1V8CA

Crystal structure of moad related protein from thermus thermophilus hb8
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
165
structure length
165
Chain Sequence
PKVNLYATFRDLTGKSQLELPGATVGEVLENLVRAYPALKEELFEGEGLAERVSVFLEGRDVRYLQGLSTPLSPGATLDLFPPVAGGGFERTFGAFPPWLLERYLEEWGGTREGEGVYRLPGAVVRFREVEPLKVGSLSIPQLRVEVEGEEAERWFERIAFAASR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MoaD related protein
publication title Crystal Structure of MoaD related protein from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Protein binding
total genus 47
structure length 165
sequence length 165
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02597 ThiS ThiS family
A PF09189 DUF1952 Domain of unknown function (DUF1952)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1v8cA01
3.30.1370.80 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Molybdopterin cofactor biosynthesis MoaD-related, C-terminal domain 1v8cA02
1E7PB 3NVZA 2CJNA 2BS3B 5H8YE 1J7CA 1E6EB 2W3SA 1E10A 1NEKB 1YQ3B 1YQ4B 1V8CA 4YXDB 4P6VF 5C3JB 2OHFA 1N5XA 5H92C 1SB3C 1N60A 1QOFA 2WS3B 1JROA 5GXGB 3NRZA 3SR6A 2L52A 1T3QA 1NYRA 1SF0A 4ITKA 1KF6B 3ABVB 4JWUC 1FMAD 1TYGB 3VR8B 2M19A 3B9JA 1JW9D 1OFFA 1DOXA 5C2TB 1TKEA 3AV8A 1FXIA 2AX5A 1FXAA 2WDQB 1ZOYB 3HVZA 5EE0A 2KAJA 3VRBB 1QF6A 1PDXA 1VJKA 2WU5B 3AEEB 3VRAB 1XLPA 2H88B 2N0SB 3AMZA 4N58A 3AE6B 1VDVA 4JX1C 1QOGA 1JQ4A 4YTMB 1N5WA 1TKGA 2EKIA 3LB8C 4A9AA 1GPXA 4HRSA 2WLBA 5EE9A 1E0ZA 4IDIA 3AM9A 1QLBB 3AECB 1PUTA 3HRDD 2W55A 1F0ZA 2KMMA 2MJ3A 1JRPA 1NI3A 1SIJA 5AUKA 4C80A 4USAA 1JWAD 3AE9B 1FFUA 1KRHA 1JWBD 2QIEB 1L0VB 3P4PB 4YSYB 4WQMA 1FM0D 3PO0A 1XO3A 3ETRA 2WP9B 3B2GA 4YSZB 1CZPA 2BT6A 1J7BA 1FFVA 3NS1A 1AWDA 3NVVA 3P4RB 3P4QB 2FBWB 3AEDB 4LTUA 3B2FA 2B76B 2MJEA 1TJEA 1FRDA 3DWGC 1YJIA 3AE2B 2G1EA 3P4SB 4KX6B 3AEAB 3L4PA 1B9RA 1DOYA 5MPOA 2WU2B 1QOBA 4YTPB 4US8A 2PIAA 3NVYA 1XLOA 3FC4A 1PFDA 3DWMA 3WCQA 2Q5WD 1ZP0B 2ACZB 3FAHA 2HTME 3W5UB 1RWSA 2CU3A 1OQQA 1WYGA 2JQRB 3VR9B 2W3RA 2DBYA 2JX5A 2QJLA 5G5GA 1N63A 1N62A 3BIID 1L6UA 1ZUD2 3P1MA 4YSXB 3AE3B 1YJJA 2LEKA 3KWLA 2BS4B 5G5HA 1NYQA 1V97A 4C7ZA 2MH7A 1J7AA 1QOAA 5EE1A 2PVGC 2WDVB 1I7HA 2H89B 1FRRA 3AEFB 4JWSC 1QT9A 5EE3A 3W9CB 1RYJA 1NENB 4HROA 4US9A 3W5VB 4WWMA 4YT0B 3SFDB 2Y5CA 3AH7A 3ZYYX 3AE1B 2DWQA 1L6VA 3AEBB 2K22A 1VLBA 2PKOA 1GAQB 3CIRB 3LXFA 3RPFC 4C7YA 3AB5A 1EWYC 1KFYB 1XLQA 3AE5B 1FIQA 4FXCA 1A70A 2L83A 1ZXIA 1CJEA 1RM6C 1ROEA 2K5PA 2M56B 1NVID 1JALA 3AN1A 3SFEB 3AE4B 3HUIA 3AEGB 2WDRB 2CJOA 2K9XA 1IUEA 1E9MA 1WWTA 3AE8B 1R7SA 3NVWA 1DOIA 1WXQA 1AYFA 1N61A 1FO4A 1L5PA 4ZHOA 1OQRA 1WRIA 2E3TA 2PVOD 2BS2B 5AUIA 3AE7B 3CWIA 4N59A 4ZOHC 1RFKA 4YTNB 1TKYA 1WGKA 2MJDA 1DGJA 2WQYB 4ZHPA 1UWMA 1XLNA 2W54A 3P63A 3EUB2 4N6EB
chains in the Genus database with same CATH superfamily
2CTFA 1KM7A 5H8YE 1E6EB 3V69A 3SDLC 2MRPA 3JSVA 3HK0A 3R3MA 1HZ6A 3MC9A 2MSED 4PS7A 3ZRFA 4B3TH 1FNWA 1TYGB 5GMVA 5IO9A 1WJ4A 2KC2A 2V0GA 2KDBA 3KYDD 3V60A 1WYWB 4HWIB 1J4WA 2C5LC 2O6VD 2BBCA 3V3XA 4LJPB 4OVZA 1QOGA 2FNJB 4NY0A 2EKIA 3EHVA 2GBKA 1E0ZA 4KV2A 1ET6A 1H8CA 4RF0A 4URKA 4X64H 2FMRA 1S03G 3VH3B 3ZUNA 4M8NA 5E6JA 2WP9B 4KZCA 1GG3A 4LF4H 1XNRH 4LTUA 1UBQA 1P7EA 5DCNA 2ZQEA 4NZLB 3DWGC 4ANUA 1E8YA 1BUIC 4K3BA 2GI9A 1R4MI 1WX8A 1K52A 3DCGA 3MJ5A 3Q3MC 4TV3A 4JLCA 2K8BA 2L7RA 2LD9A 4G11A 1C77A 1V5OA 2CWFA 2L05A 1TT5B 1HR0H 3AE3B 3DBRI 3T3NA 3KUDB 3BVZA 4I6LB 3RD2A 2Z8LA 3W1YA 4ZRQA 3AE1B 3HM6X 3RPFC 1LQBA 5JHBA 3ZJTA 4DR6H 4GXBA 2KKCA 1JWUD 1XT9B 3IT6B 5E6PA 4W9KA 3TIXA 4LJOB 3C0RB 1WGGA 2LRWA 2WXRA 4DR1H 1EF5A 2AXYA 4RMAA 1R4MB 1AYFA 4XGAB 1B1ZA 3PS6A 1KH0A 2BS2B 1DGJA 3ZRCA 2X8XX 2W54A 2F4VH 4N6EB 3Q8CA 4II3B 3DBRB 3N1YC 1WGYA 2WXKA 3BINA 1F1HA 4KZ0A 5H92C 2J4XA 5AZFA 5IAAC 1YIWA 1V2YA 2G4DB 2BB6A 4HCNB 1JWSD 3L17A 4WJNA 3AV8A 4W9LA 2J7QB 4F8CB 4P7IA 2H88B 2WHIA 3AE6B 2KLCA 2ZM6H 4DR5H 1VZ8A 5LMUH 3WIMA 2JZ3B 4NZTM 2RDBC 1HNXH 2KWDA 1ENFA 4NAWB 1ZXHA 2IO1B 2W55A 2HDEA 1TBEA 2LJIA 1WX9A 2Z59B 3P4PB 2WXMA 1V1PB 3ENEA 4JI7H 2IPKD 1CZPA 4LNNA 3RZFA 1AWDA 3P4QB 3AEDB 3I0PA 4BA1I 2B76B 2JZZA 4NJ6A 1SE3A 2MHJA 4B9KA 2NMQA 3RMKC 3P4SB 2OEDA 2PT7G 4B8CD 3NVYA 3VUWA 4WIPA 2O2VB 4LF9H 2R2QA 1V1OA 3BIID 1T0RC 4IKGA 1I42A 2ZCCA 2QC8A 5EE1A 3AEFB 2YEPF 3NZUA 2CHXA 5CHFA 2NPTB 1UGJA 4WANA 3AULA 4WAFA 1Q10A 1IGCA 2DZIA 4HDQA 1QZEA 3QD7X 3EC8A 3PSEB 4KHPH 3C8YA 4M02A 1UWXA 2L76A 1E8XA 4LIJA 2IY1B 2PQUA 4NAWA 1WXQA 2Z0EB 4TUUA 1WXMA 4J6IA 1HTQA 2RDGA 3V62A 2LZ6A 4DUYH 3W1SA 1V1PA 2QMTA 2JRHA 4KKIA 5G55A 3ZJVA 3U7ZA 1U4AA 3VUYA 1Y8RC 2NCNA 4IWOA 4OCHA 2NS5A 2ZZPB 2LI5A 3AU5A 3PRMB 3BZDB 1VBIA 3NRZA 4B3MH 1STEA 4FN2A 4K7UA 2PMVA 4JWUC 1NYRA 3B08A 3RYTA 2LGXA 4AJWA 5E6OA 2KDFB 1MG4A 2KZRA 1AN7A 2WU5B 1VZ7A 2IO3B 3QIJA 3LB8C 1WRDB 1GPXA 1P9DU 2KDMA 5CTRC 1J5KA 2KWCA 3GS2A 5JEAG 4TKNA 3PZ7A 1FM0D 2WXGA 4JGHB 4A55A 1FFVA 1YN5A 2OJWA 3B2FA 4LF6H 4DV2H 3T8MA 1HQRD 1JMLA 4MM3B 4MEMA 1L0XB 5MPOA 3VH4B 2LRRA 3H7PB 1XLOA 1TZ1A 2C7HA 2UXBH 2CU3A 3EECA 1ZZJA 2IZVB 3N32A 3P1MA 3NG0A 3PVLA 1K8RB 5DPWA 4MSQB 3PZ8A 4KDIC 1CK1A 3R66C 3I3TB 2DWQA 2VZKD 3N3KB 1CJEA 3Q3FA 4JQWC 3AEGB 3A4SC 1WWTA 2INCC 1WJUA 2LGYA 4YL8A 4YTMB 3MHSD 4AQYH 2WQYB 4A6QA 1PYWD 1E7PB 4S0RA 4PDBA 4A3OA 4P6VF 4EZLA 1ZGUB 1UD7A 4LF7H 4GB9A 4BFRA 3MC0B 4JIOU 3ZDMC 2EMSA 5LL6b 2DAFA 2KMCA 4K81A 3H7PA 2M19A 3TUOA 4KIKA 2KD0A 1DOXA 1FXIA 3WA0A 1QF6A 1SJHD 4E3CA 4EZKA 4HPLB 4OZBA 1OTRB 1X4NA 5TR5A 1EWCA 3N1ZC 1DTJA 3RNBC 3OG5A 1QLBB 2HH2A 2LASA 2LHEA 2ZJDA 4DV4H 2LXAA 1F0ZA 1KJTA 1P3QU 5D7GA 4EE2A 1NI3A 5IA7A 2SEBD 1L0VB 3UGBB 1I4RA 4XDCA 1EM7A 1V9JA 2KMAA 4ZDVA 3PV1A 3NS1A 3P4RB 4G3XB 1C3TA 4NZRM 4AWJA 2BYFA 4CYEA 1SEIA 2I38A 2GB1A 5LLIA 4AOFA 1XD3B 4LF5H 2PJHA 2C9WB 3DWMA 3APCA 4ZRKA 4NQLB 1A5RA 3L0WB 1KHMA 4NBQA 5FLXW 1VRAB 2D10A 2AYOB 2MJHA 2PLPA 4DXGA 2H89B 4K7SA 4JWSC 4RGTA 2FFMA 4HROA 3ZYYX 3ALBA 4ZYNA 2Z0DB 2UU7A 4BBNC 1NBFC 3CIRB 2ZEQA 3QA8A 1IBLH 1TY2A 4C4VA 4MDKE 2KK8A 2K5PA 4IM0A 1XCQL 4XZ4A 1PGAA 2WXFA 3Q8FA 2WXHA 1IBMH 3NZ3A 4ZRPA 3L13A 5C23A 2HHHH 2KYWA 1BT0A 1MJDA 2BYEA 4QAYA 3AU4A 4Q2JA 2JPHA 5C3JB 3P63A 4ICUA 3NVZA 3BVMA 4M00A 1K50A 4MJSA 3QHTA 3K9OB 4FJYA 4JE3B 1YX6B 1YN4A 1N60A 2KTRB 2LGIA 2G4SA 1T3QA 1KF6B 1FMAD 3TCAA 4ASWC 3PTFC 2KT7A 1OFFA 4HK2A 1X1MA 3ZO5B 2N7EA 3OJ4B 4H2AA 4WWNA 3LDZE 3ZGZA 3AEEB 3EFCA 5TSSA 4FULA 4XC2A 2DAJA 3KWVA 3QARA 4W9CA 1OGWA 4TMAB 1SE4A 3MC8A 2CTKA 2FCNA 3AM9A 3H7SA 2KX3A 3NHEB 3QAQA 1BXTA 4M01A 4USAA 2PE9A 4IFDG 1EU4A 4EUTA 1M94A 3C19A 4YSZB 2CTJA 2BT6A 2ANNA 3AI5A 3U4EG 4GDKB 5FR6A 1MSZA 3N20C 1WXSA 4ARCA 1XXGA 4IM2A 4RGOS 3UQBA 3PZDA 4MH0E 4PS3A 3X23A 1T6BX 1WYGA 2IJ0A 3MHZA 4RGNA 3IFWB 1V9NA 1V80A 2KTRA 4YWGG 1EUVB 3I5JC 3IG3A 3U2SC 4P1BC 2J0KA 4WJPA 1WH3A 3T1HH 2MEKA 3SFDB 1XCTL 4HDOA 1WX7A 5DT9A 1GAQB 3VXWA 2JZXA 3AE5B 1XLQA 1ZXIA 2JA9A 5DPTA 3FAUA 4XDDA 2CJOA 1UELA 4JL9A 2X06A 1SEBD 4ZHOA 3CWIA 4ZOHC 4X62H 2WYQA 4ZYSA 1XLNA 3DBHB 1VR9A 2CJNA 4HJGE 3U7DA 1YQ3B 2C7MB 4GDKA 2WXQA 2J0MA 2N1WA 1ZDVA 4NXMH 3VDZA 1JROA 2HD5B 1SSNA 4TSSA 2KNBA 4A3PA 2LUMA 2ON8A 4G50A 2WDQB 1I4HA 2FCMA 4A20A 2L1AA 2KTFA 3GR5A 4OW0A 3AMZA 4N58A 3N1XC 1LFDA 3BWUD 4OZCA 3FKYA 3KDGA 1L4DB 1S1QB 4MELA 4EKUA 1YMHE 3ZVVA 4KGTA 2MCNB 4IDIA 3RT3B 1HTOA 2NVUI 3NOBA 2AQ3B 4FLHA 4DWFA 3ETRA 1E5WA 3NVVA 2DYBA 1ZTGA 1FRDA 3I9V1 1R4NI 1FEHA 3AXCA 2WU2B 1PFDA 1D5MC 5DPRA 1WMHB 2A4ZA 3HIZA 3WAPA 4AS1A 4NNJB 5J17A 2D9IA 1WI0A 1WR6E 2JX5A 2BQQA 5J18A 3HVDA 2LEKA 4DV7H 2RPQA 1FRRA 1NENB 4YT0B 1FCCC 1WGRA 3JW0X 4C56C 1YQBA 5HI1A 4FXCA 2DGRA 1V86A 2L83A 1NVID 2DZMA 2NN6G 2WDRB 2J0JA 4XWWA 4FJUA 4K7WA 1ZKHA 1WZ0A 3ML9A 3PPAA 1DYQA 1OQRA 4WWOA 1KTKA 3AE7B 3DHGC 4DQOC 2WX0A 2M0XA 4F1SA 2MBOA 4YY3H 3GE8C 4LFAH 4JV5H 3D32A 5DPSA 1LO5D 2ZPNA 4KSLC 4ACFA 4G0NB 2N9PC 4YXDB 2RGFA 3PLVA 3O65B 2DYOA 3H1UA 3M63B 1P1AA 3LYYA 3NY5A 3VR8B 1TUAA 4RM9A 1NXUA 1WMHA 2BKRB 1WHRA 2KJRA 2L00B 4RFBA 4ZRIA 4DR7H 4M8MA 2LXCA 3ZQ4A 5J2RA 1TGZB 4ARIA 4JI5H 2CWHA 2HE7A 2KWVB 3ZJUA 3M3JA 4II2B 3UI3A 2KWUB 2JWZA 2INNE 3W2DA 2LVQA 4WQOB 1KRHA 4YSYB 2A1SA 2DYMA 1ZW7A 2UYZB 2NBVB 1V49A 4HVBA 4J3OD 3R8BA 3L4PA 3E56A 4RCOA 1YD8U 2B3AA 1GJZA 1N63A 2VH2A 1ZUD2 4EEWA 4X66H 2K6QA 1I7HA 3A9JB 1GB1A 1WGDA 1IYFA 2X38A 1E8ZA 4B3RH 2K22A 1VLBA 1K1GA 2JEBI 1EU3A 2JZPA 1BMLC 3OJ3A 3QJZA 4LLGM 4A8XC 2I1KA 2WXPA 5BMHA 1R7SA 1RAXA 3NVWA 3OTOH 2LVPA 2MQJA 2BGFA 2VH1A 4R3DA 1TKYA 1SJED 1E10A 1WM2A 3TEXA 2ICIA 1ZDXA 2MBBB 3DQVA 1M4VA 4FHJA 2XN9C 3A4RA 1HEZE 2ONQA 4WURA 4DV1H 1GC7A 1RRBA 4MGIE 3PHXB 2Y3AA 4B8TA 3H9DA 3W1SC 4K0KH 4NQKE 4BOSC 4EOYA 1VDVA 4HKZE 2Y3MA 3A9JA 3VTWA 1P98A 1GNUA 5EE9A 1UUPA 4DXAB 2WNMA 1FXTB 2CPQA 4GGQA 2V4LA 2ASQA 2WXJA 1WZ3A 4LF8H 2HH3A 3RCZA 1E7UA 2O2VA 2JRIB 3DBLI 4NPNA 1WE8A 5AZHA 4GIVA 2NPTA 1SBBB 2IBIB 4IOIE 2LTMA 1ZP0B 4HXDA 1OEYA 3MFGA 3R2TA 1F77A 2JQRB 3FILB 5IOIA 1SGHA 2DBYA 3DPDA 2K1FA 1UF0A 2XK5B 2G45B 5G5HA 2IO0B 2GLSA 1T5XD 1NYQA 2OPVA 2PVGC 2ZNVB 4JI0H 4JI3H 1RYJA 4UDUC 1QKZA 3KUZA 3RF2A 3RNEC 2MBHA 3AH7A 3UF8A 4BBNF 2AL3A 3AB5A 3WANA 1A70A 1ROEA 1WXAA 1F2RC 4LDTB 1I4QA 2UWQA 3VFKA 2BYVE 1QILA 1GOZA 2PW9A 4JI8H 2PEAA 1ZZIA 3RNFC 2BKFA 1WY8A 2AWTA 1L5PA 2KQ4X 1MHXA 3GZNI 4XWTA 2UXDH 4DDID 2KFJA 3KWLA 2WDTB 1I4XA 4S17A 2K3UA 2D11A 4OVVA 1X4MA 2FIDA 2OHFA 3L16A 2Y5BB 4WWPA 4EC5A 4B0MA 2J53A 2DZJA 3CSTA 4ITKA 2PE6B 3KH0A 3RNAC 2FUHB 3GP7A 2FE8A 1ZOYB 2LF0A 1GC6A 2XK5A 4JI6H 2D2QA 3SU8X 3RNGC 2M1MA 4KGSA 4I6NB 4PS8A 3OSSD 4HRSA 2K1HA 1YOVB 1X0AA 1IBXB 4MM3A 2EKEC 1JRPA 4C80A 4W9IA 4GDLB 2M8WA 4G08A 4W9FA 1MHHE 3OLMD 1LXDA 3NJTA 3QX1A 2QHOA 1XNQH 2EMTA 2JU6X 3Q3JA 4M0WB 3P42A 2VQFH 4TQ1A 2KDIA 4PK1A 3DVNU 3FC4A 2P2RA 1YN3A 1WF9A 4BZAA 2UU9H 1KLVA 2QJLA 2R2OA 1N62A 3OETA 2AQ2B 1YJJA 2BS4B 1V97A 4E71A 3W9CB 3T9LA 3IBEA 1WJ6A 3LXFA 4GSWA 1XEEA 4LNOA 2V9HA 2CTEA 3BK2A 2K0PA 1AW7A 5IKCM 3AE4B 2REXA 2FAZA 4DV3H 4W9EA 1ZZKA 1Z2IA 1IBXA 4PYUA 2K25A 4OO1G 3QK0A 3A1QB 3TBLD 4FJVB 4GDLA 4ICVA 1TS5A 1UGMA 3UINB 3EUB2 2LWPA 5AZGA 3BYTB 1I35A 4DHZB 1NEKB 4LDTD 3VUXA 2MBEA 3SD5A 3T3OA 5L95C 5D3DA 1HZ5A 2D07B 2IYDB 4M0WA 1C4AA 2LTLA 2GBRA 2DENB 5BR8H 1J0GA 2BVCA 3JAMW 3KQ4A 3LJ3A 2D5GA 3B9JA 4HCPB 5BYRA 5LMNH 2N1VA 1FXAA 1ISNA 1L0YB 3J80W 2L0FA 5FK9C 1N34H 2MP2B 2N0SB 3CSFA 4W9DA 5LXHA 1J8CA 4HPMB 1FNUA 2BWFA 2L32A 4P16A 1T0YA 4X57B 2DX5B 3DVGX 2QCZA 1Z5SB 2L3ZA 1OQYA 3ZLZA 1RFAA 3ZXVA 2QIEB 2CTLA 3DBSA 1D5ZC 2JEAI 1WGHA 2G3QB 2J42A 4EFOA 2VQEH 4F7ZA 3A1QA 3L10B 2KHWB 2WWZA 1LM8B 3AEAB 3A9KB 4AIMA 3TEWA 3N30A 3RUIB 3WCQA 1L7YA 2RSUA 1XQQA 4L2YA 3W5UB 1MPEA 4N9F4 4GU2A 1I4GA 1L6UA 3EA6A 4E74A 2M17A 2BTEA 4C7ZA 3R2IA 1QT9A 2SAKA 2LMCA 4OD6A 4WWMA 3PREA 2RMMA 4KKJA 2O6VB 3AEBB 3TEYA 1FD6A 2K39A 4MGZE 4C7YA 3UQAA 2MP2A 2N9XA 1FIQA 2WXIA 2N9EB 1E90A 3I63C 4WALA 1KLGD 3SFEB 2D3GA 4HKQA 1P7FA 4OHJA 2KLGA 4ANWA 1GB4A 3NS8A 4N59A 3H6NA 3UIPB 2MJDA 2UUCH 1ET9A 3Q8BA 1J7CA 4CO7A 3DOWA 2BB5A 4B0EA 2WXNA 1KLUD 4XYCA 1ODHA 2XBBC 1UBIA 4CQNA 4WAAA 2CU1A 2ZW1A 2KFKB 5LXIB 4HLEA 3QQ8B 3VVWB 2RDHA 2CKHB 3ABVB 1JW9D 4JYAH 3SHQA 1ACCA 5C2TB 5IP4D 2AX5A 4KVGB 2D3BA 3CF6E 3ZNHB 2BF8B 2FPHX 2KO3A 3VQIA 2YQRA 2KANA 1T0SC 3M62B 4AUQC 2IGHA 3V61A 1VIHA 4DDGD 4W9HA 2MLBA 3Q3OC 2FIFA 3NUHB 4ZRJA 3HRDD 3BVGA 1L2NA 1JWAD 5D2MB 3PO0A 1E7VA 1SE2A 1D5XC 2AEHA 4GKJH 2FBWB 5FR3A 1FNVA 2WXOA 1ESFA 4E9JA 1TJEA 2G1EA 2QILA 1WVNA 3SEBA 4YTPB 2PIAA 1D6EC 3Q14C 2N4FA 2K8HA 2M8SA 2ZVOA 2PPHA 3ZXRA 2KXJA 1N6ZA 2KFKA 4B3SH 4BKGA 1NDDA 4B95A 5JXVA 2WDVB 3Q2AC 3GB1A 3L7ZC 2ZCBA 5I4DA 3T1YH 4JI4H 3IT4B 2NTSA 4EZJA 4DR2H 4LFBH 2M6QA 3B0AA 1EO6A 3BY4B 3TSSA 1XRHA 3WALA 3TL5A 2IDYA 1N61A 4MSMB 1WRIA 1I94H 2VRRB 5AUIA 3EGRA 5D6JB 4BOZB 3ZNZB 3RFZB 1WTJA 1I4PA 2CHZA 4OX9H 2RR9A 2GBJA 1Q1OA 3VAWA 1F9JA 2MWSB 4FADA 2UUAH 2HTHA 1QQRA 5HHDG 1R4NB 5E6NA 5FKAC 1PGBA 1K51A 2JSVX 3CMMB 4BKTA 2J52A 3HM3A 1TKEA 4RH6A 1Y56A 2GMIC 1AN8A 3KVFB 5EE0A 3VRBB 1PDXA 2FCSA 1HXYD 4X65H 3AEVB 2JT4B 1S3SG 1GUAB 1MFWA 2DZKA 5BYSA 1TIFA 4NJ7A 1YNTE 2NTTA 3AECB 1OEYJ 5JZEB 2KN4A 1J5EH 3ML8A 3AE9B 2V3PA 4WQMA 1TS3A 3RZWC 2V3NA 2MX2A 1TY0A 3DDCB 3K9PB 3GABA 2KN5A 1TS2A 3PRPB 2C60A 1QOBA 1TTNA 4L23A 4KSKC 4US8A 3Q69A 2ACZB 2V4IB 3FAHA 1RWSA 3KLSX 1Z2MA 3Q3NC 1KOTA 3DHIC 1ZE3D 2A5UA 3BYYB 3RN9C 1QOAA 4ZHPA 1SIFA 4MT5A 2UXCH 2WXLA 5K36G 1MI0A 2PTLA 3N9YC 4XX5A 2JY6A 3ZKJC 2BWES 1RM6C 2M56B 4H8AA 1JALA 3AN1A 3HUIA 4C00A 3UOEA 1IUEA 3AE8B 2DHZA 2R61A 4B6WA 4ANXA 2MBQA 4YTNB 1E8WA 2NBWB 1UWMA 1VCBA 4FHKA 1DT4A 1YJ1A 2JXXA 1D3ZA 2MW5A 2W3SA 4MGKE 2YVCA 1N36H 3APDA 5C0XG 2E5LH 5KHQA 3DVGY 5AEKB 2KQSA 2L8JA 4DUZH 4IM3A 3M95A 3SR6A 2BW2A 5BO4B 4JPSA 2IO2B 2OPUA 2KOXA 2M0AA 2DNFA 3S2AA 3R7RA 1XLPA 1JWMD 3WAMA 4JX1C 1JQ4A 4HPPA 4A90A 4KGRA 3IHPC 1WM3A 5IN7A 3Q8AA 3RI7C 2VZKB 4IW0A 3U52E 1V6EA 4CHKA 2LJ5A 1WFYA 2EELA 1V5TA 2WX1A 3KUCB 2GBMA 1C76A 1F2RI 1IGDA 2KC1A 1AARA 5BYQA 2I2YA 1WE6A 3VKEA 3AE2B 1PGXA 3VTVA 4NJCA 4KX6B 1TS4A 2KVRA 2QEJC 3ZW3A 5EDSA 3DVNV 5JHAA 2HJ1A 5G5GA 3H8HA 5HKHA 1FJGH 4GMVA 1YX5B 3ZNGC 5IWAH 4RNAA 2Y5CA 2MA9B 4DV6H 4IC7B 1L6VA 4WJOA 1H4RA 2FUG1 5D94A 4AP4C 4XE0A 3U1KA 1HNZH 3HHMA 3JYUA 4RGMA 2G8YA 1C9FA 3A33B 1JCKB 3ZIMA 4BKSA 1WJNA 4K3CA 2PVOD 3DHHC 1WGKA 2JVZA 4IWPA 3TMPB 3KYCD 2N9LA 3URYA 2BS3B 3L08A 1YQ4B 3OAWA 1N5XA 5LNK1 4BA2I 3KDKA 4AQ7A 3DBLB 2KVZA 4DR4H 4GKKH 1K53A 4NXNH 4L1BA 5JH5C 1LGRA 2OJRA 4LNKA 4AJYB 4DV0H 4KDLB 4HJKA 3RNCC 5G2NA 4HEA1 4GOCA 3HVZA 2KAJA 2KJ6A 4BAXA 2CPMA 1VJKA 2YEPB 1UH6A 4DR3H 2ZPYA 1C1YB 3TJPA 5KHOA 2D3CA 2NR2A 4A9AA 1S20A 4LCDE 4KIKB 1X9ZA 1G6JA 1WE7A 2E6XA 1EC6A 1FFUA 3BK1A 4DHJB 1XO3A 4W9JA 4JVHA 1PQXA 3FILA 1J7BA 4LNIA 2OOBB 4DXFA 2ZNVC 1FKAH 2CTMA 4BKSD 1YJIA 3GZNB 3Q8EA 1VD2A 5CHWA 1XMQH 2HTME 1OQQA 2W3RA 2KDEB 3ONSA 4GN1A 4YSXB 1VZ6A 5T8IA 3PHWB 4K1RB 3ZTDA 2IGGA 4JVYA 1EF1A 2KJHB 1C4PA 2QSDA 4LFCH 4BVUC 2CR5A 3U30A 2BL5A 3NZSA 2LGSA 4PYZA 2VKCA 1KFYB 3J7AK 4IUMB 3R7QA 2JYEA 2V1YA 2FCQA 1RLFA 1UZXB 1SXTA 3O13A 1UNSA 4WJQA 2K8CA 3OWEB 2W9NA 4RM8A 2BA0A 3QWZB 4C4VB 4LK0M 4NAMA 1VIGA 4PT5A 2JE6I 2RPVA 3IAS1 2LHDA 4GLSC 1SB3C 3PLUA 1WXVA 4IWQA 3QC8B 1QOFA 5CX3A 2WS3B 5GXGB 2M4NA 2L52A 1SF0A 2AQ1B 4FJSA 2IGDA 1WR1A 2INPE 4MJSB 3MTNB 2AL6A 2ZVNA 3KW5B 3PRZA 1N5WA 1WSPA 1L4ZB 1MVKA 2WLBA 2Y5PA 3MJWA 4DK5A 1XMOH 2KQ7A 3P2BA 1F0XA 2G9HD 2MJ3A 1JWBD 4DBGA 1I6UA 3B2GA 1MG8A 5D3IB 2LRUA 1CMXB 1SE9A 1IPGA 4W9GA 2GRIA 2GOWA 1TZOA 1J19A 1DOYA 3PGEA 2LVOA 3IXSA 4DHJD 2Q5WD 3GE3C 2CHWA 1FCLA 3VR9B 2INDC 2LGDA 2V3SA 2N7JA 2MH7A 1IBKH 1J7AA 3MP9A 3NCVA 1Q5WB 3V6CB 4US9A 1UG8A 4FJZA 4REZA 3RULA 1N33H 2BYTA 1N32H 1FPYA 1EWYC 4TQ0A 4FA6A 3VHTC 3PT2B 4JI2H 2K9XA 3L54A 2PY9A 4MH8A 3EFUA 4O1NA 3I57A 1RFKA 2O4CA 5C1ZA 5A2QW 4OZAA 3ZTCA 3TEZA 2YLMA 2JF5A 2TSSA 1V8CA 2RD0A 4FBJB 2DLBA 5BMGA 2BPSA 4AM3A 4I6PA 3U8ZA 2WGSA 2QNDA 3SB1A 3J9CA 3V6EB 5BMIA 1V81A 1PQSA 1C79A 3GKUA 2XNAC 3VRAB 2JVCA 1TKGA 4LNFA 3B1LX 4MGYE 2L0TA 2NBUA 2N9KA 2KX0A 2JYTA 5HFYA 1PUTA 3APFA 2N7DA 2KMMA 2HJ8A 3QCAA 3A9KA 1SIJA 3DBHI 5AUKA 3V05A 5CHVC 2ANRA 1IP9A 4P1CC 1T0QC 3WAOA 4D2KA 1XF5L 1F52A 1Q0WB 4DHZE 5L83A 1ZPSA 4MACA 2K6DB 2MJEA 3JSVB 3Q6BA 3ZNID 4OVUA 1C78A 1JRUA 3EZJA 3ZDTA 3IAM1 2GBNA 1B9RA 2UUBH 4YHHH 1HE8A 3VTUA 2JUOA 2O6VA 1C4CA 2CS4A 4RF1A 4DV5H 2I1JA 2JXTA 4IG7B 5IT9W 5EE3A 1CQVA 2KACA 2LFIA 3W5VB 2JWUA 3J81W 3ECIA 2PKOA 1NI2A 3UIOB 2D3AA 5HG2A 1HA5A 3X0WA 2E3UA 1HNWH 4ANVA 2LUEA 4WH4A 1D4BA 4JI1H 3E9SA 1E9MA 2XEWA 1P0RA 2QDFA 1WIAA 1DOIA 2Z0SA 1FO4A 3GOEA 2E3TA 4QMFB 2IY0B 3JVZX 2ZW0A 3IVFA 2C7NB 2W82A
chains in the Genus database with same CATH topology
3NVZA 3BVMA 2K3UA 5H8YE 1E6EB 2W3SA 1K50A 2OHFA 4JE3B 1HZ6A 1YN4A 4B0MA 1N60A 2J53A 2LGIA 3SR6A 2BW2A 1T3QA 4ITKA 4JPSA 1FNWA 1KF6B 1FMAD 1TYGB 2V0GA 1OFFA 3GP7A 2M0AA 4H2AA 2FE8A 1ZOYB 2BBCA 3V3XA 3ZGZA 3AEEB 1XLPA 1JWMD 4OVZA 4JX1C 1QOGA 1JQ4A 4A90A 4KGRA 5TSSA 4KGSA 2EKIA 4HRSA 3KWVA 1E0ZA 3Q8AA 4TMAB 1IBXB 1SE4A 2VZKB 1ET6A 3AM9A 3U52E 4RF0A 1BXTA 1JRPA 4C80A 4USAA 4GDLB 2EELA 1EU4A 5E6JA 1MHHE 2WP9B 4YSZB 2BT6A 1C76A 1F2RI 1IGDA 4GDKB 4LTUA 3U4EG 1P7EA 5BYQA 4NZLB 4ARCA 2I2YA 3DWGC 1XXGA 3AE2B 2JU6X 1PGXA 3P42A 4RGOS 4NJCA 1BUIC 4KX6B 1TS4A 2QEJC 2GI9A 4TQ1A 1K52A 3MJ5A 3FC4A 1YN3A 1T6BX 1WYGA 1C77A 2IJ0A 3MHZA 4RGNA 2QJLA 5G5GA 1N62A 4YWGG 3H8HA 2AQ2B 3AE3B 1YJJA 2BS4B 1V97A 3T3NA 3W9CB 3BVZA 3U2SC 4RNAA 2Z8LA 2MEKA 3SFDB 1XCTL 2Y5CA 4ZRQA 3AE1B 1L6VA 3RPFC 3ZJTA 1GAQB 3LXFA 2FUG1 1XEEA 1JWUD 1XLQA 3AE5B 4XE0A 1ZXIA 3BK2A 4RGMA 2K0PA 1AW7A 3IT6B 1C9FA 1JCKB 3AE4B 4XDDA 2CJOA 2WXRA 1SEBD 1IBXA 1AYFA 4ZHOA 1B1ZA 2PVOD 1KH0A 2BS2B 3CWIA 4ZOHC 1WGKA 1DGJA 4ZYSA 1TS5A 1XLNA 2W54A 3EUB2 4N6EB 1VR9A 3Q8CA 2N9LA 2CJNA 3URYA 2BS3B 3BYTB 4HJGE 1NEKB 1YQ3B 1YQ4B 2WXKA 2WXQA 3T3OA 5D3DA 1N5XA 1ZDVA 5H92C 5LNK1 2J4XA 1HZ5A 4M0WA 1JROA 4AQ7A 1C4AA 1SSNA 4TSSA 1K53A 2LUMA 2BB6A 3KQ4A 1JWSD 2D5GA 3B9JA 4L1BA 5BYRA 2ON8A 3AV8A 4HEA1 1FXAA 2WDQB 1L0YB 3HVZA 1I4HA 2KAJA 5FK9C 2L1AA 1VJKA 2YEPB 4OW0A 2H88B 2N0SB 3AMZA 4N58A 3AE6B 1VZ8A 3BWUD 4OZCA 1L4DB 1FNUA 4A9AA 1YMHE 2KWDA 2L32A 1ENFA 4KGTA 4NAWB 4P16A 1ZXHA 4IDIA 2W55A 2HDEA 2E6XA 2LJIA 3P4PB 1FFUA 2QIEB 2WXMA 3BK1A 1V1PB 1D5ZC 2AQ3B 1XO3A 3ETRA 2IPKD 1CZPA 3FILA 1J7BA 3NVVA 2J42A 1AWDA 3P4QB 3AEDB 4DXFA 2B76B 1SE3A 1FRDA 2NMQA 3I9V1 1YJIA 1FEHA 3P4SB 2OEDA 3AEAB 3Q8EA 3TEWA 2WU2B 3NVYA 3WCQA 1PFDA 1D5MC 4L2YA 4AS1A 4WIPA 2HTME 3W5UB 1MPEA 1OQQA 2W3RA 2JX5A 1V1OA 3BIID 1I4GA 1L6UA 4YSXB 1VZ6A 3EA6A 4IKGA 3HVDA 2LEKA 5T8IA 2BTEA 4C7ZA 3R2IA 2IGGA 5EE1A 3AEFB 1FRRA 1QT9A 1C4PA 2SAKA 2YEPF 2QSDA 1NENB 2LMCA 4WWMA 4YT0B 2RMMA 1FCCC 1UGJA 4C56C 4KKJA 4WAFA 3TEYA 1Q10A 3AEBB 5HI1A 1FD6A 4C7YA 1KFYB 4FXCA 1FIQA 2WXIA 1IGCA 2L83A 1KLGD 1NVID 2JYEA 3SFEB 3C8YA 2WDRB 4XWWA 1UWXA 1SXTA 4HKQA 1P7FA 4OHJA 1WXQA 1GB4A 3O13A 1DYQA 1OQRA 1UNSA 1KTKA 3AE7B 4N59A 2RDGA 3OWEB 2MJDA 4DQOC 3W1SA 1V1PA 1ET9A 2QMTA 4KKIA 3Q8BA 1J7CA 1LO5D 4LK0M 4NAMA 3ZJVA 2BB5A 3U7ZA 4B0EA 4PT5A 2WXNA 1KLUD 4YXDB 2RPVA 3IAS1 4CQNA 2LHDA 4GLSC 1SB3C 2ZW1A 2DYOA 3BZDB 1QOFA 2WS3B 5GXGB 3NRZA 1STEA 2RDHA 3LYYA 2L52A 2PMVA 1NYRA 1SF0A 4JWUC 3VR8B 3ABVB 2AQ1B 1JW9D 1ACCA 5C2TB 2AX5A 2IGDA 2INPE 2WU5B 3VQIA 4RFBA 1VZ7A 2IGHA 3ZQ4A 1N5WA 4ARIA 1WSPA 1L4ZB 3LB8C 1GPXA 1MVKA 3ZJUA 2WLBA 2Y5PA 2KDMA 3NUHB 3UI3A 3GS2A 3HRDD 2G9HD 2MJ3A 3BVGA 2INNE 1JWAD 3W2DA 1KRHA 1JWBD 4YSYB 3PZ7A 1FM0D 2WXGA 2DYMA 3PO0A 1SE2A 1D5XC 3B2GA 4A55A 5D3IB 1FFVA 1YN5A 2FBWB 3B2FA 5FR3A 1FNVA 2WXOA 1ESFA 1TJEA 1HQRD 1JMLA 2GRIA 4MM3B 2G1EA 4J3OD 3R8BA 1TZOA 2QILA 3L4PA 3SEBA 1DOYA 1L0XB 3IXSA 5MPOA 4YTPB 2PIAA 1D6EC 1XLOA 3E56A 2Q5WD 4RCOA 2CU3A 1FCLA 3VR9B 1N63A 1ZUD2 3P1MA 2N7JA 2MH7A 1J7AA 3MP9A 5JXVA 2WDVB 1I7HA 1GB1A 3PZ8A 3GB1A 4US9A 2X38A 4REZA 5I4DA 1CK1A 3IT4B 2DWQA 2BYTA 2VZKD 2K22A 1VLBA 2NTSA 1EU3A 1EWYC 2JZPA 4TQ0A 1CJEA 1BMLC 4LLGM 3AEGB 2K9XA 3TSSA 4A8XC 2WXPA 5BMHA 1WWTA 4MH8A 1R7SA 3NVWA 4O1NA 2IDYA 1N61A 3I57A 4YTMB 1WRIA 5AUIA 1RFKA 4R3DA 3EGRA 1TKYA 2WQYB 4A6QA 3RFZB 4OZAA 3TEZA 1I4PA 1PYWD 1E7PB 1SJED 1E10A 3TEXA 2TSSA 2ICIA 1V8CA 1ZDXA 4P6VF 1M4VA 2DLBA 1QQRA 2XN9C 5BMGA 3MC0B 1HEZE 2ONQA 4WURA 5HHDG 5FKAC 3J9CA 1PGBA 2M19A 1K51A 2JSVX 2Y3AA 3TUOA 2J52A 1DOXA 1TKEA 4RH6A 5BMIA 1Y56A 1FXIA 1AN8A 5EE0A 1SJHD 3VRBB 1QF6A 1PDXA 1HXYD 1C79A 2XNAC 3VRAB 1VDVA 4OZBA 4HKZE 1TKGA 1EWCA 5BYSA 5EE9A 1UUPA 2N9KA 1YNTE 2NTTA 2JYTA 2WNMA 5HFYA 1QLBB 3AECB 1PUTA 2LHEA 1F0ZA 2KMMA 5D7GA 4EE2A 1NI3A 1SIJA 5AUKA 2KN4A 3V05A 3AE9B 2V3PA 2SEBD 1L0VB 2WXJA 4WQMA 1TS3A 1XF5L 1I4RA 4D2KA 4XDCA 2V3NA 1EM7A 3NS1A 3P4RB 1TY0A 1ZPSA 4MACA 2MJEA 2I38A 2GB1A 1C78A 3IAM1 1TS2A 1B9RA 1QOBA 4L23A 4US8A 1SBBB 3DWMA 3Q69A 4IOIE 1C4CA 1ZP0B 2ACZB 2V4IB 3FAHA 3MFGA 1RWSA 1F77A 2JQRB 3KLSX 3R2TA 3FILB 2DBYA 4RF1A 1VRAB 1ZE3D 5G5HA 1T5XD 1NYQA 2JXTA 3BYYB 2PLPA 1QOAA 2PVGC 4DXGA 4ZHPA 2H89B 4MT5A 5EE3A 1CQVA 4JWSC 4RGTA 2KACA 2WXLA 1RYJA 4UDUC 1QKZA 4HROA 2LFIA 3W5VB 2JWUA 3AH7A 3ZYYX 1MI0A 2PTLA 2PKOA 3CIRB 5HG2A 3AB5A 1HA5A 3N9YC 1A70A 1TY2A 1RM6C 1ROEA 2K5PA 2M56B 1JALA 1F2RC 1XCQL 3AN1A 4WH4A 1D4BA 3HUIA 1I4QA 1PGAA 3E9SA 1QILA 1IUEA 1E9MA 1GOZA 2WXFA 2PW9A 3AE8B 2WXHA 3Q8FA 3NZ3A 1DOIA 4ZRPA 1FO4A 1L5PA 2KQ4X 2E3TA 1MHXA 2R61A 4XWTA 4YTNB 2ZW0A 4Q2JA 1UWMA 5C3JB 3KWLA 2W82A 3P63A 1I4XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E7P B;  3NVZ A;  2CJN A;  2BS3 B;  5H8Y E;  1J7C A;  1E6E B;  2W3S A;  1E10 A;  1NEK B;  1YQ3 B;  1YQ4 B;  1V8C A;  4YXD B;  4P6V F;  5C3J B;  2OHF A;  1N5X A;  5H92 C;  1SB3 C;  1N60 A;  1QOF A;  2WS3 B;  1JRO A;  5GXG B;  3NRZ A;  3SR6 A;  2L52 A;  1T3Q A;  1NYR A;  1SF0 A;  4ITK A;  1KF6 B;  3ABV B;  4JWU C;  1FMA D;  1TYG B;  3VR8 B;  2M19 A;  3B9J A;  1JW9 D;  1OFF A;  1DOX A;  5C2T B;  1TKE A;  3AV8 A;  1FXI A;  2AX5 A;  1FXA A;  2WDQ B;  1ZOY B;  3HVZ A;  5EE0 A;  2KAJ A;  3VRB B;  1QF6 A;  1PDX A;  1VJK A;  2WU5 B;  3AEE B;  3VRA B;  1XLP A;  2H88 B;  2N0S B;  3AMZ A;  4N58 A;  3AE6 B;  1VDV A;  4JX1 C;  1QOG A;  1JQ4 A;  4YTM B;  1N5W A;  1TKG A;  2EKI A;  3LB8 C;  4A9A A;  1GPX A;  4HRS A;  2WLB A;  5EE9 A;  1E0Z A;  4IDI A;  3AM9 A;  1QLB B;  3AEC B;  1PUT A;  3HRD D;  2W55 A;  1F0Z A;  2KMM A;  2MJ3 A;  1JRP A;  1NI3 A;  1SIJ A;  5AUK A;  4C80 A;  4USA A;  1JWA D;  3AE9 B;  1FFU A;  1KRH A;  1JWB D;  2QIE B;  1L0V B;  3P4P B;  4YSY B;  4WQM A;  1FM0 D;  3PO0 A;  1XO3 A;  3ETR A;  2WP9 B;  3B2G A;  4YSZ B;  1CZP A;  2BT6 A;  1J7B A;  1FFV A;  3NS1 A;  1AWD A;  3NVV A;  3P4R B;  3P4Q B;  2FBW B;  3AED B;  4LTU A;  3B2F A;  2B76 B;  2MJE A;  1TJE A;  1FRD A;  3DWG C;  1YJI A;  3AE2 B;  2G1E A;  3P4S B;  4KX6 B;  3AEA B;  3L4P A;  1B9R A;  1DOY A;  5MPO A;  2WU2 B;  1QOB A;  4YTP B;  4US8 A;  2PIA A;  3NVY A;  1XLO A;  3FC4 A;  1PFD A;  3DWM A;  3WCQ A;  2Q5W D;  1ZP0 B;  2ACZ B;  3FAH A;  2HTM E;  3W5U B;  1RWS A;  2CU3 A;  1OQQ A;  1WYG A;  2JQR B;  3VR9 B;  2W3R A;  2DBY A;  2JX5 A;  2QJL A;  5G5G A;  1N63 A;  1N62 A;  3BII D;  1L6U A;  1ZUD 2;  3P1M A;  4YSX B;  3AE3 B;  1YJJ A;  2LEK A;  3KWL A;  2BS4 B;  5G5H A;  1NYQ A;  1V97 A;  4C7Z A;  2MH7 A;  1J7A A;  1QOA A;  5EE1 A;  2PVG C;  2WDV B;  1I7H A;  2H89 B;  1FRR A;  3AEF B;  4JWS C;  1QT9 A;  5EE3 A;  3W9C B;  1RYJ A;  1NEN B;  4HRO A;  4US9 A;  3W5V B;  4WWM A;  4YT0 B;  3SFD B;  2Y5C A;  3AH7 A;  3ZYY X;  3AE1 B;  2DWQ A;  1L6V A;  3AEB B;  2K22 A;  1VLB A;  2PKO A;  1GAQ B;  3CIR B;  3LXF A;  3RPF C;  4C7Y A;  3AB5 A;  1EWY C;  1KFY B;  1XLQ A;  3AE5 B;  1FIQ A;  4FXC A;  1A70 A;  2L83 A;  1ZXI A;  1CJE A;  1RM6 C;  1ROE A;  2K5P A;  2M56 B;  1NVI D;  1JAL A;  3AN1 A;  3SFE B;  3AE4 B;  3HUI A;  3AEG B;  2WDR B;  2CJO A;  2K9X A;  1IUE A;  1E9M A;  1WWT A;  3AE8 B;  1R7S A;  3NVW A;  1DOI A;  1WXQ A;  1AYF A;  1N61 A;  1FO4 A;  1L5P A;  4ZHO A;  1OQR A;  1WRI A;  2E3T A;  2PVO D;  2BS2 B;  5AUI A;  3AE7 B;  3CWI A;  4N59 A;  4ZOH C;  1RFK A;  4YTN B;  1TKY A;  1WGK A;  2MJD A;  1DGJ A;  2WQY B;  4ZHP A;  1UWM A;  1XLN A;  2W54 A;  3P63 A;  3EUB 2;  4N6E B; 
#chains in the Genus database with same CATH topology
 2CTF A;  1KM7 A;  5H8Y E;  1E6E B;  3V69 A;  3SDL C;  2MRP A;  3JSV A;  3HK0 A;  3R3M A;  1HZ6 A;  3MC9 A;  2MSE D;  4PS7 A;  3ZRF A;  4B3T H;  1FNW A;  1TYG B;  5GMV A;  5IO9 A;  1WJ4 A;  2KC2 A;  2V0G A;  2KDB A;  3KYD D;  3V60 A;  1WYW B;  4HWI B;  1J4W A;  2C5L C;  2O6V D;  2BBC A;  3V3X A;  4LJP B;  4OVZ A;  1QOG A;  2FNJ B;  4NY0 A;  2EKI A;  3EHV A;  2GBK A;  1E0Z A;  4KV2 A;  1ET6 A;  1H8C A;  4RF0 A;  4URK A;  4X64 H;  2FMR A;  1S03 G;  3VH3 B;  3ZUN A;  4M8N A;  5E6J A;  2WP9 B;  4KZC A;  1GG3 A;  4LF4 H;  1XNR H;  4LTU A;  1UBQ A;  1P7E A;  5DCN A;  2ZQE A;  4NZL B;  3DWG C;  4ANU A;  1E8Y A;  1BUI C;  4K3B A;  2GI9 A;  1R4M I;  1WX8 A;  1K52 A;  3DCG A;  3MJ5 A;  3Q3M C;  4TV3 A;  4JLC A;  2K8B A;  2L7R A;  2LD9 A;  4G11 A;  1C77 A;  1V5O A;  2CWF A;  2L05 A;  1TT5 B;  1HR0 H;  3AE3 B;  3DBR I;  3T3N A;  3KUD B;  3BVZ A;  4I6L B;  3RD2 A;  2Z8L A;  3W1Y A;  4ZRQ A;  3AE1 B;  3HM6 X;  3RPF C;  1LQB A;  5JHB A;  3ZJT A;  4DR6 H;  4GXB A;  2KKC A;  1JWU D;  1XT9 B;  3IT6 B;  5E6P A;  4W9K A;  3TIX A;  4LJO B;  3C0R B;  1WGG A;  2LRW A;  2WXR A;  4DR1 H;  1EF5 A;  2AXY A;  4RMA A;  1R4M B;  1AYF A;  4XGA B;  1B1Z A;  3PS6 A;  1KH0 A;  2BS2 B;  1DGJ A;  3ZRC A;  2X8X X;  2W54 A;  2F4V H;  4N6E B;  3Q8C A;  4II3 B;  3DBR B;  3N1Y C;  1WGY A;  2WXK A;  3BIN A;  1F1H A;  4KZ0 A;  5H92 C;  2J4X A;  5AZF A;  5IAA C;  1YIW A;  1V2Y A;  2G4D B;  2BB6 A;  4HCN B;  1JWS D;  3L17 A;  4WJN A;  3AV8 A;  4W9L A;  2J7Q B;  4F8C B;  4P7I A;  2H88 B;  2WHI A;  3AE6 B;  2KLC A;  2ZM6 H;  4DR5 H;  1VZ8 A;  5LMU H;  3WIM A;  2JZ3 B;  4NZT M;  2RDB C;  1HNX H;  2KWD A;  1ENF A;  4NAW B;  1ZXH A;  2IO1 B;  2W55 A;  2HDE A;  1TBE A;  2LJI A;  1WX9 A;  2Z59 B;  3P4P B;  2WXM A;  1V1P B;  3ENE A;  4JI7 H;  2IPK D;  1CZP A;  4LNN A;  3RZF A;  1AWD A;  3P4Q B;  3AED B;  3I0P A;  4BA1 I;  2B76 B;  2JZZ A;  4NJ6 A;  1SE3 A;  2MHJ A;  4B9K A;  2NMQ A;  3RMK C;  3P4S B;  2OED A;  2PT7 G;  4B8C D;  3NVY A;  3VUW A;  4WIP A;  2O2V B;  4LF9 H;  2R2Q A;  1V1O A;  3BII D;  1T0R C;  4IKG A;  1I42 A;  2ZCC A;  2QC8 A;  5EE1 A;  3AEF B;  2YEP F;  3NZU A;  2CHX A;  5CHF A;  2NPT B;  1UGJ A;  4WAN A;  3AUL A;  4WAF A;  1Q10 A;  1IGC A;  2DZI A;  4HDQ A;  1QZE A;  3QD7 X;  3EC8 A;  3PSE B;  4KHP H;  3C8Y A;  4M02 A;  1UWX A;  2L76 A;  1E8X A;  4LIJ A;  2IY1 B;  2PQU A;  4NAW A;  1WXQ A;  2Z0E B;  4TUU A;  1WXM A;  4J6I A;  1HTQ A;  2RDG A;  3V62 A;  2LZ6 A;  4DUY H;  3W1S A;  1V1P A;  2QMT A;  2JRH A;  4KKI A;  5G55 A;  3ZJV A;  3U7Z A;  1U4A A;  3VUY A;  1Y8R C;  2NCN A;  4IWO A;  4OCH A;  2NS5 A;  2ZZP B;  2LI5 A;  3AU5 A;  3PRM B;  3BZD B;  1VBI A;  3NRZ A;  4B3M H;  1STE A;  4FN2 A;  4K7U A;  2PMV A;  4JWU C;  1NYR A;  3B08 A;  3RYT A;  2LGX A;  4AJW A;  5E6O A;  2KDF B;  1MG4 A;  2KZR A;  1AN7 A;  2WU5 B;  1VZ7 A;  2IO3 B;  3QIJ A;  3LB8 C;  1WRD B;  1GPX A;  1P9D U;  2KDM A;  5CTR C;  1J5K A;  2KWC A;  3GS2 A;  5JEA G;  4TKN A;  3PZ7 A;  1FM0 D;  2WXG A;  4JGH B;  4A55 A;  1FFV A;  1YN5 A;  2OJW A;  3B2F A;  4LF6 H;  4DV2 H;  3T8M A;  1HQR D;  1JML A;  4MM3 B;  4MEM A;  1L0X B;  5MPO A;  3VH4 B;  2LRR A;  3H7P B;  1XLO A;  1TZ1 A;  2C7H A;  2UXB H;  2CU3 A;  3EEC A;  1ZZJ A;  2IZV B;  3N32 A;  3P1M A;  3NG0 A;  3PVL A;  1K8R B;  5DPW A;  4MSQ B;  3PZ8 A;  4KDI C;  1CK1 A;  3R66 C;  3I3T B;  2DWQ A;  2VZK D;  3N3K B;  1CJE A;  3Q3F A;  4JQW C;  3AEG B;  3A4S C;  1WWT A;  2INC C;  1WJU A;  2LGY A;  4YL8 A;  4YTM B;  3MHS D;  4AQY H;  2WQY B;  4A6Q A;  1PYW D;  1E7P B;  4S0R A;  4PDB A;  4A3O A;  4P6V F;  4EZL A;  1ZGU B;  1UD7 A;  4LF7 H;  4GB9 A;  4BFR A;  3MC0 B;  4JIO U;  3ZDM C;  2EMS A;  5LL6 b;  2DAF A;  2KMC A;  4K81 A;  3H7P A;  2M19 A;  3TUO A;  4KIK A;  2KD0 A;  1DOX A;  1FXI A;  3WA0 A;  1QF6 A;  1SJH D;  4E3C A;  4EZK A;  4HPL B;  4OZB A;  1OTR B;  1X4N A;  5TR5 A;  1EWC A;  3N1Z C;  1DTJ A;  3RNB C;  3OG5 A;  1QLB B;  2HH2 A;  2LAS A;  2LHE A;  2ZJD A;  4DV4 H;  2LXA A;  1F0Z A;  1KJT A;  1P3Q U;  5D7G A;  4EE2 A;  1NI3 A;  5IA7 A;  2SEB D;  1L0V B;  3UGB B;  1I4R A;  4XDC A;  1EM7 A;  1V9J A;  2KMA A;  4ZDV A;  3PV1 A;  3NS1 A;  3P4R B;  4G3X B;  1C3T A;  4NZR M;  4AWJ A;  2BYF A;  4CYE A;  1SEI A;  2I38 A;  2GB1 A;  5LLI A;  4AOF A;  1XD3 B;  4LF5 H;  2PJH A;  2C9W B;  3DWM A;  3APC A;  4ZRK A;  4NQL B;  1A5R A;  3L0W B;  1KHM A;  4NBQ A;  5FLX W;  1VRA B;  2D10 A;  2AYO B;  2MJH A;  2PLP A;  4DXG A;  2H89 B;  4K7S A;  4JWS C;  4RGT A;  2FFM A;  4HRO A;  3ZYY X;  3ALB A;  4ZYN A;  2Z0D B;  2UU7 A;  4BBN C;  1NBF C;  3CIR B;  2ZEQ A;  3QA8 A;  1IBL H;  1TY2 A;  4C4V A;  4MDK E;  2KK8 A;  2K5P A;  4IM0 A;  1XCQ L;  4XZ4 A;  1PGA A;  2WXF A;  3Q8F A;  2WXH A;  1IBM H;  3NZ3 A;  4ZRP A;  3L13 A;  5C23 A;  2HHH H;  2KYW A;  1BT0 A;  1MJD A;  2BYE A;  4QAY A;  3AU4 A;  4Q2J A;  2JPH A;  5C3J B;  3P63 A;  4ICU A;  3NVZ A;  3BVM A;  4M00 A;  1K50 A;  4MJS A;  3QHT A;  3K9O B;  4FJY A;  4JE3 B;  1YX6 B;  1YN4 A;  1N60 A;  2KTR B;  2LGI A;  2G4S A;  1T3Q A;  1KF6 B;  1FMA D;  3TCA A;  4ASW C;  3PTF C;  2KT7 A;  1OFF A;  4HK2 A;  1X1M A;  3ZO5 B;  2N7E A;  3OJ4 B;  4H2A A;  4WWN A;  3LDZ E;  3ZGZ A;  3AEE B;  3EFC A;  5TSS A;  4FUL A;  4XC2 A;  2DAJ A;  3KWV A;  3QAR A;  4W9C A;  1OGW A;  4TMA B;  1SE4 A;  3MC8 A;  2CTK A;  2FCN A;  3AM9 A;  3H7S A;  2KX3 A;  3NHE B;  3QAQ A;  1BXT A;  4M01 A;  4USA A;  2PE9 A;  4IFD G;  1EU4 A;  4EUT A;  1M94 A;  3C19 A;  4YSZ B;  2CTJ A;  2BT6 A;  2ANN A;  3AI5 A;  3U4E G;  4GDK B;  5FR6 A;  1MSZ A;  3N20 C;  1WXS A;  4ARC A;  1XXG A;  4IM2 A;  4RGO S;  3UQB A;  3PZD A;  4MH0 E;  4PS3 A;  3X23 A;  1T6B X;  1WYG A;  2IJ0 A;  3MHZ A;  4RGN A;  3IFW B;  1V9N A;  1V80 A;  2KTR A;  4YWG G;  1EUV B;  3I5J C;  3IG3 A;  3U2S C;  4P1B C;  2J0K A;  4WJP A;  1WH3 A;  3T1H H;  2MEK A;  3SFD B;  1XCT L;  4HDO A;  1WX7 A;  5DT9 A;  1GAQ B;  3VXW A;  2JZX A;  3AE5 B;  1XLQ A;  1ZXI A;  2JA9 A;  5DPT A;  3FAU A;  4XDD A;  2CJO A;  1UEL A;  4JL9 A;  2X06 A;  1SEB D;  4ZHO A;  3CWI A;  4ZOH C;  4X62 H;  2WYQ A;  4ZYS A;  1XLN A;  3DBH B;  1VR9 A;  2CJN A;  4HJG E;  3U7D A;  1YQ3 B;  2C7M B;  4GDK A;  2WXQ A;  2J0M A;  2N1W A;  1ZDV A;  4NXM H;  3VDZ A;  1JRO A;  2HD5 B;  1SSN A;  4TSS A;  2KNB A;  4A3P A;  2LUM A;  2ON8 A;  4G50 A;  2WDQ B;  1I4H A;  2FCM A;  4A20 A;  2L1A A;  2KTF A;  3GR5 A;  4OW0 A;  3AMZ A;  4N58 A;  3N1X C;  1LFD A;  3BWU D;  4OZC A;  3FKY A;  3KDG A;  1L4D B;  1S1Q B;  4MEL A;  4EKU A;  1YMH E;  3ZVV A;  4KGT A;  2MCN B;  4IDI A;  3RT3 B;  1HTO A;  2NVU I;  3NOB A;  2AQ3 B;  4FLH A;  4DWF A;  3ETR A;  1E5W A;  3NVV A;  2DYB A;  1ZTG A;  1FRD A;  3I9V 1;  1R4N I;  1FEH A;  3AXC A;  2WU2 B;  1PFD A;  1D5M C;  5DPR A;  1WMH B;  2A4Z A;  3HIZ A;  3WAP A;  4AS1 A;  4NNJ B;  5J17 A;  2D9I A;  1WI0 A;  1WR6 E;  2JX5 A;  2BQQ A;  5J18 A;  3HVD A;  2LEK A;  4DV7 H;  2RPQ A;  1FRR A;  1NEN B;  4YT0 B;  1FCC C;  1WGR A;  3JW0 X;  4C56 C;  1YQB A;  5HI1 A;  4FXC A;  2DGR A;  1V86 A;  2L83 A;  1NVI D;  2DZM A;  2NN6 G;  2WDR B;  2J0J A;  4XWW A;  4FJU A;  4K7W A;  1ZKH A;  1WZ0 A;  3ML9 A;  3PPA A;  1DYQ A;  1OQR A;  4WWO A;  1KTK A;  3AE7 B;  3DHG C;  4DQO C;  2WX0 A;  2M0X A;  4F1S A;  2MBO A;  4YY3 H;  3GE8 C;  4LFA H;  4JV5 H;  3D32 A;  5DPS A;  1LO5 D;  2ZPN A;  4KSL C;  4ACF A;  4G0N B;  2N9P C;  4YXD B;  2RGF A;  3PLV A;  3O65 B;  2DYO A;  3H1U A;  3M63 B;  1P1A A;  3LYY A;  3NY5 A;  3VR8 B;  1TUA A;  4RM9 A;  1NXU A;  1WMH A;  2BKR B;  1WHR A;  2KJR A;  2L00 B;  4RFB A;  4ZRI A;  4DR7 H;  4M8M A;  2LXC A;  3ZQ4 A;  5J2R A;  1TGZ B;  4ARI A;  4JI5 H;  2CWH A;  2HE7 A;  2KWV B;  3ZJU A;  3M3J A;  4II2 B;  3UI3 A;  2KWU B;  2JWZ A;  2INN E;  3W2D A;  2LVQ A;  4WQO B;  1KRH A;  4YSY B;  2A1S A;  2DYM A;  1ZW7 A;  2UYZ B;  2NBV B;  1V49 A;  4HVB A;  4J3O D;  3R8B A;  3L4P A;  3E56 A;  4RCO A;  1YD8 U;  2B3A A;  1GJZ A;  1N63 A;  2VH2 A;  1ZUD 2;  4EEW A;  4X66 H;  2K6Q A;  1I7H A;  3A9J B;  1GB1 A;  1WGD A;  1IYF A;  2X38 A;  1E8Z A;  4B3R H;  2K22 A;  1VLB A;  1K1G A;  2JEB I;  1EU3 A;  2JZP A;  1BML C;  3OJ3 A;  3QJZ A;  4LLG M;  4A8X C;  2I1K A;  2WXP A;  5BMH A;  1R7S A;  1RAX A;  3NVW A;  3OTO H;  2LVP A;  2MQJ A;  2BGF A;  2VH1 A;  4R3D A;  1TKY A;  1SJE D;  1E10 A;  1WM2 A;  3TEX A;  2ICI A;  1ZDX A;  2MBB B;  3DQV A;  1M4V A;  4FHJ A;  2XN9 C;  3A4R A;  1HEZ E;  2ONQ A;  4WUR A;  4DV1 H;  1GC7 A;  1RRB A;  4MGI E;  3PHX B;  2Y3A A;  4B8T A;  3H9D A;  3W1S C;  4K0K H;  4NQK E;  4BOS C;  4EOY A;  1VDV A;  4HKZ E;  2Y3M A;  3A9J A;  3VTW A;  1P98 A;  1GNU A;  5EE9 A;  1UUP A;  4DXA B;  2WNM A;  1FXT B;  2CPQ A;  4GGQ A;  2V4L A;  2ASQ A;  2WXJ A;  1WZ3 A;  4LF8 H;  2HH3 A;  3RCZ A;  1E7U A;  2O2V A;  2JRI B;  3DBL I;  4NPN A;  1WE8 A;  5AZH A;  4GIV A;  2NPT A;  1SBB B;  2IBI B;  4IOI E;  2LTM A;  1ZP0 B;  4HXD A;  1OEY A;  3MFG A;  3R2T A;  1F77 A;  2JQR B;  3FIL B;  5IOI A;  1SGH A;  2DBY A;  3DPD A;  2K1F A;  1UF0 A;  2XK5 B;  2G45 B;  5G5H A;  2IO0 B;  2GLS A;  1T5X D;  1NYQ A;  2OPV A;  2PVG C;  2ZNV B;  4JI0 H;  4JI3 H;  1RYJ A;  4UDU C;  1QKZ A;  3KUZ A;  3RF2 A;  3RNE C;  2MBH A;  3AH7 A;  3UF8 A;  4BBN F;  2AL3 A;  3AB5 A;  3WAN A;  1A70 A;  1ROE A;  1WXA A;  1F2R C;  4LDT B;  1I4Q A;  2UWQ A;  3VFK A;  2BYV E;  1QIL A;  1GOZ A;  2PW9 A;  4JI8 H;  2PEA A;  1ZZI A;  3RNF C;  2BKF A;  1WY8 A;  2AWT A;  1L5P A;  2KQ4 X;  1MHX A;  3GZN I;  4XWT A;  2UXD H;  4DDI D;  2KFJ A;  3KWL A;  2WDT B;  1I4X A;  4S17 A;  2K3U A;  2D11 A;  4OVV A;  1X4M A;  2FID A;  2OHF A;  3L16 A;  2Y5B B;  4WWP A;  4EC5 A;  4B0M A;  2J53 A;  2DZJ A;  3CST A;  4ITK A;  2PE6 B;  3KH0 A;  3RNA C;  2FUH B;  3GP7 A;  2FE8 A;  1ZOY B;  2LF0 A;  1GC6 A;  2XK5 A;  4JI6 H;  2D2Q A;  3SU8 X;  3RNG C;  2M1M A;  4KGS A;  4I6N B;  4PS8 A;  3OSS D;  4HRS A;  2K1H A;  1YOV B;  1X0A A;  1IBX B;  4MM3 A;  2EKE C;  1JRP A;  4C80 A;  4W9I A;  4GDL B;  2M8W A;  4G08 A;  4W9F A;  1MHH E;  3OLM D;  1LXD A;  3NJT A;  3QX1 A;  2QHO A;  1XNQ H;  2EMT A;  2JU6 X;  3Q3J A;  4M0W B;  3P42 A;  2VQF H;  4TQ1 A;  2KDI A;  4PK1 A;  3DVN U;  3FC4 A;  2P2R A;  1YN3 A;  1WF9 A;  4BZA A;  2UU9 H;  1KLV A;  2QJL A;  2R2O A;  1N62 A;  3OET A;  2AQ2 B;  1YJJ A;  2BS4 B;  1V97 A;  4E71 A;  3W9C B;  3T9L A;  3IBE A;  1WJ6 A;  3LXF A;  4GSW A;  1XEE A;  4LNO A;  2V9H A;  2CTE A;  3BK2 A;  2K0P A;  1AW7 A;  5IKC M;  3AE4 B;  2REX A;  2FAZ A;  4DV3 H;  4W9E A;  1ZZK A;  1Z2I A;  1IBX A;  4PYU A;  2K25 A;  4OO1 G;  3QK0 A;  3A1Q B;  3TBL D;  4FJV B;  4GDL A;  4ICV A;  1TS5 A;  1UGM A;  3UIN B;  3EUB 2;  2LWP A;  5AZG A;  3BYT B;  1I35 A;  4DHZ B;  1NEK B;  4LDT D;  3VUX A;  2MBE A;  3SD5 A;  3T3O A;  5L95 C;  5D3D A;  1HZ5 A;  2D07 B;  2IYD B;  4M0W A;  1C4A A;  2LTL A;  2GBR A;  2DEN B;  5BR8 H;  1J0G A;  2BVC A;  3JAM W;  3KQ4 A;  3LJ3 A;  2D5G A;  3B9J A;  4HCP B;  5BYR A;  5LMN H;  2N1V A;  1FXA A;  1ISN A;  1L0Y B;  3J80 W;  2L0F A;  5FK9 C;  1N34 H;  2MP2 B;  2N0S B;  3CSF A;  4W9D A;  5LXH A;  1J8C A;  4HPM B;  1FNU A;  2BWF A;  2L32 A;  4P16 A;  1T0Y A;  4X57 B;  2DX5 B;  3DVG X;  2QCZ A;  1Z5S B;  2L3Z A;  1OQY A;  3ZLZ A;  1RFA A;  3ZXV A;  2QIE B;  2CTL A;  3DBS A;  1D5Z C;  2JEA I;  1WGH A;  2G3Q B;  2J42 A;  4EFO A;  2VQE H;  4F7Z A;  3A1Q A;  3L10 B;  2KHW B;  2WWZ A;  1LM8 B;  3AEA B;  3A9K B;  4AIM A;  3TEW A;  3N30 A;  3RUI B;  3WCQ A;  1L7Y A;  2RSU A;  1XQQ A;  4L2Y A;  3W5U B;  1MPE A;  4N9F 4;  4GU2 A;  1I4G A;  1L6U A;  3EA6 A;  4E74 A;  2M17 A;  2BTE A;  4C7Z A;  3R2I A;  1QT9 A;  2SAK A;  2LMC A;  4OD6 A;  4WWM A;  3PRE A;  2RMM A;  4KKJ A;  2O6V B;  3AEB B;  3TEY A;  1FD6 A;  2K39 A;  4MGZ E;  4C7Y A;  3UQA A;  2MP2 A;  2N9X A;  1FIQ A;  2WXI A;  2N9E B;  1E90 A;  3I63 C;  4WAL A;  1KLG D;  3SFE B;  2D3G A;  4HKQ A;  1P7F A;  4OHJ A;  2KLG A;  4ANW A;  1GB4 A;  3NS8 A;  4N59 A;  3H6N A;  3UIP B;  2MJD A;  2UUC H;  1ET9 A;  3Q8B A;  1J7C A;  4CO7 A;  3DOW A;  2BB5 A;  4B0E A;  2WXN A;  1KLU D;  4XYC A;  1ODH A;  2XBB C;  1UBI A;  4CQN A;  4WAA A;  2CU1 A;  2ZW1 A;  2KFK B;  5LXI B;  4HLE A;  3QQ8 B;  3VVW B;  2RDH A;  2CKH B;  3ABV B;  1JW9 D;  4JYA H;  3SHQ A;  1ACC A;  5C2T B;  5IP4 D;  2AX5 A;  4KVG B;  2D3B A;  3CF6 E;  3ZNH B;  2BF8 B;  2FPH X;  2KO3 A;  3VQI A;  2YQR A;  2KAN A;  1T0S C;  3M62 B;  4AUQ C;  2IGH A;  3V61 A;  1VIH A;  4DDG D;  4W9H A;  2MLB A;  3Q3O C;  2FIF A;  3NUH B;  4ZRJ A;  3HRD D;  3BVG A;  1L2N A;  1JWA D;  5D2M B;  3PO0 A;  1E7V A;  1SE2 A;  1D5X C;  2AEH A;  4GKJ H;  2FBW B;  5FR3 A;  1FNV A;  2WXO A;  1ESF A;  4E9J A;  1TJE A;  2G1E A;  2QIL A;  1WVN A;  3SEB A;  4YTP B;  2PIA A;  1D6E C;  3Q14 C;  2N4F A;  2K8H A;  2M8S A;  2ZVO A;  2PPH A;  3ZXR A;  2KXJ A;  1N6Z A;  2KFK A;  4B3S H;  4BKG A;  1NDD A;  4B95 A;  5JXV A;  2WDV B;  3Q2A C;  3GB1 A;  3L7Z C;  2ZCB A;  5I4D A;  3T1Y H;  4JI4 H;  3IT4 B;  2NTS A;  4EZJ A;  4DR2 H;  4LFB H;  2M6Q A;  3B0A A;  1EO6 A;  3BY4 B;  3TSS A;  1XRH A;  3WAL A;  3TL5 A;  2IDY A;  1N61 A;  4MSM B;  1WRI A;  1I94 H;  2VRR B;  5AUI A;  3EGR A;  5D6J B;  4BOZ B;  3ZNZ B;  3RFZ B;  1WTJ A;  1I4P A;  2CHZ A;  4OX9 H;  2RR9 A;  2GBJ A;  1Q1O A;  3VAW A;  1F9J A;  2MWS B;  4FAD A;  2UUA H;  2HTH A;  1QQR A;  5HHD G;  1R4N B;  5E6N A;  5FKA C;  1PGB A;  1K51 A;  2JSV X;  3CMM B;  4BKT A;  2J52 A;  3HM3 A;  1TKE A;  4RH6 A;  1Y56 A;  2GMI C;  1AN8 A;  3KVF B;  5EE0 A;  3VRB B;  1PDX A;  2FCS A;  1HXY D;  4X65 H;  3AEV B;  2JT4 B;  1S3S G;  1GUA B;  1MFW A;  2DZK A;  5BYS A;  1TIF A;  4NJ7 A;  1YNT E;  2NTT A;  3AEC B;  1OEY J;  5JZE B;  2KN4 A;  1J5E H;  3ML8 A;  3AE9 B;  2V3P A;  4WQM A;  1TS3 A;  3RZW C;  2V3N A;  2MX2 A;  1TY0 A;  3DDC B;  3K9P B;  3GAB A;  2KN5 A;  1TS2 A;  3PRP B;  2C60 A;  1QOB A;  1TTN A;  4L23 A;  4KSK C;  4US8 A;  3Q69 A;  2ACZ B;  2V4I B;  3FAH A;  1RWS A;  3KLS X;  1Z2M A;  3Q3N C;  1KOT A;  3DHI C;  1ZE3 D;  2A5U A;  3BYY B;  3RN9 C;  1QOA A;  4ZHP A;  1SIF A;  4MT5 A;  2UXC H;  2WXL A;  5K36 G;  1MI0 A;  2PTL A;  3N9Y C;  4XX5 A;  2JY6 A;  3ZKJ C;  2BWE S;  1RM6 C;  2M56 B;  4H8A A;  1JAL A;  3AN1 A;  3HUI A;  4C00 A;  3UOE A;  1IUE A;  3AE8 B;  2DHZ A;  2R61 A;  4B6W A;  4ANX A;  2MBQ A;  4YTN B;  1E8W A;  2NBW B;  1UWM A;  1VCB A;  4FHK A;  1DT4 A;  1YJ1 A;  2JXX A;  1D3Z A;  2MW5 A;  2W3S A;  4MGK E;  2YVC A;  1N36 H;  3APD A;  5C0X G;  2E5L H;  5KHQ A;  3DVG Y;  5AEK B;  2KQS A;  2L8J A;  4DUZ H;  4IM3 A;  3M95 A;  3SR6 A;  2BW2 A;  5BO4 B;  4JPS A;  2IO2 B;  2OPU A;  2KOX A;  2M0A A;  2DNF A;  3S2A A;  3R7R A;  1XLP A;  1JWM D;  3WAM A;  4JX1 C;  1JQ4 A;  4HPP A;  4A90 A;  4KGR A;  3IHP C;  1WM3 A;  5IN7 A;  3Q8A A;  3RI7 C;  2VZK B;  4IW0 A;  3U52 E;  1V6E A;  4CHK A;  2LJ5 A;  1WFY A;  2EEL A;  1V5T A;  2WX1 A;  3KUC B;  2GBM A;  1C76 A;  1F2R I;  1IGD A;  2KC1 A;  1AAR A;  5BYQ A;  2I2Y A;  1WE6 A;  3VKE A;  3AE2 B;  1PGX A;  3VTV A;  4NJC A;  4KX6 B;  1TS4 A;  2KVR A;  2QEJ C;  3ZW3 A;  5EDS A;  3DVN V;  5JHA A;  2HJ1 A;  5G5G A;  3H8H A;  5HKH A;  1FJG H;  4GMV A;  1YX5 B;  3ZNG C;  5IWA H;  4RNA A;  2Y5C A;  2MA9 B;  4DV6 H;  4IC7 B;  1L6V A;  4WJO A;  1H4R A;  2FUG 1;  5D94 A;  4AP4 C;  4XE0 A;  3U1K A;  1HNZ H;  3HHM A;  3JYU A;  4RGM A;  2G8Y A;  1C9F A;  3A33 B;  1JCK B;  3ZIM A;  4BKS A;  1WJN A;  4K3C A;  2PVO D;  3DHH C;  1WGK A;  2JVZ A;  4IWP A;  3TMP B;  3KYC D;  2N9L A;  3URY A;  2BS3 B;  3L08 A;  1YQ4 B;  3OAW A;  1N5X A;  5LNK 1;  4BA2 I;  3KDK A;  4AQ7 A;  3DBL B;  2KVZ A;  4DR4 H;  4GKK H;  1K53 A;  4NXN H;  4L1B A;  5JH5 C;  1LGR A;  2OJR A;  4LNK A;  4AJY B;  4DV0 H;  4KDL B;  4HJK A;  3RNC C;  5G2N A;  4HEA 1;  4GOC A;  3HVZ A;  2KAJ A;  2KJ6 A;  4BAX A;  2CPM A;  1VJK A;  2YEP B;  1UH6 A;  4DR3 H;  2ZPY A;  1C1Y B;  3TJP A;  5KHO A;  2D3C A;  2NR2 A;  4A9A A;  1S20 A;  4LCD E;  4KIK B;  1X9Z A;  1G6J A;  1WE7 A;  2E6X A;  1EC6 A;  1FFU A;  3BK1 A;  4DHJ B;  1XO3 A;  4W9J A;  4JVH A;  1PQX A;  3FIL A;  1J7B A;  4LNI A;  2OOB B;  4DXF A;  2ZNV C;  1FKA H;  2CTM A;  4BKS D;  1YJI A;  3GZN B;  3Q8E A;  1VD2 A;  5CHW A;  1XMQ H;  2HTM E;  1OQQ A;  2W3R A;  2KDE B;  3ONS A;  4GN1 A;  4YSX B;  1VZ6 A;  5T8I A;  3PHW B;  4K1R B;  3ZTD A;  2IGG A;  4JVY A;  1EF1 A;  2KJH B;  1C4P A;  2QSD A;  4LFC H;  4BVU C;  2CR5 A;  3U30 A;  2BL5 A;  3NZS A;  2LGS A;  4PYZ A;  2VKC A;  1KFY B;  3J7A K;  4IUM B;  3R7Q A;  2JYE A;  2V1Y A;  2FCQ A;  1RLF A;  1UZX B;  1SXT A;  3O13 A;  1UNS A;  4WJQ A;  2K8C A;  3OWE B;  2W9N A;  4RM8 A;  2BA0 A;  3QWZ B;  4C4V B;  4LK0 M;  4NAM A;  1VIG A;  4PT5 A;  2JE6 I;  2RPV A;  3IAS 1;  2LHD A;  4GLS C;  1SB3 C;  3PLU A;  1WXV A;  4IWQ A;  3QC8 B;  1QOF A;  5CX3 A;  2WS3 B;  5GXG B;  2M4N A;  2L52 A;  1SF0 A;  2AQ1 B;  4FJS A;  2IGD A;  1WR1 A;  2INP E;  4MJS B;  3MTN B;  2AL6 A;  2ZVN A;  3KW5 B;  3PRZ A;  1N5W A;  1WSP A;  1L4Z B;  1MVK A;  2WLB A;  2Y5P A;  3MJW A;  4DK5 A;  1XMO H;  2KQ7 A;  3P2B A;  1F0X A;  2G9H D;  2MJ3 A;  1JWB D;  4DBG A;  1I6U A;  3B2G A;  1MG8 A;  5D3I B;  2LRU A;  1CMX B;  1SE9 A;  1IPG A;  4W9G A;  2GRI A;  2GOW A;  1TZO A;  1J19 A;  1DOY A;  3PGE A;  2LVO A;  3IXS A;  4DHJ D;  2Q5W D;  3GE3 C;  2CHW A;  1FCL A;  3VR9 B;  2IND C;  2LGD A;  2V3S A;  2N7J A;  2MH7 A;  1IBK H;  1J7A A;  3MP9 A;  3NCV A;  1Q5W B;  3V6C B;  4US9 A;  1UG8 A;  4FJZ A;  4REZ A;  3RUL A;  1N33 H;  2BYT A;  1N32 H;  1FPY A;  1EWY C;  4TQ0 A;  4FA6 A;  3VHT C;  3PT2 B;  4JI2 H;  2K9X A;  3L54 A;  2PY9 A;  4MH8 A;  3EFU A;  4O1N A;  3I57 A;  1RFK A;  2O4C A;  5C1Z A;  5A2Q W;  4OZA A;  3ZTC A;  3TEZ A;  2YLM A;  2JF5 A;  2TSS A;  1V8C A;  2RD0 A;  4FBJ B;  2DLB A;  5BMG A;  2BPS A;  4AM3 A;  4I6P A;  3U8Z A;  2WGS A;  2QND A;  3SB1 A;  3J9C A;  3V6E B;  5BMI A;  1V81 A;  1PQS A;  1C79 A;  3GKU A;  2XNA C;  3VRA B;  2JVC A;  1TKG A;  4LNF A;  3B1L X;  4MGY E;  2L0T A;  2NBU A;  2N9K A;  2KX0 A;  2JYT A;  5HFY A;  1PUT A;  3APF A;  2N7D A;  2KMM A;  2HJ8 A;  3QCA A;  3A9K A;  1SIJ A;  3DBH I;  5AUK A;  3V05 A;  5CHV C;  2ANR A;  1IP9 A;  4P1C C;  1T0Q C;  3WAO A;  4D2K A;  1XF5 L;  1F52 A;  1Q0W B;  4DHZ E;  5L83 A;  1ZPS A;  4MAC A;  2K6D B;  2MJE A;  3JSV B;  3Q6B A;  3ZNI D;  4OVU A;  1C78 A;  1JRU A;  3EZJ A;  3ZDT A;  3IAM 1;  2GBN A;  1B9R A;  2UUB H;  4YHH H;  1HE8 A;  3VTU A;  2JUO A;  2O6V A;  1C4C A;  2CS4 A;  4RF1 A;  4DV5 H;  2I1J A;  2JXT A;  4IG7 B;  5IT9 W;  5EE3 A;  1CQV A;  2KAC A;  2LFI A;  3W5V B;  2JWU A;  3J81 W;  3ECI A;  2PKO A;  1NI2 A;  3UIO B;  2D3A A;  5HG2 A;  1HA5 A;  3X0W A;  2E3U A;  1HNW H;  4ANV A;  2LUE A;  4WH4 A;  1D4B A;  4JI1 H;  3E9S A;  1E9M A;  2XEW A;  1P0R A;  2QDF A;  1WIA A;  1DOI A;  2Z0S A;  1FO4 A;  3GOE A;  2E3T A;  4QMF B;  2IY0 B;  3JVZ X;  2ZW0 A;  3IVF A;  2C7N B;  2W82 A; 
#chains in the Genus database with same CATH homology
 3NVZ A;  3BVM A;  2K3U A;  5H8Y E;  1E6E B;  2W3S A;  1K50 A;  2OHF A;  4JE3 B;  1HZ6 A;  1YN4 A;  4B0M A;  1N60 A;  2J53 A;  2LGI A;  3SR6 A;  2BW2 A;  1T3Q A;  4ITK A;  4JPS A;  1FNW A;  1KF6 B;  1FMA D;  1TYG B;  2V0G A;  1OFF A;  3GP7 A;  2M0A A;  4H2A A;  2FE8 A;  1ZOY B;  2BBC A;  3V3X A;  3ZGZ A;  3AEE B;  1XLP A;  1JWM D;  4OVZ A;  4JX1 C;  1QOG A;  1JQ4 A;  4A90 A;  4KGR A;  5TSS A;  4KGS A;  2EKI A;  4HRS A;  3KWV A;  1E0Z A;  3Q8A A;  4TMA B;  1IBX B;  1SE4 A;  2VZK B;  1ET6 A;  3AM9 A;  3U52 E;  4RF0 A;  1BXT A;  1JRP A;  4C80 A;  4USA A;  4GDL B;  2EEL A;  1EU4 A;  5E6J A;  1MHH E;  2WP9 B;  4YSZ B;  2BT6 A;  1C76 A;  1F2R I;  1IGD A;  4GDK B;  4LTU A;  3U4E G;  1P7E A;  5BYQ A;  4NZL B;  4ARC A;  2I2Y A;  3DWG C;  1XXG A;  3AE2 B;  2JU6 X;  1PGX A;  3P42 A;  4RGO S;  4NJC A;  1BUI C;  4KX6 B;  1TS4 A;  2QEJ C;  2GI9 A;  4TQ1 A;  1K52 A;  3MJ5 A;  3FC4 A;  1YN3 A;  1T6B X;  1WYG A;  1C77 A;  2IJ0 A;  3MHZ A;  4RGN A;  2QJL A;  5G5G A;  1N62 A;  4YWG G;  3H8H A;  2AQ2 B;  3AE3 B;  1YJJ A;  2BS4 B;  1V97 A;  3T3N A;  3W9C B;  3BVZ A;  3U2S C;  4RNA A;  2Z8L A;  2MEK A;  3SFD B;  1XCT L;  2Y5C A;  4ZRQ A;  3AE1 B;  1L6V A;  3RPF C;  3ZJT A;  1GAQ B;  3LXF A;  2FUG 1;  1XEE A;  1JWU D;  1XLQ A;  3AE5 B;  4XE0 A;  1ZXI A;  3BK2 A;  4RGM A;  2K0P A;  1AW7 A;  3IT6 B;  1C9F A;  1JCK B;  3AE4 B;  4XDD A;  2CJO A;  2WXR A;  1SEB D;  1IBX A;  1AYF A;  4ZHO A;  1B1Z A;  2PVO D;  1KH0 A;  2BS2 B;  3CWI A;  4ZOH C;  1WGK A;  1DGJ A;  4ZYS A;  1TS5 A;  1XLN A;  2W54 A;  3EUB 2;  4N6E B;  1VR9 A;  3Q8C A;  2N9L A;  2CJN A;  3URY A;  2BS3 B;  3BYT B;  4HJG E;  1NEK B;  1YQ3 B;  1YQ4 B;  2WXK A;  2WXQ A;  3T3O A;  5D3D A;  1N5X A;  1ZDV A;  5H92 C;  5LNK 1;  2J4X A;  1HZ5 A;  4M0W A;  1JRO A;  4AQ7 A;  1C4A A;  1SSN A;  4TSS A;  1K53 A;  2LUM A;  2BB6 A;  3KQ4 A;  1JWS D;  2D5G A;  3B9J A;  4L1B A;  5BYR A;  2ON8 A;  3AV8 A;  4HEA 1;  1FXA A;  2WDQ B;  1L0Y B;  3HVZ A;  1I4H A;  2KAJ A;  5FK9 C;  2L1A A;  1VJK A;  2YEP B;  4OW0 A;  2H88 B;  2N0S B;  3AMZ A;  4N58 A;  3AE6 B;  1VZ8 A;  3BWU D;  4OZC A;  1L4D B;  1FNU A;  4A9A A;  1YMH E;  2KWD A;  2L32 A;  1ENF A;  4KGT A;  4NAW B;  4P16 A;  1ZXH A;  4IDI A;  2W55 A;  2HDE A;  2E6X A;  2LJI A;  3P4P B;  1FFU A;  2QIE B;  2WXM A;  3BK1 A;  1V1P B;  1D5Z C;  2AQ3 B;  1XO3 A;  3ETR A;  2IPK D;  1CZP A;  3FIL A;  1J7B A;  3NVV A;  2J42 A;  1AWD A;  3P4Q B;  3AED B;  4DXF A;  2B76 B;  1SE3 A;  1FRD A;  2NMQ A;  3I9V 1;  1YJI A;  1FEH A;  3P4S B;  2OED A;  3AEA B;  3Q8E A;  3TEW A;  2WU2 B;  3NVY A;  3WCQ A;  1PFD A;  1D5M C;  4L2Y A;  4AS1 A;  4WIP A;  2HTM E;  3W5U B;  1MPE A;  1OQQ A;  2W3R A;  2JX5 A;  1V1O A;  3BII D;  1I4G A;  1L6U A;  4YSX B;  1VZ6 A;  3EA6 A;  4IKG A;  3HVD A;  2LEK A;  5T8I A;  2BTE A;  4C7Z A;  3R2I A;  2IGG A;  5EE1 A;  3AEF B;  1FRR A;  1QT9 A;  1C4P A;  2SAK A;  2YEP F;  2QSD A;  1NEN B;  2LMC A;  4WWM A;  4YT0 B;  2RMM A;  1FCC C;  1UGJ A;  4C56 C;  4KKJ A;  4WAF A;  3TEY A;  1Q10 A;  3AEB B;  5HI1 A;  1FD6 A;  4C7Y A;  1KFY B;  4FXC A;  1FIQ A;  2WXI A;  1IGC A;  2L83 A;  1KLG D;  1NVI D;  2JYE A;  3SFE B;  3C8Y A;  2WDR B;  4XWW A;  1UWX A;  1SXT A;  4HKQ A;  1P7F A;  4OHJ A;  1WXQ A;  1GB4 A;  3O13 A;  1DYQ A;  1OQR A;  1UNS A;  1KTK A;  3AE7 B;  4N59 A;  2RDG A;  3OWE B;  2MJD A;  4DQO C;  3W1S A;  1V1P A;  1ET9 A;  2QMT A;  4KKI A;  3Q8B A;  1J7C A;  1LO5 D;  4LK0 M;  4NAM A;  3ZJV A;  2BB5 A;  3U7Z A;  4B0E A;  4PT5 A;  2WXN A;  1KLU D;  4YXD B;  2RPV A;  3IAS 1;  4CQN A;  2LHD A;  4GLS C;  1SB3 C;  2ZW1 A;  2DYO A;  3BZD B;  1QOF A;  2WS3 B;  5GXG B;  3NRZ A;  1STE A;  2RDH A;  3LYY A;  2L52 A;  2PMV A;  1NYR A;  1SF0 A;  4JWU C;  3VR8 B;  3ABV B;  2AQ1 B;  1JW9 D;  1ACC A;  5C2T B;  2AX5 A;  2IGD A;  2INP E;  2WU5 B;  3VQI A;  4RFB A;  1VZ7 A;  2IGH A;  3ZQ4 A;  1N5W A;  4ARI A;  1WSP A;  1L4Z B;  3LB8 C;  1GPX A;  1MVK A;  3ZJU A;  2WLB A;  2Y5P A;  2KDM A;  3NUH B;  3UI3 A;  3GS2 A;  3HRD D;  2G9H D;  2MJ3 A;  3BVG A;  2INN E;  1JWA D;  3W2D A;  1KRH A;  1JWB D;  4YSY B;  3PZ7 A;  1FM0 D;  2WXG A;  2DYM A;  3PO0 A;  1SE2 A;  1D5X C;  3B2G A;  4A55 A;  5D3I B;  1FFV A;  1YN5 A;  2FBW B;  3B2F A;  5FR3 A;  1FNV A;  2WXO A;  1ESF A;  1TJE A;  1HQR D;  1JML A;  2GRI A;  4MM3 B;  2G1E A;  4J3O D;  3R8B A;  1TZO A;  2QIL A;  3L4P A;  3SEB A;  1DOY A;  1L0X B;  3IXS A;  5MPO A;  4YTP B;  2PIA A;  1D6E C;  1XLO A;  3E56 A;  2Q5W D;  4RCO A;  2CU3 A;  1FCL A;  3VR9 B;  1N63 A;  1ZUD 2;  3P1M A;  2N7J A;  2MH7 A;  1J7A A;  3MP9 A;  5JXV A;  2WDV B;  1I7H A;  1GB1 A;  3PZ8 A;  3GB1 A;  4US9 A;  2X38 A;  4REZ A;  5I4D A;  1CK1 A;  3IT4 B;  2DWQ A;  2BYT A;  2VZK D;  2K22 A;  1VLB A;  2NTS A;  1EU3 A;  1EWY C;  2JZP A;  4TQ0 A;  1CJE A;  1BML C;  4LLG M;  3AEG B;  2K9X A;  3TSS A;  4A8X C;  2WXP A;  5BMH A;  1WWT A;  4MH8 A;  1R7S A;  3NVW A;  4O1N A;  2IDY A;  1N61 A;  3I57 A;  4YTM B;  1WRI A;  5AUI A;  1RFK A;  4R3D A;  3EGR A;  1TKY A;  2WQY B;  4A6Q A;  3RFZ B;  4OZA A;  3TEZ A;  1I4P A;  1PYW D;  1E7P B;  1SJE D;  1E10 A;  3TEX A;  2TSS A;  2ICI A;  1V8C A;  1ZDX A;  4P6V F;  1M4V A;  2DLB A;  1QQR A;  2XN9 C;  5BMG A;  3MC0 B;  1HEZ E;  2ONQ A;  4WUR A;  5HHD G;  5FKA C;  3J9C A;  1PGB A;  2M19 A;  1K51 A;  2JSV X;  2Y3A A;  3TUO A;  2J52 A;  1DOX A;  1TKE A;  4RH6 A;  5BMI A;  1Y56 A;  1FXI A;  1AN8 A;  5EE0 A;  1SJH D;  3VRB B;  1QF6 A;  1PDX A;  1HXY D;  1C79 A;  2XNA C;  3VRA B;  1VDV A;  4OZB A;  4HKZ E;  1TKG A;  1EWC A;  5BYS A;  5EE9 A;  1UUP A;  2N9K A;  1YNT E;  2NTT A;  2JYT A;  2WNM A;  5HFY A;  1QLB B;  3AEC B;  1PUT A;  2LHE A;  1F0Z A;  2KMM A;  5D7G A;  4EE2 A;  1NI3 A;  1SIJ A;  5AUK A;  2KN4 A;  3V05 A;  3AE9 B;  2V3P A;  2SEB D;  1L0V B;  2WXJ A;  4WQM A;  1TS3 A;  1XF5 L;  1I4R A;  4D2K A;  4XDC A;  2V3N A;  1EM7 A;  3NS1 A;  3P4R B;  1TY0 A;  1ZPS A;  4MAC A;  2MJE A;  2I38 A;  2GB1 A;  1C78 A;  3IAM 1;  1TS2 A;  1B9R A;  1QOB A;  4L23 A;  4US8 A;  1SBB B;  3DWM A;  3Q69 A;  4IOI E;  1C4C A;  1ZP0 B;  2ACZ B;  2V4I B;  3FAH A;  3MFG A;  1RWS A;  1F77 A;  2JQR B;  3KLS X;  3R2T A;  3FIL B;  2DBY A;  4RF1 A;  1VRA B;  1ZE3 D;  5G5H A;  1T5X D;  1NYQ A;  2JXT A;  3BYY B;  2PLP A;  1QOA A;  2PVG C;  4DXG A;  4ZHP A;  2H89 B;  4MT5 A;  5EE3 A;  1CQV A;  4JWS C;  4RGT A;  2KAC A;  2WXL A;  1RYJ A;  4UDU C;  1QKZ A;  4HRO A;  2LFI A;  3W5V B;  2JWU A;  3AH7 A;  3ZYY X;  1MI0 A;  2PTL A;  2PKO A;  3CIR B;  5HG2 A;  3AB5 A;  1HA5 A;  3N9Y C;  1A70 A;  1TY2 A;  1RM6 C;  1ROE A;  2K5P A;  2M56 B;  1JAL A;  1F2R C;  1XCQ L;  3AN1 A;  4WH4 A;  1D4B A;  3HUI A;  1I4Q A;  1PGA A;  3E9S A;  1QIL A;  1IUE A;  1E9M A;  1GOZ A;  2WXF A;  2PW9 A;  3AE8 B;  2WXH A;  3Q8F A;  3NZ3 A;  1DOI A;  4ZRP A;  1FO4 A;  1L5P A;  2KQ4 X;  2E3T A;  1MHX A;  2R61 A;  4XWT A;  4YTN B;  2ZW0 A;  4Q2J A;  1UWM A;  5C3J B;  3KWL A;  2W82 A;  3P63 A;  1I4X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...