  1JRP A;  1V1P A;  3BYY B;  1I7H A;  3IXS A;  3MJ5 A;  3P4Q B;  1ET6 A;  1STE A;  2BS3 B;  1TKE A;  3CWI A;  3AMZ A;  1N63 A;  3FIL A;  2DYM A;  1ZDV A;  1SE3 A;  4YTN B;  3E9S A;  1ZXH A;  1JWS D;  1RM6 C;  2K9X A;  2WXG A;  3NS1 A;  3AB5 A;  4A8X C;  1XEE A;  4JX1 C;  2W54 A;  4TMA B;  2PIA A;  5BMH A;  5D7G A;  4ZYS A;  3ZQ4 A;  2QIE B;  1HEZ E;  2JX5 A;  2QSD A;  3B2G A;  1T5X D;  1FEH A;  4D2K A;  4LLG M;  2CJO A;  1XCQ L;  1TZO A;  1NEN B;  1E9M A;  3ZJU A;  1XLQ A;  4OW0 A;  3R2I A;  1HQR D;  3BYT B;  1KRH A;  2BS2 B;  5E6J A;  2W55 A;  1IBX B;  1DYQ A;  4MT5 A;  2K0P A;  3W9C B;  1JRO A;  2E6X A;  2INN E;  3SR6 A;  1C77 A;  1E0Z A;  3TEX A;  4RF0 A;  1K52 A;  1XLO A;  2AQ3 B;  1SE4 A;  1WRI A;  1I4X A;  2AQ1 B;  2EEL A;  2SEB D;  2W3S A;  3AE6 B;  3TSS A;  4FXC A;  1NI3 A;  2JU6 X;  5C3J B;  2KDM A;  1YN4 A;  1VRA B;  2IGG A;  5BMG A;  3NVV A;  2PVO D;  1IGD A;  4J3O D;  2VZK B;  3NRZ A;  1L4D B;  3P4R B;  1YN5 A;  2M0A A;  1JWU D;  3Q8C A;  1FCL A;  1F2R C;  1E6E B;  4LTU A;  3BII D;  1RFK A;  2MH7 A;  4EE2 A;  2L83 A;  1QOF A;  1OQQ A;  1VZ7 A;  3P4P B;  4OZB A;  2DWQ A;  4R3D A;  3T3O A;  1FRR A;  4C80 A;  1AW7 A;  2N0S B;  3ETR A;  1JWB D;  1K50 A;  2PVG C;  1FRD A;  1VLB A;  2K22 A;  1HZ5 A;  2CJN A;  1I4G A;  4OZA A;  4ZRQ A;  5TSS A;  3U2S C;  3PO0 A;  1MHH E;  1DGJ A;  3FIL B;  3AN1 A;  1WGK A;  3U7Z A;  1KLG D;  2HDE A;  1N60 A;  1QOG A;  2GB1 A;  2WXR A;  1PDX A;  3U52 E;  2Y5C A;  2JYT A;  4WQM A;  1YQ4 B;  4RCO A;  1L0Y B;  3TEW A;  2LEK A;  2OED A;  1PYW D;  1T3Q A;  1BXT A;  2IGH A;  4ZOH C;  1EWC A;  2N9L A;  3BZD B;  1DOY A;  4JWS C;  2KAC A;  4N59 A;  1YMH E;  1CK1 A;  2IGD A;  1TKY A;  1VDV A;  1SB3 C;  3W1S A;  2B76 B;  3B9J A;  2JWU A;  1AYF A;  1T6B X;  1BML C;  3TEZ A;  2IPK D;  1FD6 A;  4PT5 A;  3AE9 B;  1V1P B;  2KWD A;  1D4B A;  2WDR B;  1P7F A;  1AWD A;  3AEC B;  5LNK 1;  1LO5 D;  4TQ0 A;  4IOI E;  1RWS A;  1GAQ B;  1XLP A;  2WU5 B;  2WXO A;  2I38 A;  2KAJ A;  1UWM A;  2TSS A;  4XWT A;  4HRS A;  2V3N A;  4ARI A;  1TY2 A;  3VRB B;  1WYG A;  4L23 A;  1NEK B;  2H88 B;  1GB4 A;  3AM9 A;  1C4A A;  1UUP A;  2RPV A;  3KQ4 A;  1WSP A;  4YT0 B;  1FO4 A;  4RNA A;  1YN3 A;  1V97 A;  1XCT L;  2PKO A;  2V4I B;  1I4R A;  1V8C A;  5MPO A;  2E3T A;  1FMA D;  2Q5W D;  1J7A A;  5D3D A;  1DOX A;  3AED B;  1ZUD 2;  4IKG A;  3V3X A;  3Q8A A;  5D3I B;  2JYE A;  1Y56 A;  3BK1 A;  1NYQ A;  4TQ1 A;  2V3P A;  1JWA D;  3I57 A;  4YSX B;  3E56 A;  1ET9 A;  1FM0 D;  4C7Z A;  4JPS A;  1EM7 A;  1MPE A;  4N6E B;  2JXT A;  4DXF A;  1YNT E;  1XXG A;  2LMC A;  1D6E C;  4H2A A;  4HKQ A;  1N61 A;  1JML A;  3LYY A;  4RFB A;  2KMM A;  1EU4 A;  3AE4 B;  3ZJT A;  1K51 A;  2OHF A;  1JQ4 A;  3MP9 A;  4C7Y A;  1VZ8 A;  2Y3A A;  3URY A;  5FK9 C;  5C2T B;  1QKZ A;  4M0W A;  2YEP B;  1CJE A;  1NYR A;  3HUI A;  3H8H A;  4ITK A;  2H89 B;  2L32 A;  1ESF A;  2EKI A;  3NVY A;  1VR9 A;  1FFV A;  4IDI A;  4OHJ A;  1QLB B;  5T8I A;  2ACZ B;  2GRI A;  4KKI A;  3PZ7 A;  3WCQ A;  1TS2 A;  1SBB B;  1L6V A;  5G5G A;  3RFZ B;  1HXY D;  2BB6 A;  2DBY A;  3NZ3 A;  2WXJ A;  3BWU D;  2FBW B;  4JWU C;  4KKJ A;  4MM3 B;  1ZXI A;  1GB1 A;  3VRA B;  2WXI A;  4MAC A;  2MEK A;  2R61 A;  3EA6 A;  2WXH A;  1QQR A;  3P1M A;  4WUR A;  3BVZ A;  1PGA A;  1FXI A;  1QIL A;  4HKZ E;  2WLB A;  2K5P A;  2M56 B;  4RGN A;  2W82 A;  2NTT A;  1B1Z A;  3J9C A;  1TS5 A;  3AEB B;  4WAF A;  3AEE B;  1I4Q A;  2WS3 B;  1SJH D;  3SFE B;  1FNU A;  2JZP A;  2MJE A;  3HVD A;  4TSS A;  2NMQ A;  3AE8 B;  3EGR A;  1F0Z A;  2RDG A;  4B0E A;  1ZOY B;  1SSN A;  3NVW A;  1JCK B;  1NVI D;  3RPF C;  2WXM A;  3GP7 A;  1TJE A;  4JE3 B;  3V05 A;  1J7B A;  5HI1 A;  1GPX A;  2PW9 A;  1DOI A;  1C76 A;  1L6U A;  2WXQ A;  4HJG E;  1L4Z B;  2LJI A;  3LB8 C;  1PFD A;  1C9F A;  1WXQ A;  1E7P B;  4USA A;  5AUI A;  2XNA C;  1N62 A;  4RF1 A;  2KQ4 X;  2X38 A;  1JAL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...