1V8CA

Crystal structure of moad related protein from thermus thermophilus hb8
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
165
structure length
165
Chain Sequence
PKVNLYATFRDLTGKSQLELPGATVGEVLENLVRAYPALKEELFEGEGLAERVSVFLEGRDVRYLQGLSTPLSPGATLDLFPPVAGGGFERTFGAFPPWLLERYLEEWGGTREGEGVYRLPGAVVRFREVEPLKVGSLSIPQLRVEVEGEEAERWFERIAFAASR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords MoaD related protein
publication title Crystal Structure of MoaD related protein from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
total genus 47
structure length 165
sequence length 165
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02597 ThiS ThiS family
A PF09189 DUF1952 Domain of unknown function (DUF1952)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1v8cA01
3.30.1370.80 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Molybdopterin cofactor biosynthesis MoaD-related, C-terminal domain 1v8cA02
1A70A 1FO4A 1V8CA 1SIJA 2W3RA 3EUB2 1RWSA 1IUEA 4WWMA 2JQRB 3AEAB 4YTMB 2CJNA 3AEBB 1YQ4B 4A9AA 5H92C 3VRBB 1T3QA 2KAJA 1OQRA 1ZOYB 1WGKA 1FM0D 1ZXIA 1KFYB 1E6EB 1VDVA 4JWUC 1GAQB 4YTPB 1L0VB 2LEKA 4YSXB 4HRSA 2WP9B 1GPXA 3P63A 1E9MA 4HROA 2QJLA 1YJIA 3HRDD 1UWMA 3P4QB 1QOAA 2KMMA 1ROEA 1V97A 4KX6B 3ABVB 2M56B 1WWTA 1KF6B 2AX5A 2B76B 1FFVA 3CWIA 3NVWA 3P4PB 1DOXA 3AE3B 4WQMA 1QLBB 2MJEA 2Q5WD 5AUIA 3AE6B 1JQ4A 1QOFA 2BS2B 1RFKA 1ZUD2 4JWSC 5AUKA 3AE9B 4YSYB 2L83A 5MPOA 1RM6C 1WYGA 4LTUA 1F0ZA 1JWBD 1PUTA 1NENB 1AYFA 2BS3B 1AWDA 3AE1B 3AEEB 3ETRA 3LB8C 3RPFC 3DWMA 1NI3A 1QOBA 2CU3A 2ACZB 2EKIA 1CJEA 3HVZA 2K5PA 1EWYC 4US9A 3PO0A 1L6VA 5C3JB 4ITKA 4ZHPA 2WS3B 3W9CB 3AV8A 1NVID 5G5GA 1N5XA 2JX5A 2QIEB 1TKYA 1N63A 2DBYA 2BS4B 1NYRA 1FXIA 1XLPA 2FBWB 3B2FA 2K22A 4C7ZA 1PDXA 1SB3C 1J7AA 1FMAD 2CJOA 2MJ3A 2W55A 2WDRB 2WQYB 3AB5A 1DGJA 1E7PB 1JALA 4N58A 2DWQA 4ZHOA 1B9RA 1YQ3B 2PVOD 3AEFB 1ZP0B 2N0SB 2L52A 2PIAA 1E10A 1XLOA 2E3TA 2W3SA 4YT0B 3SR6A 1N60A 3W5UB 1TKGA 1TJEA 3AMZA 1FRDA 3AM9A 1N61A 3B9JA 1TKEA 1WRIA 3WCQA 3W5VB 3NVVA 4FXCA 1QF6A 1DOYA 3P4RB 2HTME 2MJDA 3AE8B 2WDVB 3NVYA 4N6EB 3AH7A 5EE9A 1NYQA 1SF0A 1VJKA 2OHFA 2H88B 3CIRB 2Y5CA 1OFFA 3AE2B 5H8YE 4IDIA 4C7YA 4YXDB 1JROA 2H89B 3NRZA 3NS1A 4US8A 1R7SA 3DWGC 1J7CA 2MH7A 3BIID 4ZOHC 1JRPA 1XLQA 5G5HA 3SFEB 3FC4A 3ZYYX 3AEGB 3AECB 1OQQA 1DOIA 3L4PA 1L5PA 3VRAB 2WU2B 1WXQA 1FIQA 3AE7B 2WDQB 1VLBA 3LXFA 3P1MA 1QOGA 4USAA 1YJJA 1J7BA 1PFDA 5EE0A 3AE4B 4YSZB 1E0ZA 5EE3A 1FFUA 1FRRA 1QT9A 3VR9B 3AEDB 1I7HA 3VR8B 2W54A 3AN1A 4YTNB 1TYGB 4C80A 3B2GA 3HUIA 1N5WA 2M19A 3KWLA 1L6UA 2G1EA 1XLNA 1KRHA 3FAHA 3P4SB 2BT6A 3SFDB 1CZPA 3NVZA 1JWAD 4JX1C 2PKOA 2WLBA 1N62A 5EE1A 5GXGB 4N59A 3AE5B 2K9XA 1JW9D 2WU5B 1XO3A 2PVGC 1RYJA 5C2TB 4P6VF 1FXAA 1NEKB
chains in the Genus database with same CATH superfamily
4MACA 3AU4A 1V8CA 3ZQ4A 2CJNA 4HXDA 2D07B 4G0NB 3VRBB 2G4SA 1TBEA 1YOVB 1D5ZC 4XE0A 2WXNA 2FUG1 4YSXB 3BZDB 1K51A 3KUZA 2NR2A 4E71A 4HROA 1Y8RC 4BKGA 1P3QU 4IM0A 1WMHA 1TS5A 3EA6A 1YN3A 2V3NA 2Z0SA 3ZDTA 2BS2B 1UWXA 4JI8H 4IM2A 3KWVA 1WYGA 1JWBD 3SHQA 4LK0M 3DWMA 3ZW3A 2C60A 2G4DB 2PLPA 4EFOA 3S2AA 3RF2A 3IBEA 1V81A 2JYTA 4P6VF 4RGMA 3ZXVA 3ONSA 4LF4H 4ANVA 4JYAH 3ZNID 3CMMB 4N58A 2E6XA 2EKEC 5CHWA 1H8CA 3RNFC 3ZKJC 1XLOA 3AMZA 2XNAC 4DBGA 1Q1OA 2KWVB 1WMHB 2RDBC 3NVVA 1S1QB 4IG7B 4IWOA 1N36H 3UQBA 2MJDA 4K7UA 2J4XA 4E3CA 1ZXHA 3NY5A 3DQVA 3AE2B 3QA8A 2OPUA 2KXJA 1E7UA 1F1HA 4ICUA 1UNSA 5IN7A 2IGHA 3RZWC 1FIQA 4GGQA 5D3DA 2C5LC 1I4QA 2JUOA 4LIJA 5EE3A 2WYQA 2N9PC 2KK8A 3VR8B 4KKJA 1EO6A 2KDEB 5E6PA 4JVHA 2LUEA 3VTVA 2CWFA 1XF5L 4RM9A 2K9XA 2WU5B 1YN4A 4ZRPA 2RGFA 4LF6H 1FO4A 3U7DA 1L4DB 3ML8A 3IT6B 4EOYA 2F4VH 2KN4A 1Z5SB 2L7RA 4NJ6A 3EFCA 2WXLA 1E6EB 2NVUI 2KTFA 2AEHA 1MPEA 4RF1A 3SEBA 2LHEA 2GBNA 3VQIA 1WF9A 3BVZA 2AX5A 3P4PB 3AE3B 1HZ5A 2JZPA 2Q5WD 3TJPA 4D2KA 2WXHA 1V5TA 2KYWA 5LXIB 5IT9W 2D5GA 3AEEB 4F8CB 4NXNH 1KH0A 4HPLB 2CPMA 5LXHA 4G50A 1WR1A 3L13A 5J2RA 1T0SC 2MRPA 3RUIB 2MBBB 3SD5A 2ZPNA 1F9JA 3QIJA 1ESFA 3K9PB 3GE3C 3DBRI 3QCAA 2JEBI 4GOCA 3B9JA 5IOIA 1WRIA 3WCQA 2A1SA 4YHHH 1EC6A 5BYRA 4FXCA 2MX2A 2KHWB 1UGMA 4KSKC 3PHXB 3KUCB 4OZBA 4EKUA 3H9DA 4BAXA 1UH6A 1STEA 4FJVB 1EU4A 2RMMA 1S03G 3RNAC 2V1YA 3VUYA 1CQVA 2WU2B 3T1HH 1I4HA 4A3PA 4USAA 1WGDA 3Q3FA 1YJJA 4K3BA 1SSNA 1X4NA 1UGJA 4JL9A 4AOFA 1L6UA 3CSFA 2NBWB 1KRHA 4GDKA 5BMIA 1CZPA 1JWAD 5EE1A 3Q8CA 1QZEA 3I3TB 2KJRA 2G9HD 5HI1A 2HH3A 2INCC 2QILA 4JWUC 1SE4A 3E56A 3NUHB 2M0XA 3GZNI 2Z0DB 2AQ2B 2LGDA 4LFCH 3Q8BA 4C00A 3N3KB 1JWSD 3QHTA 1WGRA 2WNMA 2KZRA 3FILA 1S3SG 1EF1A 4K3CA 3ZNZB 2CHZA 4JIOU 4GSWA 4WQMA 1SE3A 1JQ4A 1BT0A 4HVBA 3ZRCA 1WHRA 3QARA 3N1YC 4YSYB 4GDKB 2FCSA 1PQSA 2N7DA 4DV4H 4DR3H 4OZAA 3AE1B 1MVKA 4DK5A 3HIZA 5IKCM 3ZTDA 4MH8A 3QAQA 4E74A 2K6DB 1BMLC 4BOZB 1WR6E 2CJOA 1DGJA 4K81A 1IPGA 2IPKD 2JWZA 4FJSA 2WXKA 3VUWA 2V4IB 1I4RA 3PRMB 3FILB 3I63C 1J4WA 1NYQA 3T1YH 2PT7G 1YX5B 3PZ8A 4C7YA 3N1ZC 2KMCA 4HJKA 3R8BA 5LL6b 2L05A 4HCPB 3IT4B 4FLHA 1ET6A 2ZW0A 4LNKA 1GUAB 4NQKE 2XK5B 3J81W 1QT9A 1WTJA 2KLGA 2NBUA 3JSVA 1YQBA 5DPTA 3TMPB 2WHIA 2M19A 2BYTA 2DYMA 4OX9H 4FA6A 3QC8B 2J0KA 2LMCA 1GG3A 1I4GA 2BT6A 2JRIB 2PKOA 4F7ZA 2EELA 3A9JA 2K6QA 2KQ7A 2HDEA 4EC5A 2A5UA 2V0GA 2JVZA 1YQ4B 5H92C 1LGRA 1FD6A 2W9NA 3ZJUA 3O65B 1FM0D 3VUXA 2OJWA 1K1GA 2LD9A 1GAQB 3GR5A 2GB1A 1U4AA 3QWZB 1GPXA 2IDYA 1V1PA 3HRDD 2INNE 2LJ5A 3LDZE 1WWTA 1HR0H 2JZ3B 1D6EC 4AWJA 2K3UA 3DHHC 2FFMA 3JSVB 1MG4A 4IM3A 2UU7A 3O13A 4O1NA 3EECA 5LLIA 1GB1A 4AQYH 5G2NA 2KX3A 2RD0A 4W9CA 2DLBA 4NZRM 4MSMB 2EKIA 3U4EG 3A9JB 2MBHA 1EU3A 4XC2A 2FIFA 3GABA 4C4VA 2ANNA 3APCA 1F52A 1N63A 2LF0A 1IBXA 2ZEQA 2FBWB 2LUMA 5C0XG 1WYWB 2WDTB 2ZVOA 3AB5A 1J0GA 1C4AA 4ZRIA 5L83A 2HHHH 2Y5BB 3N32A 1V1PB 2DNFA 2N9EB 2Y3AA 2N7JA 5TR5A 1J5KA 2K39A 1QQRA 2BA0A 3MFGA 2DZKA 2KDBA 1OFFA 2R61A 3SFEB 4JI4H 2BYFA 1GC7A 2WX1A 2Z0EB 4FJZA 4EZLA 2KDIA 1OTRB 3AE4B 4REZA 3VR9B 4XDCA 3C8YA 3RI7C 3BYYB 4YTNB 4C80A 3FKYA 1WZ0A 2KKCA 5JHBA 2R2OA 5KHOA 5CX3A 3H7PA 2NCNA 5C2TB 2C9WB 2ZJDA 1PGBA 1I42A 3Q3NC 2LTLA 2VRRB 2LWPA 4DR5H 2XEWA 3EUB2 2JQRB 1LM8B 4MSQB 4LDTB 1N6ZA 1OQRA 2JYEA 2B3AA 1MHXA 2M1MA 4YTPB 4LLGM 3TEXA 3BY4B 2PE9A 2M8WA 3PGEA 5E6JA 3Q8AA 1KF6B 3U30A 1QLBB 3KW5B 2DYOA 5J18A 3NZUA 4ANXA 4BVUC 1F0ZA 3H7PB 3ZVVA 2N9LA 2DX5B 4WAFA 1QOBA 4YWGG 3RFZB 4WANA 5FKAC 4IW0A 3ZUNA 2MSED 2WXMA 1C9FA 4X65H 1TKYA 5FLXW 4HPMB 3WALA 2VQFH 1XEEA 1XCQL 2OPVA 1ZE3D 5D6JB 4DUYH 4DV2H 1P7EA 2C7NB 1HEZE 1N61A 1PQXA 2KWCA 4AQ7A 1P98A 2JA9A 4QAYA 3N30A 4YXDB 3TEYA 4DR2H 1HXYD 1C4PA 4IFDG 2LXAA 3N20C 3LXFA 3DVGY 1IBMH 4MDKE 4K7SA 1FNUA 2MW5A 2JZXA 2W54A 2BW2A 3VFKA 3KWLA 3KVFB 2CTFA 3LJ3A 1F2RC 4WWPA 1M94A 1MHHE 3Q3MC 4OHJA 1ACCA 2IBIB 5IAAC 2NBVB 4LJPB 3DHGC 2KC1A 2KVRA 2A4ZA 5CHFA 3AEBB 4LDTD 4A9AA 1V80A 5IWAH 4DDID 2KAJA 1ZOYB 4HRSA 2DZIA 3P63A 2QJLA 2K0PA 1V97A 2DYBA 1HTQA 2UXBH 5DPWA 1FEHA 2ZVNA 1OEYA 3DBRB 3RYTA 2PY9A 4DR1H 1MFWA 3L10B 1E7VA 2FCQA 2IY0B 1RM6C 3CF6E 3GS2A 2IJ0A 1X1MA 2QHOA 1XNRH 4PT5A 4US9A 4ZHPA 3W9CB 1ZDVA 1XMOH 5GMVA 4WQOB 1ZZKA 4GLSC 3V61A 2ZW1A 2RPVA 1SB3C 4KDLB 3ZTCA 2IYDB 2UU9H 2QMTA 1I6UA 3OJ3A 2BVCA 2WXPA 4I6LB 4KZCA 1EWCA 4ZRJA 3MC0B 4M00A 2HTME 2M4NA 2V9HA 2OHFA 2H88B 5JHAA 2PMVA 4WAAA 3NRZA 3PRPB 5AZHA 1LXDA 2MH7A 2YEPF 1JRPA 2LVOA 1AN8A 4OZCA 3U1KA 4B3MH 1DOIA 1PYWD 1XD3B 3VRAB 4W9EA 2HD5B 1KLVA 3OWEB 2AXYA 3GZNB 1SBBB 4H2AA 1WE6A 4GB9A 1TYGB 3B2GA 2KWDA 5IP4D 1OGWA 2BBCA 4LFBH 3J7AK 1N62A 1TUAA 1JW9D 4RGNA 4EEWA 1E8YA 1OEYJ 3VKEA 2JRHA 3ZO5B 2GBRA 4JI7H 5D7GA 1K50A 2ZNVB 3Q3JA 1KFYB 2X06A 3I9V1 3GKUA 3APFA 2YVCA 4AJWA 1P9DU 3TUOA 1AARA 4IWQA 4KGTA 2B76B 3ZJVA 2KVZA 2SAKA 1KJTA 4DV7H 4LF8H 4B6WA 2JWUA 2MLBA 1C1YB 4XGAB 3PSEB 4JVYA 2G8YA 1KTKA 2LTMA 3LB8C 3GE8C 3HVZA 4W9GA 4BBNC 2WXGA 3R2IA 1ZGUB 4B9KA 2UXDH 3TBLD 4ITKA 4NZTM 1I94H 2GRIA 1D3ZA 1DT4A 2WX0A 3V3XA 1FXTB 4ACFA 3J9CA 2JPHA 5HFYA 2CWHA 3I57A 4AP4C 2MJ3A 2WDRB 3GB1A 2K8BA 3PLVA 4ZDVA 3EGRA 2E3TA 1GC6A 3B0AA 3AM9A 2O6VD 4JI0H 4DV0H 4TQ1A 3NVYA 4J3OD 5EE9A 2O2VA 2MHJA 2IY1B 1UBIA 5E6OA 2SEBD 1YN5A 5G5HA 1I4PA 5DPRA 3AEGB 3DDCB 4MM3A 3BYTB 3ECIA 1TY2A 3RULA 4RH6A 4XZ4A 2OJRA 3VTWA 4AM3A 1WZ3A 2LGIA 4K7WA 2WXIA 3ALBA 1ZTGA 1LQBA 4NJCA 4EE2A 4EZKA 4MH0E 2NN6G 2N1WA 3NVZA 5GXGB 1Q5WB 4NNJB 4IC7B 2VH1A 5BO4B 2JZZA 5EDSA 3W1SA 2L00B 2O2VB 3AXCA 1E8ZA 2FIDA 4I6NB 2ONQA 5K36G 2KT7A 2MP2B 3OG5A 2J53A 5JZEB 4LNIA 4MM3B 1EM7A 3BK2A 4NAWA 2CHWA 2BYEA 5BYSA 2M56B 1FNVA 5JXVA 1V49A 1J19A 4YL8A 3VAWA 2X8XX 3QD7X 4JI3H 1RFKA 1TZ1A 4JWSC 2XN9C 1GNUA 5C23A 1V1OA 2M0AA 3VVWB 4KIKA 4LNNA 2IO2B 2CU3A 4DR6H 4BKSA 2LVQA 3MC9A 1WXSA 2K8HA 5DCNA 1T0RC 4LNFA 1N5XA 3A4SC 4ICVA 2VZKB 4AUQC 3IFWB 4ZHOA 4X66H 4DR7H 4FN2A 1HZ6A 4OO1G 2L52A 3H1UA 3Q69A 2AQ3B 3UF8A 1TKGA 1QKZA 2KC2A 1GB4A 4NAWB 1C4CA 4H8AA 1TZOA 3AH7A 5LNK1 2WXJA 2H89B 2XK5A 2ZQEA 4NJ7A 1J7CA 1JCKB 4HDOA 4DQOC 3V60A 2AQ1B 3ZYYX 4KIKB 1WJ4A 3IHPC 1DYQA 4GKJH 4HKZE 1E0ZA 1FFUA 3HM3A 4GDLA 3L54A 3M95A 1WSPA 5E6NA 2E5LH 2J0MA 1ET9A 4TV3A 4K0KH 1XO3A 4B3RH 2JE6I 2NMQA 4LF9H 4QMFB 3UIOB 4WWMA 3J80W 1IUEA 3EZJA 2KX0A 3DCGA 4DXFA 2QEJC 3BVMA 4G3XB 2J7QB 2ZM6H 1MJDA 2LVPA 2O4CA 5J17A 3NJTA 4X62H 2BPSA 1MG8A 1ZZJA 4KX6B 2FCMA 1LO5D 3EC8A 5IA7A 3CWIA 3RNEC 4GDLB 3DBSA 3TSSA 2WXFA 4M8MA 2UUCH 3AE9B 3TCAA 3NCVA 5MPOA 2ANRA 1SJED 4NY0A 2K8CA 3QJZA 2LGSA 2BS3B 3ETRA 4JI5H 4OVZA 1G6JA 3U7ZA 2RR9A 4EUTA 4G08A 2AL3A 4W9JA 1WM2A 1R4NI 4BA2I 4DHZB 1FCLA 2DHZA 2PW9A 3T3OA 1FXIA 1XXGA 2VZKD 4C7ZA 1K53A 2J52A 2JXTA 2PVOD 4J6IA 2PIAA 3P2BA 3WAMA 3HVDA 1FNWA 4AJYB 2UUBH 4W9DA 1VBIA 3JVZX 2MJHA 1HA5A 1WE8A 2P2RA 3PTFC 2IO1B 3NS1A 3MHSD 2NS5A 4M01A 1MSZA 3UIPB 2INDC 4AS1A 2D3AA 4C56C 4BKSD 3I5JC 3AE7B 2CTJA 4RMAA 4ZYNA 2ZZPB 3MTNB 4YY3H 1JMLA 5EE0A 4YSZB 1CK1A 3AEDB 3TEZA 3D32A 4ANUA 4BA1I 2G45B 3WANA 3SU8X 5KHQA 1PGAA 4BZAA 1B1ZA 1V9NA 1WH3A 2CTKA 4ZRQA 2GMIC 3AE5B 2PVGC 1SGHA 1FXAA 3FC4A 4WWNA 2J42A 1RWSA 2N7EA 4XWWA 2CPQA 3RMKC 1V5OA 3RNCC 3PZ7A 1TTNA 2HTHA 4A3OA 1F0XA 2YEPB 4AIMA 2V4LA 2LEKA 4MELA 4PDBA 3UQAA 4G11A 2BKRB 2CHXA 3L16A 3R2TA 2KJ6A 1C76A 4DXGA 1SEBD 3A33B 4ZYSA 2UXCH 3B08A 1IGDA 3NHEB 1WRDB 1IGCA 4LF7H 4JI6H 1SJHD 1WXMA 1BXTA 4FHKA 4RM8A 4FHJA 4KGSA 3OJ4B 1L6VA 1ZW7A 5C3JB 2GLSA 2L3ZA 3RNGC 4P16A 4NXMH 3R7QA 1NVID 2NPTA 5D3IB 2J0JA 2PE6B 2ON8A 4W9LA 2HJ1A 4A90A 3MHZA 2K22A 2VKCA 1PDXA 4GIVA 1FMAD 1PGXA 5LMUH 4TKNA 1B9RA 1YQ3B 1ZP0B 2N0SB 2K25A 4FBJB 3SR6A 4XX5A 5BYQA 1AN7A 3SB1A 2FMRA 2IGGA 3PVLA 2JF5A 2WXOA 3CIRB 4B0MA 5H8YE 3OETA 2ICIA 3BIID 3JW0X 4S17A 4RGTA 2FAZA 1K8RB 2N9KA 3UINB 2K1HA 2EMTA 4GKKH 2KD0A 2N1VA 3C19A 4JI2H 1KHMA 1VLBA 1IP9A 3ZLZA 4ARIA 1KM7A 1R4MB 2NPTB 2WXQA 2GBMA 3GP7A 2MEKA 1XLNA 4FJUA 2C7MB 3NG0A 3TL5A 1RAXA 4TMAB 3VH3B 2PPHA 4LF5H 2WWZA 1WM3A 3QX1A 1I35A 2AYOB 4RFBA 2MBOA 2QC8A 4A20A 3ZNGC 4PYZA 3JAMW 5BR8H 4DHJB 2CKHB 2MCNB 3MJ5A 4F1SA 2OEDA 3M63B 4WH4A 2LGXA 1L4ZB 1YIWA 4JE3B 1YD8U 3M62B 1QOAA 3BINA 3ABVB 2MBQA 3ZNHB 2M8SA 2MJEA 2D9IA 3U2SC 4DV6H 1XMQH 1ZUD2 2L83A 4GN1A 4WURA 5AEKB 2NTSA 3HHMA 4FJYA 2ACZB 1EWYC 1XRHA 4N9F4 2G3QB 3SDLC 1C3TA 1EF5A 1Q0WB 2LRWA 1P7FA 2O6VA 3WIMA 3PRZA 5D2MB 1J5EH 4ANWA 4L23A 1HNZH 4PS3A 3BVGA 3W5UB 5JEAG 2D3GA 3PHWB 1TKEA 2LASA 3IXSA 4P7IA 3K9OB 3A1QA 1VJKA 3DBLB 2HH2A 4KGRA 2KTRA 1WX9A 1F77A 4JGHB 1E5WA 1WX7A 2KMAA 3TIXA 1NDDA 5HG2A 2ZCCA 5HHDG 4HEA1 2FUHB 2WDQB 4XYCA 2AWTA 1UBQA 1WIAA 3VTUA 1Z2IA 1ZKHA 4E9JA 4JPSA 1RRBA 4KSLC 2FE8A 4GU2A 2O6VB 5FR3A 2CTMA 4DUZH 1YX6B 1WXVA 1WGGA 1RYJA 1NEKB 4PYUA 1VCBA 1SE9A 1S20A 4M8NA 3TEWA 1SIJA 4DHJD 4RF0A 2DAJA 3ZDMC 3A1QB 4GXBA 3NOBA 1ZXIA 2KTRB 4CO7A 1HQRD 3DBHI 4CHKA 3RT3B 3KQ4A 2LJIA 1HNWH 4XWTA 2RDGA 4NZLB 1ROEA 5D94A 4B8TA 3APDA 4TQ0A 3FAUA 1TGZB 1VZ7A 1WJUA 4XDDA 1JWUD 2ZPYA 4HJGE 1M4VA 3KYCD 2D3BA 1AW7A 2BWFA 4B95A 3GOEA 1AWDA 4II2B 2YQRA 3MC8A 4WJPA 3U52E 1R4MI 1WXAA 2JXXA 2JSVX 3KLSX 2QIEB 1XNQH 1LFDA 2DBYA 1N32H 1D4BA 3Q2AC 4RNAA 4P1BC 1EUVB 1E10A 4M0WA 1N60A 2D2QA 3A9KA 1DTJA 3DVNV 1ISNA 4KKIA 5TSSA 1VIHA 4URKA 3AE8B 4WWOA 5DPSA 1KOTA 4HWIB 3DVNU 2BWES 1VD2A 4I6PA 2Y3MA 1R7SA 1FJGH 3W1SC 4MJSA 2KACA 3L0WB 3AU5A 3AECB 1L5PA 3Q3OC 1QILA 2NTTA 1K52A 1RFAA 3N1XC 3NS8A 4IOIE 3FAHA 1NBFC 2DAFA 3NZ3A 3IAM1 2WLBA 4RGOS 3IAS1 1V2YA 3I0PA 4M0WB 3WA0A 2JVCA 1A70A 3A9KB 2MP2A 4IKGA 4DV3H 3NZSA 2GBJA 4S0RA 4YTMB 3BK1A 4KV2A 4B0EA 4DV1H 1FPYA 2CU1A 3N9YC 5FK9C 4MJSB 1R4NB 4UDUC 2KFJA 1E9MA 4LFAH 4BKTA 1ZDXA 4HLEA 1C77A 2L0FA 1FFVA 3DBLI 4ZRKA 1TT5B 2KNBA 3DOWA 4HKQA 2JY6A 1VIGA 4W9HA 4IUMB 4DR4H 4HK2A 2KDFB 2HE7A 4LTUA 2LHDA 1NENB 1AYFA 2N9XA 2UWQA 3RPFC 1SEIA 2KWUB 3AI5A 1CJEA 4OD6A 2WS3B 3AV8A 2V3PA 4DWFA 5G5GA 2E3UA 3AEVB 4MGYE 2MWSB 1E8WA 2BS4B 5T8IA 5FR6A 3BWUD 1XLPA 1HE8A 2IGDA 2WQYB 2X38A 3P42A 3ZRFA 1Z2MA 1JALA 4JV5H 2HJ8A 1X4MA 3MP9A 3EHVA 4II3B 2W3SA 4YT0B 4B3TH 1TJEA 2N4FA 1L2NA 2MQJA 4OVUA 3WAPA 2MBEA 3VH4B 1V6EA 5JH5C 4FADA 4IDIA 2V3SA 3DWGC 1UELA 2DZJA 3KH0A 4R3DA 4LJOB 2LZ6A 2VH2A 3P1MA 3KDKA 3QK0A 3VDZA 4MT5A 4DHZE 3UI3A 2EMSA 3OLMD 2UYZB 1T0QC 3SFDB 1TS4A 3RD2A 1WVNA 4W9FA 3ZIMA 4N59A 2R2QA 1F2RI 3Q6BA 1I4XA 3V69A 4CQNA 4JI1H 3CSTA 2IO3B 4NAMA 3IG3A 1UG8A 4LNOA 1P1AA 4NQLB 1JRUA 5CHVC 4A6QA 1L0VB 2L32A 1X9ZA 4OCHA 4JQWC 1IYFA 1YJIA 1UWMA 3P4QB 1KLGD 2IZVB 3T9LA 3NVWA 2TSSA 3C0RB 1MI0A 1QOFA 1YNTE 1XCTL 5AUKA 2RPQA 2KQSA 2XBBC 3UGBB 1NI3A 2QNDA 1HNXH 4WJOA 4GMVA 4NPNA 2LRRA 3RN9C 2ZCBA 4TUUA 1UD7A 4WALA 1NYRA 2GI9A 5AZFA 1L0YB 2D10A 5CTRC 4IWPA 4PK1A 3H6NA 1HTOA 2BKFA 2GOWA 3KUDB 1L0XB 2MA9B 2PTLA 1WI0A 3RNBC 4MGKE 3L7ZC 1QF6A 1CMXB 1UUPA 3T8MA 2K1FA 2ASQA 1JROA 1FKAH 4US8A 1SXTA 4A8XC 2PQUA 4ZOHC 2L76A 1XLQA 2QCZA 1SE2A 4OVVA 1ZZIA 1RLFA 2KJHB 3L4PA 2REXA 3PS6A 3PREA 4MEMA 2KANA 3V6CB 1QOGA 2DGRA 1XT9B 4B3SH 1J7BA 1FRRA 2JT4B 2Z59B 4HDQA 1E90A 1I7HA 2BGFA 2Z8LA 4KDIC 1N5WA 2G1EA 4FULA 4DXAB 4KVGB 2OOBB 1X0AA 2PJHA 5DT9A 2RDHA 1Y56A 1V86A 4WJQA 2Y5PA 5C1ZA 5I4DA 5BMHA 5HKHA 3AEAB 2YLMA 1L7YA 2L1AA 3A4RA 2LFIA 1T3QA 3RCZA 2DZMA 4B8CD 2KDMA 2KFKA 2FCNA 4MGZE 1VRAB 1YJ1A 3W1YA 2KLCA 2GBKA 3MJWA 3ZXRA 1XQQA 2KMMA 3ZGZA 1NI2A 3KDGA 1WX8A 5BMGA 4HCNB 3VXWA 1DOXA 1BUIC 1H4RA 1TY0A 4NBQA 1WJNA 1IBKH 3L08A 4BOSC 1VZ6A 1N33H 2BYVE 3HM6X 3PV1A 2UUAH 1T0YA 2KQ4X 3PO0A 1GOZA 2JEAI 3AULA 2JX5A 5G55A 2CTEA 2LGYA 1D5MC 3URYA 2FPHX 2RSUA 4L2YA 2KFKB 1J7AA 1TS2A 2W55A 1YMHE 3W5VB 2PEAA 4ASWC 4W9IA 3Q14C 4C4VB 1VR9A 3OAWA 4LCDE 1FCCC 1IBXB 2JU6X 2LI5A 1DOYA 4PS8A 1ENFA 3P4RB 3PPAA 1T5XD 4N6EB 2WDVB 2BTEA 4Q2JA 4DV5H 5L95C 1SF0A 3HK0A 4ARCA 2DENB 5IO9A 1UZXB 1Q10A 1WGYA 2I38A 3WAOA 4BBNF 2D3CA 1WJ6A 3KYDD 4P1CC 1TS3A 3DBHB 1C79A 1PFDA 2QDFA 1TIFA 1WFYA 1J8CA 4MGIE 2L0TA 3HUIA 3DHIC 3P4SB 2D11A 3U8ZA 1WE7A 4JX1C 3H8HA 2KOXA 1JWMD 4A55A 1WGHA 3AN1A 3PT2B 3V6EB 3VHTC 3V62A 3EFUA 3QQ8B 1A5RA 3E9SA 2W3RA 1E8XA 2LXCA 1WGKA 1VDVA 2C7HA 2WP9B 3M3JA 4W9KA 2I1JA 3UOEA 4PS7A 1VZ8A 1GJZA 1V9JA 3DPDA 3LYYA 3DVGX 3OTOH 2VQEH 4X57B 3Q8FA 1SIFA 3B1LX 3IVFA 2AL6A 5AUIA 1IBLH 3AE6B 5LMNH 2FNJB 2IO0B 4OW0A 2CR5A 3RZFA 1T6BX 1PUTA 2QSDA 3ZJTA 4BFRA 4RCOA 1D5XC 2K5PA 3ENEA 2KO3A 3R7RA 3Q8EA 2WGSA 2WXRA 3V05A 2INPE 2BB6A 2CS4A 4K1RB 3R66C 4HPPA 3B2FA 3PLUA 4WIPA 2I1KA 4TSSA 4M02A 1E7PB 1ZPSA 2DWQA 3AEFB 1OQYA 1FRDA 3L17A 1ODHA 3R3MA 1NXUA 2ZNVC 2M6QA 2L8JA 2KN5A 5AZGA 2BL5A 2LRUA 3X23A 2Y5CA 2BQQA 2BF8B 2M17A 3JYUA 5A2QW 1UF0A 4KZ0A 1WY8A 1OQQA 1C78A 3T3NA 2I2YA 1WXQA 4DDGD 3W2DA 2W82A 3OSSD 4CYEA 1KLUD 1P0RA 2BB5A 4KHPH 1N34H 4L1BA 3X0WA 4EZJA 4WJNA 2CTLA 3H7SA 4JLCA 3PZDA 4X64H 3ML9A
chains in the Genus database with same CATH topology
4MACA 1A70A 4IKGA 1V8CA 3ZQ4A 4WWMA 3EUB2 1IUEA 2JQRB 4YTMB 2CJNA 4DXFA 3BK1A 3VRBB 2QEJC 3BVMA 2JYEA 1OQRA 4B0EA 1MHXA 1D5ZC 4XE0A 2WXNA 3N9YC 2FUG1 4YTPB 5FK9C 4YSXB 3BZDB 4LLGM 4UDUC 1K51A 1E9MA 3TEXA 1ZDXA 4HROA 4KX6B 1C77A 1LO5D 5E6JA 3Q8AA 1KF6B 1FFVA 1TS5A 3CWIA 3EA6A 1YN3A 4GDLB 1QLBB 3TSSA 2V3NA 4HKQA 2BS2B 2DYOA 2WXFA 1UWXA 3AE9B 3KWVA 5MPOA 1F0ZA 1WYGA 4LTUA 1SJED 2LHDA 1JWBD 2BS3B 1NENB 1AYFA 3ETRA 4LK0M 2N9LA 4WAFA 3RPFC 3DWMA 1QOBA 4YWGG 1CJEA 4OVZA 3RFZB 3U7ZA 2PLPA 5FKAC 2WS3B 3AV8A 2V3PA 2WXMA 1C9FA 2JYTA 4P6VF 4RGMA 5G5GA 1TKYA 1FCLA 2BS4B 2PW9A 5T8IA 3T3OA 1FXIA 1XLPA 1XXGA 2IGDA 2VZKD 3BWUD 1XEEA 4C7ZA 2WQYB 2X38A 4N58A 1K53A 2E6XA 3P42A 2J52A 1JALA 1XCQL 2JXTA 2PVOD 3MP9A 1ZE3D 2PIAA 1XLOA 2W3SA 4YT0B 3HVDA 1FNWA 1P7EA 1TJEA 3AMZA 1HEZE 1N61A 2XNAC 3NVVA 4AQ7A 2MJDA 1HA5A 2J4XA 1ZXHA 3AE2B 4YXDB 4IDIA 3NS1A 3TEYA 1HXYD 3DWGC 1C4PA 4R3DA 4AS1A 1UNSA 4C56C 2IGHA 3AE7B 1FIQA 3LXFA 3P1MA 5D3DA 1JMLA 1I4QA 5EE0A 4YSZB 4MT5A 5EE3A 1CK1A 1FNUA 3AEDB 3TEZA 3VR8B 4KKJA 3UI3A 2W54A 2BW2A 3KWLA 1PGAA 1B1ZA 1F2RC 1XF5L 4ZRQA 1TS4A 3SFDB 1MHHE 4N59A 3AE5B 2K9XA 1F2RI 2WU5B 2PVGC 4OHJA 1I4XA 1ACCA 1FXAA 3FC4A 1YN4A 4CQNA 4ZRPA 1FO4A 1L4DB 4NAMA 2J42A 1RWSA 3IT6B 4XWWA 3AEBB 3PZ7A 2KN4A 4A9AA 2KAJA 2WXLA 2YEPB 1ZOYB 1E6EB 4A6QA 1L0VB 2LEKA 1MPEA 2L32A 4HRSA 4RF1A 3P63A 3SEBA 2LHEA 2QJLA 1YJIA 2K0PA 3VQIA 1UWMA 3P4QB 1V97A 1KLGD 3R2TA 4DXGA 1C76A 3BVZA 1SEBD 1FEHA 2AX5A 3NVWA 2TSSA 3P4PB 4ZYSA 3AE3B 1HZ5A 1MI0A 2JZPA 2Q5WD 1IGDA 1QOFA 4D2KA 1YNTE 1IGCA 1XCTL 5AUKA 2WXHA 1RM6C 1SJHD 3GS2A 2IJ0A 2D5GA 3AEEB 1BXTA 1KH0A 1NI3A 4PT5A 4US9A 4KGSA 1L6VA 5C3JB 4ZHPA 4P16A 3W9CB 1ZDVA 1NVID 5D3IB 2ON8A 4GLSC 4A90A 1NYRA 2ZW1A 3MHZA 2K22A 1PDXA 2GI9A 1SB3C 1ESFA 1FMAD 1L0YB 1PGXA 2RPVA 1B9RA 1YQ3B 1ZP0B 2N0SB 2QMTA 3SR6A 5BYQA 2WXPA 1EWCA 1L0XB 3B9JA 1WRIA 3WCQA 2PTLA 3MC0B 5BYRA 4FXCA 1QF6A 2HTME 2IGGA 1UUPA 2OHFA 2WXOA 2H88B 3CIRB 4B0MA 4OZBA 5H8YE 2PMVA 1JROA 3NRZA 2ICIA 4US8A 1SXTA 4A8XC 3BIID 2MH7A 4ZOHC 4RGTA 2YEPF 1JRPA 1STEA 1EU4A 1SE2A 1AN8A 1XLQA 2N9KA 4OZCA 2RMMA 3L4PA 1DOIA 1PYWD 1CQVA 2WU2B 3VRAB 1I4HA 1VLBA 1QOGA 4USAA 3OWEB 4ARIA 1YJJA 1J7BA 1SSNA 1FRRA 1SBBB 1I7HA 2Z8LA 4H2AA 2WXQA 1TYGB 3B2GA 1UGJA 2KWDA 1N5WA 3GP7A 1L6UA 2BBCA 2MEKA 2G1EA 1XLNA 1KRHA 5BMIA 1CZPA 1JWAD 4TMAB 5EE1A 1N62A 1JW9D 4RGNA 2RDHA 3Q8CA 1Y56A 2Y5PA 4RFBA 5I4DA 5BMHA 3AEAB 2G9HD 5HI1A 3MJ5A 2L1AA 1K50A 2LFIA 2OEDA 4WH4A 1T3QA 5D7GA 2QILA 1L4ZB 4JWUC 1SE4A 1KFYB 3E56A 2KDMA 3NUHB 1VRAB 2AQ2B 3Q8BA 4JE3B 1JWSD 3I9V1 2WNMA 1QOAA 2KMMA 3ZGZA 3TUOA 3ABVB 3FILA 3ZJVA 4KGTA 5BMGA 2B76B 1DOXA 4WQMA 1SE3A 2MJEA 2SAKA 1BUIC 1JQ4A 3U2SC 1TY0A 1ZUD2 4YSYB 2JWUA 4GDKB 2L83A 1VZ6A 4WURA 1KTKA 2NTSA 4OZAA 3LB8C 3AE1B 1MVKA 3HVZA 2ACZB 2WXGA 2KQ4X 3R2IA 1EWYC 3PO0A 1GOZA 4ITKA 4MH8A 2GRIA 3V3XA 2JX5A 3J9CA 5HFYA 1P7FA 1D5MC 3I57A 1BMLC 3URYA 4L2YA 2CJOA 2MJ3A 1J7AA 1TS2A 2W55A 1YMHE 3W5VB 2WDRB 1DGJA 2IPKD 3GB1A 4L23A 3EGRA 2WXKA 2E3TA 1VR9A 2V4IB 3BVGA 3W5UB 3AM9A 1FCCC 1TKEA 1I4RA 3FILB 1IBXB 2JU6X 1DOYA 1ENFA 3IXSA 3P4RB 4TQ1A 1T5XD 4N6EB 2WDVB 3NVYA 4Q2JA 4J3OD 5EE9A 2BTEA 1NYQA 1SF0A 1VJKA 4ARCA 3PZ8A 4C7YA 4KGRA 1F77A 2SEBD 1YN5A 1Q10A 1I4PA 5G5HA 5HG2A 3R8BA 2I38A 5HHDG 3AEGB 4HEA1 3BYTB 1TY2A 4RH6A 3IT4B 2WDQB 1TS3A 1ET6A 1C79A 2ZW0A 1PFDA 2LGIA 1QT9A 2WXIA 4JPSA 4NJCA 2FE8A 4EE2A 5FR3A 3HUIA 2BYTA 2M19A 2DYMA 2LMCA 3P4SB 1I4GA 2BT6A 3NVZA 4JX1C 2PKOA 3H8HA 5GXGB 1JWMD 4A55A 1RYJA 3AN1A 2EELA 1NEKB 3E9SA 3TEWA 1SIJA 2HDEA 2W3RA 4RF0A 3W1SA 2V0GA 1YQ4B 5H92C 1FD6A 3ZJUA 1WGKA 1FM0D 1ZXIA 1VDVA 1GAQB 1HQRD 2ONQA 2GB1A 3KQ4A 2LJIA 4XWTA 2RDGA 2WP9B 1GPXA 2J53A 4NZLB 2IDYA 4MM3B 1V1PA 1VZ8A 3HRDD 2INNE 1ROEA 1EM7A 3LYYA 3BK2A 5BYSA 2M56B 1FNVA 4TQ0A 1WWTA 5JXVA 1VZ7A 1D6EC 4XDDA 1JWUD 2K3UA 3Q8FA 4HJGE 5AUIA 1M4VA 3AE6B 3O13A 4OW0A 4O1NA 1RFKA 4JWSC 1GB1A 2XN9C 1AW7A 1T6BX 1V1OA 2M0AA 1PUTA 2DLBA 2QSDA 3ZJTA 1AWDA 4RCOA 2CU3A 2EKIA 3U4EG 1D5XC 2K5PA 3U52E 1EU3A 2JSVX 3KLSX 3Q8EA 2WXRA 3V05A 1N5XA 2QIEB 2INPE 1N63A 2DBYA 2BB6A 1IBXA 2FBWB 1D4BA 3B2FA 4WIPA 2LUMA 4TSSA 2VZKB 4RNAA 4ZHOA 3AB5A 1E7PB 1ZPSA 2DWQA 1C4AA 1HZ6A 3AEFB 2L52A 1E10A 4M0WA 1V1PB 2Y3AA 1N60A 2AQ3B 3Q69A 1TKGA 1QKZA 2N7JA 1FRDA 1GB4A 4NAWB 4KKIA 1QQRA 1C4CA 5TSSA 3AE8B 1TZOA 3AH7A 3MFGA 5LNK1 2Y5CA 1OFFA 2WXJA 2R61A 2H89B 1R7SA 1J7CA 1JCKB 4DQOC 2KACA 3SFEB 2AQ1B 3ZYYX 3AECB 1OQQA 1L5PA 1C78A 3T3NA 2I2YA 1WXQA 1DYQA 1QILA 4HKZE 2NTTA 1K52A 2W82A 3W2DA 3AE4B 4REZA 1KLUD 1E0ZA 1FFUA 2BB5A 3VR9B 4XDCA 3C8YA 3BYYB 4YTNB 4C80A 1WSPA 4L1BA 4IOIE 3FAHA 1ET9A 3NZ3A 3IAM1 2WLBA 4RGOS 3IAS1 1XO3A 5C2TB 2NMQA 1PGBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A70 A;  1FO4 A;  1V8C A;  1SIJ A;  2W3R A;  3EUB 2;  1RWS A;  1IUE A;  4WWM A;  2JQR B;  3AEA B;  4YTM B;  2CJN A;  3AEB B;  1YQ4 B;  4A9A A;  5H92 C;  3VRB B;  1T3Q A;  2KAJ A;  1OQR A;  1ZOY B;  1WGK A;  1FM0 D;  1ZXI A;  1KFY B;  1E6E B;  1VDV A;  4JWU C;  1GAQ B;  4YTP B;  1L0V B;  2LEK A;  4YSX B;  4HRS A;  2WP9 B;  1GPX A;  3P63 A;  1E9M A;  4HRO A;  2QJL A;  1YJI A;  3HRD D;  1UWM A;  3P4Q B;  1QOA A;  2KMM A;  1ROE A;  1V97 A;  4KX6 B;  3ABV B;  2M56 B;  1WWT A;  1KF6 B;  2AX5 A;  2B76 B;  1FFV A;  3CWI A;  3NVW A;  3P4P B;  1DOX A;  3AE3 B;  4WQM A;  1QLB B;  2MJE A;  2Q5W D;  5AUI A;  3AE6 B;  1JQ4 A;  1QOF A;  2BS2 B;  1RFK A;  1ZUD 2;  4JWS C;  5AUK A;  3AE9 B;  4YSY B;  2L83 A;  5MPO A;  1RM6 C;  1WYG A;  4LTU A;  1F0Z A;  1JWB D;  1PUT A;  1NEN B;  1AYF A;  2BS3 B;  1AWD A;  3AE1 B;  3AEE B;  3ETR A;  3LB8 C;  3RPF C;  3DWM A;  1NI3 A;  1QOB A;  2CU3 A;  2ACZ B;  2EKI A;  1CJE A;  3HVZ A;  2K5P A;  1EWY C;  4US9 A;  3PO0 A;  1L6V A;  5C3J B;  4ITK A;  4ZHP A;  2WS3 B;  3W9C B;  3AV8 A;  1NVI D;  5G5G A;  1N5X A;  2JX5 A;  2QIE B;  1TKY A;  1N63 A;  2DBY A;  2BS4 B;  1NYR A;  1FXI A;  1XLP A;  2FBW B;  3B2F A;  2K22 A;  4C7Z A;  1PDX A;  1SB3 C;  1J7A A;  1FMA D;  2CJO A;  2MJ3 A;  2W55 A;  2WDR B;  2WQY B;  3AB5 A;  1DGJ A;  1E7P B;  1JAL A;  4N58 A;  2DWQ A;  4ZHO A;  1B9R A;  1YQ3 B;  2PVO D;  3AEF B;  1ZP0 B;  2N0S B;  2L52 A;  2PIA A;  1E10 A;  1XLO A;  2E3T A;  2W3S A;  4YT0 B;  3SR6 A;  1N60 A;  3W5U B;  1TKG A;  1TJE A;  3AMZ A;  1FRD A;  3AM9 A;  1N61 A;  3B9J A;  1TKE A;  1WRI A;  3WCQ A;  3W5V B;  3NVV A;  4FXC A;  1QF6 A;  1DOY A;  3P4R B;  2HTM E;  2MJD A;  3AE8 B;  2WDV B;  3NVY A;  4N6E B;  3AH7 A;  5EE9 A;  1NYQ A;  1SF0 A;  1VJK A;  2OHF A;  2H88 B;  3CIR B;  2Y5C A;  1OFF A;  3AE2 B;  5H8Y E;  4IDI A;  4C7Y A;  4YXD B;  1JRO A;  2H89 B;  3NRZ A;  3NS1 A;  4US8 A;  1R7S A;  3DWG C;  1J7C A;  2MH7 A;  3BII D;  4ZOH C;  1JRP A;  1XLQ A;  5G5H A;  3SFE B;  3FC4 A;  3ZYY X;  3AEG B;  3AEC B;  1OQQ A;  1DOI A;  3L4P A;  1L5P A;  3VRA B;  2WU2 B;  1WXQ A;  1FIQ A;  3AE7 B;  2WDQ B;  1VLB A;  3LXF A;  3P1M A;  1QOG A;  4USA A;  1YJJ A;  1J7B A;  1PFD A;  5EE0 A;  3AE4 B;  4YSZ B;  1E0Z A;  5EE3 A;  1FFU A;  1FRR A;  1QT9 A;  3VR9 B;  3AED B;  1I7H A;  3VR8 B;  2W54 A;  3AN1 A;  4YTN B;  1TYG B;  4C80 A;  3B2G A;  3HUI A;  1N5W A;  2M19 A;  3KWL A;  1L6U A;  2G1E A;  1XLN A;  1KRH A;  3FAH A;  3P4S B;  2BT6 A;  3SFD B;  1CZP A;  3NVZ A;  1JWA D;  4JX1 C;  2PKO A;  2WLB A;  1N62 A;  5EE1 A;  5GXG B;  4N59 A;  3AE5 B;  2K9X A;  1JW9 D;  2WU5 B;  1XO3 A;  2PVG C;  1RYJ A;  5C2T B;  4P6V F;  1FXA A;  1NEK B; 
#chains in the Genus database with same CATH topology
 4MAC A;  3AU4 A;  1V8C A;  3ZQ4 A;  2CJN A;  4HXD A;  2D07 B;  4G0N B;  3VRB B;  2G4S A;  1TBE A;  1YOV B;  1D5Z C;  4XE0 A;  2WXN A;  2FUG 1;  4YSX B;  3BZD B;  1K51 A;  3KUZ A;  2NR2 A;  4E71 A;  4HRO A;  1Y8R C;  4BKG A;  1P3Q U;  4IM0 A;  1WMH A;  1TS5 A;  3EA6 A;  1YN3 A;  2V3N A;  2Z0S A;  3ZDT A;  2BS2 B;  1UWX A;  4JI8 H;  4IM2 A;  3KWV A;  1WYG A;  1JWB D;  3SHQ A;  4LK0 M;  3DWM A;  3ZW3 A;  2C60 A;  2G4D B;  2PLP A;  4EFO A;  3S2A A;  3RF2 A;  3IBE A;  1V81 A;  2JYT A;  4P6V F;  4RGM A;  3ZXV A;  3ONS A;  4LF4 H;  4ANV A;  4JYA H;  3ZNI D;  3CMM B;  4N58 A;  2E6X A;  2EKE C;  5CHW A;  1H8C A;  3RNF C;  3ZKJ C;  1XLO A;  3AMZ A;  2XNA C;  4DBG A;  1Q1O A;  2KWV B;  1WMH B;  2RDB C;  3NVV A;  1S1Q B;  4IG7 B;  4IWO A;  1N36 H;  3UQB A;  2MJD A;  4K7U A;  2J4X A;  4E3C A;  1ZXH A;  3NY5 A;  3DQV A;  3AE2 B;  3QA8 A;  2OPU A;  2KXJ A;  1E7U A;  1F1H A;  4ICU A;  1UNS A;  5IN7 A;  2IGH A;  3RZW C;  1FIQ A;  4GGQ A;  5D3D A;  2C5L C;  1I4Q A;  2JUO A;  4LIJ A;  5EE3 A;  2WYQ A;  2N9P C;  2KK8 A;  3VR8 B;  4KKJ A;  1EO6 A;  2KDE B;  5E6P A;  4JVH A;  2LUE A;  3VTV A;  2CWF A;  1XF5 L;  4RM9 A;  2K9X A;  2WU5 B;  1YN4 A;  4ZRP A;  2RGF A;  4LF6 H;  1FO4 A;  3U7D A;  1L4D B;  3ML8 A;  3IT6 B;  4EOY A;  2F4V H;  2KN4 A;  1Z5S B;  2L7R A;  4NJ6 A;  3EFC A;  2WXL A;  1E6E B;  2NVU I;  2KTF A;  2AEH A;  1MPE A;  4RF1 A;  3SEB A;  2LHE A;  2GBN A;  3VQI A;  1WF9 A;  3BVZ A;  2AX5 A;  3P4P B;  3AE3 B;  1HZ5 A;  2JZP A;  2Q5W D;  3TJP A;  4D2K A;  2WXH A;  1V5T A;  2KYW A;  5LXI B;  5IT9 W;  2D5G A;  3AEE B;  4F8C B;  4NXN H;  1KH0 A;  4HPL B;  2CPM A;  5LXH A;  4G50 A;  1WR1 A;  3L13 A;  5J2R A;  1T0S C;  2MRP A;  3RUI B;  2MBB B;  3SD5 A;  2ZPN A;  1F9J A;  3QIJ A;  1ESF A;  3K9P B;  3GE3 C;  3DBR I;  3QCA A;  2JEB I;  4GOC A;  3B9J A;  5IOI A;  1WRI A;  3WCQ A;  2A1S A;  4YHH H;  1EC6 A;  5BYR A;  4FXC A;  2MX2 A;  2KHW B;  1UGM A;  4KSK C;  3PHX B;  3KUC B;  4OZB A;  4EKU A;  3H9D A;  4BAX A;  1UH6 A;  1STE A;  4FJV B;  1EU4 A;  2RMM A;  1S03 G;  3RNA C;  2V1Y A;  3VUY A;  1CQV A;  2WU2 B;  3T1H H;  1I4H A;  4A3P A;  4USA A;  1WGD A;  3Q3F A;  1YJJ A;  4K3B A;  1SSN A;  1X4N A;  1UGJ A;  4JL9 A;  4AOF A;  1L6U A;  3CSF A;  2NBW B;  1KRH A;  4GDK A;  5BMI A;  1CZP A;  1JWA D;  5EE1 A;  3Q8C A;  1QZE A;  3I3T B;  2KJR A;  2G9H D;  5HI1 A;  2HH3 A;  2INC C;  2QIL A;  4JWU C;  1SE4 A;  3E56 A;  3NUH B;  2M0X A;  3GZN I;  2Z0D B;  2AQ2 B;  2LGD A;  4LFC H;  3Q8B A;  4C00 A;  3N3K B;  1JWS D;  3QHT A;  1WGR A;  2WNM A;  2KZR A;  3FIL A;  1S3S G;  1EF1 A;  4K3C A;  3ZNZ B;  2CHZ A;  4JIO U;  4GSW A;  4WQM A;  1SE3 A;  1JQ4 A;  1BT0 A;  4HVB A;  3ZRC A;  1WHR A;  3QAR A;  3N1Y C;  4YSY B;  4GDK B;  2FCS A;  1PQS A;  2N7D A;  4DV4 H;  4DR3 H;  4OZA A;  3AE1 B;  1MVK A;  4DK5 A;  3HIZ A;  5IKC M;  3ZTD A;  4MH8 A;  3QAQ A;  4E74 A;  2K6D B;  1BML C;  4BOZ B;  1WR6 E;  2CJO A;  1DGJ A;  4K81 A;  1IPG A;  2IPK D;  2JWZ A;  4FJS A;  2WXK A;  3VUW A;  2V4I B;  1I4R A;  3PRM B;  3FIL B;  3I63 C;  1J4W A;  1NYQ A;  3T1Y H;  2PT7 G;  1YX5 B;  3PZ8 A;  4C7Y A;  3N1Z C;  2KMC A;  4HJK A;  3R8B A;  5LL6 b;  2L05 A;  4HCP B;  3IT4 B;  4FLH A;  1ET6 A;  2ZW0 A;  4LNK A;  1GUA B;  4NQK E;  2XK5 B;  3J81 W;  1QT9 A;  1WTJ A;  2KLG A;  2NBU A;  3JSV A;  1YQB A;  5DPT A;  3TMP B;  2WHI A;  2M19 A;  2BYT A;  2DYM A;  4OX9 H;  4FA6 A;  3QC8 B;  2J0K A;  2LMC A;  1GG3 A;  1I4G A;  2BT6 A;  2JRI B;  2PKO A;  4F7Z A;  2EEL A;  3A9J A;  2K6Q A;  2KQ7 A;  2HDE A;  4EC5 A;  2A5U A;  2V0G A;  2JVZ A;  1YQ4 B;  5H92 C;  1LGR A;  1FD6 A;  2W9N A;  3ZJU A;  3O65 B;  1FM0 D;  3VUX A;  2OJW A;  1K1G A;  2LD9 A;  1GAQ B;  3GR5 A;  2GB1 A;  1U4A A;  3QWZ B;  1GPX A;  2IDY A;  1V1P A;  3HRD D;  2INN E;  2LJ5 A;  3LDZ E;  1WWT A;  1HR0 H;  2JZ3 B;  1D6E C;  4AWJ A;  2K3U A;  3DHH C;  2FFM A;  3JSV B;  1MG4 A;  4IM3 A;  2UU7 A;  3O13 A;  4O1N A;  3EEC A;  5LLI A;  1GB1 A;  4AQY H;  5G2N A;  2KX3 A;  2RD0 A;  4W9C A;  2DLB A;  4NZR M;  4MSM B;  2EKI A;  3U4E G;  3A9J B;  2MBH A;  1EU3 A;  4XC2 A;  2FIF A;  3GAB A;  4C4V A;  2ANN A;  3APC A;  1F52 A;  1N63 A;  2LF0 A;  1IBX A;  2ZEQ A;  2FBW B;  2LUM A;  5C0X G;  1WYW B;  2WDT B;  2ZVO A;  3AB5 A;  1J0G A;  1C4A A;  4ZRI A;  5L83 A;  2HHH H;  2Y5B B;  3N32 A;  1V1P B;  2DNF A;  2N9E B;  2Y3A A;  2N7J A;  5TR5 A;  1J5K A;  2K39 A;  1QQR A;  2BA0 A;  3MFG A;  2DZK A;  2KDB A;  1OFF A;  2R61 A;  3SFE B;  4JI4 H;  2BYF A;  1GC7 A;  2WX1 A;  2Z0E B;  4FJZ A;  4EZL A;  2KDI A;  1OTR B;  3AE4 B;  4REZ A;  3VR9 B;  4XDC A;  3C8Y A;  3RI7 C;  3BYY B;  4YTN B;  4C80 A;  3FKY A;  1WZ0 A;  2KKC A;  5JHB A;  2R2O A;  5KHO A;  5CX3 A;  3H7P A;  2NCN A;  5C2T B;  2C9W B;  2ZJD A;  1PGB A;  1I42 A;  3Q3N C;  2LTL A;  2VRR B;  2LWP A;  4DR5 H;  2XEW A;  3EUB 2;  2JQR B;  1LM8 B;  4MSQ B;  4LDT B;  1N6Z A;  1OQR A;  2JYE A;  2B3A A;  1MHX A;  2M1M A;  4YTP B;  4LLG M;  3TEX A;  3BY4 B;  2PE9 A;  2M8W A;  3PGE A;  5E6J A;  3Q8A A;  1KF6 B;  3U30 A;  1QLB B;  3KW5 B;  2DYO A;  5J18 A;  3NZU A;  4ANX A;  4BVU C;  1F0Z A;  3H7P B;  3ZVV A;  2N9L A;  2DX5 B;  4WAF A;  1QOB A;  4YWG G;  3RFZ B;  4WAN A;  5FKA C;  4IW0 A;  3ZUN A;  2MSE D;  2WXM A;  1C9F A;  4X65 H;  1TKY A;  5FLX W;  4HPM B;  3WAL A;  2VQF H;  1XEE A;  1XCQ L;  2OPV A;  1ZE3 D;  5D6J B;  4DUY H;  4DV2 H;  1P7E A;  2C7N B;  1HEZ E;  1N61 A;  1PQX A;  2KWC A;  4AQ7 A;  1P98 A;  2JA9 A;  4QAY A;  3N30 A;  4YXD B;  3TEY A;  4DR2 H;  1HXY D;  1C4P A;  4IFD G;  2LXA A;  3N20 C;  3LXF A;  3DVG Y;  1IBM H;  4MDK E;  4K7S A;  1FNU A;  2MW5 A;  2JZX A;  2W54 A;  2BW2 A;  3VFK A;  3KWL A;  3KVF B;  2CTF A;  3LJ3 A;  1F2R C;  4WWP A;  1M94 A;  1MHH E;  3Q3M C;  4OHJ A;  1ACC A;  2IBI B;  5IAA C;  2NBV B;  4LJP B;  3DHG C;  2KC1 A;  2KVR A;  2A4Z A;  5CHF A;  3AEB B;  4LDT D;  4A9A A;  1V80 A;  5IWA H;  4DDI D;  2KAJ A;  1ZOY B;  4HRS A;  2DZI A;  3P63 A;  2QJL A;  2K0P A;  1V97 A;  2DYB A;  1HTQ A;  2UXB H;  5DPW A;  1FEH A;  2ZVN A;  1OEY A;  3DBR B;  3RYT A;  2PY9 A;  4DR1 H;  1MFW A;  3L10 B;  1E7V A;  2FCQ A;  2IY0 B;  1RM6 C;  3CF6 E;  3GS2 A;  2IJ0 A;  1X1M A;  2QHO A;  1XNR H;  4PT5 A;  4US9 A;  4ZHP A;  3W9C B;  1ZDV A;  1XMO H;  5GMV A;  4WQO B;  1ZZK A;  4GLS C;  3V61 A;  2ZW1 A;  2RPV A;  1SB3 C;  4KDL B;  3ZTC A;  2IYD B;  2UU9 H;  2QMT A;  1I6U A;  3OJ3 A;  2BVC A;  2WXP A;  4I6L B;  4KZC A;  1EWC A;  4ZRJ A;  3MC0 B;  4M00 A;  2HTM E;  2M4N A;  2V9H A;  2OHF A;  2H88 B;  5JHA A;  2PMV A;  4WAA A;  3NRZ A;  3PRP B;  5AZH A;  1LXD A;  2MH7 A;  2YEP F;  1JRP A;  2LVO A;  1AN8 A;  4OZC A;  3U1K A;  4B3M H;  1DOI A;  1PYW D;  1XD3 B;  3VRA B;  4W9E A;  2HD5 B;  1KLV A;  3OWE B;  2AXY A;  3GZN B;  1SBB B;  4H2A A;  1WE6 A;  4GB9 A;  1TYG B;  3B2G A;  2KWD A;  5IP4 D;  1OGW A;  2BBC A;  4LFB H;  3J7A K;  1N62 A;  1TUA A;  1JW9 D;  4RGN A;  4EEW A;  1E8Y A;  1OEY J;  3VKE A;  2JRH A;  3ZO5 B;  2GBR A;  4JI7 H;  5D7G A;  1K50 A;  2ZNV B;  3Q3J A;  1KFY B;  2X06 A;  3I9V 1;  3GKU A;  3APF A;  2YVC A;  4AJW A;  1P9D U;  3TUO A;  1AAR A;  4IWQ A;  4KGT A;  2B76 B;  3ZJV A;  2KVZ A;  2SAK A;  1KJT A;  4DV7 H;  4LF8 H;  4B6W A;  2JWU A;  2MLB A;  1C1Y B;  4XGA B;  3PSE B;  4JVY A;  2G8Y A;  1KTK A;  2LTM A;  3LB8 C;  3GE8 C;  3HVZ A;  4W9G A;  4BBN C;  2WXG A;  3R2I A;  1ZGU B;  4B9K A;  2UXD H;  3TBL D;  4ITK A;  4NZT M;  1I94 H;  2GRI A;  1D3Z A;  1DT4 A;  2WX0 A;  3V3X A;  1FXT B;  4ACF A;  3J9C A;  2JPH A;  5HFY A;  2CWH A;  3I57 A;  4AP4 C;  2MJ3 A;  2WDR B;  3GB1 A;  2K8B A;  3PLV A;  4ZDV A;  3EGR A;  2E3T A;  1GC6 A;  3B0A A;  3AM9 A;  2O6V D;  4JI0 H;  4DV0 H;  4TQ1 A;  3NVY A;  4J3O D;  5EE9 A;  2O2V A;  2MHJ A;  2IY1 B;  1UBI A;  5E6O A;  2SEB D;  1YN5 A;  5G5H A;  1I4P A;  5DPR A;  3AEG B;  3DDC B;  4MM3 A;  3BYT B;  3ECI A;  1TY2 A;  3RUL A;  4RH6 A;  4XZ4 A;  2OJR A;  3VTW A;  4AM3 A;  1WZ3 A;  2LGI A;  4K7W A;  2WXI A;  3ALB A;  1ZTG A;  1LQB A;  4NJC A;  4EE2 A;  4EZK A;  4MH0 E;  2NN6 G;  2N1W A;  3NVZ A;  5GXG B;  1Q5W B;  4NNJ B;  4IC7 B;  2VH1 A;  5BO4 B;  2JZZ A;  5EDS A;  3W1S A;  2L00 B;  2O2V B;  3AXC A;  1E8Z A;  2FID A;  4I6N B;  2ONQ A;  5K36 G;  2KT7 A;  2MP2 B;  3OG5 A;  2J53 A;  5JZE B;  4LNI A;  4MM3 B;  1EM7 A;  3BK2 A;  4NAW A;  2CHW A;  2BYE A;  5BYS A;  2M56 B;  1FNV A;  5JXV A;  1V49 A;  1J19 A;  4YL8 A;  3VAW A;  2X8X X;  3QD7 X;  4JI3 H;  1RFK A;  1TZ1 A;  4JWS C;  2XN9 C;  1GNU A;  5C23 A;  1V1O A;  2M0A A;  3VVW B;  4KIK A;  4LNN A;  2IO2 B;  2CU3 A;  4DR6 H;  4BKS A;  2LVQ A;  3MC9 A;  1WXS A;  2K8H A;  5DCN A;  1T0R C;  4LNF A;  1N5X A;  3A4S C;  4ICV A;  2VZK B;  4AUQ C;  3IFW B;  4ZHO A;  4X66 H;  4DR7 H;  4FN2 A;  1HZ6 A;  4OO1 G;  2L52 A;  3H1U A;  3Q69 A;  2AQ3 B;  3UF8 A;  1TKG A;  1QKZ A;  2KC2 A;  1GB4 A;  4NAW B;  1C4C A;  4H8A A;  1TZO A;  3AH7 A;  5LNK 1;  2WXJ A;  2H89 B;  2XK5 A;  2ZQE A;  4NJ7 A;  1J7C A;  1JCK B;  4HDO A;  4DQO C;  3V60 A;  2AQ1 B;  3ZYY X;  4KIK B;  1WJ4 A;  3IHP C;  1DYQ A;  4GKJ H;  4HKZ E;  1E0Z A;  1FFU A;  3HM3 A;  4GDL A;  3L54 A;  3M95 A;  1WSP A;  5E6N A;  2E5L H;  2J0M A;  1ET9 A;  4TV3 A;  4K0K H;  1XO3 A;  4B3R H;  2JE6 I;  2NMQ A;  4LF9 H;  4QMF B;  3UIO B;  4WWM A;  3J80 W;  1IUE A;  3EZJ A;  2KX0 A;  3DCG A;  4DXF A;  2QEJ C;  3BVM A;  4G3X B;  2J7Q B;  2ZM6 H;  1MJD A;  2LVP A;  2O4C A;  5J17 A;  3NJT A;  4X62 H;  2BPS A;  1MG8 A;  1ZZJ A;  4KX6 B;  2FCM A;  1LO5 D;  3EC8 A;  5IA7 A;  3CWI A;  3RNE C;  4GDL B;  3DBS A;  3TSS A;  2WXF A;  4M8M A;  2UUC H;  3AE9 B;  3TCA A;  3NCV A;  5MPO A;  2ANR A;  1SJE D;  4NY0 A;  2K8C A;  3QJZ A;  2LGS A;  2BS3 B;  3ETR A;  4JI5 H;  4OVZ A;  1G6J A;  3U7Z A;  2RR9 A;  4EUT A;  4G08 A;  2AL3 A;  4W9J A;  1WM2 A;  1R4N I;  4BA2 I;  4DHZ B;  1FCL A;  2DHZ A;  2PW9 A;  3T3O A;  1FXI A;  1XXG A;  2VZK D;  4C7Z A;  1K53 A;  2J52 A;  2JXT A;  2PVO D;  4J6I A;  2PIA A;  3P2B A;  3WAM A;  3HVD A;  1FNW A;  4AJY B;  2UUB H;  4W9D A;  1VBI A;  3JVZ X;  2MJH A;  1HA5 A;  1WE8 A;  2P2R A;  3PTF C;  2IO1 B;  3NS1 A;  3MHS D;  2NS5 A;  4M01 A;  1MSZ A;  3UIP B;  2IND C;  4AS1 A;  2D3A A;  4C56 C;  4BKS D;  3I5J C;  3AE7 B;  2CTJ A;  4RMA A;  4ZYN A;  2ZZP B;  3MTN B;  4YY3 H;  1JML A;  5EE0 A;  4YSZ B;  1CK1 A;  3AED B;  3TEZ A;  3D32 A;  4ANU A;  4BA1 I;  2G45 B;  3WAN A;  3SU8 X;  5KHQ A;  1PGA A;  4BZA A;  1B1Z A;  1V9N A;  1WH3 A;  2CTK A;  4ZRQ A;  2GMI C;  3AE5 B;  2PVG C;  1SGH A;  1FXA A;  3FC4 A;  4WWN A;  2J42 A;  1RWS A;  2N7E A;  4XWW A;  2CPQ A;  3RMK C;  1V5O A;  3RNC C;  3PZ7 A;  1TTN A;  2HTH A;  4A3O A;  1F0X A;  2YEP B;  4AIM A;  2V4L A;  2LEK A;  4MEL A;  4PDB A;  3UQA A;  4G11 A;  2BKR B;  2CHX A;  3L16 A;  3R2T A;  2KJ6 A;  1C76 A;  4DXG A;  1SEB D;  3A33 B;  4ZYS A;  2UXC H;  3B08 A;  1IGD A;  3NHE B;  1WRD B;  1IGC A;  4LF7 H;  4JI6 H;  1SJH D;  1WXM A;  1BXT A;  4FHK A;  4RM8 A;  4FHJ A;  4KGS A;  3OJ4 B;  1L6V A;  1ZW7 A;  5C3J B;  2GLS A;  2L3Z A;  3RNG C;  4P16 A;  4NXM H;  3R7Q A;  1NVI D;  2NPT A;  5D3I B;  2J0J A;  2PE6 B;  2ON8 A;  4W9L A;  2HJ1 A;  4A90 A;  3MHZ A;  2K22 A;  2VKC A;  1PDX A;  4GIV A;  1FMA D;  1PGX A;  5LMU H;  4TKN A;  1B9R A;  1YQ3 B;  1ZP0 B;  2N0S B;  2K25 A;  4FBJ B;  3SR6 A;  4XX5 A;  5BYQ A;  1AN7 A;  3SB1 A;  2FMR A;  2IGG A;  3PVL A;  2JF5 A;  2WXO A;  3CIR B;  4B0M A;  5H8Y E;  3OET A;  2ICI A;  3BII D;  3JW0 X;  4S17 A;  4RGT A;  2FAZ A;  1K8R B;  2N9K A;  3UIN B;  2K1H A;  2EMT A;  4GKK H;  2KD0 A;  2N1V A;  3C19 A;  4JI2 H;  1KHM A;  1VLB A;  1IP9 A;  3ZLZ A;  4ARI A;  1KM7 A;  1R4M B;  2NPT B;  2WXQ A;  2GBM A;  3GP7 A;  2MEK A;  1XLN A;  4FJU A;  2C7M B;  3NG0 A;  3TL5 A;  1RAX A;  4TMA B;  3VH3 B;  2PPH A;  4LF5 H;  2WWZ A;  1WM3 A;  3QX1 A;  1I35 A;  2AYO B;  4RFB A;  2MBO A;  2QC8 A;  4A20 A;  3ZNG C;  4PYZ A;  3JAM W;  5BR8 H;  4DHJ B;  2CKH B;  2MCN B;  3MJ5 A;  4F1S A;  2OED A;  3M63 B;  4WH4 A;  2LGX A;  1L4Z B;  1YIW A;  4JE3 B;  1YD8 U;  3M62 B;  1QOA A;  3BIN A;  3ABV B;  2MBQ A;  3ZNH B;  2M8S A;  2MJE A;  2D9I A;  3U2S C;  4DV6 H;  1XMQ H;  1ZUD 2;  2L83 A;  4GN1 A;  4WUR A;  5AEK B;  2NTS A;  3HHM A;  4FJY A;  2ACZ B;  1EWY C;  1XRH A;  4N9F 4;  2G3Q B;  3SDL C;  1C3T A;  1EF5 A;  1Q0W B;  2LRW A;  1P7F A;  2O6V A;  3WIM A;  3PRZ A;  5D2M B;  1J5E H;  4ANW A;  4L23 A;  1HNZ H;  4PS3 A;  3BVG A;  3W5U B;  5JEA G;  2D3G A;  3PHW B;  1TKE A;  2LAS A;  3IXS A;  4P7I A;  3K9O B;  3A1Q A;  1VJK A;  3DBL B;  2HH2 A;  4KGR A;  2KTR A;  1WX9 A;  1F77 A;  4JGH B;  1E5W A;  1WX7 A;  2KMA A;  3TIX A;  1NDD A;  5HG2 A;  2ZCC A;  5HHD G;  4HEA 1;  2FUH B;  2WDQ B;  4XYC A;  2AWT A;  1UBQ A;  1WIA A;  3VTU A;  1Z2I A;  1ZKH A;  4E9J A;  4JPS A;  1RRB A;  4KSL C;  2FE8 A;  4GU2 A;  2O6V B;  5FR3 A;  2CTM A;  4DUZ H;  1YX6 B;  1WXV A;  1WGG A;  1RYJ A;  1NEK B;  4PYU A;  1VCB A;  1SE9 A;  1S20 A;  4M8N A;  3TEW A;  1SIJ A;  4DHJ D;  4RF0 A;  2DAJ A;  3ZDM C;  3A1Q B;  4GXB A;  3NOB A;  1ZXI A;  2KTR B;  4CO7 A;  1HQR D;  3DBH I;  4CHK A;  3RT3 B;  3KQ4 A;  2LJI A;  1HNW H;  4XWT A;  2RDG A;  4NZL B;  1ROE A;  5D94 A;  4B8T A;  3APD A;  4TQ0 A;  3FAU A;  1TGZ B;  1VZ7 A;  1WJU A;  4XDD A;  1JWU D;  2ZPY A;  4HJG E;  1M4V A;  3KYC D;  2D3B A;  1AW7 A;  2BWF A;  4B95 A;  3GOE A;  1AWD A;  4II2 B;  2YQR A;  3MC8 A;  4WJP A;  3U52 E;  1R4M I;  1WXA A;  2JXX A;  2JSV X;  3KLS X;  2QIE B;  1XNQ H;  1LFD A;  2DBY A;  1N32 H;  1D4B A;  3Q2A C;  4RNA A;  4P1B C;  1EUV B;  1E10 A;  4M0W A;  1N60 A;  2D2Q A;  3A9K A;  1DTJ A;  3DVN V;  1ISN A;  4KKI A;  5TSS A;  1VIH A;  4URK A;  3AE8 B;  4WWO A;  5DPS A;  1KOT A;  4HWI B;  3DVN U;  2BWE S;  1VD2 A;  4I6P A;  2Y3M A;  1R7S A;  1FJG H;  3W1S C;  4MJS A;  2KAC A;  3L0W B;  3AU5 A;  3AEC B;  1L5P A;  3Q3O C;  1QIL A;  2NTT A;  1K52 A;  1RFA A;  3N1X C;  3NS8 A;  4IOI E;  3FAH A;  1NBF C;  2DAF A;  3NZ3 A;  3IAM 1;  2WLB A;  4RGO S;  3IAS 1;  1V2Y A;  3I0P A;  4M0W B;  3WA0 A;  2JVC A;  1A70 A;  3A9K B;  2MP2 A;  4IKG A;  4DV3 H;  3NZS A;  2GBJ A;  4S0R A;  4YTM B;  3BK1 A;  4KV2 A;  4B0E A;  4DV1 H;  1FPY A;  2CU1 A;  3N9Y C;  5FK9 C;  4MJS B;  1R4N B;  4UDU C;  2KFJ A;  1E9M A;  4LFA H;  4BKT A;  1ZDX A;  4HLE A;  1C77 A;  2L0F A;  1FFV A;  3DBL I;  4ZRK A;  1TT5 B;  2KNB A;  3DOW A;  4HKQ A;  2JY6 A;  1VIG A;  4W9H A;  4IUM B;  4DR4 H;  4HK2 A;  2KDF B;  2HE7 A;  4LTU A;  2LHD A;  1NEN B;  1AYF A;  2N9X A;  2UWQ A;  3RPF C;  1SEI A;  2KWU B;  3AI5 A;  1CJE A;  4OD6 A;  2WS3 B;  3AV8 A;  2V3P A;  4DWF A;  5G5G A;  2E3U A;  3AEV B;  4MGY E;  2MWS B;  1E8W A;  2BS4 B;  5T8I A;  5FR6 A;  3BWU D;  1XLP A;  1HE8 A;  2IGD A;  2WQY B;  2X38 A;  3P42 A;  3ZRF A;  1Z2M A;  1JAL A;  4JV5 H;  2HJ8 A;  1X4M A;  3MP9 A;  3EHV A;  4II3 B;  2W3S A;  4YT0 B;  4B3T H;  1TJE A;  2N4F A;  1L2N A;  2MQJ A;  4OVU A;  3WAP A;  2MBE A;  3VH4 B;  1V6E A;  5JH5 C;  4FAD A;  4IDI A;  2V3S A;  3DWG C;  1UEL A;  2DZJ A;  3KH0 A;  4R3D A;  4LJO B;  2LZ6 A;  2VH2 A;  3P1M A;  3KDK A;  3QK0 A;  3VDZ A;  4MT5 A;  4DHZ E;  3UI3 A;  2EMS A;  3OLM D;  2UYZ B;  1T0Q C;  3SFD B;  1TS4 A;  3RD2 A;  1WVN A;  4W9F A;  3ZIM A;  4N59 A;  2R2Q A;  1F2R I;  3Q6B A;  1I4X A;  3V69 A;  4CQN A;  4JI1 H;  3CST A;  2IO3 B;  4NAM A;  3IG3 A;  1UG8 A;  4LNO A;  1P1A A;  4NQL B;  1JRU A;  5CHV C;  4A6Q A;  1L0V B;  2L32 A;  1X9Z A;  4OCH A;  4JQW C;  1IYF A;  1YJI A;  1UWM A;  3P4Q B;  1KLG D;  2IZV B;  3T9L A;  3NVW A;  2TSS A;  3C0R B;  1MI0 A;  1QOF A;  1YNT E;  1XCT L;  5AUK A;  2RPQ A;  2KQS A;  2XBB C;  3UGB B;  1NI3 A;  2QND A;  1HNX H;  4WJO A;  4GMV A;  4NPN A;  2LRR A;  3RN9 C;  2ZCB A;  4TUU A;  1UD7 A;  4WAL A;  1NYR A;  2GI9 A;  5AZF A;  1L0Y B;  2D10 A;  5CTR C;  4IWP A;  4PK1 A;  3H6N A;  1HTO A;  2BKF A;  2GOW A;  3KUD B;  1L0X B;  2MA9 B;  2PTL A;  1WI0 A;  3RNB C;  4MGK E;  3L7Z C;  1QF6 A;  1CMX B;  1UUP A;  3T8M A;  2K1F A;  2ASQ A;  1JRO A;  1FKA H;  4US8 A;  1SXT A;  4A8X C;  2PQU A;  4ZOH C;  2L76 A;  1XLQ A;  2QCZ A;  1SE2 A;  4OVV A;  1ZZI A;  1RLF A;  2KJH B;  3L4P A;  2REX A;  3PS6 A;  3PRE A;  4MEM A;  2KAN A;  3V6C B;  1QOG A;  2DGR A;  1XT9 B;  4B3S H;  1J7B A;  1FRR A;  2JT4 B;  2Z59 B;  4HDQ A;  1E90 A;  1I7H A;  2BGF A;  2Z8L A;  4KDI C;  1N5W A;  2G1E A;  4FUL A;  4DXA B;  4KVG B;  2OOB B;  1X0A A;  2PJH A;  5DT9 A;  2RDH A;  1Y56 A;  1V86 A;  4WJQ A;  2Y5P A;  5C1Z A;  5I4D A;  5BMH A;  5HKH A;  3AEA B;  2YLM A;  1L7Y A;  2L1A A;  3A4R A;  2LFI A;  1T3Q A;  3RCZ A;  2DZM A;  4B8C D;  2KDM A;  2KFK A;  2FCN A;  4MGZ E;  1VRA B;  1YJ1 A;  3W1Y A;  2KLC A;  2GBK A;  3MJW A;  3ZXR A;  1XQQ A;  2KMM A;  3ZGZ A;  1NI2 A;  3KDG A;  1WX8 A;  5BMG A;  4HCN B;  3VXW A;  1DOX A;  1BUI C;  1H4R A;  1TY0 A;  4NBQ A;  1WJN A;  1IBK H;  3L08 A;  4BOS C;  1VZ6 A;  1N33 H;  2BYV E;  3HM6 X;  3PV1 A;  2UUA H;  1T0Y A;  2KQ4 X;  3PO0 A;  1GOZ A;  2JEA I;  3AUL A;  2JX5 A;  5G55 A;  2CTE A;  2LGY A;  1D5M C;  3URY A;  2FPH X;  2RSU A;  4L2Y A;  2KFK B;  1J7A A;  1TS2 A;  2W55 A;  1YMH E;  3W5V B;  2PEA A;  4ASW C;  4W9I A;  3Q14 C;  4C4V B;  1VR9 A;  3OAW A;  4LCD E;  1FCC C;  1IBX B;  2JU6 X;  2LI5 A;  1DOY A;  4PS8 A;  1ENF A;  3P4R B;  3PPA A;  1T5X D;  4N6E B;  2WDV B;  2BTE A;  4Q2J A;  4DV5 H;  5L95 C;  1SF0 A;  3HK0 A;  4ARC A;  2DEN B;  5IO9 A;  1UZX B;  1Q10 A;  1WGY A;  2I38 A;  3WAO A;  4BBN F;  2D3C A;  1WJ6 A;  3KYD D;  4P1C C;  1TS3 A;  3DBH B;  1C79 A;  1PFD A;  2QDF A;  1TIF A;  1WFY A;  1J8C A;  4MGI E;  2L0T A;  3HUI A;  3DHI C;  3P4S B;  2D11 A;  3U8Z A;  1WE7 A;  4JX1 C;  3H8H A;  2KOX A;  1JWM D;  4A55 A;  1WGH A;  3AN1 A;  3PT2 B;  3V6E B;  3VHT C;  3V62 A;  3EFU A;  3QQ8 B;  1A5R A;  3E9S A;  2W3R A;  1E8X A;  2LXC A;  1WGK A;  1VDV A;  2C7H A;  2WP9 B;  3M3J A;  4W9K A;  2I1J A;  3UOE A;  4PS7 A;  1VZ8 A;  1GJZ A;  1V9J A;  3DPD A;  3LYY A;  3DVG X;  3OTO H;  2VQE H;  4X57 B;  3Q8F A;  1SIF A;  3B1L X;  3IVF A;  2AL6 A;  5AUI A;  1IBL H;  3AE6 B;  5LMN H;  2FNJ B;  2IO0 B;  4OW0 A;  2CR5 A;  3RZF A;  1T6B X;  1PUT A;  2QSD A;  3ZJT A;  4BFR A;  4RCO A;  1D5X C;  2K5P A;  3ENE A;  2KO3 A;  3R7R A;  3Q8E A;  2WGS A;  2WXR A;  3V05 A;  2INP E;  2BB6 A;  2CS4 A;  4K1R B;  3R66 C;  4HPP A;  3B2F A;  3PLU A;  4WIP A;  2I1K A;  4TSS A;  4M02 A;  1E7P B;  1ZPS A;  2DWQ A;  3AEF B;  1OQY A;  1FRD A;  3L17 A;  1ODH A;  3R3M A;  1NXU A;  2ZNV C;  2M6Q A;  2L8J A;  2KN5 A;  5AZG A;  2BL5 A;  2LRU A;  3X23 A;  2Y5C A;  2BQQ A;  2BF8 B;  2M17 A;  3JYU A;  5A2Q W;  1UF0 A;  4KZ0 A;  1WY8 A;  1OQQ A;  1C78 A;  3T3N A;  2I2Y A;  1WXQ A;  4DDG D;  3W2D A;  2W82 A;  3OSS D;  4CYE A;  1KLU D;  1P0R A;  2BB5 A;  4KHP H;  1N34 H;  4L1B A;  3X0W A;  4EZJ A;  4WJN A;  2CTL A;  3H7S A;  4JLC A;  3PZD A;  4X64 H;  3ML9 A; 
#chains in the Genus database with same CATH homology
 4MAC A;  1A70 A;  4IKG A;  1V8C A;  3ZQ4 A;  4WWM A;  3EUB 2;  1IUE A;  2JQR B;  4YTM B;  2CJN A;  4DXF A;  3BK1 A;  3VRB B;  2QEJ C;  3BVM A;  2JYE A;  1OQR A;  4B0E A;  1MHX A;  1D5Z C;  4XE0 A;  2WXN A;  3N9Y C;  2FUG 1;  4YTP B;  5FK9 C;  4YSX B;  3BZD B;  4LLG M;  4UDU C;  1K51 A;  1E9M A;  3TEX A;  1ZDX A;  4HRO A;  4KX6 B;  1C77 A;  1LO5 D;  5E6J A;  3Q8A A;  1KF6 B;  1FFV A;  1TS5 A;  3CWI A;  3EA6 A;  1YN3 A;  4GDL B;  1QLB B;  3TSS A;  2V3N A;  4HKQ A;  2BS2 B;  2DYO A;  2WXF A;  1UWX A;  3AE9 B;  3KWV A;  5MPO A;  1F0Z A;  1WYG A;  4LTU A;  1SJE D;  2LHD A;  1JWB D;  2BS3 B;  1NEN B;  1AYF A;  3ETR A;  4LK0 M;  2N9L A;  4WAF A;  3RPF C;  3DWM A;  1QOB A;  4YWG G;  1CJE A;  4OVZ A;  3RFZ B;  3U7Z A;  2PLP A;  5FKA C;  2WS3 B;  3AV8 A;  2V3P A;  2WXM A;  1C9F A;  2JYT A;  4P6V F;  4RGM A;  5G5G A;  1TKY A;  1FCL A;  2BS4 B;  2PW9 A;  5T8I A;  3T3O A;  1FXI A;  1XLP A;  1XXG A;  2IGD A;  2VZK D;  3BWU D;  1XEE A;  4C7Z A;  2WQY B;  2X38 A;  4N58 A;  1K53 A;  2E6X A;  3P42 A;  2J52 A;  1JAL A;  1XCQ L;  2JXT A;  2PVO D;  3MP9 A;  1ZE3 D;  2PIA A;  1XLO A;  2W3S A;  4YT0 B;  3HVD A;  1FNW A;  1P7E A;  1TJE A;  3AMZ A;  1HEZ E;  1N61 A;  2XNA C;  3NVV A;  4AQ7 A;  2MJD A;  1HA5 A;  2J4X A;  1ZXH A;  3AE2 B;  4YXD B;  4IDI A;  3NS1 A;  3TEY A;  1HXY D;  3DWG C;  1C4P A;  4R3D A;  4AS1 A;  1UNS A;  4C56 C;  2IGH A;  3AE7 B;  1FIQ A;  3LXF A;  3P1M A;  5D3D A;  1JML A;  1I4Q A;  5EE0 A;  4YSZ B;  4MT5 A;  5EE3 A;  1CK1 A;  1FNU A;  3AED B;  3TEZ A;  3VR8 B;  4KKJ A;  3UI3 A;  2W54 A;  2BW2 A;  3KWL A;  1PGA A;  1B1Z A;  1F2R C;  1XF5 L;  4ZRQ A;  1TS4 A;  3SFD B;  1MHH E;  4N59 A;  3AE5 B;  2K9X A;  1F2R I;  2WU5 B;  2PVG C;  4OHJ A;  1I4X A;  1ACC A;  1FXA A;  3FC4 A;  1YN4 A;  4CQN A;  4ZRP A;  1FO4 A;  1L4D B;  4NAM A;  2J42 A;  1RWS A;  3IT6 B;  4XWW A;  3AEB B;  3PZ7 A;  2KN4 A;  4A9A A;  2KAJ A;  2WXL A;  2YEP B;  1ZOY B;  1E6E B;  4A6Q A;  1L0V B;  2LEK A;  1MPE A;  2L32 A;  4HRS A;  4RF1 A;  3P63 A;  3SEB A;  2LHE A;  2QJL A;  1YJI A;  2K0P A;  3VQI A;  1UWM A;  3P4Q B;  1V97 A;  1KLG D;  3R2T A;  4DXG A;  1C76 A;  3BVZ A;  1SEB D;  1FEH A;  2AX5 A;  3NVW A;  2TSS A;  3P4P B;  4ZYS A;  3AE3 B;  1HZ5 A;  1MI0 A;  2JZP A;  2Q5W D;  1IGD A;  1QOF A;  4D2K A;  1YNT E;  1IGC A;  1XCT L;  5AUK A;  2WXH A;  1RM6 C;  1SJH D;  3GS2 A;  2IJ0 A;  2D5G A;  3AEE B;  1BXT A;  1KH0 A;  1NI3 A;  4PT5 A;  4US9 A;  4KGS A;  1L6V A;  5C3J B;  4ZHP A;  4P16 A;  3W9C B;  1ZDV A;  1NVI D;  5D3I B;  2ON8 A;  4GLS C;  4A90 A;  1NYR A;  2ZW1 A;  3MHZ A;  2K22 A;  1PDX A;  2GI9 A;  1SB3 C;  1ESF A;  1FMA D;  1L0Y B;  1PGX A;  2RPV A;  1B9R A;  1YQ3 B;  1ZP0 B;  2N0S B;  2QMT A;  3SR6 A;  5BYQ A;  2WXP A;  1EWC A;  1L0X B;  3B9J A;  1WRI A;  3WCQ A;  2PTL A;  3MC0 B;  5BYR A;  4FXC A;  1QF6 A;  2HTM E;  2IGG A;  1UUP A;  2OHF A;  2WXO A;  2H88 B;  3CIR B;  4B0M A;  4OZB A;  5H8Y E;  2PMV A;  1JRO A;  3NRZ A;  2ICI A;  4US8 A;  1SXT A;  4A8X C;  3BII D;  2MH7 A;  4ZOH C;  4RGT A;  2YEP F;  1JRP A;  1STE A;  1EU4 A;  1SE2 A;  1AN8 A;  1XLQ A;  2N9K A;  4OZC A;  2RMM A;  3L4P A;  1DOI A;  1PYW D;  1CQV A;  2WU2 B;  3VRA B;  1I4H A;  1VLB A;  1QOG A;  4USA A;  3OWE B;  4ARI A;  1YJJ A;  1J7B A;  1SSN A;  1FRR A;  1SBB B;  1I7H A;  2Z8L A;  4H2A A;  2WXQ A;  1TYG B;  3B2G A;  1UGJ A;  2KWD A;  1N5W A;  3GP7 A;  1L6U A;  2BBC A;  2MEK A;  2G1E A;  1XLN A;  1KRH A;  5BMI A;  1CZP A;  1JWA D;  4TMA B;  5EE1 A;  1N62 A;  1JW9 D;  4RGN A;  2RDH A;  3Q8C A;  1Y56 A;  2Y5P A;  4RFB A;  5I4D A;  5BMH A;  3AEA B;  2G9H D;  5HI1 A;  3MJ5 A;  2L1A A;  1K50 A;  2LFI A;  2OED A;  4WH4 A;  1T3Q A;  5D7G A;  2QIL A;  1L4Z B;  4JWU C;  1SE4 A;  1KFY B;  3E56 A;  2KDM A;  3NUH B;  1VRA B;  2AQ2 B;  3Q8B A;  4JE3 B;  1JWS D;  3I9V 1;  2WNM A;  1QOA A;  2KMM A;  3ZGZ A;  3TUO A;  3ABV B;  3FIL A;  3ZJV A;  4KGT A;  5BMG A;  2B76 B;  1DOX A;  4WQM A;  1SE3 A;  2MJE A;  2SAK A;  1BUI C;  1JQ4 A;  3U2S C;  1TY0 A;  1ZUD 2;  4YSY B;  2JWU A;  4GDK B;  2L83 A;  1VZ6 A;  4WUR A;  1KTK A;  2NTS A;  4OZA A;  3LB8 C;  3AE1 B;  1MVK A;  3HVZ A;  2ACZ B;  2WXG A;  2KQ4 X;  3R2I A;  1EWY C;  3PO0 A;  1GOZ A;  4ITK A;  4MH8 A;  2GRI A;  3V3X A;  2JX5 A;  3J9C A;  5HFY A;  1P7F A;  1D5M C;  3I57 A;  1BML C;  3URY A;  4L2Y A;  2CJO A;  2MJ3 A;  1J7A A;  1TS2 A;  2W55 A;  1YMH E;  3W5V B;  2WDR B;  1DGJ A;  2IPK D;  3GB1 A;  4L23 A;  3EGR A;  2WXK A;  2E3T A;  1VR9 A;  2V4I B;  3BVG A;  3W5U B;  3AM9 A;  1FCC C;  1TKE A;  1I4R A;  3FIL B;  1IBX B;  2JU6 X;  1DOY A;  1ENF A;  3IXS A;  3P4R B;  4TQ1 A;  1T5X D;  4N6E B;  2WDV B;  3NVY A;  4Q2J A;  4J3O D;  5EE9 A;  2BTE A;  1NYQ A;  1SF0 A;  1VJK A;  4ARC A;  3PZ8 A;  4C7Y A;  4KGR A;  1F77 A;  2SEB D;  1YN5 A;  1Q10 A;  1I4P A;  5G5H A;  5HG2 A;  3R8B A;  2I38 A;  5HHD G;  3AEG B;  4HEA 1;  3BYT B;  1TY2 A;  4RH6 A;  3IT4 B;  2WDQ B;  1TS3 A;  1ET6 A;  1C79 A;  2ZW0 A;  1PFD A;  2LGI A;  1QT9 A;  2WXI A;  4JPS A;  4NJC A;  2FE8 A;  4EE2 A;  5FR3 A;  3HUI A;  2BYT A;  2M19 A;  2DYM A;  2LMC A;  3P4S B;  1I4G A;  2BT6 A;  3NVZ A;  4JX1 C;  2PKO A;  3H8H A;  5GXG B;  1JWM D;  4A55 A;  1RYJ A;  3AN1 A;  2EEL A;  1NEK B;  3E9S A;  3TEW A;  1SIJ A;  2HDE A;  2W3R A;  4RF0 A;  3W1S A;  2V0G A;  1YQ4 B;  5H92 C;  1FD6 A;  3ZJU A;  1WGK A;  1FM0 D;  1ZXI A;  1VDV A;  1GAQ B;  1HQR D;  2ONQ A;  2GB1 A;  3KQ4 A;  2LJI A;  4XWT A;  2RDG A;  2WP9 B;  1GPX A;  2J53 A;  4NZL B;  2IDY A;  4MM3 B;  1V1P A;  1VZ8 A;  3HRD D;  2INN E;  1ROE A;  1EM7 A;  3LYY A;  3BK2 A;  5BYS A;  2M56 B;  1FNV A;  4TQ0 A;  1WWT A;  5JXV A;  1VZ7 A;  1D6E C;  4XDD A;  1JWU D;  2K3U A;  3Q8F A;  4HJG E;  5AUI A;  1M4V A;  3AE6 B;  3O13 A;  4OW0 A;  4O1N A;  1RFK A;  4JWS C;  1GB1 A;  2XN9 C;  1AW7 A;  1T6B X;  1V1O A;  2M0A A;  1PUT A;  2DLB A;  2QSD A;  3ZJT A;  1AWD A;  4RCO A;  2CU3 A;  2EKI A;  3U4E G;  1D5X C;  2K5P A;  3U52 E;  1EU3 A;  2JSV X;  3KLS X;  3Q8E A;  2WXR A;  3V05 A;  1N5X A;  2QIE B;  2INP E;  1N63 A;  2DBY A;  2BB6 A;  1IBX A;  2FBW B;  1D4B A;  3B2F A;  4WIP A;  2LUM A;  4TSS A;  2VZK B;  4RNA A;  4ZHO A;  3AB5 A;  1E7P B;  1ZPS A;  2DWQ A;  1C4A A;  1HZ6 A;  3AEF B;  2L52 A;  1E10 A;  4M0W A;  1V1P B;  2Y3A A;  1N60 A;  2AQ3 B;  3Q69 A;  1TKG A;  1QKZ A;  2N7J A;  1FRD A;  1GB4 A;  4NAW B;  4KKI A;  1QQR A;  1C4C A;  5TSS A;  3AE8 B;  1TZO A;  3AH7 A;  3MFG A;  5LNK 1;  2Y5C A;  1OFF A;  2WXJ A;  2R61 A;  2H89 B;  1R7S A;  1J7C A;  1JCK B;  4DQO C;  2KAC A;  3SFE B;  2AQ1 B;  3ZYY X;  3AEC B;  1OQQ A;  1L5P A;  1C78 A;  3T3N A;  2I2Y A;  1WXQ A;  1DYQ A;  1QIL A;  4HKZ E;  2NTT A;  1K52 A;  2W82 A;  3W2D A;  3AE4 B;  4REZ A;  1KLU D;  1E0Z A;  1FFU A;  2BB5 A;  3VR9 B;  4XDC A;  3C8Y A;  3BYY B;  4YTN B;  4C80 A;  1WSP A;  4L1B A;  4IOI E;  3FAH A;  1ET9 A;  3NZ3 A;  3IAM 1;  2WLB A;  4RGO S;  3IAS 1;  1XO3 A;  5C2T B;  2NMQ A;  1PGB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...