3GKUA

Crystal structure of a probable rna-binding protein from clostridium symbiosum atcc 14940
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
208
structure length
206
Chain Sequence
MDMVTVTAKTVEEAVTKALIELQTTSDKLTYEIVEKGSAGFIGSKPAIIRAKRKETLQDKAIEFLEQVFDAMNMAVDISVEYNETEKEMNVNLKGDDMGILIGKRGQTLDSLQYLVSLVVNKSSSDYIRVKLDTENYRERRKETLETLAKNIAYKVKRTKRSVSLEPMNPYERRIIHAALQNDKYVVTRSDGEEPFRHVIISLKRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable RNA-binding protein
publication title The crystal structure of a probable RNA-binding protein from Clostridium symbiosum ATCC 14940
rcsb
source organism Clostridium symbiosum atcc 14940
molecule tags Rna binding protein
total genus 55
structure length 206
sequence length 208
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01424 R3H R3H domain
A PF13083 KH_4 KH domain
A PF14804 Jag_N Jag N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.80 Alpha Beta 2-Layer Sandwich Defensin A-like probable RNA-binding protein from clostridium symbiosum atcc 14940 3gkuA01
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 3gkuA02
3.30.1370.50 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 R3H-like domain 3gkuA03
4DR1C 1JOSA 4LF7C 2QL8A 4B3TC 2KZFA 2CY1A 1XMQC 4JI2C 4LFBC 3T1YC 4LF8C 2CXCA 4MH4A 4JI3C 4KHPC 3R9XA 1FJGC 1ML8A 1N34C 4X65C 2E8EA 1MSZA 1N36C 1IBMC 4K0KC 4DR4C 5IWAC 4XX2A 4B3MC 4DUYC 4B3RC 4JI5C 4LFAC 4DV6C 4DCTA 1HR0C 2A1SA 3LUSA 2ONFA 2ASBA 2D7VA 5FLXD 3T1HC 2UUCC 3CJEA 4B3SC 2F4VC 1UG8A 2HHHC 4DR7C 1WHRA 1N32C 4DCUA 4X62C 4NOZA 2UUBC 1K0RA 1QWIA 4JI4C 2ZM6C 2E8FA 3GKUA 1HH2P 4DV3C 4JI0C 3IEUA 2HJGA 4LFCC 1UKKA 2OPLB 3EERA 2ATWA 4JI6C 2UXCC 3IEVA 3OTOC 4NXMC 4GKKC 4MTNA 3J81D 1ZB8A 2PT7G 4DV2C 2UU9C 1HNZC 4DV1C 4JI7C 4DR5C 3AF6A 2XR1A 2CPMA 2OPLA 1N2FA 1NYEA 2E8CA 1HNWC 4DUZC 1XNRC 2JMPA 1IBLC 4OX9C 4GKJC 4DV4C 1L2FA 2VQEC 2UUAC 4DR3C 5BR8C 1N33C 2E5LC 1WH9A 2VQFC 4AQYC 4DV5C 4LF5C 4LF4C 3R9WA 1KKGA 5LMUC 1MKYA 2LRRA 4NXNC 4LF6C 4BSZA 1XNQC 4DV7C 2EGTA 2DYJA 1WF3A 4DCVA 4LF9C 1USPA 5LMNC 2PN2A 4DR6C 2YCBA 1HNXC 5A2QD 1IBKC 1XMOC 1I94C 4X66C 2BJOA 3JAMD 1VLAA 4DR2C 3AF5A 1PA4A 1ZB9A 5IT9D 2UXBC 3J80D 4DCSA 1USPB 4JI1C 1EGAA 4DV0C 4JYAC 3I07A 4YY3C 4JV5C 4JI8C 2E7GA 4X64C 4YHHC 2UXDC 1J5EC 1LQLA
chains in the Genus database with same CATH superfamily
1MYNA 1NGDA 5EY4A 5CY0A 4LF7C 4B3TC 1NGHA 1XRBA 2CY1A 2KDNA 1N34H 1SEIA 3FCEA 1XMOH 1JKZA 2QW0X 2M5HA 4U5YD 1N36H 1ZZJA 4L7IA 1NRAA 4KHPC 1KAXA 1OMYA 1V60A 1VEHA 4EATA 5BPNA 3LNVA 4X65C 4B3MH 1P4EA 2ZZMA 4DUYH 1T1TA 2VSQA 4DG8A 2D1QA 3L8CA 3KP0A 5AQNA 1EC6A 4B8CD 1BA1A 2VZEA 4UAEF 3J81W 5DT9A 4B3SH 3A26A 2DHMA 4JI5C 4LFAC 4DV6C 5FPDA 4AM3A 1XMQH 3LUSA 2D7VA 4JI4H 2LY5A 1S20A 4PDBA 2F4VC 5AQWA 2HHHC 3KOXA 2MM9A 5BSMA 4DR7C 2FPHX 1BA0A 3DHVA 1N32C 1WHRA 2JZXA 4JI0H 1P00A 3GR5A 4NOZA 1SEGA 1AMUA 2ZQEA 2CWHA 1IBMH 5BPLA 2OPUA 3A4IA 3GKUA 2I61A 4DV3C 5EX5A 1VNBA 5AQSA 3KOWA 1NGBA 3A9UA 1ODHA 2QWQA 2OO4A 1XRHA 3D2FB 3AEVB 2KSKA 3OTOC 2D1RA 2E8AA 5BSWA 3LDNA 2P20A 4GKKC 2CTJA 2NN6G 5AQLA 5AQGA 4PUHA 5BSUA 1LQQA 3RV2A 1AHOA 4DR5C 3AF6A 2XR1A 2QW9A 1N2FA 1M6XC 2QWLA 3GR1A 4H8AA 2ZM6H 3L95X 1XHJA 4H5NA 3D2FA 1MXCA 5A2QW 3FAUA 5BR8H 4JVHA 1N33H 4NBQA 3QD7X 2VQFH 4LFCH 2P2FA 4OX9C 5A19A 4ISBA 4HE7A 1WT7A 2YWCA 2VQEC 3EQ6A 3OSSD 2E5LC 1POIA 2JDQD 3ATVA 2M5OA 3PBKA 1T7BA 4AQYC 3NPDA 5C0XG 4LF5C 3CQ2A 2Z51A 3CQXA 3IPLA 5LMUC 1HPMA 1UWDA 3TDEA 2BRZA 5LMNH 1FKAH 3VNRA 2D1TA 4DV7C 3H2TA 2EGTA 3PSMA 2DYJA 1WF3A 5F0XA 4DCVA 1XNRH 5K36G 1I2UA 1USPA 5LCIA 1DQ7A 2WD9A 4D56A 2PN2A 4GXRA 4JVYA 3R2VA 4WS9A 2YCBA 1ICAA 1ZU3A 4PUGA 4D57A 1IBKC 4X66C 2KBKA 1VLAA 4DR2C 1JZAA 2LF0A 4JYAH 5AE2A 4JV5H 1BRZA 2WP0C 1BUPA 4CQKA 3J80D 5IT9D 2UXBC 1V9NA 4YHHH 2E88A 5FPMA 1EGAA 4FL9A 1SN4A 2VKCA 1XNQH 4LF7H 3GDQA 1TUAA 2YIPA 3ETOA 4YY3C 4FSVA 5JRHA 2E7GA 1T7EA 2K35A 3KHWA 1TH5A 2P2MA 4WV3A 1IB8A 5BURA 2G8YA 4LIJA 2NY8X 1HNXH 4X65H 2CTKA 2NCLA 1V26A 1S03G 4GXQA 2LJMA 3CQ1A 2NY9X 5BSTA 5K8FA 3R9XA 1WVNA 2ANRA 5CZXA 2GMOA 1O93A 4AIMA 1PTXA 2E8EA 3CW4A 4RM3A 1ATSA 4JI5H 4D4IA 4DV6H 2LKBA 4LFAH 1M6XA 1T5DX 2LTLA 4DR4C 2UXDH 1XRAA 5IWAC 1WCJA 4L2ZA 4XX2A 2YILA 2JE6I 2F4VH 5BPMA 1SNBA 2HHHH 2YC1C 4PZPA 4V1DC 2QVYX 4DR7H 1N32H 5AE1A 3FZHA 4LFBH 1BCGA 2VY6A 5FLXD 3T1HC 5AE3A 2D9IA 2UUCC 2YBRC 4I9GA 5T8SA 5KEIA 1WWNA 2P2QA 2CTEA 2YIOA 4DCUA 2KHOA 4X62C 3KDGA 3UX3A 3I0PA 4KTVA 4H5RA 3OTOH 2YEOA 1OZZA 5A1GA 1NE5A 1K8BA 1FUGA 1NPIA 1ATRA 2KPYA 1VIGA 2ATWA 5LL6b 1HR0H 3A9VA 4JI6C 4DR5H 2JNVA 1J5KA 5T8TA 3FZMA 1CN2A 1ZVEA 1ZYWA 2QWMA 3UOEA 3AY9A 2QXLA 2UU9C 4FUQA 2YX1A 5H9UA 1HNZC 3U1KA 5AQRA 4OCHA 3VNQA 1NYEA 2M6QA 2MMAB 4OX9H 1KAYA 2LT8A 4PUIA 2MCQA 4FJUA 2M8WA 1PG4A 2VQEH 1JZBA 4I9FA 2O4CA 2E5LH 3QFUA 4DUZC 2JMPA 2E2FA 5KYVA 1TI5A 4AQYH 4LF5H 3E7RL 4GKJC 4DV4C 2YWBA 4BCAA 2MN5A 5LMUH 4ZLPA 2UUAC 4UAFE 5EXWA 1XRCA 4DR3C 1C56A 2UXCH 2A7TA 4LF4C 1S3XA 3R9WA 1YJ7A 4DV1H 1VIHA 4LF6C 4BSZA 3I33A 1DT4A 3HSCA 2CPQA 4LF9C 2Y27A 1IBKH 1FH3A 4X66H 4UJ0A 4G1IA 2N2RA 4DR2H 5A1IA 4DR6C 2UXBH 3JAMW 2LY6A 1XMOC 4DV5H 4G36A 1K1GA 2BJOA 2JEBI 3TR3A 5BUSA 4KYPA 2CTFA 2YQRA 1WMTA 1PA4A 1ZB9A 2MBKA 3AF5A 1L4VA 3R44A 4R0MA 1WE8A 2D56A 4AAZA 1USPB 1F0XA 1JXCA 3CW9A 1NGEA 4H5TA 2B3CA 1T0ZA 3I08A 4KBOA 3KXWA 1J5EC 4DR1C 1JOSA 5BSRA 5AQJA 2AXYA 3JXUA 4DG9A 2PQUA 5KYTA 1XMQC 4JI2C 2B68A 3T1YC 4LF8C 1NGJA 1UGLA 5AQIA 5KK4A 4WANA 2FFMA 3NYRA 4JI3C 1FJGC 4BA1I 1V8CA 1ML8A 3E7XA 2X06A 4DR4H 5IWAH 1AYJA 1MSZA 3VNSA 4JM1A 4DV0H 3E7UX 1IBMC 5BUQA 4K0KC 2KGQA 3PROC 1DKGD 1N4NA 2ATBA 3S82A 2UUCH 4B3RC 4B3TH 2E3UA 2E3FA 1HX1A 1P4EC 2OBVA 4X62H 2ASBA 3C7NA 2QWNA 3KP1A 2AYAA 3O2EA 5AQKA 4KHPH 3CQ3A 1GPSA 4FTFA 2G2KA 1PG3A 1KHMA 2UUBC 3FZKA 1K0RA 1QWIA 3NYQA 2ZM6C 2E8FA 3QFPA 4HPVA 4RLFA 3LDOA 3LDLA 4JI6H 2KBHA 3D2EA 4BC7A 2N66A 4HHFA 4LFCC 1P7LA 2OPLB 5AQXA 1DJTA 2D27A 2Y4OA 4HWIA 1Z2IA 3N54B 2UU9H 1LQIA 2KYQA 3EERA 1HNZH 2ASCA 1B3CA 3KVGA 3KDKA 1I6UA 4NXMC 1SN1A 3SF4D 3N2QA 3IMLA 3J81D 1ZB8A 2PT7G 4DV2C 2KJAA 2QWOA 4JI7C 4DUZH 3GPCA 2CPMA 2OPLA 4PROC 4RVNA 4GKJH 4DV4H 4PHTA 4IR7A 1J4WA 2E8CA 1HNWC 4DR3H 3QMLA 2PROA 1QQMA 4OYCA 3B7WA 4DV3H 1XNRC 2D28C 3L56A 1ZYVA 1IBLC 1FLOA 2KZ0A 3ATUA 3RG2A 3ETCA 4E9JA 4RM2A 2CTMA 3J80W 5IT9W 2KBJA 4ZJZA 2JEAI 4LF6H 5AQVA 3SO4A 4GKKH 2JVZA 1O90A 1T5HX 3DLPX 5F1XA 1MR4A 1MKYA 5CZVA 2LRRA 4LF9H 2P2JA 4NXNC 2E0GA 3E7WA 1QM4A 1XNQC 5AQYA 1GPMA 4OO1G 4DR6H 1NXUA 1MDBA 3OETA 5E7QA 4B8TA 1X0AA 3A8YA 3J7AK 1PU1A 4RLQA 4OD6A 5AR0A 2Y3MA 2Y4NA 4NZRM 5EVZA 1HNXC 5A2QD 1NGFA 1I94C 2GL1A 4FUTA 3JAMD 3VKEA 2QVZX 2D1SA 1KV0A 4TPSB 4H5VA 4DCSA 5BN8A 3L6QA 4JI1C 3KOZA 1J5EH 4DV7H 4DR1H 1ZVGA 3DAYA 2LR3A 1P0AA 5AQPA 3I07A 1T7AA 1ULTA 5FLXW 1NGIA 4JI2H 5AQZA 4JI8C 4X64C 3T1YH 2MJHA 4LF8H 2UXDC 1XRSB 2V7BA 2HH3A 2LTMA 4JI3H 3IUCA 3NCVA 2ZZNA 2QL8A 1FJGH 4H5WA 2KZFA 4AB0A 4IO8A 2JA9A 1ZTGA 4LFBC 1NGGA 2LJ7A 5AQHA 2FMRA 2CXCA 4MH4A 4R1LA 1MXBA 4AEIA 4K0KH 1VNAA 5GTDA 1N34C 2CU6A 2P2RA 3AY0A 4B3RH 1NRBA 1N36C 3UX2A 3K6RA 1ZUTA 3G7SA 1AN7A 4G08A 4YY3H 1ZFUA 4BC9A 1NGAA 5AQTA 3PESA 4DUYC 4B3MC 4RMNA 1DTJA 1HJOA 2K1HA 2M8BB 4G37A 1BMRA 1I6GA 4DCTA 1HR0C 1MDFA 2A1SA 1WTJA 2ONFA 1V25A 2UUBH 3GR0A 1MD9A 3FE1A 3CJEA 4B3SC 1UG8A 3SB1A 5BN9A 4IFDG 5BSVA 2BH1X 3BK3C 2P2BA 5AQFA 2QVXX 5K85A 4JI4C 4EC5A 4D4GA 4GS5A 4IZ6A 1HH2P 2LI7A 4JI0C 3IEUA 4NXMH 2HJGA 3C7NB 1UKKA 2BUPA 4DV2H 4UADE 1PQXA 3GL1A 3RF2A 1MXAA 5IFIA 3TQIA 4JI7H 5FPNA 2UXCC 3IEVA 1VBIA 2CTLA 3M3ZA 2V7ZA 3L4IA 3T1HH 2CWFA 3CW8X 3FZLA 2E3GA 4MTNA 1HNWH 3LDPA 4FJSA 4DV1C 3D2EB 5JEAG 2E0HA 1IBLH 1QQOA 1RG9A 3LNOA 1CHZA 1PE4A 4LE5A 1I2VA 5F2RA 3C5EA 5AQUA 2QWPA 2Z0SA 1RY2A 2BL5A 1C55A 2SN3A 3TUFA 4NZTM 1B7DA 3KC6A 1L2FA 4KTTA 1NGCA 4K0BA 5BR8C 1N33C 4R1MA 2QNDA 4NXNH 1BA3A 2N2QA 1LQHA 1WH9A 3LAXA 2VQFC 3V69A 4DV5C 1ZZKA 1X9ZA 1KKGA 3A25A 3NI2A 3KOYA 1PX9A 5DV9A 4QMFB 3LGXA 1I6FA 4BA2I 1BK8A 2N69A 1ZZIA 2P02A 2QWRA 4L4QA 3LDQA 1X4MA 5AQOA 5AQQA 1XS3A 4NDNA 4WALA 4GNIA 1QQNA 2DPLA 1I94H 4RVOA 5LMNC 3L7ZC 2UUAH 1YUWA 5FPEA 1NH5A 1O9TA 1X4NA 1GPTA 4LF4H 4JI1H 3UEBA 2ANNA 3QI7A 2BA0A 1NY8A 3FZFA 4JI8H 2HH2A 1O92A 4X64H 4BBYA 2MZ0A 3FCCA 3UZ0A 4OXIA 2OPVA 5ADZA 4DV0C 2PY9A 4JYAC 3EZJA 4JV5C 2LN8A 3UOWA 3GABA 1KAZA 5AQMA 4YHHC 1LCIA 4ODJA 2DGRA 1LQLA
chains in the Genus database with same CATH topology
4LF7C 4B3TC 1XRBA 2CY1A 3FCEA 2QW0X 4U5YD 4L7IA 4KHPC 4EATA 3LNVA 4X65C 2VSQA 4DG8A 2D1QA 3L8CA 2VZEA 4JI5C 4LFAC 4DV6C 3LUSA 2D7VA 2F4VC 2HHHC 5BSMA 4DR7C 3DHVA 1N32C 1WHRA 4NOZA 1AMUA 3A4IA 3GKUA 4DV3C 3A9UA 2OO4A 3OTOC 2D1RA 5BSWA 2P20A 4GKKC 5BSUA 3RV2A 4DR5C 3AF6A 2XR1A 1N2FA 3GR1A 3L95X 1MXCA 2P2FA 4OX9C 5A19A 4ISBA 2YWCA 2VQEC 3EQ6A 2E5LC 3PBKA 4AQYC 3NPDA 4LF5C 5LMUC 3IPLA 3TDEA 3VNRA 2D1TA 4DV7C 3H2TA 2EGTA 2DYJA 1WF3A 4DCVA 1USPA 2WD9A 4D56A 2PN2A 4GXRA 4WS9A 2YCBA 1IBKC 4D57A 4X66C 1VLAA 4DR2C 5AE2A 5IT9D 2WP0C 3J80D 2UXBC 1EGAA 3ETOA 4YY3C 5JRHA 2E7GA 4WV3A 2P2MA 5BURA 1V26A 4GXQA 5BSTA 5K8FA 3R9XA 5CZXA 1O93A 2E8EA 4RM3A 4D4IA 1T5DX 4DR4C 1XRAA 5IWAC 4XX2A 4L2ZA 4PZPA 2QVYX 5AE1A 5FLXD 3T1HC 5AE3A 2UUCC 4I9GA 5T8SA 5KEIA 2P2QA 4DCUA 4X62C 4KTVA 5A1GA 1FUGA 2ATWA 3A9VA 4JI6C 5T8TA 2UU9C 4FUQA 5H9UA 1HNZC 3VNQA 1NYEA 1PG4A 4I9FA 4DUZC 2JMPA 5KYVA 4GKJC 4DV4C 2YWBA 4BCAA 4ZLPA 2UUAC 1XRCA 4DR3C 4LF4C 3R9WA 1YJ7A 4LF6C 4BSZA 4LF9C 2Y27A 4G1IA 5A1IA 4DR6C 1XMOC 4G36A 2BJOA 5BUSA 3AF5A 1PA4A 1ZB9A 3R44A 4R0MA 1USPB 3CW9A 3I08A 3KXWA 1J5EC 4DR1C 1JOSA 5BSRA 4DG9A 5KYTA 1XMQC 4JI2C 3T1YC 4LF8C 3NYRA 4JI3C 1FJGC 1ML8A 3E7XA 1MSZA 3VNSA 4JM1A 1IBMC 5BUQA 4K0KC 3PROC 3S82A 4B3RC 2OBVA 2ASBA 2AYAA 4FTFA 1PG3A 2UUBC 1K0RA 1QWIA 3NYQA 2ZM6C 2E8FA 4HPVA 4RLFA 4LFCC 1P7LA 2OPLB 2D27A 2Y4OA 3N54B 3EERA 4NXMC 3N2QA 3IMLA 3J81D 1ZB8A 2PT7G 4DV2C 4JI7C 3GPCA 2CPMA 2OPLA 4PROC 4RVNA 4PHTA 4IR7A 2E8CA 1HNWC 2PROA 4OYCA 3B7WA 1XNRC 2D28C 1IBLC 3RG2A 3ETCA 4RM2A 4ZJZA 3SO4A 1O90A 1T5HX 3DLPX 1MKYA 5CZVA 2LRRA 2P2JA 4NXNC 2E0GA 3E7WA 1QM4A 1XNQC 1GPMA 1LQLA 1MDBA 5E7QA 4RLQA 2Y4NA 1HNXC 5A2QD 1I94C 4FUTA 3JAMD 2QVZX 2D1SA 4TPSB 4DCSA 4JI1C 3DAYA 3I07A 1ULTA 4JI8C 4X64C 2UXDC 2V7BA 2QL8A 2KZFA 4LFBC 2CXCA 4MH4A 4R1LA 1MXBA 5GTDA 1N34C 1N36C 3G7SA 4BC9A 3PESA 4B3MC 4DUYC 4RMNA 4G37A 4DCTA 1HR0C 1MDFA 2A1SA 2ONFA 1V25A 3GR0A 1MD9A 3CJEA 4B3SC 1UG8A 5BSVA 2BH1X 2P2BA 2QVXX 5K85A 4JI4C 4D4GA 4GS5A 4IZ6A 1HH2P 4JI0C 3IEUA 2HJGA 1UKKA 1MXAA 5IFIA 3TQIA 2UXCC 3IEVA 3CW8X 4MTNA 4DV1C 1RG9A 4LE5A 3C5EA 1RY2A 3TUFA 1L2FA 4KTTA 4K0BA 5BR8C 1N33C 4R1MA 1BA3A 3LAXA 1WH9A 2VQFC 4DV5C 1KKGA 3NI2A 5DV9A 3LGXA 2P02A 4L4QA 4NDNA 2DPLA 4RVOA 5LMNC 1O9TA 1O92A 4BBYA 3UZ0A 3FCCA 4OXIA 5ADZA 4DV0C 4JYAC 4JV5C 3UOWA 4YHHC 1LCIA 4ODJA 4BC7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR1 C;  1JOS A;  4LF7 C;  2QL8 A;  4B3T C;  2KZF A;  2CY1 A;  1XMQ C;  4JI2 C;  4LFB C;  3T1Y C;  4LF8 C;  2CXC A;  4MH4 A;  4JI3 C;  4KHP C;  3R9X A;  1FJG C;  1ML8 A;  1N34 C;  4X65 C;  2E8E A;  1MSZ A;  1N36 C;  1IBM C;  4K0K C;  4DR4 C;  5IWA C;  4XX2 A;  4B3M C;  4DUY C;  4B3R C;  4JI5 C;  4LFA C;  4DV6 C;  4DCT A;  1HR0 C;  2A1S A;  3LUS A;  2ONF A;  2ASB A;  2D7V A;  5FLX D;  3T1H C;  2UUC C;  3CJE A;  4B3S C;  2F4V C;  1UG8 A;  2HHH C;  4DR7 C;  1WHR A;  1N32 C;  4DCU A;  4X62 C;  4NOZ A;  2UUB C;  1K0R A;  1QWI A;  4JI4 C;  2ZM6 C;  2E8F A;  3GKU A;  1HH2 P;  4DV3 C;  4JI0 C;  3IEU A;  2HJG A;  4LFC C;  1UKK A;  2OPL B;  3EER A;  2ATW A;  4JI6 C;  2UXC C;  3IEV A;  3OTO C;  4NXM C;  4GKK C;  4MTN A;  3J81 D;  1ZB8 A;  2PT7 G;  4DV2 C;  2UU9 C;  1HNZ C;  4DV1 C;  4JI7 C;  4DR5 C;  3AF6 A;  2XR1 A;  2CPM A;  2OPL A;  1N2F A;  1NYE A;  2E8C A;  1HNW C;  4DUZ C;  1XNR C;  2JMP A;  1IBL C;  4OX9 C;  4GKJ C;  4DV4 C;  1L2F A;  2VQE C;  2UUA C;  4DR3 C;  5BR8 C;  1N33 C;  2E5L C;  1WH9 A;  2VQF C;  4AQY C;  4DV5 C;  4LF5 C;  4LF4 C;  3R9W A;  1KKG A;  5LMU C;  1MKY A;  2LRR A;  4NXN C;  4LF6 C;  4BSZ A;  1XNQ C;  4DV7 C;  2EGT A;  2DYJ A;  1WF3 A;  4DCV A;  4LF9 C;  1USP A;  5LMN C;  2PN2 A;  4DR6 C;  2YCB A;  1HNX C;  5A2Q D;  1IBK C;  1XMO C;  1I94 C;  4X66 C;  2BJO A;  3JAM D;  1VLA A;  4DR2 C;  3AF5 A;  1PA4 A;  1ZB9 A;  5IT9 D;  2UXB C;  3J80 D;  4DCS A;  1USP B;  4JI1 C;  1EGA A;  4DV0 C;  4JYA C;  3I07 A;  4YY3 C;  4JV5 C;  4JI8 C;  2E7G A;  4X64 C;  4YHH C;  2UXD C;  1J5E C;  1LQL A; 
#chains in the Genus database with same CATH topology
 1MYN A;  1NGD A;  5EY4 A;  5CY0 A;  4LF7 C;  4B3T C;  1NGH A;  1XRB A;  2CY1 A;  2KDN A;  1N34 H;  1SEI A;  3FCE A;  1XMO H;  1JKZ A;  2QW0 X;  2M5H A;  4U5Y D;  1N36 H;  1ZZJ A;  4L7I A;  1NRA A;  4KHP C;  1KAX A;  1OMY A;  1V60 A;  1VEH A;  4EAT A;  5BPN A;  3LNV A;  4X65 C;  4B3M H;  1P4E A;  2ZZM A;  4DUY H;  1T1T A;  2VSQ A;  4DG8 A;  2D1Q A;  3L8C A;  3KP0 A;  5AQN A;  1EC6 A;  4B8C D;  1BA1 A;  2VZE A;  4UAE F;  3J81 W;  5DT9 A;  4B3S H;  3A26 A;  2DHM A;  4JI5 C;  4LFA C;  4DV6 C;  5FPD A;  4AM3 A;  1XMQ H;  3LUS A;  2D7V A;  4JI4 H;  2LY5 A;  1S20 A;  4PDB A;  2F4V C;  5AQW A;  2HHH C;  3KOX A;  2MM9 A;  5BSM A;  4DR7 C;  2FPH X;  1BA0 A;  3DHV A;  1N32 C;  1WHR A;  2JZX A;  4JI0 H;  1P00 A;  3GR5 A;  4NOZ A;  1SEG A;  1AMU A;  2ZQE A;  2CWH A;  1IBM H;  5BPL A;  2OPU A;  3A4I A;  3GKU A;  2I61 A;  4DV3 C;  5EX5 A;  1VNB A;  5AQS A;  3KOW A;  1NGB A;  3A9U A;  1ODH A;  2QWQ A;  2OO4 A;  1XRH A;  3D2F B;  3AEV B;  2KSK A;  3OTO C;  2D1R A;  2E8A A;  5BSW A;  3LDN A;  2P20 A;  4GKK C;  2CTJ A;  2NN6 G;  5AQL A;  5AQG A;  4PUH A;  5BSU A;  1LQQ A;  3RV2 A;  1AHO A;  4DR5 C;  3AF6 A;  2XR1 A;  2QW9 A;  1N2F A;  1M6X C;  2QWL A;  3GR1 A;  4H8A A;  2ZM6 H;  3L95 X;  1XHJ A;  4H5N A;  3D2F A;  1MXC A;  5A2Q W;  3FAU A;  5BR8 H;  4JVH A;  1N33 H;  4NBQ A;  3QD7 X;  2VQF H;  4LFC H;  2P2F A;  4OX9 C;  5A19 A;  4ISB A;  4HE7 A;  1WT7 A;  2YWC A;  2VQE C;  3EQ6 A;  3OSS D;  2E5L C;  1POI A;  2JDQ D;  3ATV A;  2M5O A;  3PBK A;  1T7B A;  4AQY C;  3NPD A;  5C0X G;  4LF5 C;  3CQ2 A;  2Z51 A;  3CQX A;  3IPL A;  5LMU C;  1HPM A;  1UWD A;  3TDE A;  2BRZ A;  5LMN H;  1FKA H;  3VNR A;  2D1T A;  4DV7 C;  3H2T A;  2EGT A;  3PSM A;  2DYJ A;  1WF3 A;  5F0X A;  4DCV A;  1XNR H;  5K36 G;  1I2U A;  1USP A;  5LCI A;  1DQ7 A;  2WD9 A;  4D56 A;  2PN2 A;  4GXR A;  4JVY A;  3R2V A;  4WS9 A;  2YCB A;  1ICA A;  1ZU3 A;  4PUG A;  4D57 A;  1IBK C;  4X66 C;  2KBK A;  1VLA A;  4DR2 C;  1JZA A;  2LF0 A;  4JYA H;  5AE2 A;  4JV5 H;  1BRZ A;  2WP0 C;  1BUP A;  4CQK A;  3J80 D;  5IT9 D;  2UXB C;  1V9N A;  4YHH H;  2E88 A;  5FPM A;  1EGA A;  4FL9 A;  1SN4 A;  2VKC A;  1XNQ H;  4LF7 H;  3GDQ A;  1TUA A;  2YIP A;  3ETO A;  4YY3 C;  4FSV A;  5JRH A;  2E7G A;  1T7E A;  2K35 A;  3KHW A;  1TH5 A;  2P2M A;  4WV3 A;  1IB8 A;  5BUR A;  2G8Y A;  4LIJ A;  2NY8 X;  1HNX H;  4X65 H;  2CTK A;  2NCL A;  1V26 A;  1S03 G;  4GXQ A;  2LJM A;  3CQ1 A;  2NY9 X;  5BST A;  5K8F A;  3R9X A;  1WVN A;  2ANR A;  5CZX A;  2GMO A;  1O93 A;  4AIM A;  1PTX A;  2E8E A;  3CW4 A;  4RM3 A;  1ATS A;  4JI5 H;  4D4I A;  4DV6 H;  2LKB A;  4LFA H;  1M6X A;  1T5D X;  2LTL A;  4DR4 C;  2UXD H;  1XRA A;  5IWA C;  1WCJ A;  4L2Z A;  4XX2 A;  2YIL A;  2JE6 I;  2F4V H;  5BPM A;  1SNB A;  2HHH H;  2YC1 C;  4PZP A;  4V1D C;  2QVY X;  4DR7 H;  1N32 H;  5AE1 A;  3FZH A;  4LFB H;  1BCG A;  2VY6 A;  5FLX D;  3T1H C;  5AE3 A;  2D9I A;  2UUC C;  2YBR C;  4I9G A;  5T8S A;  5KEI A;  1WWN A;  2P2Q A;  2CTE A;  2YIO A;  4DCU A;  2KHO A;  4X62 C;  3KDG A;  3UX3 A;  3I0P A;  4KTV A;  4H5R A;  3OTO H;  2YEO A;  1OZZ A;  5A1G A;  1NE5 A;  1K8B A;  1FUG A;  1NPI A;  1ATR A;  2KPY A;  1VIG A;  2ATW A;  5LL6 b;  1HR0 H;  3A9V A;  4JI6 C;  4DR5 H;  2JNV A;  1J5K A;  5T8T A;  3FZM A;  1CN2 A;  1ZVE A;  1ZYW A;  2QWM A;  3UOE A;  3AY9 A;  2QXL A;  2UU9 C;  4FUQ A;  2YX1 A;  5H9U A;  1HNZ C;  3U1K A;  5AQR A;  4OCH A;  3VNQ A;  1NYE A;  2M6Q A;  2MMA B;  4OX9 H;  1KAY A;  2LT8 A;  4PUI A;  2MCQ A;  4FJU A;  2M8W A;  1PG4 A;  2VQE H;  1JZB A;  4I9F A;  2O4C A;  2E5L H;  3QFU A;  4DUZ C;  2JMP A;  2E2F A;  5KYV A;  1TI5 A;  4AQY H;  4LF5 H;  3E7R L;  4GKJ C;  4DV4 C;  2YWB A;  4BCA A;  2MN5 A;  5LMU H;  4ZLP A;  2UUA C;  4UAF E;  5EXW A;  1XRC A;  4DR3 C;  1C56 A;  2UXC H;  2A7T A;  4LF4 C;  1S3X A;  3R9W A;  1YJ7 A;  4DV1 H;  1VIH A;  4LF6 C;  4BSZ A;  3I33 A;  1DT4 A;  3HSC A;  2CPQ A;  4LF9 C;  2Y27 A;  1IBK H;  1FH3 A;  4X66 H;  4UJ0 A;  4G1I A;  2N2R A;  4DR2 H;  5A1I A;  4DR6 C;  2UXB H;  3JAM W;  2LY6 A;  1XMO C;  4DV5 H;  4G36 A;  1K1G A;  2BJO A;  2JEB I;  3TR3 A;  5BUS A;  4KYP A;  2CTF A;  2YQR A;  1WMT A;  1PA4 A;  1ZB9 A;  2MBK A;  3AF5 A;  1L4V A;  3R44 A;  4R0M A;  1WE8 A;  2D56 A;  4AAZ A;  1USP B;  1F0X A;  1JXC A;  3CW9 A;  1NGE A;  4H5T A;  2B3C A;  1T0Z A;  3I08 A;  4KBO A;  3KXW A;  1J5E C;  4DR1 C;  1JOS A;  5BSR A;  5AQJ A;  2AXY A;  3JXU A;  4DG9 A;  2PQU A;  5KYT A;  1XMQ C;  4JI2 C;  2B68 A;  3T1Y C;  4LF8 C;  1NGJ A;  1UGL A;  5AQI A;  5KK4 A;  4WAN A;  2FFM A;  3NYR A;  4JI3 C;  1FJG C;  4BA1 I;  1V8C A;  1ML8 A;  3E7X A;  2X06 A;  4DR4 H;  5IWA H;  1AYJ A;  1MSZ A;  3VNS A;  4JM1 A;  4DV0 H;  3E7U X;  1IBM C;  5BUQ A;  4K0K C;  2KGQ A;  3PRO C;  1DKG D;  1N4N A;  2ATB A;  3S82 A;  2UUC H;  4B3R C;  4B3T H;  2E3U A;  2E3F A;  1HX1 A;  1P4E C;  2OBV A;  4X62 H;  2ASB A;  3C7N A;  2QWN A;  3KP1 A;  2AYA A;  3O2E A;  5AQK A;  4KHP H;  3CQ3 A;  1GPS A;  4FTF A;  2G2K A;  1PG3 A;  1KHM A;  2UUB C;  3FZK A;  1K0R A;  1QWI A;  3NYQ A;  2ZM6 C;  2E8F A;  3QFP A;  4HPV A;  4RLF A;  3LDO A;  3LDL A;  4JI6 H;  2KBH A;  3D2E A;  4BC7 A;  2N66 A;  4HHF A;  4LFC C;  1P7L A;  2OPL B;  5AQX A;  1DJT A;  2D27 A;  2Y4O A;  4HWI A;  1Z2I A;  3N54 B;  2UU9 H;  1LQI A;  2KYQ A;  3EER A;  1HNZ H;  2ASC A;  1B3C A;  3KVG A;  3KDK A;  1I6U A;  4NXM C;  1SN1 A;  3SF4 D;  3N2Q A;  3IML A;  3J81 D;  1ZB8 A;  2PT7 G;  4DV2 C;  2KJA A;  2QWO A;  4JI7 C;  4DUZ H;  3GPC A;  2CPM A;  2OPL A;  4PRO C;  4RVN A;  4GKJ H;  4DV4 H;  4PHT A;  4IR7 A;  1J4W A;  2E8C A;  1HNW C;  4DR3 H;  3QML A;  2PRO A;  1QQM A;  4OYC A;  3B7W A;  4DV3 H;  1XNR C;  2D28 C;  3L56 A;  1ZYV A;  1IBL C;  1FLO A;  2KZ0 A;  3ATU A;  3RG2 A;  3ETC A;  4E9J A;  4RM2 A;  2CTM A;  3J80 W;  5IT9 W;  2KBJ A;  4ZJZ A;  2JEA I;  4LF6 H;  5AQV A;  3SO4 A;  4GKK H;  2JVZ A;  1O90 A;  1T5H X;  3DLP X;  5F1X A;  1MR4 A;  1MKY A;  5CZV A;  2LRR A;  4LF9 H;  2P2J A;  4NXN C;  2E0G A;  3E7W A;  1QM4 A;  1XNQ C;  5AQY A;  1GPM A;  4OO1 G;  4DR6 H;  1NXU A;  1MDB A;  3OET A;  5E7Q A;  4B8T A;  1X0A A;  3A8Y A;  3J7A K;  1PU1 A;  4RLQ A;  4OD6 A;  5AR0 A;  2Y3M A;  2Y4N A;  4NZR M;  5EVZ A;  1HNX C;  5A2Q D;  1NGF A;  1I94 C;  2GL1 A;  4FUT A;  3JAM D;  3VKE A;  2QVZ X;  2D1S A;  1KV0 A;  4TPS B;  4H5V A;  4DCS A;  5BN8 A;  3L6Q A;  4JI1 C;  3KOZ A;  1J5E H;  4DV7 H;  4DR1 H;  1ZVG A;  3DAY A;  2LR3 A;  1P0A A;  5AQP A;  3I07 A;  1T7A A;  1ULT A;  5FLX W;  1NGI A;  4JI2 H;  5AQZ A;  4JI8 C;  4X64 C;  3T1Y H;  2MJH A;  4LF8 H;  2UXD C;  1XRS B;  2V7B A;  2HH3 A;  2LTM A;  4JI3 H;  3IUC A;  3NCV A;  2ZZN A;  2QL8 A;  1FJG H;  4H5W A;  2KZF A;  4AB0 A;  4IO8 A;  2JA9 A;  1ZTG A;  4LFB C;  1NGG A;  2LJ7 A;  5AQH A;  2FMR A;  2CXC A;  4MH4 A;  4R1L A;  1MXB A;  4AEI A;  4K0K H;  1VNA A;  5GTD A;  1N34 C;  2CU6 A;  2P2R A;  3AY0 A;  4B3R H;  1NRB A;  1N36 C;  3UX2 A;  3K6R A;  1ZUT A;  3G7S A;  1AN7 A;  4G08 A;  4YY3 H;  1ZFU A;  4BC9 A;  1NGA A;  5AQT A;  3PES A;  4DUY C;  4B3M C;  4RMN A;  1DTJ A;  1HJO A;  2K1H A;  2M8B B;  4G37 A;  1BMR A;  1I6G A;  4DCT A;  1HR0 C;  1MDF A;  2A1S A;  1WTJ A;  2ONF A;  1V25 A;  2UUB H;  3GR0 A;  1MD9 A;  3FE1 A;  3CJE A;  4B3S C;  1UG8 A;  3SB1 A;  5BN9 A;  4IFD G;  5BSV A;  2BH1 X;  3BK3 C;  2P2B A;  5AQF A;  2QVX X;  5K85 A;  4JI4 C;  4EC5 A;  4D4G A;  4GS5 A;  4IZ6 A;  1HH2 P;  2LI7 A;  4JI0 C;  3IEU A;  4NXM H;  2HJG A;  3C7N B;  1UKK A;  2BUP A;  4DV2 H;  4UAD E;  1PQX A;  3GL1 A;  3RF2 A;  1MXA A;  5IFI A;  3TQI A;  4JI7 H;  5FPN A;  2UXC C;  3IEV A;  1VBI A;  2CTL A;  3M3Z A;  2V7Z A;  3L4I A;  3T1H H;  2CWF A;  3CW8 X;  3FZL A;  2E3G A;  4MTN A;  1HNW H;  3LDP A;  4FJS A;  4DV1 C;  3D2E B;  5JEA G;  2E0H A;  1IBL H;  1QQO A;  1RG9 A;  3LNO A;  1CHZ A;  1PE4 A;  4LE5 A;  1I2V A;  5F2R A;  3C5E A;  5AQU A;  2QWP A;  2Z0S A;  1RY2 A;  2BL5 A;  1C55 A;  2SN3 A;  3TUF A;  4NZT M;  1B7D A;  3KC6 A;  1L2F A;  4KTT A;  1NGC A;  4K0B A;  5BR8 C;  1N33 C;  4R1M A;  2QND A;  4NXN H;  1BA3 A;  2N2Q A;  1LQH A;  1WH9 A;  3LAX A;  2VQF C;  3V69 A;  4DV5 C;  1ZZK A;  1X9Z A;  1KKG A;  3A25 A;  3NI2 A;  3KOY A;  1PX9 A;  5DV9 A;  4QMF B;  3LGX A;  1I6F A;  4BA2 I;  1BK8 A;  2N69 A;  1ZZI A;  2P02 A;  2QWR A;  4L4Q A;  3LDQ A;  1X4M A;  5AQO A;  5AQQ A;  1XS3 A;  4NDN A;  4WAL A;  4GNI A;  1QQN A;  2DPL A;  1I94 H;  4RVO A;  5LMN C;  3L7Z C;  2UUA H;  1YUW A;  5FPE A;  1NH5 A;  1O9T A;  1X4N A;  1GPT A;  4LF4 H;  4JI1 H;  3UEB A;  2ANN A;  3QI7 A;  2BA0 A;  1NY8 A;  3FZF A;  4JI8 H;  2HH2 A;  1O92 A;  4X64 H;  4BBY A;  2MZ0 A;  3FCC A;  3UZ0 A;  4OXI A;  2OPV A;  5ADZ A;  4DV0 C;  2PY9 A;  4JYA C;  3EZJ A;  4JV5 C;  2LN8 A;  3UOW A;  3GAB A;  1KAZ A;  5AQM A;  4YHH C;  1LCI A;  4ODJ A;  2DGR A;  1LQL A; 
#chains in the Genus database with same CATH homology
 4LF7 C;  4B3T C;  1XRB A;  2CY1 A;  3FCE A;  2QW0 X;  4U5Y D;  4L7I A;  4KHP C;  4EAT A;  3LNV A;  4X65 C;  2VSQ A;  4DG8 A;  2D1Q A;  3L8C A;  2VZE A;  4JI5 C;  4LFA C;  4DV6 C;  3LUS A;  2D7V A;  2F4V C;  2HHH C;  5BSM A;  4DR7 C;  3DHV A;  1N32 C;  1WHR A;  4NOZ A;  1AMU A;  3A4I A;  3GKU A;  4DV3 C;  3A9U A;  2OO4 A;  3OTO C;  2D1R A;  5BSW A;  2P20 A;  4GKK C;  5BSU A;  3RV2 A;  4DR5 C;  3AF6 A;  2XR1 A;  1N2F A;  3GR1 A;  3L95 X;  1MXC A;  2P2F A;  4OX9 C;  5A19 A;  4ISB A;  2YWC A;  2VQE C;  3EQ6 A;  2E5L C;  3PBK A;  4AQY C;  3NPD A;  4LF5 C;  5LMU C;  3IPL A;  3TDE A;  3VNR A;  2D1T A;  4DV7 C;  3H2T A;  2EGT A;  2DYJ A;  1WF3 A;  4DCV A;  1USP A;  2WD9 A;  4D56 A;  2PN2 A;  4GXR A;  4WS9 A;  2YCB A;  1IBK C;  4D57 A;  4X66 C;  1VLA A;  4DR2 C;  5AE2 A;  5IT9 D;  2WP0 C;  3J80 D;  2UXB C;  1EGA A;  3ETO A;  4YY3 C;  5JRH A;  2E7G A;  4WV3 A;  2P2M A;  5BUR A;  1V26 A;  4GXQ A;  5BST A;  5K8F A;  3R9X A;  5CZX A;  1O93 A;  2E8E A;  4RM3 A;  4D4I A;  1T5D X;  4DR4 C;  1XRA A;  5IWA C;  4XX2 A;  4L2Z A;  4PZP A;  2QVY X;  5AE1 A;  5FLX D;  3T1H C;  5AE3 A;  2UUC C;  4I9G A;  5T8S A;  5KEI A;  2P2Q A;  4DCU A;  4X62 C;  4KTV A;  5A1G A;  1FUG A;  2ATW A;  3A9V A;  4JI6 C;  5T8T A;  2UU9 C;  4FUQ A;  5H9U A;  1HNZ C;  3VNQ A;  1NYE A;  1PG4 A;  4I9F A;  4DUZ C;  2JMP A;  5KYV A;  4GKJ C;  4DV4 C;  2YWB A;  4BCA A;  4ZLP A;  2UUA C;  1XRC A;  4DR3 C;  4LF4 C;  3R9W A;  1YJ7 A;  4LF6 C;  4BSZ A;  4LF9 C;  2Y27 A;  4G1I A;  5A1I A;  4DR6 C;  1XMO C;  4G36 A;  2BJO A;  5BUS A;  3AF5 A;  1PA4 A;  1ZB9 A;  3R44 A;  4R0M A;  1USP B;  3CW9 A;  3I08 A;  3KXW A;  1J5E C;  4DR1 C;  1JOS A;  5BSR A;  4DG9 A;  5KYT A;  1XMQ C;  4JI2 C;  3T1Y C;  4LF8 C;  3NYR A;  4JI3 C;  1FJG C;  1ML8 A;  3E7X A;  1MSZ A;  3VNS A;  4JM1 A;  1IBM C;  5BUQ A;  4K0K C;  3PRO C;  3S82 A;  4B3R C;  2OBV A;  2ASB A;  2AYA A;  4FTF A;  1PG3 A;  2UUB C;  1K0R A;  1QWI A;  3NYQ A;  2ZM6 C;  2E8F A;  4HPV A;  4RLF A;  4LFC C;  1P7L A;  2OPL B;  2D27 A;  2Y4O A;  3N54 B;  3EER A;  4NXM C;  3N2Q A;  3IML A;  3J81 D;  1ZB8 A;  2PT7 G;  4DV2 C;  4JI7 C;  3GPC A;  2CPM A;  2OPL A;  4PRO C;  4RVN A;  4PHT A;  4IR7 A;  2E8C A;  1HNW C;  2PRO A;  4OYC A;  3B7W A;  1XNR C;  2D28 C;  1IBL C;  3RG2 A;  3ETC A;  4RM2 A;  4ZJZ A;  3SO4 A;  1O90 A;  1T5H X;  3DLP X;  1MKY A;  5CZV A;  2LRR A;  2P2J A;  4NXN C;  2E0G A;  3E7W A;  1QM4 A;  1XNQ C;  1GPM A;  1LQL A;  1MDB A;  5E7Q A;  4RLQ A;  2Y4N A;  1HNX C;  5A2Q D;  1I94 C;  4FUT A;  3JAM D;  2QVZ X;  2D1S A;  4TPS B;  4DCS A;  4JI1 C;  3DAY A;  3I07 A;  1ULT A;  4JI8 C;  4X64 C;  2UXD C;  2V7B A;  2QL8 A;  2KZF A;  4LFB C;  2CXC A;  4MH4 A;  4R1L A;  1MXB A;  5GTD A;  1N34 C;  1N36 C;  3G7S A;  4BC9 A;  3PES A;  4B3M C;  4DUY C;  4RMN A;  4G37 A;  4DCT A;  1HR0 C;  1MDF A;  2A1S A;  2ONF A;  1V25 A;  3GR0 A;  1MD9 A;  3CJE A;  4B3S C;  1UG8 A;  5BSV A;  2BH1 X;  2P2B A;  2QVX X;  5K85 A;  4JI4 C;  4D4G A;  4GS5 A;  4IZ6 A;  1HH2 P;  4JI0 C;  3IEU A;  2HJG A;  1UKK A;  1MXA A;  5IFI A;  3TQI A;  2UXC C;  3IEV A;  3CW8 X;  4MTN A;  4DV1 C;  1RG9 A;  4LE5 A;  3C5E A;  1RY2 A;  3TUF A;  1L2F A;  4KTT A;  4K0B A;  5BR8 C;  1N33 C;  4R1M A;  1BA3 A;  3LAX A;  1WH9 A;  2VQF C;  4DV5 C;  1KKG A;  3NI2 A;  5DV9 A;  3LGX A;  2P02 A;  4L4Q A;  4NDN A;  2DPL A;  4RVO A;  5LMN C;  1O9T A;  1O92 A;  4BBY A;  3UZ0 A;  3FCC A;  4OXI A;  5ADZ A;  4DV0 C;  4JYA C;  4JV5 C;  3UOW A;  4YHH C;  1LCI A;  4ODJ A;  4BC7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...