1V8CA

Crystal structure of moad related protein from thermus thermophilus hb8
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
165
structure length
165
Chain Sequence
PKVNLYATFRDLTGKSQLELPGATVGEVLENLVRAYPALKEELFEGEGLAERVSVFLEGRDVRYLQGLSTPLSPGATLDLFPPVAGGGFERTFGAFPPWLLERYLEEWGGTREGEGVYRLPGAVVRFREVEPLKVGSLSIPQLRVEVEGEEAERWFERIAFAASR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MoaD related protein
publication title Crystal Structure of MoaD related protein from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Protein binding
total genus 47
structure length 165
sequence length 165
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02597 ThiS ThiS family
A PF09189 DUF1952 Domain of unknown function (DUF1952)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1v8cA01
3.30.1370.80 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Molybdopterin cofactor biosynthesis MoaD-related, C-terminal domain 1v8cA02
5H8YE 4YT0B 2QIEB 2L83A 3B9JA 3AM9A 1NI3A 2PVOD 3AN1A 1TYGB 3B2FA 2MJEA 2BS2B 2HTME 3AE4B 3AEDB 2OHFA 5H92C 5AUKA 3AB5A 4N6EB 4N59A 4WQMA 1QOFA 3W9CB 1DGJA 1GPXA 1UWMA 4C7YA 1CZPA 2KAJA 2LEKA 3AE7B 3AH7A 2WP9B 3CWIA 2Q5WD 1N62A 3PO0A 4P6VF 2BS3B 1XLNA 4ZOHC 3SFEB 3W5VB 3NVYA 1VLBA 2CJOA 3AV8A 1ZP0B 2WQYB 4C80A 3ABVB 1NVID 1DOXA 3RPFC 2QJLA 4C7ZA 1WYGA 1ZXIA 2H89B 1TKEA 2H88B 3B2GA 3VRBB 2N0SB 2WDVB 2WDQB 3AE6B 3VR8B 1RWSA 1EWYC 2MH7A 1J7CA 1RFKA 2BT6A 4HROA 1N5XA 3VR9B 2M19A 1QOGA 1T3QA 2WDRB 1N63A 1RYJA 1F0ZA 3AE1B 1NENB 1J7AA 2DBYA 1PUTA 4YTMB 1J7BA 1OQQA 4US8A 2WU5B 4YTPB 1GAQB 3AE3B 3AEEB 3P1MA 2CU3A 2DWQA 3NVZA 3HVZA 1FO4A 2WS3B 4A9AA 1AWDA 1OQRA 2K22A 2K5PA 1QOBA 4US9A 3AE2B 3SR6A 1CJEA 4WWMA 3AEAB 2AX5A 2Y5CA 1JROA 4ZHPA 5C2TB 1PFDA 3AEFB 3LB8C 3AEBB 1SF0A 3P4SB 1XLPA 1YQ3B 1A70A 1E10A 3KWLA 4HRSA 1DOYA 2JX5A 3NVVA 3AE9B 3VRAB 3AE8B 1ZOYB 3NS1A 1E9MA 3NVWA 1VJKA 4FXCA 1FIQA 4KX6B 1I7HA 1V97A 1KRHA 1YQ4B 1ZUD2 3EUB2 5MPOA 1QT9A 1TKGA 2BS4B 5AUIA 3SFDB 1ROEA 3P4PB 3P4QB 3AEGB 4IDIA 3AE5B 1NEKB 2E3TA 4ZHOA 1AYFA 4YTNB 2WLBA 1RM6C 2CJNA 4YSXB 1L6UA 1SB3C 4JWSC 1NYQA 1VDVA 4JWUC 2KMMA 3L4PA 1E6EB 2MJDA 3WCQA 1TJEA 1N61A 3HUIA 2G1EA 2PVGC 3DWMA 1L5PA 2FBWB 4USAA 1FXIA 1N60A 1WWTA 3ZYYX 1WGKA 1E7PB 1KFYB 1QF6A 3FC4A 1XLQA 3CIRB 1FFUA 1QOAA 1V8CA 1XO3A 5EE3A 1NYRA 3W5UB 2MJ3A 1JWBD 2W55A 2L52A 3FAHA 3HRDD 1YJJA 1TKYA 4LTUA 2PKOA 1FM0D 2WU2B 5G5GA 1FFVA 1WXQA 1JALA 3ETRA 1JW9D 1JWAD 2W3RA 3AECB 2M56B 3P4RB 5EE0A 4YXDB 1R7SA 1IUEA 1JQ4A 3BIID 3NRZA 4YSZB 1PDXA 2JQRB 1QLBB 1L0VB 1L6VA 2W3SA 1YJIA 4YSYB 5EE9A 3DWGC 4N58A 5C3JB 2PIAA 1FMAD 4ITKA 1KF6B 5GXGB 1JRPA 2EKIA 3LXFA 1B9RA 1FRDA 1N5WA 2B76B 1OFFA 1DOIA 1FRRA 1FXAA 2K9XA 2W54A 5G5HA 2ACZB 1XLOA 3P63A 1WRIA 5EE1A 3AMZA 1E0ZA 4JX1C 1SIJA
chains in the Genus database with same CATH superfamily
1Y8RC 3UQAA 5TR5A 3U7DA 2K6QA 4ACFA 3AH7A 3GABA 4EZJA 4GDLB 1UWXA 1C77A 2CS4A 4E3CA 1DOXA 4LF8H 4IC7B 3VTVA 2JSVX 2IGGA 1C9FA 4ZRQA 2VH2A 2WDRB 3I63C 1J5KA 1MFWA 1H8CA 2JEBI 2QSDA 3X0WA 2FIDA 5FLXW 3TL5A 1D5MC 3P1MA 2JZPA 2KTRA 3KH0A 2WXPA 2PJHA 3ZDTA 3ZTCA 3C19A 4LJPB 2D10A 2Y5CA 1K51A 2K8CA 1GUAB 4N9F4 4GLSC 3A9JB 2NTTA 3ML9A 3PLUA 3MC8A 1UNSA 2MJHA 3NS1A 5LLIA 3GB1A 1YJ1A 3SDLC 1VD2A 4LNNA 3AEGB 3IVFA 4B8TA 1NEKB 2E3TA 1WGHA 2AEHA 4M8NA 3L4PA 3WCQA 1TBEA 2V9HA 4P1CC 4M02A 1ISNA 2LI5A 1FXIA 1N60A 4GU2A 3RNGC 4LCDE 3P42A 4DDGD 3QD7X 1JW9D 1L0YB 1UELA 1DT4A 2ZNVC 2O4CA 1SJHD 2INNE 4WURA 2FCMA 1GC6A 3T3OA 2QMTA 2JVZA 3TSSA 1C78A 2G9HD 2TSSA 3CF6E 3OJ3A 4JE3B 1D3ZA 4PS3A 2NPTB 4YT0B 4TQ0A 2KHWB 3R2TA 1M94A 2I2YA 2O6VB 4C00A 1WRDB 3R66C 1CZPA 1FKAH 4A55A 1UD7A 1WZ0A 2PT7G 4MM3B 3RI7C 1FNVA 1VLBA 1JCKB 1HE8A 1E5WA 4KGRA 3E56A 3RT3B 2WXGA 4M00A 2F4VH 2N7DA 3Q3FA 5EDSA 1GJZA 2KQ7A 3VAWA 1CK1A 1NENB 2MBQA 3P2BA 4YTPB 1GAQB 3EA6A 3NVZA 3EGRA 2UUCH 1KM7A 5FR3A 4WAFA 1MHHE 4B0MA 3BVGA 3QIJA 4XWTA 1SF0A 1FCCC 1UUPA 2J42A 3MTNB 4W9CA 2JX5A 3NVVA 3ZNID 4GGQA 2KVZA 3T3NA 3EFCA 4DV2H 1KLVA 3CMMB 1HEZE 2BS4B 2WXNA 2MP2B 2AWTA 3BVZA 3T1YH 1WGDA 4WJNA 2UUAH 4XYCA 4B8CD 3ZYYX 3DBRI 1WGKA 4OVVA 5J2RA 4ARIA 3I5JC 2M0XA 3ZO5B 3DDCB 3VTWA 4JVHA 1GNUA 1STEA 1P3QU 3DOWA 2AYOB 2E5LH 2A5UA 3RNFC 5G5GA 2M56B 4B95A 2N7JA 4YSYB 1K1GA 3C8YA 4A6QA 2UXDH 1N5WA 3Q8FA 4DHJD 1FXAA 2PMVA 2MBBB 3E9SA 4CHKA 4BOSC 3AMZA 3JSVB 2MBHA 5IT9W 2N1WA 4M01A 2AL3A 5D2MB 2MQJA 3Q3NC 2L0FA 3AEDB 1B1ZA 1LQBA 3KDGA 1V5TA 5LMNH 2WXRA 2NMQA 4WQMA 1AARA 1C79A 1GPXA 3FILB 2L3ZA 4P6VF 1TZ1A 2VRRB 2LGYA 5HFYA 3Q8AA 4ICVA 3GE3C 2D3CA 2QJLA 5AZGA 2UUBH 1WJNA 2WXQA 1J7BA 4JI1H 3AE3B 4FADA 4GIVA 2L76A 3PPAA 4JL9A 4RNAA 2JYTA 2K5PA 4EZLA 2ZVOA 1EF5A 2LTLA 5IN7A 4UDUC 3RN9C 3RNEC 4MJSA 3T9LA 4FJSA 4I6NB 3M62B 1T5XD 1SE9A 4DHZE 3AEFB 1MSZA 3FAUA 4FJVB 1YQ3B 2BYVE 2KX3A 2YEPF 2OPUA 5A2QW 4ANWA 2KLCA 2FCNA 3MP9A 1KHMA 4MH8A 1ROEA 2EMSA 2HE7A 4H8AA 3DVGY 3UF8A 1F1HA 2KTFA 3DBHB 2PLPA 3HIZA 2D11A 1HTQA 2FBWB 4MEMA 3GS2A 2IGHA 4OVUA 1L4ZB 1L0XB 1E7UA 2BYFA 4DR6H 2PKOA 2VQEH 3AULA 3QHTA 3ZW3A 1PDXA 2M17A 4EE2A 1Z2IA 1L0VB 1L6VA 3FKYA 4XZ4A 5GXGB 2LASA 2XK5B 1F77A 2ICIA 4NZLB 1N33H 1I4XA 5JEAG 2BW2A 4IWOA 2DENB 3A1QB 2BBCA 1BT0A 2WX1A 1UG8A 1LM8B 1FEHA 5JHBA 2MJEA 3AE4B 1SEBD 4C7YA 1HNXH 2KAJA 5DPTA 4NY0A 4HLEA 3AV8A 2D5GA 2WXLA 2IDYA 4HDOA 1TKEA 2KDIA 1T0QC 4RGMA 2MH7A 1J7CA 1RFKA 2Z0EB 1T3QA 2DLBA 4DDID 2ZVNA 4M0WB 2DNFA 2K3UA 2G4DB 2GBJA 1Y56A 2VH1A 1C3TA 1QOBA 4A8XC 2MWSB 4ANXA 4NBQA 2KWVB 4BVUC 4AQ7A 2Y3MA 2DGRA 2JZZA 1WE8A 1D5ZC 4DV0H 4MH0E 1A70A 3VRAB 3AE9B 5E6PA 3UOEA 3URYA 1J5EH 3SD5A 2Z59B 2GMIC 4G3XB 3ZNGC 4LF4H 4KDLB 2JVCA 4JI3H 2V3NA 1AYFA 4K7SA 2C5LC 1YQBA 1FXTB 3DBLB 4W9FA 1L4DB 4JWUC 5T8IA 2A1SA 1UH6A 1XT9B 3N9YC 4E9JA 1R4MI 1WXMA 3M95A 3NZ3A 1Q1OA 2PE9A 4P16A 2LGSA 2EMTA 3FAHA 1ZZJA 4IWQA 1NXUA 3GZNI 3KDKA 2CKHB 2W3RA 4NXNH 2MBEA 4HJGE 1E7VA 2IO2B 1JQ4A 2QNDA 4LDTD 2N9PC 2PPHA 2GBNA 1HZ6A 4ANVA 2EKIA 1WR6E 1B9RA 3AU5A 3T8MA 5L83A 2CTKA 1OGWA 5EE1A 4DHZB 2K6DB 4WIPA 3W1SA 2QIEB 4WWPA 5E6JA 4HEA1 4MELA 1F2RC 4W9DA 3W9CB 2DYMA 1UWMA 1I42A 4JPSA 1WHRA 3J80W 2G4SA 1ZZKA 2BS3B 3IAS1 1P7FA 2FFMA 4RF1A 3EZJA 4IOIE 2OJWA 4C80A 2LXAA 2D3GA 4RGNA 5JHAA 1SXTA 2H89B 2H88B 2WDVB 3BY4B 4XC2A 4I6LB 2N4FA 1SE2A 3KQ4A 3AE1B 1TS3A 4YTMB 3WAPA 2O2VB 3RCZA 1SGHA 5BO4B 3AEEB 2CU3A 4G50A 1FO4A 4GKKH 5KHQA 4F7ZA 1WGRA 1I35A 1GB4A 2CWFA 2X06A 1TT5B 3EUB2 5MPOA 3KUZA 2P2RA 2KANA 2FNJB 3VQIA 3N3KB 2ZJDA 4GDLA 2KO3A 4DV3H 4BKTA 1V1PB 4KIKB 4ZYSA 3UI3A 1VDVA 5D94A 4OVZA 2N9KA 2G1EA 2ZW1A 1EO6A 1IPGA 4USAA 2XNAC 2J4XA 4LFAH 3N1XC 3R8BA 4G0NB 1FFUA 1U4AA 3ECIA 3RUIB 1WTJA 1JWBD 2W55A 4MDKE 2DZMA 1T0RC 1IUEA 3WIMA 4KDIC 1Q0WB 3SB1A 2PTLA 3U8ZA 1KF6B 3U4EG 1DOIA 2BB5A 2CHZA 2K9XA 1XLOA 1YIWA 2SEBD 2PQUA 4RFBA 2D2QA 2O6VD 2KYWA 2GLSA 2L7RA 4BBNF 4NZTM 3W5UB 3I0PA 3MC9A 5BYRA 3PS6A 4BBNC 5DPRA 4X66H 5D6JB 1EUVB 1K53A 5BYSA 2ASQA 1L2NA 2CTMA 4XDCA 1I4RA 1I4PA 1XRHA 1RWSA 3Q8BA 3DBSA 4URKA 5E6NA 1SBBB 1WX8A 3BZDB 2AXYA 3PTFC 1Q10A 4JGHB 4L23A 3HM6X 2RPQA 3KLSX 4R3DA 2HJ8A 5C1ZA 2KQ4X 4DUZH 4DXFA 5K36G 3GP7A 4US9A 1WJ4A 4RM8A 3P4SB 1XMQH 2NPTA 2M8SA 3C0RB 2R61A 4IKGA 2O6VA 1HNWH 3EC8A 2Y5BB 3RNAC 1J19A 2KMAA 4DXAB 4DV5H 1QT9A 4YHHH 1IP9A 3DBRB 3ZKJC 4MM3A 2NR2A 1P1AA 4JWSC 2KVRA 2MJDA 2E6XA 3ML8A 2DAJA 1XQQA 3U30A 1I94H 4LK0M 2LXCA 5IO9A 4IFDG 1V8CA 2CTJA 2I1JA 1F52A 1UBQA 2BKFA 2IY1B 4HDQA 1IBKH 2UU9H 1V6EA 2IYDB 3U7ZA 4C56C 3HHMA 3DVNU 4HWIB 2ZPNA 4YXDB 4AM3A 1R7SA 1TS5A 5LMUH 1J0GA 4BKSA 2DYOA 2FUHB 4XWWA 1SSNA 2J0JA 1DTJA 1UBIA 2ACZB 2MP2A 5H8YE 4EZKA 2KC1A 2RPVA 3AM9A 2YVCA 1V49A 2JT4B 3QC8B 1WXAA 3AB5A 2NVUI 3H8HA 4N59A 2C9WB 5D7GA 2IO3B 2RDHA 2RD0A 1JRUA 1ZKHA 1QQRA 1I6UA 2GBRA 2EELA 4HXDA 2JRIB 3H1UA 2V1YA 3R7RA 4JI2H 2N0SB 1F0ZA 3QQ8B 1I4GA 1WZ3A 1OQQA 5CHFA 4FJZA 1YX5B 3TEWA 3ZLZA 1C4PA 3RYTA 1P98A 2CPMA 1PQSA 2UXCH 4ZHPA 4A3OA 3JSVA 4YL8A 2FIFA 3EHVA 1MJDA 5GMVA 4JI7H 2RDBC 4FXCA 1MI0A 1BXTA 2DAFA 1KRHA 2FUG1 3APDA 5TSSA 1ZUD2 3ZUNA 4D2KA 3FILA 1XCQL 1WXSA 3P4PB 1YOVB 3P4QB 4ZRKA 1D6EC 2IO1B 1YN4A 4YSXB 4W9EA 2ZW0A 2IBIB 1NYQA 1WY8A 1N61A 1PGAA 2NCNA 3WAOA 1E8XA 5J17A 2K8BA 1E7PB 3UQBA 3Q6BA 4EOYA 3CIRB 1XO3A 3K9PB 2HTHA 4QMFB 1TKYA 2MEKA 4XGAB 1FFVA 2RDGA 2JE6I 3NJTA 3TCAA 5HKHA 3AECB 2ON8A 1X9ZA 2B3AA 2V4IB 3TIXA 2ONQA 1IBXB 3W1SC 3VFKA 2LRUA 1FD6A 2IJ0A 1FMAD 4ITKA 4MSMB 1XCTL 3RF2A 3AXCA 3B0AA 3UGBB 2KC2A 3PZ8A 1FJGH 2L32A 2N7EA 5JH5C 4J6IA 4XDDA 1HA5A 2PVOD 3Q3MC 2AQ3B 1YMHE 4N6EB 2OEDA 2BTEA 2YQRA 1XD3B 4DXGA 5J18A 2ZCBA 4TKNA 1IBMH 3U2SC 3BYTB 1KH0A 1C76A 2UYZB 4E74A 2PW9A 2GBMA 1M4VA 1EWYC 1T6BX 4P7IA 1RYJA 1PYWD 3TEZA 1QZEA 2WU5B 3V62A 2LHEA 1WGGA 2XK5A 3GE8C 3NOBA 1C1YB 2KDFB 3A1QA 3A4SC 2KKCA 4FJYA 2KQSA 4KVGB 1DOYA 4KX6B 1X4NA 2KT7A 4CQNA 2LVQA 4HCNB 2BVCA 4PS8A 1MHXA 1R4MB 3K9OB 2LWPA 2BB6A 1V2YA 2JWUA 3GZNB 2OOBB 2M8WA 3VKEA 2CR5A 1K50A 5FR6A 3Q8EA 1RRBA 5G55A 1QILA 2QEJC 2RMMA 1UGJA 2R2QA 4JYAH 3QX1A 3DQVA 4BFRA 4AOFA 4M0WA 4NJ7A 3WAMA 1Q5WB 4LTUA 1WXQA 2JEAI 3VDZA 4JI0H 4GMVA 2LD9A 4KKIA 2LJIA 4K7WA 3IFWB 3NZUA 2IPKD 1HZ5A 4MGZE 3IHPC 3ZVVA 2MA9B 4LNFA 2D9IA 5JZEB 1K8RB 2L83A 1UF0A 1KOTA 2VZKB 4HPMB 4W9LA 5AZFA 1X0AA 1SEIA 2Z0DB 3AE7B 4EC5A 4A90A 4WH4A 3SFEB 5LNK1 1FNUA 1ACCA 3AU4A 3ABVB 4DR4H 1VBIA 1J4WA 2ANRA 1PGBA 1WYGA 3DVNV 3AE6B 4DV1H 2QC8A 3PT2B 4MGKE 2LUEA 2LTMA 2N1VA 1JMLA 1N5XA 1QOGA 1P0RA 1J7AA 5FKAC 2CTLA 3Q3OC 2DX5B 1WJ6A 3DHGC 1V86A 3RFZB 1WMHB 2GI9A 3PHWB 3AE2B 4X62H 1OTRB 2BWFA 5CTRC 1TUAA 2AX5A 3O13A 3Q8CA 4HRSA 2L0TA 2QHOA 1VZ7A 1ENFA 1V5OA 1YQ4B 4X57B 2Y3AA 3SFDB 4KV2A 4TUUA 4OZCA 2BF8B 4B3TH 4FLHA 5D3DA 1E6EB 2WXOA 2JXTA 1MG4A 3DPDA 4NQLB 4DHJB 1SE3A 4NNJB 2Z0SA 2O2VA 4LFCH 1NYRA 2KN5A 4B6WA 1YJJA 4LFBH 3RZWC 5DPSA 1KJTA 3QWZB 2G45B 2ZZPB 2M1MA 1OQYA 4YSZB 1V9JA 2WXIA 3L16A 1XXGA 3AI5A 4K3CA 1F2RI 2D3BA 4AP4C 3ZTDA 4AS1A 3VUYA 3KYCD 5G5HA 2W9NA 1E0ZA 4TQ1A 3IBEA 1XNQH 1V1PA 4KIKA 3W1YA 2I1KA 3L17A 2OHFA 4H2AA 2V4LA 4OZBA 4GOCA 3I9V1 1PGXA 1EU3A 2KMCA 3VH3B 1HXYD 1E8WA 2CJOA 1ZP0B 2WQYB 1E8YA 4QAYA 1ZXHA 2SAKA 4ZRPA 2L00B 3B2GA 2N9XA 3VR8B 2BT6A 3UINB 3TEXA 2KDEB 4G11A 1PUTA 4C4VA 4DUYH 2BWES 3RMKC 3DCGA 3UIPB 4F1SA 4AQYH 3ZNZB 4A9AA 1OQRA 3EFUA 1HQRD 4MT5A 3VVWB 1WIAA 1VIHA 5LL6b 2DZKA 1L7YA 3AE8B 3PLVA 1TZOA 4II2B 4K81A 1KLUD 4NAWB 2KFKB 2WGSA 5BMGA 1HR0H 4NAMA 4ZDVA 2R2OA 5BYQA 4HKZE 3BWUD 2M6QA 4RCOA 2ZNVB 1OEYA 1H4RA 2WYQA 1L6UA 2KLGA 4PT5A 2PVGC 1N32H 4IM3A 2J53A 4RGOS 3L13A 3SU8X 3FC4A 4RGTA 1XLQA 4BOZB 4LF9H 3PGEA 2WX0A 3L7ZC 2NS5A 2WXFA 2J7QB 2HD5B 4LF6H 2WHIA 3ZIMA 3BK2A 4W9HA 1LGRA 3ETRA 1EC6A 4JQWC 4FHJA 3P4RB 4GSWA 4RF0A 1VRAB 4YWGG 3QCAA 1OFFA 2KWCA 1D4BA 5BMIA 3UIOB 2OPVA 4II3B 2KFJA 4JX1C 4KHPH 2KXJA 1TYGB 5C23A 2K1FA 2DHZA 1YD8U 1A5RA 4PYZA 3I3TB 3H6NA 5C3JB 4ZYNA 4ZOHC 4C4VB 3W5VB 1MG8A 1XEEA 3R2IA 1VZ8A 4DV7H 1NVID 4HVBA 2DYBA 3RPFC 4C7ZA 3ZDMC 1WM3A 1VZ6A 2K25A 2CTEA 4LNOA 2M19A 3O65B 4LNKA 1GOZA 3KWVA 3J9CA 2OJRA 2KJRA 3ZJUA 1VCBA 2V3PA 2KJHB 3EECA 5JXVA 1JROA 2AQ2B 4WQOB 4K3BA 5KHOA 3KWLA 3B08A 1R4NI 3BVMA 1TIFA 2MX2A 4A3PA 4OD6A 1D5XC 1ZW7A 4LF5H 2FCQA 3J7AK 1LO5D 5IWAH 3KW5B 4WANA 2AL6A 4ZHOA 1YNTE 3VXWA 2JU6X 2N9EB 4GDKB 1WJUA 4KZ0A 5HG2A 1KFYB 1QF6A 1EWCA 4BKSD 2E3UA 2HDEA 2L52A 4KKJA 3HRDD 4WJOA 2WU2B 5BR8H 2N9LA 4KSKC 3H7PB 1UGMA 2M0AA 1T0SC 2YLMA 3Q69A 2RGFA 1C4CA 2B76B 1ZZIA 2HJ1A 1FRRA 2I38A 4MSQB 1WI0A 3TBLD 3NG0A 1PQXA 1IYFA 4AWJA 1OEYJ 3JYUA 1NBFC 3ZJTA 3ENEA 5I4DA 1FPYA 5H92C 2HTME 4GB9A 2ZM6H 4TV3A 4B3MH 3N1YC 4E71A 4LF7H 1X4MA 2Q5WD 2V0GA 4JV5H 4DWFA 1WX9A 3NVYA 1V1OA 2KX0A 3RD2A 2REXA 4BA1I 2HHHH 4EFOA 3VRBB 3NY5A 3A9KB 3MC0B 2G3QB 3SHQA 2YEPB 5IP4D 4BKGA 1N63A 1IBXA 2DBYA 1TGZB 4KGTA 4REZA 4AJYB 4PK1A 2LUMA 4O1NA 4WJPA 4W9GA 3QJZA 3AEAB 2FCSA 5C2TB 4DV4H 3MJ5A 1WVNA 4EEWA 3OJ4B 3S2AA 3NVWA 5AEKB 1V97A 4RH6A 4ASWC 2CWHA 3H7SA 1ZTGA 5AUIA 3R3MA 4NJ6A 1EF1A 3KUDB 3RZFA 3BK1A 4DR1H 1QKZA 4YTNB 1LXDA 4ARCA 1SB3C 1HTOA 4RM9A 1WGYA 1NDDA 5HI1A 1L5PA 2NBWB 4W9IA 4IM0A 2INDC 1ET9A 3DVGX 4ICUA 3Q2AC 3ZGZA 3Q3JA 3AEVB 1JALA 2RSUA 2UWQA 1FCLA 1RAXA 2MBOA 3OG5A 4FULA 2KOXA 3BYYB 4WALA 3VUWA 1P9DU 2KD0A 1QLBB 4L1BA 3V60A 3L54A 1JRPA 4K0KH 1FRDA 3IT4B 2KTRB 2L1AA 1AW7A 2J52A 3QAQA 3HK0A 3IG3A 1JWUD 2KN4A 1SIJA 2IGDA 5IAAC 1JWSD 4HPLB 3AN1A 2KWUB 2VZKD 2BS2B 4B3RH 2K39A 2CPQA 4MACA 3NS8A 1N62A 3D32A 1C4AA 3NHEB 2JPHA 3OSSD 1V80A 2M4NA 4TSSA 4DR5H 5CHVC 1RLFA 3VR9B 2JRHA 1F0XA 1XMOH 3L08A 4TMAB 2WXHA 2WS3B 3NCVA 2K22A 2KZRA 4F8CB 2CU1A 4NXMH 3OWEB 4CO7A 3V3XA 3SR6A 1NI2A 1TY2A 4WWMA 4NPNA 2PE6B 4JI4H 1YN3A 1PFDA 2KDMA 1BMLC 2LVOA 3VTUA 4HKQA 3NUHB 1VJKA 1FIQA 3RULA 1I7HA 2FPHX 1FNWA 4G08A 1Z5SB 2CHXA 2ANNA 4OX9H 1AN8A 1ESFA 4OO1G 3IT6B 3BINA 1GG3A 3TEYA 1RM6C 3X23A 3PRMB 2LGXA 4NZRM 4EKUA 2JUOA 2D07B 4YY3H 1XNRH 3J81W 4FA6A 5DPWA 3M63B 2K8HA 1KLGD 3V6CB 1WMHA 4OHJA 3TMPB 2BYTA 2LRRA 4DV6H 3DHIC 1VIGA 2MHJA 2HH2A 3NRZA 1E8ZA 1BUIC 4Q2JA 1WE6A 3Q14C 1V81A 3A4RA 3ONSA 1TS4A 1S3SG 2BQQA 2ZCCA 2AQ1B 2LMCA 4DR2H 3B9JA 3M3JA 3QK0A 4WJQA 3JAMW 3L0WB 2QILA 1QOFA 4BAXA 2C7HA 2LEKA 5G2NA 3PO0A 4ZRIA 1I4HA 2XBBC 3HM3A 2FMRA 2CHWA 2BL5A 2NBVB 4DBGA 1ZE3D 3DHHC 1WFYA 4PYUA 4BZAA 2EKEC 2ZQEA 1S03G 4US8A 3LJ3A 2GOWA 3PSEB 2MCNB 2WXKA 3OAWA 3HVZA 1AWDA 5AZHA 2PY9A 2XEWA 4JI8H 1N34H 4FBJB 5DT9A 4IM2A 4IUMB 3LB8C 4J3OD 3AEBB 4RMAA 2PEAA 4MGYE 1YN5A 4LLGM 1ZOYB 1TKGA 2KWDA 5E6OA 4KGSA 1ZGUB 1ZPSA 3AE5B 3GR5A 4LNIA 4B9KA 2G8YA 4NJCA 2GB1A 3QARA 2C7MB 4JIOU 3PREA 1SJED 2KDBA 4PDBA 3DWMA 1TTNA 4S0RA 3WA0A 2BGFA 1IGCA 4NQKE 2JWZA 1QOAA 5EE3A 2KJ6A 3KVFB 3JVZX 1EU4A 4CYEA 4K7UA 3R7QA 4BA2I 3MJWA 3HVDA 4M8MA 2INCC 1V9NA 2V3SA 2K1HA 4IWPA 3OETA 2JF5A 4AJWA 4PS7A 1WXVA 5EE9A 3IAM1 3KYDD 3APFA 2LFIA 5LXHA 1WM2A 3SEBA 4NAWA 2KFKA 1HNZH 3V69A 2INPE 4MJSB 1ODHA 3N1ZC 1MVKA 3PV1A 1UZXB 2LHDA 1NI3A 5FK9C 3LDZE 2IZVB 2WP9B 3CWIA 4HK2A 3TJPA 1CQVA 4S17A 1GB1A 2UXBH 4KZCA 3TUOA 3MFGA 2LZ6A 1WE7A 3ZQ4A 2DZJA 4DQOC 2J0MA 1VR9A 1ZXIA 2KNBA 5D3IB 2WDQB 4A20A 3APCA 1TY0A 3WALA 4OZAA 4K1RB 4DK5A 2DZIA 5C0XG 1R4NB 2DWQA 2RR9A 2XN9C 5BMHA 4XE0A 4ANUA 2X8XX 2A4ZA 1TS2A 2BPSA 3N32A 3ZJVA 1ZDVA 4XX5A 3ZXVA 2C60A 3V6EB 4IDIA 4B3SH 3B1LX 3U1KA 2WLBA 2CJNA 2QCZA 2WXJA 2KK8A 2J0KA 3PZDA 5HHDG 5L95C 2KMMA 4GN1A 1YX6B 3HUIA 1ET6A 2Z8LA 2LGDA 2X38A 2BYEA 4HCPB 2JA9A 3VHTC 2L8JA 1WR1A 3MHZA 3DBHI 2IO0B 1P7EA 4JLCA 3GKUA 1FM0D 1AN7A 3PHXB 3A33B 5LXIB 4MGIE 2MSED 2L05A 2JZ3B 3PRPB 4JVYA 4GKJH 1WSPA 1X1MA 3GOEA 4JI5H 1T0YA 4AUQC 2PIAA 3IXSA 4OCHA 3RNCC 4X65H 1S20A 4DR7H 4OW0A 3ZXRA 1KTKA 1ZDXA 1J8CA 3MHSD 3VH4B 3PRZA 2ZEQA 1MPEA 2QDFA 1K52A 2MRPA 2MLBA 1I4QA 5IKCM 2LF0A 2HH3A 5CX3A 2Y5PA 3B2FA 2CTFA 4WWNA 5AUKA 4GDKA 4FHKA 1DGJA 2GBKA 1GC7A 3N20C 4W9KA 3OLMD 4B0EA 1Z2MA 1XLNA 3WANA 2NN6G 2KACA 2FAZA 2W82A 2BA0A 1DYQA 2LRWA 1N6ZA 4IG7B 4HROA 5DCNA 1WYWB 3H7PA 3H9DA 2C7NB 2UU7A 4HJKA 2VKCA 3VUXA 1LFDA 2D3AA 1JWMD 2LJ5A 3I57A 4HPPA 4X64H 3KUCB 1IGDA 1WX7A 2JYEA 3U52E 2GRIA 4IW0A 1CJEA 4WAAA 3W2DA 1XLPA 1E10A 2WDTB 3V05A 4ZRJA 1N36H 1E9MA 2VQFH 1SE4A 2LVPA 4P1BC 2JY6A 3ALBA 2JXXA 3V61A 3QA8A 1WH3A 2MW5A 3LYYA 1RFAA 5IOIA 3ZRFA 2WXMA 2NTSA 3A9JA 3PZ7A 5CHWA 1S1QB 3CSFA 2NBUA 1TJEA 3A9KA 1IBLH 2BKRB 3NZSA 3N30A 3PVLA 4KSLC 4DR3H 1WWTA 4W9JA 2JZXA 4AIMA 2LGIA 1XF5L 3JW0X 2FE8A 2K0PA 2MJ3A 4WWOA 2WNMA 3DBLI 1WF9A 4FN2A 3ZRCA 1JWAD 3CSTA 1G6JA 3OTOH 1SIFA 2ZPYA 5EE0A 4FJUA 1F9JA 2WWZA 3T1HH 3BIID 2JQRB 4LDTB 4JI6H 2W3SA 4LIJA 1YJIA 2IY0B 3DWGC 4N58A 4L2YA 4LJOB 3LXFA 4EUTA 1CMXB 1EM7A 4I6PA 1E90A 3ZNHB 2W54A 3L10B 3RNBC 3P63A 5IA7A 1WRIA 4GXBA
chains in the Genus database with same CATH topology
4WIPA 3W1SA 1JWSD 2QIEB 2L83A 5E6JA 3AN1A 2VZKD 2BS2B 2VZKB 4HEA1 1F2RC 3W9CB 2DYMA 1UWMA 4MACA 3AE7B 3AH7A 4JPSA 4A90A 4WH4A 1N62A 2BS3B 1C4AA 3SFEB 5LNK1 3IAS1 4GDLB 1P7FA 4RF1A 1FNUA 1UWXA 1ACCA 1C77A 4IOIE 4C80A 4TSSA 3ABVB 4RGNA 1DOXA 1PGBA 1SXTA 1WYGA 2H89B 2H88B 2JSVX 2IGGA 2WDVB 3AE6B 1C9FA 4ZRQA 3VR9B 1JMLA 1N5XA 1SE2A 1QOGA 2WDRB 3KQ4A 3AE1B 1J7AA 5FKAC 1TS3A 4YTMB 2QSDA 4TMAB 3AEEB 3RFZB 1D5MC 2WXHA 3P1MA 2CU3A 2JZPA 1FO4A 2WS3B 2K22A 2GI9A 2WXPA 3OWEB 3AE2B 3V3XA 3SR6A 1TY2A 4WWMA 2AX5A 2Y5CA 3O13A 1K51A 1YN3A 1PFDA 2KDMA 4GLSC 2NTTA 1BMLC 3Q8CA 4HRSA 1GB4A 1UNSA 4HKQA 1VZ7A 1ENFA 3NS1A 3NUHB 1VJKA 1FIQA 1I7HA 1YQ4B 3EUB2 3GB1A 1FNWA 5MPOA 2Y3AA 3SFDB 3VQIA 1AN8A 1ESFA 3AEGB 3IT6B 1NEKB 2E3TA 3TEYA 1RM6C 1V1PB 4OZCA 4ZYSA 3UI3A 1VDVA 5D3DA 3WCQA 3L4PA 1E6EB 4OVZA 2WXOA 2JXTA 2N9KA 2G1EA 2ZW1A 1SE3A 4USAA 1FXIA 1N60A 2XNAC 2J4XA 3R8BA 1FFUA 1NYRA 3P42A 1JWBD 2W55A 1KLGD 1YJJA 4OHJA 2BYTA 1JW9D 1L0YB 1SJHD 1IUEA 2INNE 4WURA 3NRZA 4YSZB 1BUIC 3T3OA 4Q2JA 2PTLA 2WXIA 1XXGA 2QMTA 1KF6B 1F2RI 3U4EG 1DOIA 1TS4A 4AS1A 3TSSA 2BB5A 2K9XA 5G5HA 1C78A 1XLOA 2G9HD 2TSSA 1E0ZA 2SEBD 4TQ1A 4JE3B 4YT0B 2AQ1B 4RFBA 2LMCA 1V1PA 3B9JA 4TQ0A 3R2TA 2I2YA 2OHFA 4H2AA 4OZBA 2QILA 1QOFA 3I9V1 1CZPA 1PGXA 2LEKA 3W5UB 1EU3A 3PO0A 5BYRA 4A55A 1I4HA 1HXYD 4MM3B 1FNVA 1VLBA 2CJOA 1JCKB 1ZP0B 2WQYB 4KGRA 3E56A 1K53A 5BYSA 2WXGA 1ZE3D 1ZXHA 2SAKA 4XDCA 4ZRPA 1I4RA 1I4PA 3B2GA 3VR8B 1RWSA 2BT6A 3Q8BA 3TEXA 1SBBB 1CK1A 1NENB 1PUTA 3BZDB 4US8A 4YTPB 1GAQB 1Q10A 4L23A 2WXKA 4R3DA 3KLSX 3EA6A 3NVZA 3HVZA 2KQ4X 3EGRA 1AWDA 1OQRA 4A9AA 1HQRD 4DXFA 4MT5A 3GP7A 4US9A 5FR3A 4WAFA 1MHHE 4B0MA 3BVGA 3LB8C 4J3OD 3AEBB 1SF0A 3P4SB 4XWTA 1FCCC 1UUPA 2J42A 1YN5A 2JX5A 2R61A 3NVVA 3AE8B 4IKGA 1TZOA 4LLGM 1KLUD 1ZOYB 4NAWB 5BMGA 3T3NA 4NAMA 1HEZE 5BYQA 1QT9A 1TKGA 2BS4B 2KWDA 2WXNA 4HKZE 4KGSA 3BWUD 3BVZA 1ZPSA 3AE5B 4RCOA 1L6UA 4NJCA 4JWSC 2GB1A 2MJDA 2E6XA 4PT5A 2PVGC 1SJED 3DWMA 4LK0M 3ZYYX 2J53A 1WGKA 4RGOS 4ARIA 1IGCA 3FC4A 4RGTA 1XLQA 1QOAA 1V8CA 5EE3A 2WXFA 1STEA 5G5GA 1EU4A 3BK2A 3ETRA 3HVDA 2M56B 3U7ZA 4C56C 3P4RB 4YXDB 1R7SA 2N7JA 1TS5A 4YSYB 5EE9A 3IAM1 4RF0A 3C8YA 2LFIA 4A6QA 1VRAB 2DYOA 3SEBA 4YWGG 4XWWA 1SSNA 1N5WA 1OFFA 3Q8FA 1D4BA 1FXAA 2PMVA 5BMIA 2INPE 3E9SA 2ACZB 3AMZA 1MVKA 4JX1C 5H8YE 2LHDA 2RPVA 3AM9A 1NI3A 1TYGB 5FK9C 3AEDB 1B1ZA 3AB5A 3H8HA 2WXRA 2NMQA 4N59A 4WQMA 1C79A 1GPXA 3FILB 5D7GA 4P6VF 5C3JB 2WP9B 3CWIA 4ZOHC 1GB1A 1CQVA 3W5VB 1XEEA 2RDHA 3TUOA 3R2IA 1VZ8A 3MFGA 5HFYA 3Q8AA 1QQRA 3ZQ4A 4DQOC 1NVID 2EELA 1VR9A 3RPFC 2QJLA 4C7ZA 1ZXIA 5D3IB 2N0SB 2WDQB 1VZ6A 2M19A 1TY0A 4OZAA 1F0ZA 1I4GA 2WXQA 1J7BA 1OQQA 3TEWA 3AE3B 1C4PA 1GOZA 2DWQA 3KWVA 4RNAA 1SIJA 2JYTA 3J9CA 2K5PA 3ZJUA 2XN9C 4UDUC 5BMHA 2V3PA 4XE0A 5JXVA 1JROA 4ZHPA 1T5XD 3AEFB 2AQ2B 1YQ3B 3KWLA 2YEPF 3BVMA 1TS2A 4FXCA 3ZJVA 1ZDVA 1MI0A 1BXTA 2FUG1 1KRHA 3MP9A 5TSSA 1ZUD2 1D5XC 4D2KA 4MH8A 1LO5D 3FILA 1XCQL 1ROEA 3P4PB 3P4QB 4IDIA 1D6EC 4ZHOA 2WLBA 1YN4A 1YNTE 2CJNA 4YSXB 2WXJA 2ZW0A 2JU6X 1NYQA 5HHDG 2KMMA 4GDKB 1N61A 1PGAA 2PLPA 1ET6A 3HUIA 2FBWB 2Z8LA 2X38A 3GS2A 2IGHA 1E7PB 1L4ZB 5HG2A 1KFYB 1QF6A 1EWCA 1L0XB 3CIRB 1XO3A 3MHZA 2HDEA 2L52A 4KKJA 3HRDD 1P7EA 1TKYA 2MEKA 1FM0D 2PKOA 2WU2B 1FFVA 2N9LA 2RDGA 3AECB 2ON8A 2V4IB 2M0AA 2ONQA 1IBXB 1WSPA 1PDXA 4EE2A 1L0VB 1L6VA 1FD6A 2IJ0A 3Q69A 2PIAA 1FMAD 3IXSA 4ITKA 5GXGB 1F77A 1C4CA 2ICIA 1XCTL 4NZLB 2B76B 4OW0A 1FRRA 1KTKA 1ZDXA 1I4XA 2I38A 2BW2A 1MPEA 3PZ8A 2BBCA 1K52A 2L32A 1I4QA 4XDDA 1FEHA 3ZJTA 1HA5A 2PVOD 2Y5PA 3B2FA 5I4DA 2MJEA 5H92C 2HTME 3AE4B 2AQ3B 1YMHE 5AUKA 4N6EB 2OEDA 2BTEA 1SEBD 1DGJA 4C7YA 2KAJA 4B0EA 4DXGA 2Q5WD 2V0GA 1XLNA 3NVYA 1V1OA 3U2SC 2KACA 2W82A 3AV8A 2D5GA 3BYTB 1DYQA 2WXLA 1KH0A 2IDYA 1C76A 1TKEA 3VRBB 2PW9A 1M4VA 1EWYC 3MC0B 2MH7A 1J7CA 1RFKA 1T6BX 4HROA 4RGMA 1T3QA 2YEPB 2DLBA 1N63A 1RYJA 1IBXA 2DBYA 1JWMD 1PYWD 3I57A 3TEZA 2WU5B 4KGTA 4REZA 2LHEA 1IGDA 2JYEA 2K3UA 3U52E 1Y56A 2LUMA 1QOBA 2GRIA 4O1NA 1CJEA 4A8XC 3AEAB 3W2DA 4AQ7A 5C2TB 1D5ZC 1XLPA 1E10A 1A70A 3MJ5A 1DOYA 3VRAB 3AE9B 3V05A 3NVWA 1E9MA 4KX6B 4CQNA 3URYA 1SE4A 1V97A 4RH6A 5AUIA 3BK1A 3LYYA 1MHXA 2V3NA 1AYFA 1QKZA 4YTNB 2WXMA 4ARCA 2NTSA 3PZ7A 1SB3C 2BB6A 1L4DB 2JWUA 4JWUC 5T8IA 1TJEA 1K50A 5HI1A 3Q8EA 1QILA 2QEJC 1L5PA 1UGJA 2RMMA 3N9YC 1WWTA 2LGIA 1XF5L 3NZ3A 2FE8A 2K0PA 2MJ3A 2WNMA 4M0WA 4P16A 1ET9A 3FAHA 4LTUA 3ZGZA 1WXQA 1JALA 1JWAD 1FCLA 2W3RA 3BYYB 4HJGE 4KKIA 5EE0A 2LJIA 1JQ4A 3BIID 2JQRB 1QLBB 4L1BA 2IPKD 2W3SA 1YJIA 1HZ6A 3DWGC 4N58A 1HZ5A 4L2YA 1JRPA 2EKIA 3LXFA 1B9RA 1EM7A 1FRDA 3IT4B 2L1AA 1AW7A 2J52A 2W54A 3P63A 5EE1A 1WRIA 1JWUD 2KN4A 2IGDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5H8Y E;  4YT0 B;  2QIE B;  2L83 A;  3B9J A;  3AM9 A;  1NI3 A;  2PVO D;  3AN1 A;  1TYG B;  3B2F A;  2MJE A;  2BS2 B;  2HTM E;  3AE4 B;  3AED B;  2OHF A;  5H92 C;  5AUK A;  3AB5 A;  4N6E B;  4N59 A;  4WQM A;  1QOF A;  3W9C B;  1DGJ A;  1GPX A;  1UWM A;  4C7Y A;  1CZP A;  2KAJ A;  2LEK A;  3AE7 B;  3AH7 A;  2WP9 B;  3CWI A;  2Q5W D;  1N62 A;  3PO0 A;  4P6V F;  2BS3 B;  1XLN A;  4ZOH C;  3SFE B;  3W5V B;  3NVY A;  1VLB A;  2CJO A;  3AV8 A;  1ZP0 B;  2WQY B;  4C80 A;  3ABV B;  1NVI D;  1DOX A;  3RPF C;  2QJL A;  4C7Z A;  1WYG A;  1ZXI A;  2H89 B;  1TKE A;  2H88 B;  3B2G A;  3VRB B;  2N0S B;  2WDV B;  2WDQ B;  3AE6 B;  3VR8 B;  1RWS A;  1EWY C;  2MH7 A;  1J7C A;  1RFK A;  2BT6 A;  4HRO A;  1N5X A;  3VR9 B;  2M19 A;  1QOG A;  1T3Q A;  2WDR B;  1N63 A;  1RYJ A;  1F0Z A;  3AE1 B;  1NEN B;  1J7A A;  2DBY A;  1PUT A;  4YTM B;  1J7B A;  1OQQ A;  4US8 A;  2WU5 B;  4YTP B;  1GAQ B;  3AE3 B;  3AEE B;  3P1M A;  2CU3 A;  2DWQ A;  3NVZ A;  3HVZ A;  1FO4 A;  2WS3 B;  4A9A A;  1AWD A;  1OQR A;  2K22 A;  2K5P A;  1QOB A;  4US9 A;  3AE2 B;  3SR6 A;  1CJE A;  4WWM A;  3AEA B;  2AX5 A;  2Y5C A;  1JRO A;  4ZHP A;  5C2T B;  1PFD A;  3AEF B;  3LB8 C;  3AEB B;  1SF0 A;  3P4S B;  1XLP A;  1YQ3 B;  1A70 A;  1E10 A;  3KWL A;  4HRS A;  1DOY A;  2JX5 A;  3NVV A;  3AE9 B;  3VRA B;  3AE8 B;  1ZOY B;  3NS1 A;  1E9M A;  3NVW A;  1VJK A;  4FXC A;  1FIQ A;  4KX6 B;  1I7H A;  1V97 A;  1KRH A;  1YQ4 B;  1ZUD 2;  3EUB 2;  5MPO A;  1QT9 A;  1TKG A;  2BS4 B;  5AUI A;  3SFD B;  1ROE A;  3P4P B;  3P4Q B;  3AEG B;  4IDI A;  3AE5 B;  1NEK B;  2E3T A;  4ZHO A;  1AYF A;  4YTN B;  2WLB A;  1RM6 C;  2CJN A;  4YSX B;  1L6U A;  1SB3 C;  4JWS C;  1NYQ A;  1VDV A;  4JWU C;  2KMM A;  3L4P A;  1E6E B;  2MJD A;  3WCQ A;  1TJE A;  1N61 A;  3HUI A;  2G1E A;  2PVG C;  3DWM A;  1L5P A;  2FBW B;  4USA A;  1FXI A;  1N60 A;  1WWT A;  3ZYY X;  1WGK A;  1E7P B;  1KFY B;  1QF6 A;  3FC4 A;  1XLQ A;  3CIR B;  1FFU A;  1QOA A;  1V8C A;  1XO3 A;  5EE3 A;  1NYR A;  3W5U B;  2MJ3 A;  1JWB D;  2W55 A;  2L52 A;  3FAH A;  3HRD D;  1YJJ A;  1TKY A;  4LTU A;  2PKO A;  1FM0 D;  2WU2 B;  5G5G A;  1FFV A;  1WXQ A;  1JAL A;  3ETR A;  1JW9 D;  1JWA D;  2W3R A;  3AEC B;  2M56 B;  3P4R B;  5EE0 A;  4YXD B;  1R7S A;  1IUE A;  1JQ4 A;  3BII D;  3NRZ A;  4YSZ B;  1PDX A;  2JQR B;  1QLB B;  1L0V B;  1L6V A;  2W3S A;  1YJI A;  4YSY B;  5EE9 A;  3DWG C;  4N58 A;  5C3J B;  2PIA A;  1FMA D;  4ITK A;  1KF6 B;  5GXG B;  1JRP A;  2EKI A;  3LXF A;  1B9R A;  1FRD A;  1N5W A;  2B76 B;  1OFF A;  1DOI A;  1FRR A;  1FXA A;  2K9X A;  2W54 A;  5G5H A;  2ACZ B;  1XLO A;  3P63 A;  1WRI A;  5EE1 A;  3AMZ A;  1E0Z A;  4JX1 C;  1SIJ A; 
#chains in the Genus database with same CATH topology
 1Y8R C;  3UQA A;  5TR5 A;  3U7D A;  2K6Q A;  4ACF A;  3AH7 A;  3GAB A;  4EZJ A;  4GDL B;  1UWX A;  1C77 A;  2CS4 A;  4E3C A;  1DOX A;  4LF8 H;  4IC7 B;  3VTV A;  2JSV X;  2IGG A;  1C9F A;  4ZRQ A;  2VH2 A;  2WDR B;  3I63 C;  1J5K A;  1MFW A;  1H8C A;  2JEB I;  2QSD A;  3X0W A;  2FID A;  5FLX W;  3TL5 A;  1D5M C;  3P1M A;  2JZP A;  2KTR A;  3KH0 A;  2WXP A;  2PJH A;  3ZDT A;  3ZTC A;  3C19 A;  4LJP B;  2D10 A;  2Y5C A;  1K51 A;  2K8C A;  1GUA B;  4N9F 4;  4GLS C;  3A9J B;  2NTT A;  3ML9 A;  3PLU A;  3MC8 A;  1UNS A;  2MJH A;  3NS1 A;  5LLI A;  3GB1 A;  1YJ1 A;  3SDL C;  1VD2 A;  4LNN A;  3AEG B;  3IVF A;  4B8T A;  1NEK B;  2E3T A;  1WGH A;  2AEH A;  4M8N A;  3L4P A;  3WCQ A;  1TBE A;  2V9H A;  4P1C C;  4M02 A;  1ISN A;  2LI5 A;  1FXI A;  1N60 A;  4GU2 A;  3RNG C;  4LCD E;  3P42 A;  4DDG D;  3QD7 X;  1JW9 D;  1L0Y B;  1UEL A;  1DT4 A;  2ZNV C;  2O4C A;  1SJH D;  2INN E;  4WUR A;  2FCM A;  1GC6 A;  3T3O A;  2QMT A;  2JVZ A;  3TSS A;  1C78 A;  2G9H D;  2TSS A;  3CF6 E;  3OJ3 A;  4JE3 B;  1D3Z A;  4PS3 A;  2NPT B;  4YT0 B;  4TQ0 A;  2KHW B;  3R2T A;  1M94 A;  2I2Y A;  2O6V B;  4C00 A;  1WRD B;  3R66 C;  1CZP A;  1FKA H;  4A55 A;  1UD7 A;  1WZ0 A;  2PT7 G;  4MM3 B;  3RI7 C;  1FNV A;  1VLB A;  1JCK B;  1HE8 A;  1E5W A;  4KGR A;  3E56 A;  3RT3 B;  2WXG A;  4M00 A;  2F4V H;  2N7D A;  3Q3F A;  5EDS A;  1GJZ A;  2KQ7 A;  3VAW A;  1CK1 A;  1NEN B;  2MBQ A;  3P2B A;  4YTP B;  1GAQ B;  3EA6 A;  3NVZ A;  3EGR A;  2UUC H;  1KM7 A;  5FR3 A;  4WAF A;  1MHH E;  4B0M A;  3BVG A;  3QIJ A;  4XWT A;  1SF0 A;  1FCC C;  1UUP A;  2J42 A;  3MTN B;  4W9C A;  2JX5 A;  3NVV A;  3ZNI D;  4GGQ A;  2KVZ A;  3T3N A;  3EFC A;  4DV2 H;  1KLV A;  3CMM B;  1HEZ E;  2BS4 B;  2WXN A;  2MP2 B;  2AWT A;  3BVZ A;  3T1Y H;  1WGD A;  4WJN A;  2UUA H;  4XYC A;  4B8C D;  3ZYY X;  3DBR I;  1WGK A;  4OVV A;  5J2R A;  4ARI A;  3I5J C;  2M0X A;  3ZO5 B;  3DDC B;  3VTW A;  4JVH A;  1GNU A;  1STE A;  1P3Q U;  3DOW A;  2AYO B;  2E5L H;  2A5U A;  3RNF C;  5G5G A;  2M56 B;  4B95 A;  2N7J A;  4YSY B;  1K1G A;  3C8Y A;  4A6Q A;  2UXD H;  1N5W A;  3Q8F A;  4DHJ D;  1FXA A;  2PMV A;  2MBB B;  3E9S A;  4CHK A;  4BOS C;  3AMZ A;  3JSV B;  2MBH A;  5IT9 W;  2N1W A;  4M01 A;  2AL3 A;  5D2M B;  2MQJ A;  3Q3N C;  2L0F A;  3AED B;  1B1Z A;  1LQB A;  3KDG A;  1V5T A;  5LMN H;  2WXR A;  2NMQ A;  4WQM A;  1AAR A;  1C79 A;  1GPX A;  3FIL B;  2L3Z A;  4P6V F;  1TZ1 A;  2VRR B;  2LGY A;  5HFY A;  3Q8A A;  4ICV A;  3GE3 C;  2D3C A;  2QJL A;  5AZG A;  2UUB H;  1WJN A;  2WXQ A;  1J7B A;  4JI1 H;  3AE3 B;  4FAD A;  4GIV A;  2L76 A;  3PPA A;  4JL9 A;  4RNA A;  2JYT A;  2K5P A;  4EZL A;  2ZVO A;  1EF5 A;  2LTL A;  5IN7 A;  4UDU C;  3RN9 C;  3RNE C;  4MJS A;  3T9L A;  4FJS A;  4I6N B;  3M62 B;  1T5X D;  1SE9 A;  4DHZ E;  3AEF B;  1MSZ A;  3FAU A;  4FJV B;  1YQ3 B;  2BYV E;  2KX3 A;  2YEP F;  2OPU A;  5A2Q W;  4ANW A;  2KLC A;  2FCN A;  3MP9 A;  1KHM A;  4MH8 A;  1ROE A;  2EMS A;  2HE7 A;  4H8A A;  3DVG Y;  3UF8 A;  1F1H A;  2KTF A;  3DBH B;  2PLP A;  3HIZ A;  2D11 A;  1HTQ A;  2FBW B;  4MEM A;  3GS2 A;  2IGH A;  4OVU A;  1L4Z B;  1L0X B;  1E7U A;  2BYF A;  4DR6 H;  2PKO A;  2VQE H;  3AUL A;  3QHT A;  3ZW3 A;  1PDX A;  2M17 A;  4EE2 A;  1Z2I A;  1L0V B;  1L6V A;  3FKY A;  4XZ4 A;  5GXG B;  2LAS A;  2XK5 B;  1F77 A;  2ICI A;  4NZL B;  1N33 H;  1I4X A;  5JEA G;  2BW2 A;  4IWO A;  2DEN B;  3A1Q B;  2BBC A;  1BT0 A;  2WX1 A;  1UG8 A;  1LM8 B;  1FEH A;  5JHB A;  2MJE A;  3AE4 B;  1SEB D;  4C7Y A;  1HNX H;  2KAJ A;  5DPT A;  4NY0 A;  4HLE A;  3AV8 A;  2D5G A;  2WXL A;  2IDY A;  4HDO A;  1TKE A;  2KDI A;  1T0Q C;  4RGM A;  2MH7 A;  1J7C A;  1RFK A;  2Z0E B;  1T3Q A;  2DLB A;  4DDI D;  2ZVN A;  4M0W B;  2DNF A;  2K3U A;  2G4D B;  2GBJ A;  1Y56 A;  2VH1 A;  1C3T A;  1QOB A;  4A8X C;  2MWS B;  4ANX A;  4NBQ A;  2KWV B;  4BVU C;  4AQ7 A;  2Y3M A;  2DGR A;  2JZZ A;  1WE8 A;  1D5Z C;  4DV0 H;  4MH0 E;  1A70 A;  3VRA B;  3AE9 B;  5E6P A;  3UOE A;  3URY A;  1J5E H;  3SD5 A;  2Z59 B;  2GMI C;  4G3X B;  3ZNG C;  4LF4 H;  4KDL B;  2JVC A;  4JI3 H;  2V3N A;  1AYF A;  4K7S A;  2C5L C;  1YQB A;  1FXT B;  3DBL B;  4W9F A;  1L4D B;  4JWU C;  5T8I A;  2A1S A;  1UH6 A;  1XT9 B;  3N9Y C;  4E9J A;  1R4M I;  1WXM A;  3M95 A;  3NZ3 A;  1Q1O A;  2PE9 A;  4P16 A;  2LGS A;  2EMT A;  3FAH A;  1ZZJ A;  4IWQ A;  1NXU A;  3GZN I;  3KDK A;  2CKH B;  2W3R A;  4NXN H;  2MBE A;  4HJG E;  1E7V A;  2IO2 B;  1JQ4 A;  2QND A;  4LDT D;  2N9P C;  2PPH A;  2GBN A;  1HZ6 A;  4ANV A;  2EKI A;  1WR6 E;  1B9R A;  3AU5 A;  3T8M A;  5L83 A;  2CTK A;  1OGW A;  5EE1 A;  4DHZ B;  2K6D B;  4WIP A;  3W1S A;  2QIE B;  4WWP A;  5E6J A;  4HEA 1;  4MEL A;  1F2R C;  4W9D A;  3W9C B;  2DYM A;  1UWM A;  1I42 A;  4JPS A;  1WHR A;  3J80 W;  2G4S A;  1ZZK A;  2BS3 B;  3IAS 1;  1P7F A;  2FFM A;  4RF1 A;  3EZJ A;  4IOI E;  2OJW A;  4C80 A;  2LXA A;  2D3G A;  4RGN A;  5JHA A;  1SXT A;  2H89 B;  2H88 B;  2WDV B;  3BY4 B;  4XC2 A;  4I6L B;  2N4F A;  1SE2 A;  3KQ4 A;  3AE1 B;  1TS3 A;  4YTM B;  3WAP A;  2O2V B;  3RCZ A;  1SGH A;  5BO4 B;  3AEE B;  2CU3 A;  4G50 A;  1FO4 A;  4GKK H;  5KHQ A;  4F7Z A;  1WGR A;  1I35 A;  1GB4 A;  2CWF A;  2X06 A;  1TT5 B;  3EUB 2;  5MPO A;  3KUZ A;  2P2R A;  2KAN A;  2FNJ B;  3VQI A;  3N3K B;  2ZJD A;  4GDL A;  2KO3 A;  4DV3 H;  4BKT A;  1V1P B;  4KIK B;  4ZYS A;  3UI3 A;  1VDV A;  5D94 A;  4OVZ A;  2N9K A;  2G1E A;  2ZW1 A;  1EO6 A;  1IPG A;  4USA A;  2XNA C;  2J4X A;  4LFA H;  3N1X C;  3R8B A;  4G0N B;  1FFU A;  1U4A A;  3ECI A;  3RUI B;  1WTJ A;  1JWB D;  2W55 A;  4MDK E;  2DZM A;  1T0R C;  1IUE A;  3WIM A;  4KDI C;  1Q0W B;  3SB1 A;  2PTL A;  3U8Z A;  1KF6 B;  3U4E G;  1DOI A;  2BB5 A;  2CHZ A;  2K9X A;  1XLO A;  1YIW A;  2SEB D;  2PQU A;  4RFB A;  2D2Q A;  2O6V D;  2KYW A;  2GLS A;  2L7R A;  4BBN F;  4NZT M;  3W5U B;  3I0P A;  3MC9 A;  5BYR A;  3PS6 A;  4BBN C;  5DPR A;  4X66 H;  5D6J B;  1EUV B;  1K53 A;  5BYS A;  2ASQ A;  1L2N A;  2CTM A;  4XDC A;  1I4R A;  1I4P A;  1XRH A;  1RWS A;  3Q8B A;  3DBS A;  4URK A;  5E6N A;  1SBB B;  1WX8 A;  3BZD B;  2AXY A;  3PTF C;  1Q10 A;  4JGH B;  4L23 A;  3HM6 X;  2RPQ A;  3KLS X;  4R3D A;  2HJ8 A;  5C1Z A;  2KQ4 X;  4DUZ H;  4DXF A;  5K36 G;  3GP7 A;  4US9 A;  1WJ4 A;  4RM8 A;  3P4S B;  1XMQ H;  2NPT A;  2M8S A;  3C0R B;  2R61 A;  4IKG A;  2O6V A;  1HNW H;  3EC8 A;  2Y5B B;  3RNA C;  1J19 A;  2KMA A;  4DXA B;  4DV5 H;  1QT9 A;  4YHH H;  1IP9 A;  3DBR B;  3ZKJ C;  4MM3 A;  2NR2 A;  1P1A A;  4JWS C;  2KVR A;  2MJD A;  2E6X A;  3ML8 A;  2DAJ A;  1XQQ A;  3U30 A;  1I94 H;  4LK0 M;  2LXC A;  5IO9 A;  4IFD G;  1V8C A;  2CTJ A;  2I1J A;  1F52 A;  1UBQ A;  2BKF A;  2IY1 B;  4HDQ A;  1IBK H;  2UU9 H;  1V6E A;  2IYD B;  3U7Z A;  4C56 C;  3HHM A;  3DVN U;  4HWI B;  2ZPN A;  4YXD B;  4AM3 A;  1R7S A;  1TS5 A;  5LMU H;  1J0G A;  4BKS A;  2DYO A;  2FUH B;  4XWW A;  1SSN A;  2J0J A;  1DTJ A;  1UBI A;  2ACZ B;  2MP2 A;  5H8Y E;  4EZK A;  2KC1 A;  2RPV A;  3AM9 A;  2YVC A;  1V49 A;  2JT4 B;  3QC8 B;  1WXA A;  3AB5 A;  2NVU I;  3H8H A;  4N59 A;  2C9W B;  5D7G A;  2IO3 B;  2RDH A;  2RD0 A;  1JRU A;  1ZKH A;  1QQR A;  1I6U A;  2GBR A;  2EEL A;  4HXD A;  2JRI B;  3H1U A;  2V1Y A;  3R7R A;  4JI2 H;  2N0S B;  1F0Z A;  3QQ8 B;  1I4G A;  1WZ3 A;  1OQQ A;  5CHF A;  4FJZ A;  1YX5 B;  3TEW A;  3ZLZ A;  1C4P A;  3RYT A;  1P98 A;  2CPM A;  1PQS A;  2UXC H;  4ZHP A;  4A3O A;  3JSV A;  4YL8 A;  2FIF A;  3EHV A;  1MJD A;  5GMV A;  4JI7 H;  2RDB C;  4FXC A;  1MI0 A;  1BXT A;  2DAF A;  1KRH A;  2FUG 1;  3APD A;  5TSS A;  1ZUD 2;  3ZUN A;  4D2K A;  3FIL A;  1XCQ L;  1WXS A;  3P4P B;  1YOV B;  3P4Q B;  4ZRK A;  1D6E C;  2IO1 B;  1YN4 A;  4YSX B;  4W9E A;  2ZW0 A;  2IBI B;  1NYQ A;  1WY8 A;  1N61 A;  1PGA A;  2NCN A;  3WAO A;  1E8X A;  5J17 A;  2K8B A;  1E7P B;  3UQB A;  3Q6B A;  4EOY A;  3CIR B;  1XO3 A;  3K9P B;  2HTH A;  4QMF B;  1TKY A;  2MEK A;  4XGA B;  1FFV A;  2RDG A;  2JE6 I;  3NJT A;  3TCA A;  5HKH A;  3AEC B;  2ON8 A;  1X9Z A;  2B3A A;  2V4I B;  3TIX A;  2ONQ A;  1IBX B;  3W1S C;  3VFK A;  2LRU A;  1FD6 A;  2IJ0 A;  1FMA D;  4ITK A;  4MSM B;  1XCT L;  3RF2 A;  3AXC A;  3B0A A;  3UGB B;  2KC2 A;  3PZ8 A;  1FJG H;  2L32 A;  2N7E A;  5JH5 C;  4J6I A;  4XDD A;  1HA5 A;  2PVO D;  3Q3M C;  2AQ3 B;  1YMH E;  4N6E B;  2OED A;  2BTE A;  2YQR A;  1XD3 B;  4DXG A;  5J18 A;  2ZCB A;  4TKN A;  1IBM H;  3U2S C;  3BYT B;  1KH0 A;  1C76 A;  2UYZ B;  4E74 A;  2PW9 A;  2GBM A;  1M4V A;  1EWY C;  1T6B X;  4P7I A;  1RYJ A;  1PYW D;  3TEZ A;  1QZE A;  2WU5 B;  3V62 A;  2LHE A;  1WGG A;  2XK5 A;  3GE8 C;  3NOB A;  1C1Y B;  2KDF B;  3A1Q A;  3A4S C;  2KKC A;  4FJY A;  2KQS A;  4KVG B;  1DOY A;  4KX6 B;  1X4N A;  2KT7 A;  4CQN A;  2LVQ A;  4HCN B;  2BVC A;  4PS8 A;  1MHX A;  1R4M B;  3K9O B;  2LWP A;  2BB6 A;  1V2Y A;  2JWU A;  3GZN B;  2OOB B;  2M8W A;  3VKE A;  2CR5 A;  1K50 A;  5FR6 A;  3Q8E A;  1RRB A;  5G55 A;  1QIL A;  2QEJ C;  2RMM A;  1UGJ A;  2R2Q A;  4JYA H;  3QX1 A;  3DQV A;  4BFR A;  4AOF A;  4M0W A;  4NJ7 A;  3WAM A;  1Q5W B;  4LTU A;  1WXQ A;  2JEA I;  3VDZ A;  4JI0 H;  4GMV A;  2LD9 A;  4KKI A;  2LJI A;  4K7W A;  3IFW B;  3NZU A;  2IPK D;  1HZ5 A;  4MGZ E;  3IHP C;  3ZVV A;  2MA9 B;  4LNF A;  2D9I A;  5JZE B;  1K8R B;  2L83 A;  1UF0 A;  1KOT A;  2VZK B;  4HPM B;  4W9L A;  5AZF A;  1X0A A;  1SEI A;  2Z0D B;  3AE7 B;  4EC5 A;  4A90 A;  4WH4 A;  3SFE B;  5LNK 1;  1FNU A;  1ACC A;  3AU4 A;  3ABV B;  4DR4 H;  1VBI A;  1J4W A;  2ANR A;  1PGB A;  1WYG A;  3DVN V;  3AE6 B;  4DV1 H;  2QC8 A;  3PT2 B;  4MGK E;  2LUE A;  2LTM A;  2N1V A;  1JML A;  1N5X A;  1QOG A;  1P0R A;  1J7A A;  5FKA C;  2CTL A;  3Q3O C;  2DX5 B;  1WJ6 A;  3DHG C;  1V86 A;  3RFZ B;  1WMH B;  2GI9 A;  3PHW B;  3AE2 B;  4X62 H;  1OTR B;  2BWF A;  5CTR C;  1TUA A;  2AX5 A;  3O13 A;  3Q8C A;  4HRS A;  2L0T A;  2QHO A;  1VZ7 A;  1ENF A;  1V5O A;  1YQ4 B;  4X57 B;  2Y3A A;  3SFD B;  4KV2 A;  4TUU A;  4OZC A;  2BF8 B;  4B3T H;  4FLH A;  5D3D A;  1E6E B;  2WXO A;  2JXT A;  1MG4 A;  3DPD A;  4NQL B;  4DHJ B;  1SE3 A;  4NNJ B;  2Z0S A;  2O2V A;  4LFC H;  1NYR A;  2KN5 A;  4B6W A;  1YJJ A;  4LFB H;  3RZW C;  5DPS A;  1KJT A;  3QWZ B;  2G45 B;  2ZZP B;  2M1M A;  1OQY A;  4YSZ B;  1V9J A;  2WXI A;  3L16 A;  1XXG A;  3AI5 A;  4K3C A;  1F2R I;  2D3B A;  4AP4 C;  3ZTD A;  4AS1 A;  3VUY A;  3KYC D;  5G5H A;  2W9N A;  1E0Z A;  4TQ1 A;  3IBE A;  1XNQ H;  1V1P A;  4KIK A;  3W1Y A;  2I1K A;  3L17 A;  2OHF A;  4H2A A;  2V4L A;  4OZB A;  4GOC A;  3I9V 1;  1PGX A;  1EU3 A;  2KMC A;  3VH3 B;  1HXY D;  1E8W A;  2CJO A;  1ZP0 B;  2WQY B;  1E8Y A;  4QAY A;  1ZXH A;  2SAK A;  4ZRP A;  2L00 B;  3B2G A;  2N9X A;  3VR8 B;  2BT6 A;  3UIN B;  3TEX A;  2KDE B;  4G11 A;  1PUT A;  4C4V A;  4DUY H;  2BWE S;  3RMK C;  3DCG A;  3UIP B;  4F1S A;  4AQY H;  3ZNZ B;  4A9A A;  1OQR A;  3EFU A;  1HQR D;  4MT5 A;  3VVW B;  1WIA A;  1VIH A;  5LL6 b;  2DZK A;  1L7Y A;  3AE8 B;  3PLV A;  1TZO A;  4II2 B;  4K81 A;  1KLU D;  4NAW B;  2KFK B;  2WGS A;  5BMG A;  1HR0 H;  4NAM A;  4ZDV A;  2R2O A;  5BYQ A;  4HKZ E;  3BWU D;  2M6Q A;  4RCO A;  2ZNV B;  1OEY A;  1H4R A;  2WYQ A;  1L6U A;  2KLG A;  4PT5 A;  2PVG C;  1N32 H;  4IM3 A;  2J53 A;  4RGO S;  3L13 A;  3SU8 X;  3FC4 A;  4RGT A;  1XLQ A;  4BOZ B;  4LF9 H;  3PGE A;  2WX0 A;  3L7Z C;  2NS5 A;  2WXF A;  2J7Q B;  2HD5 B;  4LF6 H;  2WHI A;  3ZIM A;  3BK2 A;  4W9H A;  1LGR A;  3ETR A;  1EC6 A;  4JQW C;  4FHJ A;  3P4R B;  4GSW A;  4RF0 A;  1VRA B;  4YWG G;  3QCA A;  1OFF A;  2KWC A;  1D4B A;  5BMI A;  3UIO B;  2OPV A;  4II3 B;  2KFJ A;  4JX1 C;  4KHP H;  2KXJ A;  1TYG B;  5C23 A;  2K1F A;  2DHZ A;  1YD8 U;  1A5R A;  4PYZ A;  3I3T B;  3H6N A;  5C3J B;  4ZYN A;  4ZOH C;  4C4V B;  3W5V B;  1MG8 A;  1XEE A;  3R2I A;  1VZ8 A;  4DV7 H;  1NVI D;  4HVB A;  2DYB A;  3RPF C;  4C7Z A;  3ZDM C;  1WM3 A;  1VZ6 A;  2K25 A;  2CTE A;  4LNO A;  2M19 A;  3O65 B;  4LNK A;  1GOZ A;  3KWV A;  3J9C A;  2OJR A;  2KJR A;  3ZJU A;  1VCB A;  2V3P A;  2KJH B;  3EEC A;  5JXV A;  1JRO A;  2AQ2 B;  4WQO B;  4K3B A;  5KHO A;  3KWL A;  3B08 A;  1R4N I;  3BVM A;  1TIF A;  2MX2 A;  4A3P A;  4OD6 A;  1D5X C;  1ZW7 A;  4LF5 H;  2FCQ A;  3J7A K;  1LO5 D;  5IWA H;  3KW5 B;  4WAN A;  2AL6 A;  4ZHO A;  1YNT E;  3VXW A;  2JU6 X;  2N9E B;  4GDK B;  1WJU A;  4KZ0 A;  5HG2 A;  1KFY B;  1QF6 A;  1EWC A;  4BKS D;  2E3U A;  2HDE A;  2L52 A;  4KKJ A;  3HRD D;  4WJO A;  2WU2 B;  5BR8 H;  2N9L A;  4KSK C;  3H7P B;  1UGM A;  2M0A A;  1T0S C;  2YLM A;  3Q69 A;  2RGF A;  1C4C A;  2B76 B;  1ZZI A;  2HJ1 A;  1FRR A;  2I38 A;  4MSQ B;  1WI0 A;  3TBL D;  3NG0 A;  1PQX A;  1IYF A;  4AWJ A;  1OEY J;  3JYU A;  1NBF C;  3ZJT A;  3ENE A;  5I4D A;  1FPY A;  5H92 C;  2HTM E;  4GB9 A;  2ZM6 H;  4TV3 A;  4B3M H;  3N1Y C;  4E71 A;  4LF7 H;  1X4M A;  2Q5W D;  2V0G A;  4JV5 H;  4DWF A;  1WX9 A;  3NVY A;  1V1O A;  2KX0 A;  3RD2 A;  2REX A;  4BA1 I;  2HHH H;  4EFO A;  3VRB B;  3NY5 A;  3A9K B;  3MC0 B;  2G3Q B;  3SHQ A;  2YEP B;  5IP4 D;  4BKG A;  1N63 A;  1IBX A;  2DBY A;  1TGZ B;  4KGT A;  4REZ A;  4AJY B;  4PK1 A;  2LUM A;  4O1N A;  4WJP A;  4W9G A;  3QJZ A;  3AEA B;  2FCS A;  5C2T B;  4DV4 H;  3MJ5 A;  1WVN A;  4EEW A;  3OJ4 B;  3S2A A;  3NVW A;  5AEK B;  1V97 A;  4RH6 A;  4ASW C;  2CWH A;  3H7S A;  1ZTG A;  5AUI A;  3R3M A;  4NJ6 A;  1EF1 A;  3KUD B;  3RZF A;  3BK1 A;  4DR1 H;  1QKZ A;  4YTN B;  1LXD A;  4ARC A;  1SB3 C;  1HTO A;  4RM9 A;  1WGY A;  1NDD A;  5HI1 A;  1L5P A;  2NBW B;  4W9I A;  4IM0 A;  2IND C;  1ET9 A;  3DVG X;  4ICU A;  3Q2A C;  3ZGZ A;  3Q3J A;  3AEV B;  1JAL A;  2RSU A;  2UWQ A;  1FCL A;  1RAX A;  2MBO A;  3OG5 A;  4FUL A;  2KOX A;  3BYY B;  4WAL A;  3VUW A;  1P9D U;  2KD0 A;  1QLB B;  4L1B A;  3V60 A;  3L54 A;  1JRP A;  4K0K H;  1FRD A;  3IT4 B;  2KTR B;  2L1A A;  1AW7 A;  2J52 A;  3QAQ A;  3HK0 A;  3IG3 A;  1JWU D;  2KN4 A;  1SIJ A;  2IGD A;  5IAA C;  1JWS D;  4HPL B;  3AN1 A;  2KWU B;  2VZK D;  2BS2 B;  4B3R H;  2K39 A;  2CPQ A;  4MAC A;  3NS8 A;  1N62 A;  3D32 A;  1C4A A;  3NHE B;  2JPH A;  3OSS D;  1V80 A;  2M4N A;  4TSS A;  4DR5 H;  5CHV C;  1RLF A;  3VR9 B;  2JRH A;  1F0X A;  1XMO H;  3L08 A;  4TMA B;  2WXH A;  2WS3 B;  3NCV A;  2K22 A;  2KZR A;  4F8C B;  2CU1 A;  4NXM H;  3OWE B;  4CO7 A;  3V3X A;  3SR6 A;  1NI2 A;  1TY2 A;  4WWM A;  4NPN A;  2PE6 B;  4JI4 H;  1YN3 A;  1PFD A;  2KDM A;  1BML C;  2LVO A;  3VTU A;  4HKQ A;  3NUH B;  1VJK A;  1FIQ A;  3RUL A;  1I7H A;  2FPH X;  1FNW A;  4G08 A;  1Z5S B;  2CHX A;  2ANN A;  4OX9 H;  1AN8 A;  1ESF A;  4OO1 G;  3IT6 B;  3BIN A;  1GG3 A;  3TEY A;  1RM6 C;  3X23 A;  3PRM B;  2LGX A;  4NZR M;  4EKU A;  2JUO A;  2D07 B;  4YY3 H;  1XNR H;  3J81 W;  4FA6 A;  5DPW A;  3M63 B;  2K8H A;  1KLG D;  3V6C B;  1WMH A;  4OHJ A;  3TMP B;  2BYT A;  2LRR A;  4DV6 H;  3DHI C;  1VIG A;  2MHJ A;  2HH2 A;  3NRZ A;  1E8Z A;  1BUI C;  4Q2J A;  1WE6 A;  3Q14 C;  1V81 A;  3A4R A;  3ONS A;  1TS4 A;  1S3S G;  2BQQ A;  2ZCC A;  2AQ1 B;  2LMC A;  4DR2 H;  3B9J A;  3M3J A;  3QK0 A;  4WJQ A;  3JAM W;  3L0W B;  2QIL A;  1QOF A;  4BAX A;  2C7H A;  2LEK A;  5G2N A;  3PO0 A;  4ZRI A;  1I4H A;  2XBB C;  3HM3 A;  2FMR A;  2CHW A;  2BL5 A;  2NBV B;  4DBG A;  1ZE3 D;  3DHH C;  1WFY A;  4PYU A;  4BZA A;  2EKE C;  2ZQE A;  1S03 G;  4US8 A;  3LJ3 A;  2GOW A;  3PSE B;  2MCN B;  2WXK A;  3OAW A;  3HVZ A;  1AWD A;  5AZH A;  2PY9 A;  2XEW A;  4JI8 H;  1N34 H;  4FBJ B;  5DT9 A;  4IM2 A;  4IUM B;  3LB8 C;  4J3O D;  3AEB B;  4RMA A;  2PEA A;  4MGY E;  1YN5 A;  4LLG M;  1ZOY B;  1TKG A;  2KWD A;  5E6O A;  4KGS A;  1ZGU B;  1ZPS A;  3AE5 B;  3GR5 A;  4LNI A;  4B9K A;  2G8Y A;  4NJC A;  2GB1 A;  3QAR A;  2C7M B;  4JIO U;  3PRE A;  1SJE D;  2KDB A;  4PDB A;  3DWM A;  1TTN A;  4S0R A;  3WA0 A;  2BGF A;  1IGC A;  4NQK E;  2JWZ A;  1QOA A;  5EE3 A;  2KJ6 A;  3KVF B;  3JVZ X;  1EU4 A;  4CYE A;  4K7U A;  3R7Q A;  4BA2 I;  3MJW A;  3HVD A;  4M8M A;  2INC C;  1V9N A;  2V3S A;  2K1H A;  4IWP A;  3OET A;  2JF5 A;  4AJW A;  4PS7 A;  1WXV A;  5EE9 A;  3IAM 1;  3KYD D;  3APF A;  2LFI A;  5LXH A;  1WM2 A;  3SEB A;  4NAW A;  2KFK A;  1HNZ H;  3V69 A;  2INP E;  4MJS B;  1ODH A;  3N1Z C;  1MVK A;  3PV1 A;  1UZX B;  2LHD A;  1NI3 A;  5FK9 C;  3LDZ E;  2IZV B;  2WP9 B;  3CWI A;  4HK2 A;  3TJP A;  1CQV A;  4S17 A;  1GB1 A;  2UXB H;  4KZC A;  3TUO A;  3MFG A;  2LZ6 A;  1WE7 A;  3ZQ4 A;  2DZJ A;  4DQO C;  2J0M A;  1VR9 A;  1ZXI A;  2KNB A;  5D3I B;  2WDQ B;  4A20 A;  3APC A;  1TY0 A;  3WAL A;  4OZA A;  4K1R B;  4DK5 A;  2DZI A;  5C0X G;  1R4N B;  2DWQ A;  2RR9 A;  2XN9 C;  5BMH A;  4XE0 A;  4ANU A;  2X8X X;  2A4Z A;  1TS2 A;  2BPS A;  3N32 A;  3ZJV A;  1ZDV A;  4XX5 A;  3ZXV A;  2C60 A;  3V6E B;  4IDI A;  4B3S H;  3B1L X;  3U1K A;  2WLB A;  2CJN A;  2QCZ A;  2WXJ A;  2KK8 A;  2J0K A;  3PZD A;  5HHD G;  5L95 C;  2KMM A;  4GN1 A;  1YX6 B;  3HUI A;  1ET6 A;  2Z8L A;  2LGD A;  2X38 A;  2BYE A;  4HCP B;  2JA9 A;  3VHT C;  2L8J A;  1WR1 A;  3MHZ A;  3DBH I;  2IO0 B;  1P7E A;  4JLC A;  3GKU A;  1FM0 D;  1AN7 A;  3PHX B;  3A33 B;  5LXI B;  4MGI E;  2MSE D;  2L05 A;  2JZ3 B;  3PRP B;  4JVY A;  4GKJ H;  1WSP A;  1X1M A;  3GOE A;  4JI5 H;  1T0Y A;  4AUQ C;  2PIA A;  3IXS A;  4OCH A;  3RNC C;  4X65 H;  1S20 A;  4DR7 H;  4OW0 A;  3ZXR A;  1KTK A;  1ZDX A;  1J8C A;  3MHS D;  3VH4 B;  3PRZ A;  2ZEQ A;  1MPE A;  2QDF A;  1K52 A;  2MRP A;  2MLB A;  1I4Q A;  5IKC M;  2LF0 A;  2HH3 A;  5CX3 A;  2Y5P A;  3B2F A;  2CTF A;  4WWN A;  5AUK A;  4GDK A;  4FHK A;  1DGJ A;  2GBK A;  1GC7 A;  3N20 C;  4W9K A;  3OLM D;  4B0E A;  1Z2M A;  1XLN A;  3WAN A;  2NN6 G;  2KAC A;  2FAZ A;  2W82 A;  2BA0 A;  1DYQ A;  2LRW A;  1N6Z A;  4IG7 B;  4HRO A;  5DCN A;  1WYW B;  3H7P A;  3H9D A;  2C7N B;  2UU7 A;  4HJK A;  2VKC A;  3VUX A;  1LFD A;  2D3A A;  1JWM D;  2LJ5 A;  3I57 A;  4HPP A;  4X64 H;  3KUC B;  1IGD A;  1WX7 A;  2JYE A;  3U52 E;  2GRI A;  4IW0 A;  1CJE A;  4WAA A;  3W2D A;  1XLP A;  1E10 A;  2WDT B;  3V05 A;  4ZRJ A;  1N36 H;  1E9M A;  2VQF H;  1SE4 A;  2LVP A;  4P1B C;  2JY6 A;  3ALB A;  2JXX A;  3V61 A;  3QA8 A;  1WH3 A;  2MW5 A;  3LYY A;  1RFA A;  5IOI A;  3ZRF A;  2WXM A;  2NTS A;  3A9J A;  3PZ7 A;  5CHW A;  1S1Q B;  3CSF A;  2NBU A;  1TJE A;  3A9K A;  1IBL H;  2BKR B;  3NZS A;  3N30 A;  3PVL A;  4KSL C;  4DR3 H;  1WWT A;  4W9J A;  2JZX A;  4AIM A;  2LGI A;  1XF5 L;  3JW0 X;  2FE8 A;  2K0P A;  2MJ3 A;  4WWO A;  2WNM A;  3DBL I;  1WF9 A;  4FN2 A;  3ZRC A;  1JWA D;  3CST A;  1G6J A;  3OTO H;  1SIF A;  2ZPY A;  5EE0 A;  4FJU A;  1F9J A;  2WWZ A;  3T1H H;  3BII D;  2JQR B;  4LDT B;  4JI6 H;  2W3S A;  4LIJ A;  1YJI A;  2IY0 B;  3DWG C;  4N58 A;  4L2Y A;  4LJO B;  3LXF A;  4EUT A;  1CMX B;  1EM7 A;  4I6P A;  1E90 A;  3ZNH B;  2W54 A;  3L10 B;  3RNB C;  3P63 A;  5IA7 A;  1WRI A;  4GXB A; 
#chains in the Genus database with same CATH homology
 4WIP A;  3W1S A;  1JWS D;  2QIE B;  2L83 A;  5E6J A;  3AN1 A;  2VZK D;  2BS2 B;  2VZK B;  4HEA 1;  1F2R C;  3W9C B;  2DYM A;  1UWM A;  4MAC A;  3AE7 B;  3AH7 A;  4JPS A;  4A90 A;  4WH4 A;  1N62 A;  2BS3 B;  1C4A A;  3SFE B;  5LNK 1;  3IAS 1;  4GDL B;  1P7F A;  4RF1 A;  1FNU A;  1UWX A;  1ACC A;  1C77 A;  4IOI E;  4C80 A;  4TSS A;  3ABV B;  4RGN A;  1DOX A;  1PGB A;  1SXT A;  1WYG A;  2H89 B;  2H88 B;  2JSV X;  2IGG A;  2WDV B;  3AE6 B;  1C9F A;  4ZRQ A;  3VR9 B;  1JML A;  1N5X A;  1SE2 A;  1QOG A;  2WDR B;  3KQ4 A;  3AE1 B;  1J7A A;  5FKA C;  1TS3 A;  4YTM B;  2QSD A;  4TMA B;  3AEE B;  3RFZ B;  1D5M C;  2WXH A;  3P1M A;  2CU3 A;  2JZP A;  1FO4 A;  2WS3 B;  2K22 A;  2GI9 A;  2WXP A;  3OWE B;  3AE2 B;  3V3X A;  3SR6 A;  1TY2 A;  4WWM A;  2AX5 A;  2Y5C A;  3O13 A;  1K51 A;  1YN3 A;  1PFD A;  2KDM A;  4GLS C;  2NTT A;  1BML C;  3Q8C A;  4HRS A;  1GB4 A;  1UNS A;  4HKQ A;  1VZ7 A;  1ENF A;  3NS1 A;  3NUH B;  1VJK A;  1FIQ A;  1I7H A;  1YQ4 B;  3EUB 2;  3GB1 A;  1FNW A;  5MPO A;  2Y3A A;  3SFD B;  3VQI A;  1AN8 A;  1ESF A;  3AEG B;  3IT6 B;  1NEK B;  2E3T A;  3TEY A;  1RM6 C;  1V1P B;  4OZC A;  4ZYS A;  3UI3 A;  1VDV A;  5D3D A;  3WCQ A;  3L4P A;  1E6E B;  4OVZ A;  2WXO A;  2JXT A;  2N9K A;  2G1E A;  2ZW1 A;  1SE3 A;  4USA A;  1FXI A;  1N60 A;  2XNA C;  2J4X A;  3R8B A;  1FFU A;  1NYR A;  3P42 A;  1JWB D;  2W55 A;  1KLG D;  1YJJ A;  4OHJ A;  2BYT A;  1JW9 D;  1L0Y B;  1SJH D;  1IUE A;  2INN E;  4WUR A;  3NRZ A;  4YSZ B;  1BUI C;  3T3O A;  4Q2J A;  2PTL A;  2WXI A;  1XXG A;  2QMT A;  1KF6 B;  1F2R I;  3U4E G;  1DOI A;  1TS4 A;  4AS1 A;  3TSS A;  2BB5 A;  2K9X A;  5G5H A;  1C78 A;  1XLO A;  2G9H D;  2TSS A;  1E0Z A;  2SEB D;  4TQ1 A;  4JE3 B;  4YT0 B;  2AQ1 B;  4RFB A;  2LMC A;  1V1P A;  3B9J A;  4TQ0 A;  3R2T A;  2I2Y A;  2OHF A;  4H2A A;  4OZB A;  2QIL A;  1QOF A;  3I9V 1;  1CZP A;  1PGX A;  2LEK A;  3W5U B;  1EU3 A;  3PO0 A;  5BYR A;  4A55 A;  1I4H A;  1HXY D;  4MM3 B;  1FNV A;  1VLB A;  2CJO A;  1JCK B;  1ZP0 B;  2WQY B;  4KGR A;  3E56 A;  1K53 A;  5BYS A;  2WXG A;  1ZE3 D;  1ZXH A;  2SAK A;  4XDC A;  4ZRP A;  1I4R A;  1I4P A;  3B2G A;  3VR8 B;  1RWS A;  2BT6 A;  3Q8B A;  3TEX A;  1SBB B;  1CK1 A;  1NEN B;  1PUT A;  3BZD B;  4US8 A;  4YTP B;  1GAQ B;  1Q10 A;  4L23 A;  2WXK A;  4R3D A;  3KLS X;  3EA6 A;  3NVZ A;  3HVZ A;  2KQ4 X;  3EGR A;  1AWD A;  1OQR A;  4A9A A;  1HQR D;  4DXF A;  4MT5 A;  3GP7 A;  4US9 A;  5FR3 A;  4WAF A;  1MHH E;  4B0M A;  3BVG A;  3LB8 C;  4J3O D;  3AEB B;  1SF0 A;  3P4S B;  4XWT A;  1FCC C;  1UUP A;  2J42 A;  1YN5 A;  2JX5 A;  2R61 A;  3NVV A;  3AE8 B;  4IKG A;  1TZO A;  4LLG M;  1KLU D;  1ZOY B;  4NAW B;  5BMG A;  3T3N A;  4NAM A;  1HEZ E;  5BYQ A;  1QT9 A;  1TKG A;  2BS4 B;  2KWD A;  2WXN A;  4HKZ E;  4KGS A;  3BWU D;  3BVZ A;  1ZPS A;  3AE5 B;  4RCO A;  1L6U A;  4NJC A;  4JWS C;  2GB1 A;  2MJD A;  2E6X A;  4PT5 A;  2PVG C;  1SJE D;  3DWM A;  4LK0 M;  3ZYY X;  2J53 A;  1WGK A;  4RGO S;  4ARI A;  1IGC A;  3FC4 A;  4RGT A;  1XLQ A;  1QOA A;  1V8C A;  5EE3 A;  2WXF A;  1STE A;  5G5G A;  1EU4 A;  3BK2 A;  3ETR A;  3HVD A;  2M56 B;  3U7Z A;  4C56 C;  3P4R B;  4YXD B;  1R7S A;  2N7J A;  1TS5 A;  4YSY B;  5EE9 A;  3IAM 1;  4RF0 A;  3C8Y A;  2LFI A;  4A6Q A;  1VRA B;  2DYO A;  3SEB A;  4YWG G;  4XWW A;  1SSN A;  1N5W A;  1OFF A;  3Q8F A;  1D4B A;  1FXA A;  2PMV A;  5BMI A;  2INP E;  3E9S A;  2ACZ B;  3AMZ A;  1MVK A;  4JX1 C;  5H8Y E;  2LHD A;  2RPV A;  3AM9 A;  1NI3 A;  1TYG B;  5FK9 C;  3AED B;  1B1Z A;  3AB5 A;  3H8H A;  2WXR A;  2NMQ A;  4N59 A;  4WQM A;  1C79 A;  1GPX A;  3FIL B;  5D7G A;  4P6V F;  5C3J B;  2WP9 B;  3CWI A;  4ZOH C;  1GB1 A;  1CQV A;  3W5V B;  1XEE A;  2RDH A;  3TUO A;  3R2I A;  1VZ8 A;  3MFG A;  5HFY A;  3Q8A A;  1QQR A;  3ZQ4 A;  4DQO C;  1NVI D;  2EEL A;  1VR9 A;  3RPF C;  2QJL A;  4C7Z A;  1ZXI A;  5D3I B;  2N0S B;  2WDQ B;  1VZ6 A;  2M19 A;  1TY0 A;  4OZA A;  1F0Z A;  1I4G A;  2WXQ A;  1J7B A;  1OQQ A;  3TEW A;  3AE3 B;  1C4P A;  1GOZ A;  2DWQ A;  3KWV A;  4RNA A;  1SIJ A;  2JYT A;  3J9C A;  2K5P A;  3ZJU A;  2XN9 C;  4UDU C;  5BMH A;  2V3P A;  4XE0 A;  5JXV A;  1JRO A;  4ZHP A;  1T5X D;  3AEF B;  2AQ2 B;  1YQ3 B;  3KWL A;  2YEP F;  3BVM A;  1TS2 A;  4FXC A;  3ZJV A;  1ZDV A;  1MI0 A;  1BXT A;  2FUG 1;  1KRH A;  3MP9 A;  5TSS A;  1ZUD 2;  1D5X C;  4D2K A;  4MH8 A;  1LO5 D;  3FIL A;  1XCQ L;  1ROE A;  3P4P B;  3P4Q B;  4IDI A;  1D6E C;  4ZHO A;  2WLB A;  1YN4 A;  1YNT E;  2CJN A;  4YSX B;  2WXJ A;  2ZW0 A;  2JU6 X;  1NYQ A;  5HHD G;  2KMM A;  4GDK B;  1N61 A;  1PGA A;  2PLP A;  1ET6 A;  3HUI A;  2FBW B;  2Z8L A;  2X38 A;  3GS2 A;  2IGH A;  1E7P B;  1L4Z B;  5HG2 A;  1KFY B;  1QF6 A;  1EWC A;  1L0X B;  3CIR B;  1XO3 A;  3MHZ A;  2HDE A;  2L52 A;  4KKJ A;  3HRD D;  1P7E A;  1TKY A;  2MEK A;  1FM0 D;  2PKO A;  2WU2 B;  1FFV A;  2N9L A;  2RDG A;  3AEC B;  2ON8 A;  2V4I B;  2M0A A;  2ONQ A;  1IBX B;  1WSP A;  1PDX A;  4EE2 A;  1L0V B;  1L6V A;  1FD6 A;  2IJ0 A;  3Q69 A;  2PIA A;  1FMA D;  3IXS A;  4ITK A;  5GXG B;  1F77 A;  1C4C A;  2ICI A;  1XCT L;  4NZL B;  2B76 B;  4OW0 A;  1FRR A;  1KTK A;  1ZDX A;  1I4X A;  2I38 A;  2BW2 A;  1MPE A;  3PZ8 A;  2BBC A;  1K52 A;  2L32 A;  1I4Q A;  4XDD A;  1FEH A;  3ZJT A;  1HA5 A;  2PVO D;  2Y5P A;  3B2F A;  5I4D A;  2MJE A;  5H92 C;  2HTM E;  3AE4 B;  2AQ3 B;  1YMH E;  5AUK A;  4N6E B;  2OED A;  2BTE A;  1SEB D;  1DGJ A;  4C7Y A;  2KAJ A;  4B0E A;  4DXG A;  2Q5W D;  2V0G A;  1XLN A;  3NVY A;  1V1O A;  3U2S C;  2KAC A;  2W82 A;  3AV8 A;  2D5G A;  3BYT B;  1DYQ A;  2WXL A;  1KH0 A;  2IDY A;  1C76 A;  1TKE A;  3VRB B;  2PW9 A;  1M4V A;  1EWY C;  3MC0 B;  2MH7 A;  1J7C A;  1RFK A;  1T6B X;  4HRO A;  4RGM A;  1T3Q A;  2YEP B;  2DLB A;  1N63 A;  1RYJ A;  1IBX A;  2DBY A;  1JWM D;  1PYW D;  3I57 A;  3TEZ A;  2WU5 B;  4KGT A;  4REZ A;  2LHE A;  1IGD A;  2JYE A;  2K3U A;  3U52 E;  1Y56 A;  2LUM A;  1QOB A;  2GRI A;  4O1N A;  1CJE A;  4A8X C;  3AEA B;  3W2D A;  4AQ7 A;  5C2T B;  1D5Z C;  1XLP A;  1E10 A;  1A70 A;  3MJ5 A;  1DOY A;  3VRA B;  3AE9 B;  3V05 A;  3NVW A;  1E9M A;  4KX6 B;  4CQN A;  3URY A;  1SE4 A;  1V97 A;  4RH6 A;  5AUI A;  3BK1 A;  3LYY A;  1MHX A;  2V3N A;  1AYF A;  1QKZ A;  4YTN B;  2WXM A;  4ARC A;  2NTS A;  3PZ7 A;  1SB3 C;  2BB6 A;  1L4D B;  2JWU A;  4JWU C;  5T8I A;  1TJE A;  1K50 A;  5HI1 A;  3Q8E A;  1QIL A;  2QEJ C;  1L5P A;  1UGJ A;  2RMM A;  3N9Y C;  1WWT A;  2LGI A;  1XF5 L;  3NZ3 A;  2FE8 A;  2K0P A;  2MJ3 A;  2WNM A;  4M0W A;  4P16 A;  1ET9 A;  3FAH A;  4LTU A;  3ZGZ A;  1WXQ A;  1JAL A;  1JWA D;  1FCL A;  2W3R A;  3BYY B;  4HJG E;  4KKI A;  5EE0 A;  2LJI A;  1JQ4 A;  3BII D;  2JQR B;  1QLB B;  4L1B A;  2IPK D;  2W3S A;  1YJI A;  1HZ6 A;  3DWG C;  4N58 A;  1HZ5 A;  4L2Y A;  1JRP A;  2EKI A;  3LXF A;  1B9R A;  1EM7 A;  1FRD A;  3IT4 B;  2L1A A;  1AW7 A;  2J52 A;  2W54 A;  3P63 A;  5EE1 A;  1WRI A;  1JWU D;  2KN4 A;  2IGD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...