1V8CA

Crystal structure of moad related protein from thermus thermophilus hb8
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
165
structure length
165
Chain Sequence
b'PKVNLYATFRDLTGKSQLELPGATVGEVLENLVRAYPALKEELFEGEGLAERVSVFLEGRDVRYLQGLSTPLSPGATLDLFPPVAGGGFERTFGAFPPWLLERYLEEWGGTREGEGVYRLPGAVVRFREVEPLKVGSLSIPQLRVEVEGEEAERWFERIAFAASR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MoaD related protein
publication title Crystal Structure of MoaD related protein from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Protein binding
total genus 47
structure length 165
sequence length 165
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02597 ThiS ThiS family
A PF09189 DUF1952 Domain of unknown function (DUF1952)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1v8cA01
3.30.1370.80 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Molybdopterin cofactor biosynthesis MoaD-related, C-terminal domain 1v8cA02
1CJEA 5AUIA 1JWBD 1L0VB 4JX1C 4USAA 2ACZB 2Q5WD 2OHFA 1KFYB 2PIAA 4WWMA 4LTUA 4YTPB 5GXGB 1OFFA 1YQ4B 3RPFC 2MJDA 1N63A 4WQMA 1F0ZA 4IDIA 2DBYA 3AE3B 2WP9B 3ETRA 2BS3B 1N61A 1UWMA 1XO3A 1V97A 2WDQB 3NVWA 2WS3B 3WCQA 1SF0A 4P6VF 2KMMA 1VLBA 1FMAD 5H92C 4FXCA 4YSXB 4HRSA 3AEAB 1QOBA 2H88B 4N58A 3VRAB 1WRIA 3AEFB 2BS4B 3B2FA 1WYGA 1PDXA 1OQQA 2G1EA 5C3JB 1TKYA 2L52A 2M19A 4N59A 2M56B 1N5XA 2Y5CA 1FFVA 2JQRB 1J7AA 1VDVA 2E3TA 1IUEA 2QIEB 1NI3A 1XLPA 2LEKA 1E6EB 2WDVB 2WU2B 2PVGC 4ZHOA 1XLOA 1VJKA 1KRHA 3AN1A 1WWTA 3LB8C 3PO0A 4C7YA 1GPXA 2W55A 1T3QA 1CZPA 5MPOA 1NVID 2CU3A 1AYFA 1JRPA 1XLNA 5G5GA 2WDRB 2K5PA 2MH7A 5EE0A 3W9CB 2PVOD 2W3SA 3HRDD 3NRZA 3NVYA 4HROA 1NYRA 1J7CA 1N62A 1WXQA 1JALA 3W5VB 1FRDA 1QOGA 1RWSA 4C80A 2BS2B 1ZXIA 1SIJA 2JX5A 2MJ3A 3CIRB 3NS1A 4ZOHC 1NEKB 1WGKA 1QT9A 3B2GA 1JWAD 3AEGB 1L6UA 2N0SB 4YXDB 1JW9D 3AE7B 1ZOYB 3VR8B 3SFDB 3AE5B 1PUTA 2EKIA 3EUB2 1QF6A 1YJJA 4ITKA 3AE1B 1SB3C 4KX6B 2K22A 3AE8B 5AUKA 3AM9A 1I7HA 2W3RA 3AV8A 1FM0D 3FAHA 3KWLA 3W5UB 1KF6B 3HVZA 2FBWB 3AE9B 3AECB 4A9AA 3AE6B 3P4SB 1E0ZA 2CJOA 5G5HA 3SR6A 3ZYYX 1JROA 2BT6A 2H89B 3ABVB 1RM6C 1ZP0B 1OQRA 3P4PB 1DOIA 3B9JA 5EE9A 1E10A 2PKOA 3VRBB 4ZHPA 1YJIA 3AEBB 1QOAA 1L5PA 1DOYA 1FXAA 1FIQA 3P4QB 1JQ4A 1TYGB 3VR9B 1ROEA 2HTME 1B9RA 2W54A 1RYJA 2B76B 2WU5B 1PFDA 3BIID 4JWUC 4YSZB 2AX5A 3NVVA 3SFEB 1J7BA 1N60A 3P63A 2CJNA 1ZUD2 1DGJA 4JWSC 1FRRA 1XLQA 4N6EB 5EE3A 1E9MA 1QLBB 4US8A 3AH7A 3LXFA 4YTNB 2DWQA 1DOXA 2QJLA 3AE4B 4YSYB 4C7ZA 1E7PB 1FFUA 4YT0B 1GAQB 1TJEA 1R7SA 2WLBA 1TKEA 2K9XA 3AMZA 5H8YE 1EWYC 3L4PA 2L83A 3AEEB 3CWIA 1NENB 1A70A 2KAJA 2MJEA 3DWMA 1YQ3B 1N5WA 3P1MA 1FXIA 2WQYB 3AB5A 1RFKA 1L6VA 3DWGC 3P4RB 3FC4A 4US9A 1QOFA 3AEDB 3HUIA 1AWDA 4YTMB 5C2TB 1FO4A 1V8CA 1NYQA 1TKGA 5EE1A 3NVZA 3AE2B
chains in the Genus database with same CATH superfamily
2AL6A 2NPTA 2V0GA 2ACZB 4WWMA 2ZCCA 1WM2A 2MJDA 1ZE3D 3L0WB 2ZPNA 3ZNZB 4MJSB 4KIKA 1L4ZB 4IDIA 2KX3A 4DXFA 2N9EB 1E7UA 3RNGC 3I3TB 3OG5A 4DXAB 3DBRB 4HPLB 2V3PA 4JIOU 4YSXB 2RDGA 2H88B 2JZ3B 4PS3A 4C4VB 2DZIA 1V5TA 1OQQA 4DV6H 2KX0A 3MJ5A 1YOVB 3ZJTA 5D3IB 2QIEB 4GDKB 2JUOA 3RZWC 3TEZA 2XEWA 1GPXA 1YIWA 2E5LH 4JV5H 4KSKC 3HVDA 2CU3A 1KLVA 4WURA 1MSZA 2ZCBA 1JALA 1WZ0A 5LLIA 1FRDA 3Q8AA 3ZDMC 4AUQC 2NPTB 4YXDB 4P7IA 5J2RA 2QHOA 4LNNA 2L1AA 3EUB2 1UELA 4FHJA 4NPNA 4IKGA 4KIKB 3A4RA 3AM9A 3IHPC 2QILA 4B3MH 3Q14C 3Q3OC 3ZYYX 1K1GA 4NAMA 1ZP0B 4MH8A 2BYTA 4HJKA 2XN9C 4W9EA 2UXBH 1MI0A 3NVVA 1HNWH 1FNWA 1BT0A 1ZUD2 4P1CC 4W9FA 1TGZB 4LCDE 1HZ5A 2KWCA 2AL3A 2BB5A 1N36H 2LRUA 2MW5A 4XYCA 3ZDTA 2CR5A 4IFDG 4B9KA 2Q5WD 3L08A 3WANA 4MGIE 3Q69A 1N63A 3Q6BA 3UF8A 2WP9B 1D3ZA 3GB1A 4I6PA 1D5MC 2R2QA 3M63B 1I35A 1FPYA 4B8CD 2RPQA 3K9OB 4FHKA 2K3UA 1QOBA 4A20A 2K1HA 4DUZH 4EUTA 2CTEA 3IXSA 4FJUA 2B3AA 2G8YA 2JF5A 2WNMA 4DR1H 1J7AA 4DR2H 1XLPA 3IT4B 3LB8C 4LNOA 3OAWA 3OWEB 4W9JA 2WXNA 5I4DA 2N7DA 3OTOH 2BYFA 3O65B 4B0MA 2I1JA 4XDCA 5HKHA 2C5LC 4JGHB 2A1SA 1GUAB 1N62A 4W9GA 2PJHA 3PV1A 2MRPA 1ZXIA 3NS1A 3UOEA 3B2GA 1UUPA 3AEGB 3BYYB 2O2VA 5DT9A 1ZOYB 1UBIA 3HIZA 4JL9A 3B08A 1EF1A 2GOWA 4TQ1A 2DX5B 3FAHA 2N9LA 3ZNHB 2CJOA 2AQ2B 3N1ZC 4IG7B 2BT6A 3A4SC 2ZPYA 1X4NA 3KLSX 2NVUI 1S03G 4WAFA 3MC0B 4GOCA 4ANUA 1ZGUB 1YN4A 4OZCA 2Y3MA 3P4QB 3OJ4B 3JAMW 4JI0H 2MLBA 1B9RA 2ZEQA 1IYFA 4MELA 2LFIA 3PRZA 2RDBC 3BZDB 5L95C 4YTNB 4YSYB 4FADA 2WXGA 4KKJA 4EKUA 1HA5A 4ZYSA 1PGBA 3CMMB 1YQ3B 1EO6A 1UNSA 2L3ZA 3KVFB 3P4RB 1V5OA 3V3XA 3SU8X 1SEBD 1WY8A 2FUG1 5C2TB 4LJPB 2LMCA 5AUIA 2O2VB 4N9F4 2EKEC 3DBSA 2FFMA 4A55A 1QZEA 1TS5A 4E9JA 2K0PA 1JMLA 1WHRA 3DBLB 4AJWA 4LNIA 2MEKA 4FXCA 2JZZA 2INPE 1I4XA 2L0FA 1I4GA 3B2FA 4ARIA 2JY6A 3A1QA 3X23A 3GOEA 3VDZA 5JH5C 4LF9H 2PEAA 4IWPA 2WDVB 4ZHOA 3URYA 4MT5A 3HK0A 3B0AA 2N9KA 4FN2A 3S2AA 3W9CB 2V1YA 2ANNA 4BBNC 1J7CA 4EFOA 2C7NB 2MJ3A 4NNJB 2JPHA 4RM9A 2IGDA 4H2AA 2KDFB 1T6BX 5D6JB 2CTLA 4ANVA 3GZNI 1L2NA 4A90A 3TUOA 3ZVVA 1WGDA 3NG0A 2FUHB 5DPSA 3QJZA 2M0XA 4MEMA 2FBWB 2YVCA 4L2YA 2KJHB 3GP7A 3P4PB 1GJZA 4AQYH 5FLXW 4WALA 1YJIA 2WXIA 2INDC 1FIQA 4QAYA 5BMHA 2HTME 1YD8U 3IG3A 3A1QB 4X66H 1YX6B 1S20A 4RH6A 1B1ZA 2W9NA 1J7BA 4ZRIA 2EMSA 4WANA 2YLMA 2QJLA 1ZTGA 4KDIC 4NQLB 2K9XA 4DV2H 3ZQ4A 3L4PA 2Y5PA 2MHJA 1WXMA 4MSQB 4K3BA 3N1YC 5BMIA 3GR5A 3FC4A 1V1OA 3H7PA 3AEDB 3HUIA 1P98A 2G45B 1TKGA 5LL6b 4CYEA 3AE2B 4DDGD 5LXIB 1Q0WB 4FJYA 1C1YB 4P16A 5EE9A 2OHFA 2D3GA 4GU2A 3LJ3A 2MA9B 4CQNA 1X1MA 4WQMA 2OJRA 2LVQA 4ACFA 4JYAH 2DYMA 3L13A 1KHMA 2ON8A 2BYEA 4B3TH 1UWMA 4WJNA 2AXYA 4KDLB 2NS5A 3B1LX 1VBIA 2G1EA 1TKYA 1V9JA 4KGSA 1V2YA 1R4NI 3TL5A 1WI0A 2WU2B 2PW9A 1KRHA 4URKA 2KLGA 1NVID 3HM3A 1CK1A 4LIJA 3DBLI 3PSEB 3H7PB 4RF0A 5G55A 3ZXVA 4NXMH 3IBEA 2KKCA 4ZOHC 1QT9A 1QQRA 3QD7X 1XNRH 3U7DA 4FA6A 3BWUD 4W9HA 1VZ6A 3GS2A 3MFGA 4HCNB 4K7UA 4GGQA 5A2QW 1E8XA 4TKNA 4BBNF 5BR8H 4EOYA 2J7QB 2K25A 2WU5B 1PGXA 3ML8A 4OVUA 1WGRA 2GBRA 2PE6B 4US8A 4N6EB 1FRRA 4W9DA 1Z2IA 4DXGA 2L8JA 2QEJC 4YT0B 1E7VA 4LF4H 1C79A 4FJSA 1F9JA 3UGBB 2MQJA 3H1UA 2D5GA 2WXRA 1WXVA 3DWGC 1V8CA 1ZZJA 3DHGC 1HNXH 4K1RB 2N1VA 2L7RA 1YQ4B 5G2NA 1WGGA 4PK1A 2KXJA 3AI5A 3ZGZA 1WE7A 3MTNB 1V81A 3OSSD 1EWCA 1HTOA 2KTFA 1FD6A 4YY3H 2WS3B 3WCQA 4DR3H 3RNAC 1I42A 4JI6H 4HRSA 3AEFB 3R66C 4PT5A 4HDOA 5C3JB 2M17A 2HHHH 4L1BA 2CTMA 2KQ4X 2BWFA 1MHHE 5CHVC 3AULA 4DHZE 1JRPA 5BYQA 3Q3FA 1HNZH 4LF7H 3QCAA 3QC8B 1WFYA 2KWVB 4FLHA 2I38A 1WMHA 2CWHA 1WJ4A 1WX7A 2DLBA 2N7EA 1OEYJ 2DENB 2WDTB 1LM8B 1QF6A 4DK5A 1D5XC 3KWVA 3W5UB 1I7HA 4PYUA 2KVRA 3JW0X 2EMTA 3VH4B 3PZ8A 2BKFA 2UU9H 2QC8A 1NBFC 4KHPH 4XC2A 2JT4B 3PHXB 3UQAA 2FNJB 1D4BA 3R2IA 4G50A 3U4EG 4WJOA 2IBIB 3ML9A 4RGMA 2B76B 5AZGA 3L16A 3H6NA 5EE3A 2OPUA 2JWUA 1DOXA 4ANXA 1E7PB 3PGEA 2IGGA 2MSED 1UBQA 1XMQH 3KUZA 1RAXA 1A70A 3W2DA 2K6DB 5IWAH 3BK1A 1V86A 1FXIA 2IYDB 1AWDA 1T0QC 1WMHB 4W9IA 3PLVA 1R4MB 2JE6I 3I63C 1X9ZA 1KFYB 3C19A 4WJQA 2QCZA 2KMAA 4B95A 4KVGB 5KHQA 1N61A 3VTVA 1IBLH 3RUIB 2GBNA 5HI1A 2KMMA 5K36G 5H92C 2RGFA 1MVKA 1C4AA 4GB9A 2JU6X 3TCAA 4LFAH 2CWFA 4N59A 3HHMA 3BINA 2LGXA 4RCOA 3SDLC 2D2QA 2Z0SA 3ENEA 1V1PA 3PO0A 5IO9A 3H9DA 2W55A 1S1QB 4KGTA 4I6NB 3EECA 2R2OA 2MH7A 1KOTA 5JHBA 3BY4B 4KZCA 1ZZIA 1J5EH 5IKCM 2NN6G 1NDDA 3WALA 1P1AA 4RGNA 2IZVB 2LUEA 4BA1I 1WVNA 5J17A 2L32A 4FBJB 1E10A 4DHZB 1FCLA 1F52A 2XK5A 3E9SA 1C4CA 4RNAA 5TSSA 2MWSB 3GE3C 1OTRB 3B9JA 1C9FA 1P7EA 2P2RA 1LO5D 4OX9H 5LMUH 5BMGA 4BKTA 5C1ZA 1PFDA 4BFRA 2WX1A 2JZPA 3Q8FA 2LI5A 2ONQA 1ESFA 3CSTA 1V1PB 1UGMA 2JVZA 2SAKA 3J7AK 2R61A 4G0NB 2MBEA 3V69A 3CWIA 4BAXA 5HG2A 3RNBC 3NOBA 1GC6A 2NMQA 1M4VA 3NZUA 4GIVA 3EFUA 1NYQA 5EE1A 1CJEA 1SE3A 4USAA 5GXGB 4G11A 3ECIA 4XWWA 2IO1B 1MHXA 1WZ3A 3TEYA 2GBMA 2C9WB 2XK5B 3PTFC 2DNFA 2CS4A 2M0AA 3SHQA 1J4WA 2PMVA 4P6VF 4YHHH 4MACA 3VRAB 5EDSA 1OQYA 4XX5A 2M19A 3U52E 5IP4D 1S3SG 1FFVA 1R4MI 4LFCH 1DYQA 3T3NA 1E6EB 3DCGA 1WX9A 2ZVNA 4GSWA 5D7GA 5E6OA 2DGRA 2PQUA 4B3SH 2TSSA 4K81A 2DZJA 3KUDB 4AS1A 3I5JC 2IDYA 4YWGG 5DCNA 4EZKA 3WAOA 3NRZA 2J0MA 4K3CA 3NVYA 4DV4H 2O6VA 5TR5A 4GXBA 3KYDD 5AZFA 1U4AA 2IY0B 4GLSC 4NZRM 3NZSA 1C3TA 4JI8H 3AU5A 3KYCD 4JVYA 1GOZA 1XMOH 2PTLA 3SFDB 1XRHA 2BL5A 3W1SA 3BVZA 1HE8A 2ZNVB 1WX8A 3QAQA 1I6UA 1I4QA 3DBHB 4FJZA 1N6ZA 3T9LA 3T3OA 3AE9B 2OOBB 5G5HA 4B0EA 1OQRA 3DBRI 3RI7C 2CTKA 4DV0H 3VR9B 4WWOA 3EC8A 5E6NA 1WSPA 3TMPB 2X06A 4JWSC 4JI1H 2Y5BB 3LXFA 3NY5A 5AZHA 3C8YA 3AEEB 3APDA 2O6VB 1C77A 1E90A 1C76A 4B3RH 1IGDA 2MCNB 3ZLZA 1VCBA 3VH3B 3RNEC 1FJGH 4JI5H 3NVZA 3AEVB 2X8XX 4JX1C 1ZDVA 4C7YA 1UH6A 2CTJA 2K8HA 3RPFC 3VUXA 4A8XC 2KANA 1P0RA 1SE2A 2QNDA 3N1XC 2ZJDA 2J4XA 1WJNA 3MHZA 2FMRA 2Z0DB 3N3KB 3V6EB 2VQEH 4HKZE 3NVWA 1SIFA 1SF0A 2D11A 5JEAG 4II3B 3ALBA 2D9IA 3NZ3A 1V49A 1IGCA 3R8BA 1KLUD 1J5KA 2KDMA 4LLGM 5D94A 1SE4A 4W9LA 1XLOA 4REZA 2KFJA 1I4HA 2O6VD 2KNBA 1VZ8A 2CTFA 2KVZA 2VH1A 2V9HA 1IPGA 1VD2A 1NYRA 3APFA 4PS7A 3IVFA 2JX5A 1XEEA 1STEA 1V80A 2WHIA 1NEKB 3PRPB 3ZRCA 1Z2MA 2JXTA 2WXMA 3PVLA 1PUTA 2KFKA 4HPPA 2BA0A 3T1HH 2BW2A 2HD5B 4W9KA 4ICUA 5AUKA 5AEKB 3U1KA 4RGTA 2Z59B 1CMXB 1CQVA 2JZXA 3UIOB 3PLUA 4M01A 4NJ7A 2BF8B 4KSLC 4ZRPA 3DDCB 2ZQEA 2N7JA 4OVVA 1AW7A 4OD6A 2AYOB 3V61A 5E6JA 3LYYA 1BXTA 2IO3B 1UGJA 4C56C 4IM0A 4C7ZA 1ZDXA 1GAQB 1R7SA 2JA9A 3DBHI 2L83A 2UWQA 1V9NA 3FILA 4M8MA 4IWOA 1TUAA 3I0PA 2WYQA 2FCQA 3GE8C 4DR5H 4RF1A 4EC5A 3PS6A 2G4SA 3L10B 4IM2A 4NZTM 2OPVA 3IAS1 2KFKB 4WH4A 3ZNGC 1KH0A 1WM3A 2J0KA 4XGAB 4BVUC 2BS3B 3ZRFA 1FNUA 3JSVA 4LFBH 2L0TA 3OLMD 2KC1A 2DZMA 1WIAA 2KJRA 2JQRB 4WJPA 1JQ4A 2LEKA 3M62B 4HXDA 4DDID 4ZRQA 4TV3A 4I6LB 3V62A 2UU7A 1T3QA 1XLNA 2K5PA 3RNCC 3FILB 4GKKH 3HM6X 4H8AA 3MC8A 4CHKA 1L0XB 3DPDA 2X38A 2ZW1A 3WAPA 2LJ5A 1C4PA 3AE5B 4K7SA 3QA8A 1T0SC 3TSSA 1FEHA 1GB1A 1SE9A 3ABVB 3JSVB 4A6QA 2BQQA 1Q1OA 2PKOA 3N20C 4EZLA 2W54A 5LMNH 2INNE 3SFEB 4TUUA 1MG8A 4IW0A 1J8CA 2JEAI 1QKZA 4AJYB 4FULA 1TKEA 2I2YA 1DT4A 1VIHA 2DZKA 5E6PA 3ZKJC 3P1MA 4HWIB 3QK0A 1N5WA 2MP2A 1VIGA 3V05A 4D2KA 3M95A 1XCTL 2QMTA 4JPSA 3WIMA 2A5UA 2ICIA 4IUMB 4HVBA 1NXUA 2XNAC 4LTUA 1TIFA 4IC7B 2NTTA 4R3DA 4DV5H 3ZTDA 4AM3A 2FE8A 4LNFA 1I4RA 2I1KA 2D07B 3H8HA 2CPMA 3MP9A 3Q8EA 2LTLA 4UDUC 4BA2I 3U7ZA 2BS4B 2KK8A 1SEIA 3OETA 1VDVA 1VRAB 2WXLA 3E56A 2BB6A 4OZAA 2PVGC 4RGOS 3IAM1 3AN1A 1PGAA 1TZ1A 4E71A 3RULA 1HR0H 2ASQA 2HJ1A 1EUVB 4DR4H 2MP2B 1TZOA 2MJHA 1RWSA 3V6CB 2BS2B 1SIJA 3WAMA 4II2B 1WGKA 2J53A 4ZDVA 4HK2A 5LXHA 2FCSA 2KC2A 2KQ7A 2J52A 1UZXB 3AE1B 3DVNU 2W3RA 4NQKE 3O13A 1FM0D 3KDKA 3FKYA 4OW0A 4AQ7A 1E0ZA 2JRHA 4ZHPA 5CTRC 5CHWA 4ICVA 2L00B 1X4MA 2UUCH 2CKHB 3RNFC 3VVWB 3Q3JA 2AX5A 4MH0E 1K50A 2N4FA 1GB4A 1LXDA 1YN5A 1QLBB 4DBGA 1YN3A 3VUYA 2DWQA 1IBKH 5FR3A 1XF5L 4RM8A 1N34H 1NENB 2LHDA 1TT5B 3VQIA 3AB5A 4M00A 3VTUA 5IT9W 1ENFA 2KO3A 4A3OA 3V60A 3RT3B 2JVCA 1H8CA 3W1YA 4MM3A 4LDTB 4DUYH 4DV1H 1SXTA 4OVZA 1XO3A 5FKAC 3QIJA 5DPTA 1VLBA 4ZYNA 2G3QB 1FMAD 1L0YB 2LD9A 2LUMA 1AN7A 1KJTA 3P2BA 2L52A 4DV7H 4PYZA 4EE2A 3VHTC 2E3TA 4MJSA 4IOIE 5KHOA 1WWTA 2Y3AA 2W82A 4LJOB 1LFDA 2Z0EB 2UXDH 3A33B 1Y8RC 1WXQA 5DPRA 5FK9C 2REXA 2WX0A 3OJ3A 2LGYA 2INCC 3CIRB 4LDTD 4KGRA 1K8RB 3FAUA 1RLFA 4L23A 3L17A 2AEHA 4MM3B 4KX6B 2K22A 2VQFH 5BYSA 1YX5B 3RF2A 4A9AA 3SR6A 2H89B 1TY0A 3VUWA 2FCNA 3KQ4A 2DHZA 3TEWA 2YQRA 3X0WA 1TY2A 2MBOA 4F7ZA 1K52A 4YSZB 2J0JA 4JWUC 1D6EC 2CU1A 2F4VH 1N60A 1E9MA 3IFWB 3AH7A 4IM3A 2AQ1B 2RSUA 1FFUA 2DAFA 4X57B 3NCVA 1E5WA 3WA0A 2LGDA 2AWTA 3PRMB 1K51A 1UD7A 5C23A 1Q5WB 3RN9C 1P3QU 1JWBD 1RFAA 2SEBD 2PIAA 4MSMB 3MC9A 2L05A 1WJUA 1UF0A 1ET6A 3Q8BA 1F0ZA 2GMIC 2VH2A 3MHSD 2UXCH 2RDHA 2IJ0A 3ZJVA 2WDQB 2DYOA 5JXVA 3TBLD 1WF9A 2ZM6H 2HH3A 1M94A 4N58A 1PDXA 1X0AA 4DV3H 2KACA 3UIPB 2WGSA 1IUEA 2KDIA 2PPHA 1JWSD 2CHXA 1HTQA 4ASWC 4XDDA 3N32A 2LF0A 4GDLA 2VZKB 4CO7A 2RMMA 4HPMB 1GC7A 2OJWA 3HRDD 4OCHA 4YL8A 2IPKD 2WXKA 3PHWB 3EGRA 3W5VB 1QOGA 4C80A 4NY0A 3U2SC 2C7HA 4F8CB 1JWAD 2O4CA 2IO2B 3AXCA 3VR8B 2FIDA 1RRBA 1LQBA 5CX3A 2EKIA 2ZVOA 3L7ZC 3AE6B 3DHHC 1XQQA 2EELA 2LRRA 1JWMD 2C7MB 1SBBB 4HDQA 3A9JA 1FXAA 1T0RC 1ROEA 3AU4A 4LNKA 2XBBC 3U30A 5JHAA 4DHJB 2VZKD 1L4DB 1XLQA 2GBKA 2N9PC 1YJ1A 2PLPA 2RR9A 4DR6H 2JRIB 4GDLB 4HEA1 4M02A 3K9PB 2KWDA 1BMLC 5IA7A 2MJEA 3DWMA 2GRIA 1P7FA 2HE7A 3VFKA 1QOFA 4S0RA 4O1NA 2JXXA 1IP9A 4K0KH 1WH3A 3NJTA 3KW5B 3GZNB 1G6JA 2LZ6A 4X65H 1OFFA 2IO0B 1EC6A 3CF6E 4KZ0A 1T0YA 1C78A 2DAJA 3N9YC 1VR9A 1E8ZA 4RMAA 4MGKE 2VRRB 2HDEA 3AEAB 3A9JB 4LF5H 4DHJD 1N32H 2M4NA 3NHEB 1H4RA 4B8TA 1FCCC 1PQSA 3ONSA 1AN8A 2ZNVC 1OEYA 3DQVA 1L7YA 1HEZE 4XZ4A 3UQBA 5MPOA 2ANRA 2MBBB 2WDRB 4B6WA 3CSFA 5DPWA 1KTKA 2K1FA 3ZW3A 4G08A 4OZBA 3QHTA 2ZW0A 2D3BA 2BTEA 3SB1A 2WXHA 2NTSA 1ZW7A 3PZ7A 1A5RA 3APCA 1JW9D 4NJ6A 3QQ8B 4A3PA 2V3NA 1NI2A 1F2RC 1I94H 2KOXA 1KF6B 3HVZA 1E8YA 1J0GA 3P4SB 3DHIC 2LVOA 5HFYA 2GLSA 2LHEA 4HLEA 3AEBB 3SEBA 3KUCB 4DR7H 3EFCA 1R4NB 3R3MA 4M0WA 4TMAB 3W1SC 2KJ6A 3R2TA 2FAZA 2LGIA 2D3CA 3Q3MC 4M8NA 1FKAH 4FJVB 2LJIA 4NBQA 1XNQH 3KH0A 3PT2B 1TJEA 2LXAA 3L54A 1EWYC 1WGYA 5JZEB 3Q3NC 5D3DA 2LXCA 4MGYE 1VZ7A 1L6VA 3RD2A 2KHWB 5L83A 2PY9A 2D3AA 2M8SA 1GG3A 2WWZA 1HXYD 3C0RB 2VKCA 4DQOC 2BYVE 2OEDA 1K53A 3IT6B 3NS8A 4G3XB 1ET9A 3I57A 2DYBA 4S17A 4JI7H 2L76A 2YEPB 3BVMA 1XCQL 3DVGX 1UG8A 2JYTA 2JYEA 3M3JA 4X62H 4NZLB 2PT7G 1T5XD 2FPHX 4QMFB 3QARA 1WJ6A 3EA6A 4KV2A 4M0WB 5BO4B 2JEBI 4F1SA 2MBHA 2Y5CA 4OHJA 3BK2A 3PPAA 2NBVB 5G5GA 1SGHA 5EE0A 2NBWB 4WAAA 2UYZB 1ZZKA 5FR6A 4HROA 1F2RI 2G4DB 2K39A 3QWZB 4KKIA 1F1HA 3RMKC 4JVHA 1Q10A 4EZJA 1L6UA 4E3CA 4AP4C 1TS4A 4JI4H 4IWQA 3AE8B 1DTJA 1ZPSA 2IY1B 4JQWC 2V3SA 1JROA 2KQSA 4XWTA 1MFWA 2UUAH 1WTJA 1HQRD 2WXQA 4GN1A 1DOIA 2LASA 1L5PA 2JWZA 4TQ0A 3ZXRA 3D32A 3SD5A 2AQ3B 1RYJA 4WWNA 1IBMH 3PREA 1EM7A 3P63A 4LK0M 2KLCA 3AE4B 3J9CA 4GMVA 2WXPA 4JI3H 5H8YE 2LVPA 3VXWA 2K6QA 3J81W 3TJPA 2KAJA 1F0XA 3DOWA 3MJWA 4JLCA 3TIXA 2GB1A 3UI3A 4HKQA 1TTNA 2CPQA 3VTWA 1L0VB 4YTPB 4W9CA 2WXFA 1XXGA 2M1MA 3R7QA 4C00A 2DBYA 3AE3B 2A4ZA 4BKSA 3VAWA 1V97A 1Z5SB 4WIPA 1EF5A 4GKJH 2FIFA 1QILA 1WRIA 3PZDA 3LDZE 1WYGA 1SJED 1IBXA 3KDGA 3ZIMA 2Z8LA 1I4PA 3JVZX 1PQXA 2M56B 1N5XA 1YMHE 3R7RA 4BOSC 1JWUD 4BZAA 1WXSA 1HZ6A 2PE9A 1N33H 3NUHB 2MX2A 3BVGA 5GMVA 3GABA 1V6EA 1AARA 2PVOD 4MGZE 1ZKHA 3U8ZA 2ZZPB 1WRDB 2MBQA 4RFBA 3UINB 4DWFA 1KM7A 2QSDA 3RYTA 2J42A 3RZFA 2CHWA 1XD3B 1YJJA 4ITKA 3ZJUA 2LGSA 3RCZA 3AV8A 3AECB 1BUIC 1ISNA 2BKRB 4BKGA 2BWES 1RM6C 4OO1G 3VRBB 4E74A 1IBXB 1TYGB 1EU3A 5IOIA 3ZNID 1GNUA 3EHVA 1ACCA 2N9XA 2NR2A 3GKUA 3BIID 2JSVX 1WR6E 4NJCA 2N1WA 2NCNA 2WXOA 2RPVA 2CJNA 1DGJA 1FXTB 2RD0A 3A9KA 5BYRA 1WR1A 2KYWA 2V4IB 1OGWA 4JI2H 4BOZB 3VKEA 2YEPF 2KDBA 1JRUA 4WQOB 2V4LA 2IGHA 2E6XA 1YNTE 3H7SA 5J18A 5D2MB 3TEXA 2HTHA 1RFKA 2QDFA 2C60A 4US9A 5C0XG 2KDEB 3QX1A 4YTMB 1MPEA 2M6QA 4EEWA 2NBUA 1F77A 2KN4A 1UWXA 2KMCA 4AIMA 4NAWA 1SJHD 4BKSD 2K8BA 3DVNV 1PYWD 1TBEA 3ZTCA 1FNVA 4PS8A 2G9HD 3Q8CA 1TS3A 3ETRA 1WE6A 3T1YH 3BYTB 2LWPA 2GBJA 2KD0A 2KTRA 1J19A 1D5ZC 4ZRJA 2KZRA 4ZRKA 3P42A 2LTMA 1WYWB 1Y56A 4Q2JA 2CHZA 3JYUA 1WE8A 4AOFA 1NI3A 4ARCA 2E3UA 1VJKA 3A9KB 5IAAC 1TS2A 4WWPA 3DVGY 1CZPA 3RFZB 1AYFA 1WGHA 4NXNH 2BPSA 2W3SA 4LF6H 3T8MA 1WXAA 5LNK1 5CHFA 3ZO5B 4LF8H 1MJDA 1ZXHA 2N0SB 4ANWA 4NAWB 3AE7B 1MG4A 2FCMA 3EZJA 1ODHA 4J6IA 1SB3C 4X64H 3I9V1 4HJGE 4K7WA 2KN5A 3KWLA 4PDBA 2KTRB 2WXJA 1P9DU 2BBCA 3J80W 3N30A 2KWUB 1XT9B 4J3OD 2HJ8A 4HCPB 1QOAA 1DOYA 4C4VA 2M8WA 3Q2AC 2BGFA 3ZUNA 4XE0A 5HHDG 2UUBH 1E8WA 4JE3B 1LGRA 4GDKA 4P1BC 1SSNA 1EU4A 5IN7A 2WLBA 4AWJA 3AMZA 1JCKB 2K8CA 5T8IA 1YQBA 4MDKE 1KLGD 2D10A 2BVCA 2WQYB 2KT7A 2LRWA 4TSSA 1FO4A 2GI9A 2HH2A
chains in the Genus database with same CATH topology
3IAS1 2V0GA 2ACZB 4WWMA 1OFFA 1YQ4B 4WH4A 2MJDA 1ZE3D 1KH0A 3ZGZA 1L4ZB 4IDIA 4DXFA 1C78A 1EWCA 3N9YC 2BS3B 1VR9A 1FD6A 1FNUA 2WS3B 3WCQA 2V3PA 2HDEA 4YSXB 4HRSA 3AEAB 2RDGA 2H88B 3AEFB 4PT5A 1OQQA 5C3JB 3MJ5A 1FCCC 4L1BA 3ZJTA 2JQRB 5D3IB 1JQ4A 2QIEB 1AN8A 4GDKB 2LEKA 2KQ4X 4ZRQA 1MHHE 3TEZA 1GPXA 1HEZE 1T3QA 5MPOA 3HVDA 2CU3A 1JRPA 1XLNA 2WDRB 2K5PA 5BYQA 3FILB 1KTKA 4WURA 4OZBA 2ZW0A 1JALA 2BTEA 1FRDA 3Q8AA 2I38A 2WXHA 1L0XB 2NTSA 3PZ7A 2DLBA 4YXDB 2X38A 1JW9D 2ZW1A 1C4PA 3AE5B 2L1AA 3EUB2 1QF6A 1D5XC 3TSSA 2V3NA 4IKGA 1FEHA 3KWVA 3AM9A 1F2RC 1I7HA 3W5UB 1GB1A 1KF6B 3HVZA 2QILA 3PZ8A 3P4SB 3ZYYX 3ABVB 5HFYA 4A6QA 2LHEA 4NAMA 1ZP0B 1D4BA 4MH8A 2BYTA 3R2IA 2PKOA 3AEBB 3SEBA 3U4EG 2XN9C 4RGMA 2W54A 1MI0A 4M0WA 2B76B 2INNE 4TMAB 3NVVA 3SFEB 3R2TA 1FNWA 2LGIA 1ZUD2 5EE3A 2LJIA 2JWUA 1DOXA 1HZ5A 1E7PB 1QKZA 2IGGA 1TJEA 1TKEA 2I2YA 2BB5A 1EWYC 3P1MA 1A70A 5D3DA 1N5WA 3W2DA 3V05A 3BK1A 1FXIA 4D2KA 1VZ7A 1L6VA 1XCTL 2QMTA 4JPSA 1AWDA 2ICIA 1HXYD 2Q5WD 4DQOC 2XNAC 1KFYB 4LTUA 2OEDA 1K53A 3Q69A 1N63A 3IT6B 2NTTA 1ET9A 4R3DA 3I57A 2FE8A 2WP9B 2YEPB 3BVMA 3GB1A 1I4RA 1D5MC 1XCQL 1N61A 3H8HA 2JYTA 5HI1A 2JYEA 2KMMA 3MP9A 3Q8EA 2K3UA 5H92C 4UDUC 4NZLB 1QOBA 1T5XD 1MVKA 1C4AA 3U7ZA 2BS4B 3EA6A 2JU6X 3IXSA 4N59A 2WNMA 2Y5CA 4RCOA 1VDVA 1J7AA 4OHJA 1VRAB 1XLPA 2WXLA 2BB6A 3E56A 2PVGC 3IT4B 4OZAA 4RGOS 3IAM1 3BK2A 3AN1A 3LB8C 1PGAA 1V1PA 3PO0A 2W55A 3OWEB 4KGTA 2WXNA 5I4DA 5G5GA 2MH7A 5EE0A 4B0MA 4XDCA 1TZOA 4HROA 1F2RI 1N62A 4KKIA 1RWSA 1Q10A 2BS2B 1ZXIA 1SIJA 3NS1A 1WGKA 2J53A 3B2GA 1UUPA 3AEGB 3BYYB 1L6UA 4RGNA 1ZOYB 1TS4A 2J52A 4TQ1A 3AE1B 2L32A 3AE8B 3FAHA 1ZPSA 2W3RA 3O13A 1FM0D 1E10A 1FCLA 4OW0A 2N9LA 4AQ7A 1E0ZA 3E9SA 2CJOA 2AQ2B 1C4CA 1JROA 2BT6A 4XWTA 4RNAA 5TSSA 3KLSX 1HQRD 2WXQA 4WAFA 1DOIA 3B9JA 3MC0B 1C9FA 4ZHPA 1P7EA 1YN4A 4OZCA 1L5PA 3P4QB 1LO5D 4TQ0A 5BMGA 2AQ3B 1B9RA 1RYJA 1PFDA 2AX5A 1K50A 1GB4A 1EM7A 2LFIA 3P63A 3BZDB 4LK0M 2JZPA 3Q8FA 1YN5A 1ESFA 1QLBB 2ONQA 1YN3A 4YTNB 2DWQA 1V1PB 3AE4B 4YSYB 3J9CA 2SAKA 2R61A 2WXGA 2WXPA 4KKJA 5FR3A 5H8YE 1HA5A 1XF5L 4ZYSA 1PGBA 3CWIA 1NENB 2KAJA 5HG2A 1YQ3B 2LHDA 1UNSA 3VQIA 3AB5A 3P4RB 2NMQA 3V3XA 1M4VA 1SEBD 2FUG1 5C2TB 2GB1A 1ENFA 3UI3A 4HKQA 1NYQA 5EE1A 2LMCA 1CJEA 5AUIA 1L0VB 1SE3A 4USAA 5GXGB 4YTPB 4XWWA 2WXFA 1XXGA 3TEYA 1MHXA 4A55A 1TS5A 2DBYA 1SXTA 3AE3B 4OVZA 2K0PA 1JMLA 1XO3A 1V97A 2M0AA 5FKAC 2PMVA 4WIPA 4P6VF 1VLBA 4MACA 2MEKA 1FMAD 4FXCA 1L0YB 3VRAB 2LUMA 1QILA 1I4XA 2INPE 1WRIA 1I4GA 3B2FA 1WYGA 1SJED 4ARIA 1IBXA 2L52A 3U52E 2M19A 2Z8LA 1I4PA 4EE2A 2M56B 1N5XA 1YMHE 1FFVA 1JWUD 1DYQA 2E3TA 2WDVB 3T3NA 1E6EB 5D7GA 1HZ6A 4ZHOA 3URYA 2TSSA 4IOIE 3NUHB 4MT5A 1WWTA 4AS1A 2IDYA 4YWGG 2Y3AA 2N9KA 3BVGA 2W82A 3W9CB 2PVOD 3NRZA 3NVYA 4RFBA 1J7CA 1WXQA 5FK9C 2QSDA 2MJ3A 3CIRB 4GLSC 4KGRA 2J42A 2IGDA 4H2AA 1T6BX 4L23A 1GOZA 2PTLA 3SFDB 3W1SA 3BVZA 4MM3B 1YJJA 4ITKA 4A90A 4KX6B 3TUOA 2K22A 3ZJUA 1I4QA 3AV8A 5BYSA 3T3OA 2FBWB 3AE9B 1BUIC 3AECB 4A9AA 5G5HA 3SR6A 2H89B 1TY0A 1RM6C 4B0EA 4L2YA 3KQ4A 1OQRA 3GP7A 3P4PB 3TEWA 3VRBB 1YJIA 2WXIA 1FIQA 1IBXB 1TYGB 1EU3A 1TY2A 3VR9B 5BMHA 2HTME 1ACCA 1K52A 4YSZB 4JWUC 3BIID 2JSVX 1D6EC 1WSPA 4NJCA 4RH6A 1B1ZA 2WXOA 1J7BA 1N60A 2RPVA 2CJNA 4JWSC 1DGJA 1E9MA 3AH7A 3LXFA 2AQ1B 5BYRA 2QJLA 2V4IB 1FFUA 2K9XA 3C8YA 2YEPF 3ZQ4A 2Y5PA 3L4PA 3AEEB 2IGHA 2E6XA 1YNTE 3TEXA 1K51A 1C77A 1RFKA 5BMIA 3FC4A 4US9A 1C76A 1V1OA 1IGDA 3AEDB 3HUIA 4YTMB 1MPEA 1TKGA 3NVZA 3AE2B 1F77A 2KN4A 1JWBD 1UWXA 4JX1C 4P16A 1ZDVA 5EE9A 2OHFA 2SEBD 2PIAA 4C7YA 1SJHD 3RPFC 4A8XC 1PYWD 4CQNA 4WQMA 1SE2A 1ET6A 1FNVA 3Q8BA 1F0ZA 2G9HD 3Q8CA 2DYMA 1TS3A 2J4XA 2ON8A 2IJ0A 2RDHA 3BYTB 3ETRA 3MHZA 3ZJVA 1UWMA 2WDQB 4HKZE 2DYOA 3NVWA 5JXVA 1SF0A 1D5ZC 4N58A 3P42A 3NZ3A 1Y56A 4Q2JA 1IGCA 1PDXA 3R8BA 1KLUD 2G1EA 1TKYA 2KDMA 2KACA 4KGSA 4LLGM 1SE4A 1IUEA 1NI3A 1JWSD 2PW9A 2WU2B 4ARCA 1XLOA 1VJKA 4REZA 1KRHA 1TS2A 1I4HA 4XDDA 1VZ8A 1CZPA 3RFZB 1NVID 1AYFA 2VZKB 2RMMA 2W3SA 3HRDD 1CK1A 5LNK1 1NYRA 2IPKD 2WXKA 4RF0A 3W5VB 3EGRA 1QOGA 4C80A 3U2SC 2JX5A 1XEEA 4ZOHC 1STEA 1NEKB 1QT9A 1ZXHA 1JWAD 2JXTA 2N0SB 4NAWB 3VR8B 1QQRA 3AE7B 2WXMA 1PUTA 2EKIA 3BWUD 2BW2A 1SB3C 3I9V1 5AUKA 1VZ6A 3GS2A 4HJGE 3MFGA 3KWLA 4RGTA 1CQVA 3AE6B 2WXJA 4ZRPA 2EELA 2BBCA 4J3OD 1JWMD 2N7JA 1SBBB 1QOAA 1AW7A 1DOYA 1FXAA 5E6JA 1ROEA 3LYYA 1BXTA 2WU5B 1PGXA 4XE0A 5HHDG 4JE3B 2VZKD 1L4DB 4US8A 4N6EB 1FRRA 1XLQA 1UGJA 1SSNA 1EU4A 2PLPA 4C56C 4DXGA 4C7ZA 1ZDXA 2QEJC 1GAQB 2WLBA 1R7SA 4GDLB 4YT0B 3AMZA 1JCKB 4HEA1 5T8IA 1C79A 1BMLC 2KWDA 2L83A 1KLGD 2MJEA 3DWMA 2GRIA 3FILA 1P7FA 2D5GA 2WQYB 2WXRA 3DWGC 1QOFA 4O1NA 4RF1A 1V8CA 4TSSA 1FO4A 2GI9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CJE A;  5AUI A;  1JWB D;  1L0V B;  4JX1 C;  4USA A;  2ACZ B;  2Q5W D;  2OHF A;  1KFY B;  2PIA A;  4WWM A;  4LTU A;  4YTP B;  5GXG B;  1OFF A;  1YQ4 B;  3RPF C;  2MJD A;  1N63 A;  4WQM A;  1F0Z A;  4IDI A;  2DBY A;  3AE3 B;  2WP9 B;  3ETR A;  2BS3 B;  1N61 A;  1UWM A;  1XO3 A;  1V97 A;  2WDQ B;  3NVW A;  2WS3 B;  3WCQ A;  1SF0 A;  4P6V F;  2KMM A;  1VLB A;  1FMA D;  5H92 C;  4FXC A;  4YSX B;  4HRS A;  3AEA B;  1QOB A;  2H88 B;  4N58 A;  3VRA B;  1WRI A;  3AEF B;  2BS4 B;  3B2F A;  1WYG A;  1PDX A;  1OQQ A;  2G1E A;  5C3J B;  1TKY A;  2L52 A;  2M19 A;  4N59 A;  2M56 B;  1N5X A;  2Y5C A;  1FFV A;  2JQR B;  1J7A A;  1VDV A;  2E3T A;  1IUE A;  2QIE B;  1NI3 A;  1XLP A;  2LEK A;  1E6E B;  2WDV B;  2WU2 B;  2PVG C;  4ZHO A;  1XLO A;  1VJK A;  1KRH A;  3AN1 A;  1WWT A;  3LB8 C;  3PO0 A;  4C7Y A;  1GPX A;  2W55 A;  1T3Q A;  1CZP A;  5MPO A;  1NVI D;  2CU3 A;  1AYF A;  1JRP A;  1XLN A;  5G5G A;  2WDR B;  2K5P A;  2MH7 A;  5EE0 A;  3W9C B;  2PVO D;  2W3S A;  3HRD D;  3NRZ A;  3NVY A;  4HRO A;  1NYR A;  1J7C A;  1N62 A;  1WXQ A;  1JAL A;  3W5V B;  1FRD A;  1QOG A;  1RWS A;  4C80 A;  2BS2 B;  1ZXI A;  1SIJ A;  2JX5 A;  2MJ3 A;  3CIR B;  3NS1 A;  4ZOH C;  1NEK B;  1WGK A;  1QT9 A;  3B2G A;  1JWA D;  3AEG B;  1L6U A;  2N0S B;  4YXD B;  1JW9 D;  3AE7 B;  1ZOY B;  3VR8 B;  3SFD B;  3AE5 B;  1PUT A;  2EKI A;  3EUB 2;  1QF6 A;  1YJJ A;  4ITK A;  3AE1 B;  1SB3 C;  4KX6 B;  2K22 A;  3AE8 B;  5AUK A;  3AM9 A;  1I7H A;  2W3R A;  3AV8 A;  1FM0 D;  3FAH A;  3KWL A;  3W5U B;  1KF6 B;  3HVZ A;  2FBW B;  3AE9 B;  3AEC B;  4A9A A;  3AE6 B;  3P4S B;  1E0Z A;  2CJO A;  5G5H A;  3SR6 A;  3ZYY X;  1JRO A;  2BT6 A;  2H89 B;  3ABV B;  1RM6 C;  1ZP0 B;  1OQR A;  3P4P B;  1DOI A;  3B9J A;  5EE9 A;  1E10 A;  2PKO A;  3VRB B;  4ZHP A;  1YJI A;  3AEB B;  1QOA A;  1L5P A;  1DOY A;  1FXA A;  1FIQ A;  3P4Q B;  1JQ4 A;  1TYG B;  3VR9 B;  1ROE A;  2HTM E;  1B9R A;  2W54 A;  1RYJ A;  2B76 B;  2WU5 B;  1PFD A;  3BII D;  4JWU C;  4YSZ B;  2AX5 A;  3NVV A;  3SFE B;  1J7B A;  1N60 A;  3P63 A;  2CJN A;  1ZUD 2;  1DGJ A;  4JWS C;  1FRR A;  1XLQ A;  4N6E B;  5EE3 A;  1E9M A;  1QLB B;  4US8 A;  3AH7 A;  3LXF A;  4YTN B;  2DWQ A;  1DOX A;  2QJL A;  3AE4 B;  4YSY B;  4C7Z A;  1E7P B;  1FFU A;  4YT0 B;  1GAQ B;  1TJE A;  1R7S A;  2WLB A;  1TKE A;  2K9X A;  3AMZ A;  5H8Y E;  1EWY C;  3L4P A;  2L83 A;  3AEE B;  3CWI A;  1NEN B;  1A70 A;  2KAJ A;  2MJE A;  3DWM A;  1YQ3 B;  1N5W A;  3P1M A;  1FXI A;  2WQY B;  3AB5 A;  1RFK A;  1L6V A;  3DWG C;  3P4R B;  3FC4 A;  4US9 A;  1QOF A;  3AED B;  3HUI A;  1AWD A;  4YTM B;  5C2T B;  1FO4 A;  1V8C A;  1NYQ A;  1TKG A;  5EE1 A;  3NVZ A;  3AE2 B; 
#chains in the Genus database with same CATH topology
 2AL6 A;  2NPT A;  2V0G A;  2ACZ B;  4WWM A;  2ZCC A;  1WM2 A;  2MJD A;  1ZE3 D;  3L0W B;  2ZPN A;  3ZNZ B;  4MJS B;  4KIK A;  1L4Z B;  4IDI A;  2KX3 A;  4DXF A;  2N9E B;  1E7U A;  3RNG C;  3I3T B;  3OG5 A;  4DXA B;  3DBR B;  4HPL B;  2V3P A;  4JIO U;  4YSX B;  2RDG A;  2H88 B;  2JZ3 B;  4PS3 A;  4C4V B;  2DZI A;  1V5T A;  1OQQ A;  4DV6 H;  2KX0 A;  3MJ5 A;  1YOV B;  3ZJT A;  5D3I B;  2QIE B;  4GDK B;  2JUO A;  3RZW C;  3TEZ A;  2XEW A;  1GPX A;  1YIW A;  2E5L H;  4JV5 H;  4KSK C;  3HVD A;  2CU3 A;  1KLV A;  4WUR A;  1MSZ A;  2ZCB A;  1JAL A;  1WZ0 A;  5LLI A;  1FRD A;  3Q8A A;  3ZDM C;  4AUQ C;  2NPT B;  4YXD B;  4P7I A;  5J2R A;  2QHO A;  4LNN A;  2L1A A;  3EUB 2;  1UEL A;  4FHJ A;  4NPN A;  4IKG A;  4KIK B;  3A4R A;  3AM9 A;  3IHP C;  2QIL A;  4B3M H;  3Q14 C;  3Q3O C;  3ZYY X;  1K1G A;  4NAM A;  1ZP0 B;  4MH8 A;  2BYT A;  4HJK A;  2XN9 C;  4W9E A;  2UXB H;  1MI0 A;  3NVV A;  1HNW H;  1FNW A;  1BT0 A;  1ZUD 2;  4P1C C;  4W9F A;  1TGZ B;  4LCD E;  1HZ5 A;  2KWC A;  2AL3 A;  2BB5 A;  1N36 H;  2LRU A;  2MW5 A;  4XYC A;  3ZDT A;  2CR5 A;  4IFD G;  4B9K A;  2Q5W D;  3L08 A;  3WAN A;  4MGI E;  3Q69 A;  1N63 A;  3Q6B A;  3UF8 A;  2WP9 B;  1D3Z A;  3GB1 A;  4I6P A;  1D5M C;  2R2Q A;  3M63 B;  1I35 A;  1FPY A;  4B8C D;  2RPQ A;  3K9O B;  4FHK A;  2K3U A;  1QOB A;  4A20 A;  2K1H A;  4DUZ H;  4EUT A;  2CTE A;  3IXS A;  4FJU A;  2B3A A;  2G8Y A;  2JF5 A;  2WNM A;  4DR1 H;  1J7A A;  4DR2 H;  1XLP A;  3IT4 B;  3LB8 C;  4LNO A;  3OAW A;  3OWE B;  4W9J A;  2WXN A;  5I4D A;  2N7D A;  3OTO H;  2BYF A;  3O65 B;  4B0M A;  2I1J A;  4XDC A;  5HKH A;  2C5L C;  4JGH B;  2A1S A;  1GUA B;  1N62 A;  4W9G A;  2PJH A;  3PV1 A;  2MRP A;  1ZXI A;  3NS1 A;  3UOE A;  3B2G A;  1UUP A;  3AEG B;  3BYY B;  2O2V A;  5DT9 A;  1ZOY B;  1UBI A;  3HIZ A;  4JL9 A;  3B08 A;  1EF1 A;  2GOW A;  4TQ1 A;  2DX5 B;  3FAH A;  2N9L A;  3ZNH B;  2CJO A;  2AQ2 B;  3N1Z C;  4IG7 B;  2BT6 A;  3A4S C;  2ZPY A;  1X4N A;  3KLS X;  2NVU I;  1S03 G;  4WAF A;  3MC0 B;  4GOC A;  4ANU A;  1ZGU B;  1YN4 A;  4OZC A;  2Y3M A;  3P4Q B;  3OJ4 B;  3JAM W;  4JI0 H;  2MLB A;  1B9R A;  2ZEQ A;  1IYF A;  4MEL A;  2LFI A;  3PRZ A;  2RDB C;  3BZD B;  5L95 C;  4YTN B;  4YSY B;  4FAD A;  2WXG A;  4KKJ A;  4EKU A;  1HA5 A;  4ZYS A;  1PGB A;  3CMM B;  1YQ3 B;  1EO6 A;  1UNS A;  2L3Z A;  3KVF B;  3P4R B;  1V5O A;  3V3X A;  3SU8 X;  1SEB D;  1WY8 A;  2FUG 1;  5C2T B;  4LJP B;  2LMC A;  5AUI A;  2O2V B;  4N9F 4;  2EKE C;  3DBS A;  2FFM A;  4A55 A;  1QZE A;  1TS5 A;  4E9J A;  2K0P A;  1JML A;  1WHR A;  3DBL B;  4AJW A;  4LNI A;  2MEK A;  4FXC A;  2JZZ A;  2INP E;  1I4X A;  2L0F A;  1I4G A;  3B2F A;  4ARI A;  2JY6 A;  3A1Q A;  3X23 A;  3GOE A;  3VDZ A;  5JH5 C;  4LF9 H;  2PEA A;  4IWP A;  2WDV B;  4ZHO A;  3URY A;  4MT5 A;  3HK0 A;  3B0A A;  2N9K A;  4FN2 A;  3S2A A;  3W9C B;  2V1Y A;  2ANN A;  4BBN C;  1J7C A;  4EFO A;  2C7N B;  2MJ3 A;  4NNJ B;  2JPH A;  4RM9 A;  2IGD A;  4H2A A;  2KDF B;  1T6B X;  5D6J B;  2CTL A;  4ANV A;  3GZN I;  1L2N A;  4A90 A;  3TUO A;  3ZVV A;  1WGD A;  3NG0 A;  2FUH B;  5DPS A;  3QJZ A;  2M0X A;  4MEM A;  2FBW B;  2YVC A;  4L2Y A;  2KJH B;  3GP7 A;  3P4P B;  1GJZ A;  4AQY H;  5FLX W;  4WAL A;  1YJI A;  2WXI A;  2IND C;  1FIQ A;  4QAY A;  5BMH A;  2HTM E;  1YD8 U;  3IG3 A;  3A1Q B;  4X66 H;  1YX6 B;  1S20 A;  4RH6 A;  1B1Z A;  2W9N A;  1J7B A;  4ZRI A;  2EMS A;  4WAN A;  2YLM A;  2QJL A;  1ZTG A;  4KDI C;  4NQL B;  2K9X A;  4DV2 H;  3ZQ4 A;  3L4P A;  2Y5P A;  2MHJ A;  1WXM A;  4MSQ B;  4K3B A;  3N1Y C;  5BMI A;  3GR5 A;  3FC4 A;  1V1O A;  3H7P A;  3AED B;  3HUI A;  1P98 A;  2G45 B;  1TKG A;  5LL6 b;  4CYE A;  3AE2 B;  4DDG D;  5LXI B;  1Q0W B;  4FJY A;  1C1Y B;  4P16 A;  5EE9 A;  2OHF A;  2D3G A;  4GU2 A;  3LJ3 A;  2MA9 B;  4CQN A;  1X1M A;  4WQM A;  2OJR A;  2LVQ A;  4ACF A;  4JYA H;  2DYM A;  3L13 A;  1KHM A;  2ON8 A;  2BYE A;  4B3T H;  1UWM A;  4WJN A;  2AXY A;  4KDL B;  2NS5 A;  3B1L X;  1VBI A;  2G1E A;  1TKY A;  1V9J A;  4KGS A;  1V2Y A;  1R4N I;  3TL5 A;  1WI0 A;  2WU2 B;  2PW9 A;  1KRH A;  4URK A;  2KLG A;  1NVI D;  3HM3 A;  1CK1 A;  4LIJ A;  3DBL I;  3PSE B;  3H7P B;  4RF0 A;  5G55 A;  3ZXV A;  4NXM H;  3IBE A;  2KKC A;  4ZOH C;  1QT9 A;  1QQR A;  3QD7 X;  1XNR H;  3U7D A;  4FA6 A;  3BWU D;  4W9H A;  1VZ6 A;  3GS2 A;  3MFG A;  4HCN B;  4K7U A;  4GGQ A;  5A2Q W;  1E8X A;  4TKN A;  4BBN F;  5BR8 H;  4EOY A;  2J7Q B;  2K25 A;  2WU5 B;  1PGX A;  3ML8 A;  4OVU A;  1WGR A;  2GBR A;  2PE6 B;  4US8 A;  4N6E B;  1FRR A;  4W9D A;  1Z2I A;  4DXG A;  2L8J A;  2QEJ C;  4YT0 B;  1E7V A;  4LF4 H;  1C79 A;  4FJS A;  1F9J A;  3UGB B;  2MQJ A;  3H1U A;  2D5G A;  2WXR A;  1WXV A;  3DWG C;  1V8C A;  1ZZJ A;  3DHG C;  1HNX H;  4K1R B;  2N1V A;  2L7R A;  1YQ4 B;  5G2N A;  1WGG A;  4PK1 A;  2KXJ A;  3AI5 A;  3ZGZ A;  1WE7 A;  3MTN B;  1V81 A;  3OSS D;  1EWC A;  1HTO A;  2KTF A;  1FD6 A;  4YY3 H;  2WS3 B;  3WCQ A;  4DR3 H;  3RNA C;  1I42 A;  4JI6 H;  4HRS A;  3AEF B;  3R66 C;  4PT5 A;  4HDO A;  5C3J B;  2M17 A;  2HHH H;  4L1B A;  2CTM A;  2KQ4 X;  2BWF A;  1MHH E;  5CHV C;  3AUL A;  4DHZ E;  1JRP A;  5BYQ A;  3Q3F A;  1HNZ H;  4LF7 H;  3QCA A;  3QC8 B;  1WFY A;  2KWV B;  4FLH A;  2I38 A;  1WMH A;  2CWH A;  1WJ4 A;  1WX7 A;  2DLB A;  2N7E A;  1OEY J;  2DEN B;  2WDT B;  1LM8 B;  1QF6 A;  4DK5 A;  1D5X C;  3KWV A;  3W5U B;  1I7H A;  4PYU A;  2KVR A;  3JW0 X;  2EMT A;  3VH4 B;  3PZ8 A;  2BKF A;  2UU9 H;  2QC8 A;  1NBF C;  4KHP H;  4XC2 A;  2JT4 B;  3PHX B;  3UQA A;  2FNJ B;  1D4B A;  3R2I A;  4G50 A;  3U4E G;  4WJO A;  2IBI B;  3ML9 A;  4RGM A;  2B76 B;  5AZG A;  3L16 A;  3H6N A;  5EE3 A;  2OPU A;  2JWU A;  1DOX A;  4ANX A;  1E7P B;  3PGE A;  2IGG A;  2MSE D;  1UBQ A;  1XMQ H;  3KUZ A;  1RAX A;  1A70 A;  3W2D A;  2K6D B;  5IWA H;  3BK1 A;  1V86 A;  1FXI A;  2IYD B;  1AWD A;  1T0Q C;  1WMH B;  4W9I A;  3PLV A;  1R4M B;  2JE6 I;  3I63 C;  1X9Z A;  1KFY B;  3C19 A;  4WJQ A;  2QCZ A;  2KMA A;  4B95 A;  4KVG B;  5KHQ A;  1N61 A;  3VTV A;  1IBL H;  3RUI B;  2GBN A;  5HI1 A;  2KMM A;  5K36 G;  5H92 C;  2RGF A;  1MVK A;  1C4A A;  4GB9 A;  2JU6 X;  3TCA A;  4LFA H;  2CWF A;  4N59 A;  3HHM A;  3BIN A;  2LGX A;  4RCO A;  3SDL C;  2D2Q A;  2Z0S A;  3ENE A;  1V1P A;  3PO0 A;  5IO9 A;  3H9D A;  2W55 A;  1S1Q B;  4KGT A;  4I6N B;  3EEC A;  2R2O A;  2MH7 A;  1KOT A;  5JHB A;  3BY4 B;  4KZC A;  1ZZI A;  1J5E H;  5IKC M;  2NN6 G;  1NDD A;  3WAL A;  1P1A A;  4RGN A;  2IZV B;  2LUE A;  4BA1 I;  1WVN A;  5J17 A;  2L32 A;  4FBJ B;  1E10 A;  4DHZ B;  1FCL A;  1F52 A;  2XK5 A;  3E9S A;  1C4C A;  4RNA A;  5TSS A;  2MWS B;  3GE3 C;  1OTR B;  3B9J A;  1C9F A;  1P7E A;  2P2R A;  1LO5 D;  4OX9 H;  5LMU H;  5BMG A;  4BKT A;  5C1Z A;  1PFD A;  4BFR A;  2WX1 A;  2JZP A;  3Q8F A;  2LI5 A;  2ONQ A;  1ESF A;  3CST A;  1V1P B;  1UGM A;  2JVZ A;  2SAK A;  3J7A K;  2R61 A;  4G0N B;  2MBE A;  3V69 A;  3CWI A;  4BAX A;  5HG2 A;  3RNB C;  3NOB A;  1GC6 A;  2NMQ A;  1M4V A;  3NZU A;  4GIV A;  3EFU A;  1NYQ A;  5EE1 A;  1CJE A;  1SE3 A;  4USA A;  5GXG B;  4G11 A;  3ECI A;  4XWW A;  2IO1 B;  1MHX A;  1WZ3 A;  3TEY A;  2GBM A;  2C9W B;  2XK5 B;  3PTF C;  2DNF A;  2CS4 A;  2M0A A;  3SHQ A;  1J4W A;  2PMV A;  4P6V F;  4YHH H;  4MAC A;  3VRA B;  5EDS A;  1OQY A;  4XX5 A;  2M19 A;  3U52 E;  5IP4 D;  1S3S G;  1FFV A;  1R4M I;  4LFC H;  1DYQ A;  3T3N A;  1E6E B;  3DCG A;  1WX9 A;  2ZVN A;  4GSW A;  5D7G A;  5E6O A;  2DGR A;  2PQU A;  4B3S H;  2TSS A;  4K81 A;  2DZJ A;  3KUD B;  4AS1 A;  3I5J C;  2IDY A;  4YWG G;  5DCN A;  4EZK A;  3WAO A;  3NRZ A;  2J0M A;  4K3C A;  3NVY A;  4DV4 H;  2O6V A;  5TR5 A;  4GXB A;  3KYD D;  5AZF A;  1U4A A;  2IY0 B;  4GLS C;  4NZR M;  3NZS A;  1C3T A;  4JI8 H;  3AU5 A;  3KYC D;  4JVY A;  1GOZ A;  1XMO H;  2PTL A;  3SFD B;  1XRH A;  2BL5 A;  3W1S A;  3BVZ A;  1HE8 A;  2ZNV B;  1WX8 A;  3QAQ A;  1I6U A;  1I4Q A;  3DBH B;  4FJZ A;  1N6Z A;  3T9L A;  3T3O A;  3AE9 B;  2OOB B;  5G5H A;  4B0E A;  1OQR A;  3DBR I;  3RI7 C;  2CTK A;  4DV0 H;  3VR9 B;  4WWO A;  3EC8 A;  5E6N A;  1WSP A;  3TMP B;  2X06 A;  4JWS C;  4JI1 H;  2Y5B B;  3LXF A;  3NY5 A;  5AZH A;  3C8Y A;  3AEE B;  3APD A;  2O6V B;  1C77 A;  1E90 A;  1C76 A;  4B3R H;  1IGD A;  2MCN B;  3ZLZ A;  1VCB A;  3VH3 B;  3RNE C;  1FJG H;  4JI5 H;  3NVZ A;  3AEV B;  2X8X X;  4JX1 C;  1ZDV A;  4C7Y A;  1UH6 A;  2CTJ A;  2K8H A;  3RPF C;  3VUX A;  4A8X C;  2KAN A;  1P0R A;  1SE2 A;  2QND A;  3N1X C;  2ZJD A;  2J4X A;  1WJN A;  3MHZ A;  2FMR A;  2Z0D B;  3N3K B;  3V6E B;  2VQE H;  4HKZ E;  3NVW A;  1SIF A;  1SF0 A;  2D11 A;  5JEA G;  4II3 B;  3ALB A;  2D9I A;  3NZ3 A;  1V49 A;  1IGC A;  3R8B A;  1KLU D;  1J5K A;  2KDM A;  4LLG M;  5D94 A;  1SE4 A;  4W9L A;  1XLO A;  4REZ A;  2KFJ A;  1I4H A;  2O6V D;  2KNB A;  1VZ8 A;  2CTF A;  2KVZ A;  2VH1 A;  2V9H A;  1IPG A;  1VD2 A;  1NYR A;  3APF A;  4PS7 A;  3IVF A;  2JX5 A;  1XEE A;  1STE A;  1V80 A;  2WHI A;  1NEK B;  3PRP B;  3ZRC A;  1Z2M A;  2JXT A;  2WXM A;  3PVL A;  1PUT A;  2KFK A;  4HPP A;  2BA0 A;  3T1H H;  2BW2 A;  2HD5 B;  4W9K A;  4ICU A;  5AUK A;  5AEK B;  3U1K A;  4RGT A;  2Z59 B;  1CMX B;  1CQV A;  2JZX A;  3UIO B;  3PLU A;  4M01 A;  4NJ7 A;  2BF8 B;  4KSL C;  4ZRP A;  3DDC B;  2ZQE A;  2N7J A;  4OVV A;  1AW7 A;  4OD6 A;  2AYO B;  3V61 A;  5E6J A;  3LYY A;  1BXT A;  2IO3 B;  1UGJ A;  4C56 C;  4IM0 A;  4C7Z A;  1ZDX A;  1GAQ B;  1R7S A;  2JA9 A;  3DBH I;  2L83 A;  2UWQ A;  1V9N A;  3FIL A;  4M8M A;  4IWO A;  1TUA A;  3I0P A;  2WYQ A;  2FCQ A;  3GE8 C;  4DR5 H;  4RF1 A;  4EC5 A;  3PS6 A;  2G4S A;  3L10 B;  4IM2 A;  4NZT M;  2OPV A;  3IAS 1;  2KFK B;  4WH4 A;  3ZNG C;  1KH0 A;  1WM3 A;  2J0K A;  4XGA B;  4BVU C;  2BS3 B;  3ZRF A;  1FNU A;  3JSV A;  4LFB H;  2L0T A;  3OLM D;  2KC1 A;  2DZM A;  1WIA A;  2KJR A;  2JQR B;  4WJP A;  1JQ4 A;  2LEK A;  3M62 B;  4HXD A;  4DDI D;  4ZRQ A;  4TV3 A;  4I6L B;  3V62 A;  2UU7 A;  1T3Q A;  1XLN A;  2K5P A;  3RNC C;  3FIL B;  4GKK H;  3HM6 X;  4H8A A;  3MC8 A;  4CHK A;  1L0X B;  3DPD A;  2X38 A;  2ZW1 A;  3WAP A;  2LJ5 A;  1C4P A;  3AE5 B;  4K7S A;  3QA8 A;  1T0S C;  3TSS A;  1FEH A;  1GB1 A;  1SE9 A;  3ABV B;  3JSV B;  4A6Q A;  2BQQ A;  1Q1O A;  2PKO A;  3N20 C;  4EZL A;  2W54 A;  5LMN H;  2INN E;  3SFE B;  4TUU A;  1MG8 A;  4IW0 A;  1J8C A;  2JEA I;  1QKZ A;  4AJY B;  4FUL A;  1TKE A;  2I2Y A;  1DT4 A;  1VIH A;  2DZK A;  5E6P A;  3ZKJ C;  3P1M A;  4HWI B;  3QK0 A;  1N5W A;  2MP2 A;  1VIG A;  3V05 A;  4D2K A;  3M95 A;  1XCT L;  2QMT A;  4JPS A;  3WIM A;  2A5U A;  2ICI A;  4IUM B;  4HVB A;  1NXU A;  2XNA C;  4LTU A;  1TIF A;  4IC7 B;  2NTT A;  4R3D A;  4DV5 H;  3ZTD A;  4AM3 A;  2FE8 A;  4LNF A;  1I4R A;  2I1K A;  2D07 B;  3H8H A;  2CPM A;  3MP9 A;  3Q8E A;  2LTL A;  4UDU C;  4BA2 I;  3U7Z A;  2BS4 B;  2KK8 A;  1SEI A;  3OET A;  1VDV A;  1VRA B;  2WXL A;  3E56 A;  2BB6 A;  4OZA A;  2PVG C;  4RGO S;  3IAM 1;  3AN1 A;  1PGA A;  1TZ1 A;  4E71 A;  3RUL A;  1HR0 H;  2ASQ A;  2HJ1 A;  1EUV B;  4DR4 H;  2MP2 B;  1TZO A;  2MJH A;  1RWS A;  3V6C B;  2BS2 B;  1SIJ A;  3WAM A;  4II2 B;  1WGK A;  2J53 A;  4ZDV A;  4HK2 A;  5LXH A;  2FCS A;  2KC2 A;  2KQ7 A;  2J52 A;  1UZX B;  3AE1 B;  3DVN U;  2W3R A;  4NQK E;  3O13 A;  1FM0 D;  3KDK A;  3FKY A;  4OW0 A;  4AQ7 A;  1E0Z A;  2JRH A;  4ZHP A;  5CTR C;  5CHW A;  4ICV A;  2L00 B;  1X4M A;  2UUC H;  2CKH B;  3RNF C;  3VVW B;  3Q3J A;  2AX5 A;  4MH0 E;  1K50 A;  2N4F A;  1GB4 A;  1LXD A;  1YN5 A;  1QLB B;  4DBG A;  1YN3 A;  3VUY A;  2DWQ A;  1IBK H;  5FR3 A;  1XF5 L;  4RM8 A;  1N34 H;  1NEN B;  2LHD A;  1TT5 B;  3VQI A;  3AB5 A;  4M00 A;  3VTU A;  5IT9 W;  1ENF A;  2KO3 A;  4A3O A;  3V60 A;  3RT3 B;  2JVC A;  1H8C A;  3W1Y A;  4MM3 A;  4LDT B;  4DUY H;  4DV1 H;  1SXT A;  4OVZ A;  1XO3 A;  5FKA C;  3QIJ A;  5DPT A;  1VLB A;  4ZYN A;  2G3Q B;  1FMA D;  1L0Y B;  2LD9 A;  2LUM A;  1AN7 A;  1KJT A;  3P2B A;  2L52 A;  4DV7 H;  4PYZ A;  4EE2 A;  3VHT C;  2E3T A;  4MJS A;  4IOI E;  5KHO A;  1WWT A;  2Y3A A;  2W82 A;  4LJO B;  1LFD A;  2Z0E B;  2UXD H;  3A33 B;  1Y8R C;  1WXQ A;  5DPR A;  5FK9 C;  2REX A;  2WX0 A;  3OJ3 A;  2LGY A;  2INC C;  3CIR B;  4LDT D;  4KGR A;  1K8R B;  3FAU A;  1RLF A;  4L23 A;  3L17 A;  2AEH A;  4MM3 B;  4KX6 B;  2K22 A;  2VQF H;  5BYS A;  1YX5 B;  3RF2 A;  4A9A A;  3SR6 A;  2H89 B;  1TY0 A;  3VUW A;  2FCN A;  3KQ4 A;  2DHZ A;  3TEW A;  2YQR A;  3X0W A;  1TY2 A;  2MBO A;  4F7Z A;  1K52 A;  4YSZ B;  2J0J A;  4JWU C;  1D6E C;  2CU1 A;  2F4V H;  1N60 A;  1E9M A;  3IFW B;  3AH7 A;  4IM3 A;  2AQ1 B;  2RSU A;  1FFU A;  2DAF A;  4X57 B;  3NCV A;  1E5W A;  3WA0 A;  2LGD A;  2AWT A;  3PRM B;  1K51 A;  1UD7 A;  5C23 A;  1Q5W B;  3RN9 C;  1P3Q U;  1JWB D;  1RFA A;  2SEB D;  2PIA A;  4MSM B;  3MC9 A;  2L05 A;  1WJU A;  1UF0 A;  1ET6 A;  3Q8B A;  1F0Z A;  2GMI C;  2VH2 A;  3MHS D;  2UXC H;  2RDH A;  2IJ0 A;  3ZJV A;  2WDQ B;  2DYO A;  5JXV A;  3TBL D;  1WF9 A;  2ZM6 H;  2HH3 A;  1M94 A;  4N58 A;  1PDX A;  1X0A A;  4DV3 H;  2KAC A;  3UIP B;  2WGS A;  1IUE A;  2KDI A;  2PPH A;  1JWS D;  2CHX A;  1HTQ A;  4ASW C;  4XDD A;  3N32 A;  2LF0 A;  4GDL A;  2VZK B;  4CO7 A;  2RMM A;  4HPM B;  1GC7 A;  2OJW A;  3HRD D;  4OCH A;  4YL8 A;  2IPK D;  2WXK A;  3PHW B;  3EGR A;  3W5V B;  1QOG A;  4C80 A;  4NY0 A;  3U2S C;  2C7H A;  4F8C B;  1JWA D;  2O4C A;  2IO2 B;  3AXC A;  3VR8 B;  2FID A;  1RRB A;  1LQB A;  5CX3 A;  2EKI A;  2ZVO A;  3L7Z C;  3AE6 B;  3DHH C;  1XQQ A;  2EEL A;  2LRR A;  1JWM D;  2C7M B;  1SBB B;  4HDQ A;  3A9J A;  1FXA A;  1T0R C;  1ROE A;  3AU4 A;  4LNK A;  2XBB C;  3U30 A;  5JHA A;  4DHJ B;  2VZK D;  1L4D B;  1XLQ A;  2GBK A;  2N9P C;  1YJ1 A;  2PLP A;  2RR9 A;  4DR6 H;  2JRI B;  4GDL B;  4HEA 1;  4M02 A;  3K9P B;  2KWD A;  1BML C;  5IA7 A;  2MJE A;  3DWM A;  2GRI A;  1P7F A;  2HE7 A;  3VFK A;  1QOF A;  4S0R A;  4O1N A;  2JXX A;  1IP9 A;  4K0K H;  1WH3 A;  3NJT A;  3KW5 B;  3GZN B;  1G6J A;  2LZ6 A;  4X65 H;  1OFF A;  2IO0 B;  1EC6 A;  3CF6 E;  4KZ0 A;  1T0Y A;  1C78 A;  2DAJ A;  3N9Y C;  1VR9 A;  1E8Z A;  4RMA A;  4MGK E;  2VRR B;  2HDE A;  3AEA B;  3A9J B;  4LF5 H;  4DHJ D;  1N32 H;  2M4N A;  3NHE B;  1H4R A;  4B8T A;  1FCC C;  1PQS A;  3ONS A;  1AN8 A;  2ZNV C;  1OEY A;  3DQV A;  1L7Y A;  1HEZ E;  4XZ4 A;  3UQB A;  5MPO A;  2ANR A;  2MBB B;  2WDR B;  4B6W A;  3CSF A;  5DPW A;  1KTK A;  2K1F A;  3ZW3 A;  4G08 A;  4OZB A;  3QHT A;  2ZW0 A;  2D3B A;  2BTE A;  3SB1 A;  2WXH A;  2NTS A;  1ZW7 A;  3PZ7 A;  1A5R A;  3APC A;  1JW9 D;  4NJ6 A;  3QQ8 B;  4A3P A;  2V3N A;  1NI2 A;  1F2R C;  1I94 H;  2KOX A;  1KF6 B;  3HVZ A;  1E8Y A;  1J0G A;  3P4S B;  3DHI C;  2LVO A;  5HFY A;  2GLS A;  2LHE A;  4HLE A;  3AEB B;  3SEB A;  3KUC B;  4DR7 H;  3EFC A;  1R4N B;  3R3M A;  4M0W A;  4TMA B;  3W1S C;  2KJ6 A;  3R2T A;  2FAZ A;  2LGI A;  2D3C A;  3Q3M C;  4M8N A;  1FKA H;  4FJV B;  2LJI A;  4NBQ A;  1XNQ H;  3KH0 A;  3PT2 B;  1TJE A;  2LXA A;  3L54 A;  1EWY C;  1WGY A;  5JZE B;  3Q3N C;  5D3D A;  2LXC A;  4MGY E;  1VZ7 A;  1L6V A;  3RD2 A;  2KHW B;  5L83 A;  2PY9 A;  2D3A A;  2M8S A;  1GG3 A;  2WWZ A;  1HXY D;  3C0R B;  2VKC A;  4DQO C;  2BYV E;  2OED A;  1K53 A;  3IT6 B;  3NS8 A;  4G3X B;  1ET9 A;  3I57 A;  2DYB A;  4S17 A;  4JI7 H;  2L76 A;  2YEP B;  3BVM A;  1XCQ L;  3DVG X;  1UG8 A;  2JYT A;  2JYE A;  3M3J A;  4X62 H;  4NZL B;  2PT7 G;  1T5X D;  2FPH X;  4QMF B;  3QAR A;  1WJ6 A;  3EA6 A;  4KV2 A;  4M0W B;  5BO4 B;  2JEB I;  4F1S A;  2MBH A;  2Y5C A;  4OHJ A;  3BK2 A;  3PPA A;  2NBV B;  5G5G A;  1SGH A;  5EE0 A;  2NBW B;  4WAA A;  2UYZ B;  1ZZK A;  5FR6 A;  4HRO A;  1F2R I;  2G4D B;  2K39 A;  3QWZ B;  4KKI A;  1F1H A;  3RMK C;  4JVH A;  1Q10 A;  4EZJ A;  1L6U A;  4E3C A;  4AP4 C;  1TS4 A;  4JI4 H;  4IWQ A;  3AE8 B;  1DTJ A;  1ZPS A;  2IY1 B;  4JQW C;  2V3S A;  1JRO A;  2KQS A;  4XWT A;  1MFW A;  2UUA H;  1WTJ A;  1HQR D;  2WXQ A;  4GN1 A;  1DOI A;  2LAS A;  1L5P A;  2JWZ A;  4TQ0 A;  3ZXR A;  3D32 A;  3SD5 A;  2AQ3 B;  1RYJ A;  4WWN A;  1IBM H;  3PRE A;  1EM7 A;  3P63 A;  4LK0 M;  2KLC A;  3AE4 B;  3J9C A;  4GMV A;  2WXP A;  4JI3 H;  5H8Y E;  2LVP A;  3VXW A;  2K6Q A;  3J81 W;  3TJP A;  2KAJ A;  1F0X A;  3DOW A;  3MJW A;  4JLC A;  3TIX A;  2GB1 A;  3UI3 A;  4HKQ A;  1TTN A;  2CPQ A;  3VTW A;  1L0V B;  4YTP B;  4W9C A;  2WXF A;  1XXG A;  2M1M A;  3R7Q A;  4C00 A;  2DBY A;  3AE3 B;  2A4Z A;  4BKS A;  3VAW A;  1V97 A;  1Z5S B;  4WIP A;  1EF5 A;  4GKJ H;  2FIF A;  1QIL A;  1WRI A;  3PZD A;  3LDZ E;  1WYG A;  1SJE D;  1IBX A;  3KDG A;  3ZIM A;  2Z8L A;  1I4P A;  3JVZ X;  1PQX A;  2M56 B;  1N5X A;  1YMH E;  3R7R A;  4BOS C;  1JWU D;  4BZA A;  1WXS A;  1HZ6 A;  2PE9 A;  1N33 H;  3NUH B;  2MX2 A;  3BVG A;  5GMV A;  3GAB A;  1V6E A;  1AAR A;  2PVO D;  4MGZ E;  1ZKH A;  3U8Z A;  2ZZP B;  1WRD B;  2MBQ A;  4RFB A;  3UIN B;  4DWF A;  1KM7 A;  2QSD A;  3RYT A;  2J42 A;  3RZF A;  2CHW A;  1XD3 B;  1YJJ A;  4ITK A;  3ZJU A;  2LGS A;  3RCZ A;  3AV8 A;  3AEC B;  1BUI C;  1ISN A;  2BKR B;  4BKG A;  2BWE S;  1RM6 C;  4OO1 G;  3VRB B;  4E74 A;  1IBX B;  1TYG B;  1EU3 A;  5IOI A;  3ZNI D;  1GNU A;  3EHV A;  1ACC A;  2N9X A;  2NR2 A;  3GKU A;  3BII D;  2JSV X;  1WR6 E;  4NJC A;  2N1W A;  2NCN A;  2WXO A;  2RPV A;  2CJN A;  1DGJ A;  1FXT B;  2RD0 A;  3A9K A;  5BYR A;  1WR1 A;  2KYW A;  2V4I B;  1OGW A;  4JI2 H;  4BOZ B;  3VKE A;  2YEP F;  2KDB A;  1JRU A;  4WQO B;  2V4L A;  2IGH A;  2E6X A;  1YNT E;  3H7S A;  5J18 A;  5D2M B;  3TEX A;  2HTH A;  1RFK A;  2QDF A;  2C60 A;  4US9 A;  5C0X G;  2KDE B;  3QX1 A;  4YTM B;  1MPE A;  2M6Q A;  4EEW A;  2NBU A;  1F77 A;  2KN4 A;  1UWX A;  2KMC A;  4AIM A;  4NAW A;  1SJH D;  4BKS D;  2K8B A;  3DVN V;  1PYW D;  1TBE A;  3ZTC A;  1FNV A;  4PS8 A;  2G9H D;  3Q8C A;  1TS3 A;  3ETR A;  1WE6 A;  3T1Y H;  3BYT B;  2LWP A;  2GBJ A;  2KD0 A;  2KTR A;  1J19 A;  1D5Z C;  4ZRJ A;  2KZR A;  4ZRK A;  3P42 A;  2LTM A;  1WYW B;  1Y56 A;  4Q2J A;  2CHZ A;  3JYU A;  1WE8 A;  4AOF A;  1NI3 A;  4ARC A;  2E3U A;  1VJK A;  3A9K B;  5IAA C;  1TS2 A;  4WWP A;  3DVG Y;  1CZP A;  3RFZ B;  1AYF A;  1WGH A;  4NXN H;  2BPS A;  2W3S A;  4LF6 H;  3T8M A;  1WXA A;  5LNK 1;  5CHF A;  3ZO5 B;  4LF8 H;  1MJD A;  1ZXH A;  2N0S B;  4ANW A;  4NAW B;  3AE7 B;  1MG4 A;  2FCM A;  3EZJ A;  1ODH A;  4J6I A;  1SB3 C;  4X64 H;  3I9V 1;  4HJG E;  4K7W A;  2KN5 A;  3KWL A;  4PDB A;  2KTR B;  2WXJ A;  1P9D U;  2BBC A;  3J80 W;  3N30 A;  2KWU B;  1XT9 B;  4J3O D;  2HJ8 A;  4HCP B;  1QOA A;  1DOY A;  4C4V A;  2M8W A;  3Q2A C;  2BGF A;  3ZUN A;  4XE0 A;  5HHD G;  2UUB H;  1E8W A;  4JE3 B;  1LGR A;  4GDK A;  4P1B C;  1SSN A;  1EU4 A;  5IN7 A;  2WLB A;  4AWJ A;  3AMZ A;  1JCK B;  2K8C A;  5T8I A;  1YQB A;  4MDK E;  1KLG D;  2D10 A;  2BVC A;  2WQY B;  2KT7 A;  2LRW A;  4TSS A;  1FO4 A;  2GI9 A;  2HH2 A; 
#chains in the Genus database with same CATH homology
 3IAS 1;  2V0G A;  2ACZ B;  4WWM A;  1OFF A;  1YQ4 B;  4WH4 A;  2MJD A;  1ZE3 D;  1KH0 A;  3ZGZ A;  1L4Z B;  4IDI A;  4DXF A;  1C78 A;  1EWC A;  3N9Y C;  2BS3 B;  1VR9 A;  1FD6 A;  1FNU A;  2WS3 B;  3WCQ A;  2V3P A;  2HDE A;  4YSX B;  4HRS A;  3AEA B;  2RDG A;  2H88 B;  3AEF B;  4PT5 A;  1OQQ A;  5C3J B;  3MJ5 A;  1FCC C;  4L1B A;  3ZJT A;  2JQR B;  5D3I B;  1JQ4 A;  2QIE B;  1AN8 A;  4GDK B;  2LEK A;  2KQ4 X;  4ZRQ A;  1MHH E;  3TEZ A;  1GPX A;  1HEZ E;  1T3Q A;  5MPO A;  3HVD A;  2CU3 A;  1JRP A;  1XLN A;  2WDR B;  2K5P A;  5BYQ A;  3FIL B;  1KTK A;  4WUR A;  4OZB A;  2ZW0 A;  1JAL A;  2BTE A;  1FRD A;  3Q8A A;  2I38 A;  2WXH A;  1L0X B;  2NTS A;  3PZ7 A;  2DLB A;  4YXD B;  2X38 A;  1JW9 D;  2ZW1 A;  1C4P A;  3AE5 B;  2L1A A;  3EUB 2;  1QF6 A;  1D5X C;  3TSS A;  2V3N A;  4IKG A;  1FEH A;  3KWV A;  3AM9 A;  1F2R C;  1I7H A;  3W5U B;  1GB1 A;  1KF6 B;  3HVZ A;  2QIL A;  3PZ8 A;  3P4S B;  3ZYY X;  3ABV B;  5HFY A;  4A6Q A;  2LHE A;  4NAM A;  1ZP0 B;  1D4B A;  4MH8 A;  2BYT A;  3R2I A;  2PKO A;  3AEB B;  3SEB A;  3U4E G;  2XN9 C;  4RGM A;  2W54 A;  1MI0 A;  4M0W A;  2B76 B;  2INN E;  4TMA B;  3NVV A;  3SFE B;  3R2T A;  1FNW A;  2LGI A;  1ZUD 2;  5EE3 A;  2LJI A;  2JWU A;  1DOX A;  1HZ5 A;  1E7P B;  1QKZ A;  2IGG A;  1TJE A;  1TKE A;  2I2Y A;  2BB5 A;  1EWY C;  3P1M A;  1A70 A;  5D3D A;  1N5W A;  3W2D A;  3V05 A;  3BK1 A;  1FXI A;  4D2K A;  1VZ7 A;  1L6V A;  1XCT L;  2QMT A;  4JPS A;  1AWD A;  2ICI A;  1HXY D;  2Q5W D;  4DQO C;  2XNA C;  1KFY B;  4LTU A;  2OED A;  1K53 A;  3Q69 A;  1N63 A;  3IT6 B;  2NTT A;  1ET9 A;  4R3D A;  3I57 A;  2FE8 A;  2WP9 B;  2YEP B;  3BVM A;  3GB1 A;  1I4R A;  1D5M C;  1XCQ L;  1N61 A;  3H8H A;  2JYT A;  5HI1 A;  2JYE A;  2KMM A;  3MP9 A;  3Q8E A;  2K3U A;  5H92 C;  4UDU C;  4NZL B;  1QOB A;  1T5X D;  1MVK A;  1C4A A;  3U7Z A;  2BS4 B;  3EA6 A;  2JU6 X;  3IXS A;  4N59 A;  2WNM A;  2Y5C A;  4RCO A;  1VDV A;  1J7A A;  4OHJ A;  1VRA B;  1XLP A;  2WXL A;  2BB6 A;  3E56 A;  2PVG C;  3IT4 B;  4OZA A;  4RGO S;  3IAM 1;  3BK2 A;  3AN1 A;  3LB8 C;  1PGA A;  1V1P A;  3PO0 A;  2W55 A;  3OWE B;  4KGT A;  2WXN A;  5I4D A;  5G5G A;  2MH7 A;  5EE0 A;  4B0M A;  4XDC A;  1TZO A;  4HRO A;  1F2R I;  1N62 A;  4KKI A;  1RWS A;  1Q10 A;  2BS2 B;  1ZXI A;  1SIJ A;  3NS1 A;  1WGK A;  2J53 A;  3B2G A;  1UUP A;  3AEG B;  3BYY B;  1L6U A;  4RGN A;  1ZOY B;  1TS4 A;  2J52 A;  4TQ1 A;  3AE1 B;  2L32 A;  3AE8 B;  3FAH A;  1ZPS A;  2W3R A;  3O13 A;  1FM0 D;  1E10 A;  1FCL A;  4OW0 A;  2N9L A;  4AQ7 A;  1E0Z A;  3E9S A;  2CJO A;  2AQ2 B;  1C4C A;  1JRO A;  2BT6 A;  4XWT A;  4RNA A;  5TSS A;  3KLS X;  1HQR D;  2WXQ A;  4WAF A;  1DOI A;  3B9J A;  3MC0 B;  1C9F A;  4ZHP A;  1P7E A;  1YN4 A;  4OZC A;  1L5P A;  3P4Q B;  1LO5 D;  4TQ0 A;  5BMG A;  2AQ3 B;  1B9R A;  1RYJ A;  1PFD A;  2AX5 A;  1K50 A;  1GB4 A;  1EM7 A;  2LFI A;  3P63 A;  3BZD B;  4LK0 M;  2JZP A;  3Q8F A;  1YN5 A;  1ESF A;  1QLB B;  2ONQ A;  1YN3 A;  4YTN B;  2DWQ A;  1V1P B;  3AE4 B;  4YSY B;  3J9C A;  2SAK A;  2R61 A;  2WXG A;  2WXP A;  4KKJ A;  5FR3 A;  5H8Y E;  1HA5 A;  1XF5 L;  4ZYS A;  1PGB A;  3CWI A;  1NEN B;  2KAJ A;  5HG2 A;  1YQ3 B;  2LHD A;  1UNS A;  3VQI A;  3AB5 A;  3P4R B;  2NMQ A;  3V3X A;  1M4V A;  1SEB D;  2FUG 1;  5C2T B;  2GB1 A;  1ENF A;  3UI3 A;  4HKQ A;  1NYQ A;  5EE1 A;  2LMC A;  1CJE A;  5AUI A;  1L0V B;  1SE3 A;  4USA A;  5GXG B;  4YTP B;  4XWW A;  2WXF A;  1XXG A;  3TEY A;  1MHX A;  4A55 A;  1TS5 A;  2DBY A;  1SXT A;  3AE3 B;  4OVZ A;  2K0P A;  1JML A;  1XO3 A;  1V97 A;  2M0A A;  5FKA C;  2PMV A;  4WIP A;  4P6V F;  1VLB A;  4MAC A;  2MEK A;  1FMA D;  4FXC A;  1L0Y B;  3VRA B;  2LUM A;  1QIL A;  1I4X A;  2INP E;  1WRI A;  1I4G A;  3B2F A;  1WYG A;  1SJE D;  4ARI A;  1IBX A;  2L52 A;  3U52 E;  2M19 A;  2Z8L A;  1I4P A;  4EE2 A;  2M56 B;  1N5X A;  1YMH E;  1FFV A;  1JWU D;  1DYQ A;  2E3T A;  2WDV B;  3T3N A;  1E6E B;  5D7G A;  1HZ6 A;  4ZHO A;  3URY A;  2TSS A;  4IOI E;  3NUH B;  4MT5 A;  1WWT A;  4AS1 A;  2IDY A;  4YWG G;  2Y3A A;  2N9K A;  3BVG A;  2W82 A;  3W9C B;  2PVO D;  3NRZ A;  3NVY A;  4RFB A;  1J7C A;  1WXQ A;  5FK9 C;  2QSD A;  2MJ3 A;  3CIR B;  4GLS C;  4KGR A;  2J42 A;  2IGD A;  4H2A A;  1T6B X;  4L23 A;  1GOZ A;  2PTL A;  3SFD B;  3W1S A;  3BVZ A;  4MM3 B;  1YJJ A;  4ITK A;  4A90 A;  4KX6 B;  3TUO A;  2K22 A;  3ZJU A;  1I4Q A;  3AV8 A;  5BYS A;  3T3O A;  2FBW B;  3AE9 B;  1BUI C;  3AEC B;  4A9A A;  5G5H A;  3SR6 A;  2H89 B;  1TY0 A;  1RM6 C;  4B0E A;  4L2Y A;  3KQ4 A;  1OQR A;  3GP7 A;  3P4P B;  3TEW A;  3VRB B;  1YJI A;  2WXI A;  1FIQ A;  1IBX B;  1TYG B;  1EU3 A;  1TY2 A;  3VR9 B;  5BMH A;  2HTM E;  1ACC A;  1K52 A;  4YSZ B;  4JWU C;  3BII D;  2JSV X;  1D6E C;  1WSP A;  4NJC A;  4RH6 A;  1B1Z A;  2WXO A;  1J7B A;  1N60 A;  2RPV A;  2CJN A;  4JWS C;  1DGJ A;  1E9M A;  3AH7 A;  3LXF A;  2AQ1 B;  5BYR A;  2QJL A;  2V4I B;  1FFU A;  2K9X A;  3C8Y A;  2YEP F;  3ZQ4 A;  2Y5P A;  3L4P A;  3AEE B;  2IGH A;  2E6X A;  1YNT E;  3TEX A;  1K51 A;  1C77 A;  1RFK A;  5BMI A;  3FC4 A;  4US9 A;  1C76 A;  1V1O A;  1IGD A;  3AED B;  3HUI A;  4YTM B;  1MPE A;  1TKG A;  3NVZ A;  3AE2 B;  1F77 A;  2KN4 A;  1JWB D;  1UWX A;  4JX1 C;  4P16 A;  1ZDV A;  5EE9 A;  2OHF A;  2SEB D;  2PIA A;  4C7Y A;  1SJH D;  3RPF C;  4A8X C;  1PYW D;  4CQN A;  4WQM A;  1SE2 A;  1ET6 A;  1FNV A;  3Q8B A;  1F0Z A;  2G9H D;  3Q8C A;  2DYM A;  1TS3 A;  2J4X A;  2ON8 A;  2IJ0 A;  2RDH A;  3BYT B;  3ETR A;  3MHZ A;  3ZJV A;  1UWM A;  2WDQ B;  4HKZ E;  2DYO A;  3NVW A;  5JXV A;  1SF0 A;  1D5Z C;  4N58 A;  3P42 A;  3NZ3 A;  1Y56 A;  4Q2J A;  1IGC A;  1PDX A;  3R8B A;  1KLU D;  2G1E A;  1TKY A;  2KDM A;  2KAC A;  4KGS A;  4LLG M;  1SE4 A;  1IUE A;  1NI3 A;  1JWS D;  2PW9 A;  2WU2 B;  4ARC A;  1XLO A;  1VJK A;  4REZ A;  1KRH A;  1TS2 A;  1I4H A;  4XDD A;  1VZ8 A;  1CZP A;  3RFZ B;  1NVI D;  1AYF A;  2VZK B;  2RMM A;  2W3S A;  3HRD D;  1CK1 A;  5LNK 1;  1NYR A;  2IPK D;  2WXK A;  4RF0 A;  3W5V B;  3EGR A;  1QOG A;  4C80 A;  3U2S C;  2JX5 A;  1XEE A;  4ZOH C;  1STE A;  1NEK B;  1QT9 A;  1ZXH A;  1JWA D;  2JXT A;  2N0S B;  4NAW B;  3VR8 B;  1QQR A;  3AE7 B;  2WXM A;  1PUT A;  2EKI A;  3BWU D;  2BW2 A;  1SB3 C;  3I9V 1;  5AUK A;  1VZ6 A;  3GS2 A;  4HJG E;  3MFG A;  3KWL A;  4RGT A;  1CQV A;  3AE6 B;  2WXJ A;  4ZRP A;  2EEL A;  2BBC A;  4J3O D;  1JWM D;  2N7J A;  1SBB B;  1QOA A;  1AW7 A;  1DOY A;  1FXA A;  5E6J A;  1ROE A;  3LYY A;  1BXT A;  2WU5 B;  1PGX A;  4XE0 A;  5HHD G;  4JE3 B;  2VZK D;  1L4D B;  4US8 A;  4N6E B;  1FRR A;  1XLQ A;  1UGJ A;  1SSN A;  1EU4 A;  2PLP A;  4C56 C;  4DXG A;  4C7Z A;  1ZDX A;  2QEJ C;  1GAQ B;  2WLB A;  1R7S A;  4GDL B;  4YT0 B;  3AMZ A;  1JCK B;  4HEA 1;  5T8I A;  1C79 A;  1BML C;  2KWD A;  2L83 A;  1KLG D;  2MJE A;  3DWM A;  2GRI A;  3FIL A;  1P7F A;  2D5G A;  2WQY B;  2WXR A;  3DWG C;  1QOF A;  4O1N A;  4RF1 A;  1V8C A;  4TSS A;  1FO4 A;  2GI9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...