3GKUA

Crystal structure of a probable rna-binding protein from clostridium symbiosum atcc 14940
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
208
structure length
206
Chain Sequence
MDMVTVTAKTVEEAVTKALIELQTTSDKLTYEIVEKGSAGFIGSKPAIIRAKRKETLQDKAIEFLEQVFDAMNMAVDISVEYNETEKEMNVNLKGDDMGILIGKRGQTLDSLQYLVSLVVNKSSSDYIRVKLDTENYRERRKETLETLAKNIAYKVKRTKRSVSLEPMNPYERRIIHAALQNDKYVVTRSDGEEPFRHVIISLKRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable RNA-binding protein
publication title The crystal structure of a probable RNA-binding protein from Clostridium symbiosum ATCC 14940
rcsb
source organism Clostridium symbiosum atcc 14940
molecule tags Rna binding protein
total genus 55
structure length 206
sequence length 208
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01424 R3H R3H domain
A PF13083 KH_4 KH domain
A PF14804 Jag_N Jag N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.80 Alpha Beta 2-Layer Sandwich Defensin A-like probable RNA-binding protein from clostridium symbiosum atcc 14940 3gkuA01
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 3gkuA02
3.30.1370.50 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 R3H-like domain 3gkuA03
1ML8A 4LF4C 4JI2C 1LQLA 3R9XA 4GKKC 1K0RA 3IEVA 1I94C 1MSZA 4B3MC 4XX2A 4DV4C 2BJOA 3R9WA 4B3SC 4LF9C 5BR8C 2PN2A 4DR3C 3JAMD 2HJGA 4JI3C 4NXMC 2QL8A 2F4VC 5FLXD 4JI4C 4KHPC 1HNWC 1N2FA 1XMQC 5LMUC 1JOSA 4DCSA 4YHHC 4LF8C 3IEUA 1VLAA 1ZB8A 4X66C 4LFAC 3AF5A 1FJGC 2ATWA 1PA4A 3J80D 1IBLC 2XR1A 2PT7G 2VQEC 4LF5C 1HNXC 4JYAC 2UXCC 2UUAC 1UG8A 1MKYA 4JV5C 4JI1C 4OX9C 1HNZC 3T1HC 4DUZC 4DV3C 4DV2C 1USPA 4DR2C 2ZM6C 4X64C 3J81D 4DV0C 1WHRA 1ZB9A 4X65C 1QWIA 4YY3C 4DCUA 4JI8C 2E8EA 1HR0C 5IWAC 4DCTA 4LFCC 4LFBC 2VQFC 2CY1A 2UU9C 4AQYC 2OPLA 1USPB 1KKGA 4DR7C 3I07A 4DR1C 4DV5C 2DYJA 4BSZA 4MH4A 1IBMC 4MTNA 2E8FA 3OTOC 1WH9A 4X62C 4DV1C 2UXBC 4DR4C 2ONFA 1N33C 2OPLB 4LF6C 5IT9D 2CPMA 4DUYC 4DR5C 2E5LC 3LUSA 1HH2P 1XMOC 2EGTA 2ASBA 1XNRC 1N32C 4JI0C 2HHHC 4NOZA 3T1YC 1XNQC 2E7GA 2D7VA 1WF3A 4DV7C 2UUCC 4JI7C 1J5EC 1EGAA 3CJEA 2UUBC 3GKUA 2KZFA 4DCVA 1N34C 1L2FA 4B3TC 2JMPA 1UKKA 4DV6C 4JI5C 4JI6C 4B3RC 4GKJC 4DR6C 1N36C 2YCBA 3AF6A 4LF7C 5A2QD 1NYEA 4K0KC 3EERA 2UXDC 2A1SA 2LRRA 2CXCA 4NXNC 5LMNC 1IBKC 2E8CA
chains in the Genus database with same CATH superfamily
4GKJH 4KBOA 5IT9W 2LN8A 1I94C 2D1SA 2QW9A 3PBKA 4DV4C 2UXDH 2BJOA 3E7RL 5EXWA 2KZ0A 3DHVA 4TPSB 3LDOA 4NXNH 1V25A 1HJOA 5LMNH 2E8AA 2HJGA 4JI2H 1T7EA 1MDBA 4JI4C 4KHPC 4YHHH 3SO4A 1HNWC 2V7BA 2MM9A 2BL5A 3A9UA 2CPQA 5LMUC 1JOSA 4DCSA 4B3SH 3GABA 1VLAA 1TI5A 1ZB8A 1PE4A 3OSSD 5K8FA 2HH3A 2M8WA 2YBRC 4ODJA 4DV2H 4G1IA 2ATWA 3CQ3A 2QWRA 2KBKA 1M6XA 1C56A 5IFIA 3FZMA 1B7DA 2N2RA 2P02A 1JXCA 4LF5C 4X66H 5AQQA 4L7IA 1MKYA 3E7XA 4JI1C 4JV5C 1NE5A 1HNZC 1FKAH 3FCCA 2YQRA 3KP0A 4HPVA 3M3ZA 2YIOA 2DGRA 5T8TA 4AQYH 4DUZC 1VBIA 4DV3C 3GDQA 1V26A 4DV5H 4DR1H 1WHRA 5AE2A 1O93A 1YUWA 1T5HX 4X65C 4JI8C 5AQOA 1WTJA 1P4EC 2UUAH 1MXBA 3A25A 5K85A 4OX9H 3ETCA 2CTKA 2GL1A 2QWNA 2JDQD 5FLXW 3KXWA 1EC6A 4LFCC 2YX1A 4LFBC 1WWNA 5BSTA 4BC9A 1N33H 3N54B 5A1IA 2UU9C 5LCIA 1USPB 2KHOA 3LDNA 4DR7C 5AQXA 1KKGA 1Z2IA 4FTFA 1HR0H 5BN9A 5IWAH 1PTXA 2NY8X 4MTNA 2GMOA 4H5TA 3GL1A 1WH9A 4EC5A 5AQHA 2M8BB 3I33A 1VEHA 3B7WA 1SEIA 4DR4C 5AQNA 3PESA 2HH2A 4IZ6A 4H8AA 2NY9X 3TR3A 1DJTA 3GR0A 5BPMA 2YC1C 4DUYC 4DR5C 4FJUA 3J7AK 3UZ0A 4DV1H 5BPNA 4JI5H 1I2VA 3L8CA 1O92A 2QVYX 4B8TA 2JZXA 3R2VA 1T0ZA 1NRBA 3SF4D 3ATUA 4OD6A 3GKUA 4UADE 1XNRH 2P2FA 4AAZA 3L6QA 3RG2A 2JE6I 2I61A 2QWMA 2B68A 1GPSA 4DCVA 1X4NA 4AEIA 2PY9A 1BA0A 4WALA 4DV7H 1I6GA 4B3TC 2UUCH 2JMPA 3KDGA 2BRZA 2VSQA 1SEGA 1XRHA 1I94H 4DV6C 4D4GA 1ODHA 4JI6C 4KTTA 2UUBH 4DR6C 4LIJA 1NH5A 4R1MA 2YCBA 3AY9A 3G7SA 2LTLA 2AYAA 2KDNA 1NGCA 5A2QD 1NGBA 4LF7C 4BA2I 5FPNA 2DPLA 3UX3A 1HNWH 3NI2A 2LRRA 1DKGD 1PG3A 2CXCA 5AQWA 4RMNA 3QI7A 2P2BA 3R9XA 4LF4C 1NGGA 1WCJA 1N36H 1KAZA 1J4WA 2OPUA 5A2QW 5BSUA 1MSZA 3QFUA 4NZRM 4B3MC 4XX2A 1ZTGA 3I0PA 1DTJA 5BPLA 2JVZA 4LF9C 4NBQA 1SNBA 1IBKH 4JI3C 3NYQA 4NXMC 2O4CA 4GKKH 4IO8A 3NYRA 4AM3A 3E7WA 1P4EA 2VY6A 5K36G 4FSVA 4GXQA 5F1XA 3EZJA 4YHHC 4LF8C 5BR8H 2PQUA 1ZZKA 3L7ZC 1OMYA 5DT9A 2LY6A 5F2RA 1FJGC 1BK8A 3C7NB 2B3CA 2MCQA 1XMQH 4JI8H 2DHMA 1IBLC 2XR1A 4RLFA 2VQEC 2QWPA 1HNXC 4PROC 4ISBA 3QFPA 3QD7X 1YJ7A 2ANNA 4JYAC 2UXCC 4LFAH 2QXLA 1UG8A 2G8YA 2WD9A 2JA9A 2BUPA 3NPDA 4OO1G 2UU9H 4FL9A 3C7NA 1NGHA 4LE5A 2QWQA 4DR7H 1WE8A 3I08A 3J81D 4DV0C 1QQMA 4DCUA 5H9UA 3KP1A 1MXCA 3T1HH 4PUIA 2YWCA 4BCAA 3J81W 4DR2H 2VQFC 2Y4OA 1WMTA 1BCGA 4OXIA 2ZM6H 4H5VA 4UAEF 2CY1A 3GR1A 2BA0A 3KHWA 3R44A 4YY3H 2QW0X 4DUYH 1GPMA 3GR5A 3FZKA 5AQFA 2CTEA 1V8CA 2D28C 2E8FA 4RM2A 3OTOC 4I9GA 2P2MA 5DV9A 1KAYA 4QMFB 2D56A 3KOXA 3FZFA 2CTFA 4R1LA 2ONFA 1NGEA 1VNBA 4B8CD 2E5LC 1IBMH 1HH2P 2LTMA 4JI0C 4X62H 4PUHA 4NOZA 3CQ2A 2KBHA 2V7ZA 4HHFA 2NN6G 1MR4A 1WF3A 4DR6H 3TUFA 1PQXA 2QWOA 4JI7C 1NXUA 4LF6H 1POIA 1XMOH 1LCIA 5KYTA 1N32H 2KGQA 3LAXA 1PX9A 1AYJA 2HHHH 2MN5A 2PROA 1V60A 1L2FA 1ZZJA 2VKCA 5BUSA 5FPEA 2BH1X 2LKBA 1J5KA 1J5EH 1ZFUA 1RY2A 4AB0A 3EQ6A 4B3RC 4GKJC 2ASCA 5C0XG 3BK3C 5BUQA 1JZBA 3AF6A 5BURA 3KOYA 1S3XA 2UXDC 4V1DC 1NYEA 4JI3H 4NXMH 5EY4A 4RLQA 1K1GA 4AIMA 4IR7A 4NXNC 4HWIA 2QNDA 4UJ0A 5LMNC 4JVYA 1AMUA 1VNAA 1ML8A 3H2TA 1LQLA 4JI2C 3V69A 1XRBA 1ZYVA 1K8BA 1LQIA 4PHTA 1X9ZA 2NCLA 2ZQEA 3UX2A 5AQUA 5ADZA 1XRAA 3IEVA 1HX1A 5LL6b 3FE1A 4HE7A 1ZZIA 4K0KH 1XS3A 2KYQA 3AEVB 3S82A 5AQSA 1GPTA 4B3SC 1FJGH 2PN2A 1PU1A 4DR3C 3JAMD 1KAXA 2P2JA 2QVZX 2QL8A 2E3UA 2K35A 1I2UA 3L56A 2Y4NA 5BSVA 4DV4H 2UXCH 3D2EB 5JEAG 2CWFA 1FUGA 3IEUA 2KPYA 4L2ZA 1NGJA 4X66C 5AE1A 3KVGA 3UOEA 1ZU3A 1QQOA 3N2QA 4JI4H 4KHPH 3LGXA 2K1HA 1T5DX 1X0AA 4G08A 5LMUH 2ZZMA 3RV2A 1S20A 3J80D 1BMRA 2PT7G 5E7QA 3D2EA 5AQRA 2X06A 2MMAB 1KV0A 5AQKA 4KYPA 2UUAC 1XRCA 1MDFA 4OX9C 3L4IA 1AN7A 4DG8A 2E88A 3T1YH 1BUPA 1L4VA 5FPMA 2G2KA 3PROC 4E9JA 4LF5H 4X64C 4G36A 1ZYWA 1ZB9A 2E2FA 2MBKA 4WS9A 1UGLA 2FMRA 1HR0C 4JI1H 1HNZH 4JV5H 3KOZA 5IWAC 3A4IA 2N66A 4ZJZA 1T7AA 1CHZA 4DCTA 4DUZH 4DV3H 2LI7A 1XRSB 1VIGA 4CQKA 1VIHA 1BA3A 4I9FA 5AQJA 3IMLA 4X65H 2OPLA 2Z51A 4K0BA 3I07A 4JI0H 3O2EA 2DYJA 5CZXA 2QWLA 1S03G 1KHMA 5AQPA 1MXAA 4LFCH 4LFBH 2VZEA 3CQ1A 3TQIA 2LJ7A 2YWBA 1LQHA 2D27A 5CZVA 4DV1C 3PSMA 5AQTA 2UXBC 1QM4A 3A26A 4D4IA 2OBVA 4EATA 2YIPA 2A7TA 5KYVA 5IT9D 2ATBA 1P00A 2ANRA 1ULTA 3LUSA 1V9NA 2EGTA 1XNRC 5BSMA 5EX5A 3T1YC 1XNQC 4BC7A 2P2QA 4BA1I 2N2QA 4L4QA 5KEIA 3D2FB 2D7VA 2M6QA 4B3RH 3A8YA 4D56A 4DV7C 2UUCC 4DR4H 3TDEA 2CTMA 2Z0SA 4NZTM 4H5RA 4PZPA 2LJMA 4DR5H 2UUBC 2QVXX 4LF8H 2KZFA 3UEBA 1OZZA 4JM1A 1DT4A 3IUCA 5AE3A 1N34C 1P0AA 3NCVA 4KTVA 3FZHA 2CTLA 3KC6A 3D2FA 2CWHA 1LQQA 1T1TA 3CQXA 1UKKA 3LNVA 2E0GA 4ZLPA 2N69A 2M5HA 3FCEA 2D1TA 1N36C 1ZVEA 3LDQA 4DR3H 1T7BA 4NDNA 5AQLA 4B3TH 1HPMA 3GPCA 2A1SA 2YILA 4UAFE 2LY5A 4DV6H 1NGFA 2MZ0A 4FUQA 1BA1A 4JI6H 1IBKC 1WT7A 2LT8A 4GKKC 1K0RA 1XHJA 3DAYA 1BRZA 4PDBA 4LF7H 3U1KA 5EVZA 1RG9A 2JNVA 3R9WA 5JRHA 1IB8A 2JEAI 5T8SA 5BR8C 3QMLA 1SN1A 1SN4A 1C55A 3SB1A 4LF4H 5BN8A 5FLXD 4R0MA 2F4VC 1N2FA 1O90A 1XMQC 4B3MH 5GTDA 4GXRA 1FLOA 4LF9H 2CU6A 4DG9A 3FAUA 5KK4A 3A9VA 4LFAC 1F0XA 1ATSA 1ZUTA 3AF5A 4X64H 2E0HA 1ATRA 1TH5A 1PA4A 1UWDA 2YEOA 2SN3A 2P20A 5AQMA 5AQIA 3VNRA 1QQNA 5A1GA 2CTJA 5FPDA 1AHOA 2ZZNA 1FH3A 3T1HC 2E3FA 1WVNA 2FFMA 2E3GA 4H5WA 2LR3A 4DV2C 1IBLH 1USPA 4DR2C 2ZM6C 2VQEH 3CW4A 1HNXH 3ATVA 3L95X 1QWIA 4YY3C 4JYAH 2E8EA 3AY0A 3JAMW 2P2RA 3LDPA 3HSCA 1O9TA 2UXBH 2OPVA 1MYNA 3CW9A 1NGAA 3VNSA 3VNQA 2MJHA 4U5YD 4DV0H 2KJAA 3OETA 4FJSA 1JZAA 4GNIA 1CN2A 2AXYA 4AQYC 3RF2A 5BSWA 1M6XC 1NRAA 5AQGA 4DV5C 4DR1C 3K6RA 1XNQH 4FUTA 1X4MA 4GS5A 4PUGA 4MH4A 4BSZA 1IBMC 5AQVA 3LDLA 2WP0C 4JVHA 4WV3A 2VQFH 1I6FA 3FZLA 4X62C 3E7UX 4G37A 3J80W 1JKZA 5AQZA 3LNOA 4RVOA 1N33C 1N34H 2OPLB 4LF6C 2CPMA 1XMOC 1N32C 2ASBA 2JEBI 3OTOH 4H5NA 3DLPX 2HHHC 5CY0A 2E7GA 3ETOA 3KOWA 4RM3A 5AR0A 4RVNA 1J5EC 3C5EA 1NGIA 1EGAA 1PG4A 3CJEA 1N4NA 3VKEA 2E5LH 3CW8X 2D1QA 5A19A 1NGDA 1NY8A 2LF0A 1TUAA 5AQYA 2D9IA 2D1RA 2KSKA 1ZVGA 5F0XA 1P7LA 3IPLA 1B3CA 2OO4A 4JI7H 1NPIA 4JI5C 2KBJA 3JXUA 4BBYA 2Y27A 4D57A 2Y3MA 4OYCA 4IFDG 2FPHX 1DQ7A 3UOWA 1ICAA 5BSRA 4K0KC 4WANA 3EERA 4OCHA 2F4VH 1I6UA 2M5OA 3KDKA 1MD9A 2E8CA
chains in the Genus database with same CATH topology
1I94C 2D1SA 3PBKA 4DV4C 2BJOA 3DHVA 4TPSB 1V25A 2HJGA 1MDBA 4JI4C 4KHPC 3SO4A 1HNWC 2V7BA 3A9UA 5LMUC 1JOSA 4DCSA 1VLAA 1ZB8A 5K8FA 4ODJA 4G1IA 2ATWA 5IFIA 2P02A 4LF5C 4L7IA 1MKYA 3E7XA 4JI1C 4JV5C 1HNZC 3FCCA 4HPVA 5T8TA 4DUZC 4DV3C 1V26A 1WHRA 5AE2A 1O93A 4X65C 1T5HX 4JI8C 1MXBA 5K85A 3ETCA 3KXWA 4LFCC 4LFBC 5BSTA 4BC9A 3N54B 5A1IA 2UU9C 1USPB 1KKGA 4DR7C 4FTFA 4MTNA 1WH9A 3B7WA 4DR4C 3PESA 4IZ6A 3GR0A 4DUYC 4DR5C 3UZ0A 3L8CA 1O92A 2QVYX 3GKUA 2P2FA 3RG2A 4DCVA 4B3TC 2JMPA 2VSQA 4DV6C 4D4GA 4JI6C 4KTTA 4DR6C 4R1MA 2YCBA 3G7SA 2AYAA 5A2QD 4LF7C 2DPLA 3NI2A 2LRRA 1PG3A 2CXCA 4RMNA 2P2BA 3R9XA 4LF4C 5BSUA 1MSZA 4B3MC 4XX2A 4LF9C 4JI3C 3NYQA 4NXMC 3NYRA 3E7WA 4GXQA 4YHHC 4LF8C 1FJGC 1IBLC 2XR1A 4RLFA 2VQEC 1HNXC 4PROC 4ISBA 1YJ7A 4JYAC 2UXCC 1UG8A 2WD9A 3NPDA 4LE5A 3I08A 3J81D 4DV0C 4DCUA 5H9UA 1MXCA 2YWCA 4BCAA 2VQFC 2Y4OA 4OXIA 2CY1A 3GR1A 3R44A 2QW0X 1GPMA 2D28C 2E8FA 4RM2A 3OTOC 4I9GA 2P2MA 5DV9A 4R1LA 2ONFA 2E5LC 1HH2P 4JI0C 4NOZA 1WF3A 3TUFA 4JI7C 1LCIA 5KYTA 3LAXA 2PROA 1L2FA 2BH1X 1RY2A 3EQ6A 4B3RC 4GKJC 5BUQA 3AF6A 5BURA 2UXDC 1NYEA 4RLQA 4IR7A 4NXNC 5LMNC 1AMUA 1ML8A 3H2TA 4JI2C 1LQLA 1XRBA 4PHTA 5ADZA 3IEVA 1XRAA 3S82A 4B3SC 2PN2A 4DR3C 3JAMD 2P2JA 2QVZX 2QL8A 2Y4NA 5BSVA 1FUGA 3IEUA 4L2ZA 4X66C 5AE1A 3N2QA 3LGXA 1T5DX 3RV2A 3J80D 2PT7G 5E7QA 2UUAC 1XRCA 1MDFA 4OX9C 1MD9A 4DG8A 3PROC 4X64C 4G36A 1ZB9A 4WS9A 1HR0C 5IWAC 3A4IA 4ZJZA 4DCTA 1BA3A 4I9FA 3IMLA 2OPLA 4K0BA 3I07A 2DYJA 5CZXA 1MXAA 2VZEA 3TQIA 2YWBA 2D27A 5CZVA 4DV1C 2UXBC 1QM4A 4D4IA 2OBVA 4EATA 5KYVA 5IT9D 1ULTA 3LUSA 2EGTA 1XNRC 5BSMA 3T1YC 1XNQC 4BC7A 2P2QA 4L4QA 5KEIA 2D7VA 4D56A 4DV7C 2UUCC 3TDEA 4PZPA 2UUBC 2QVXX 2KZFA 4JM1A 5AE3A 1N34C 4KTVA 4ZLPA 1UKKA 3LNVA 2E0GA 3FCEA 2D1TA 1N36C 4NDNA 3GPCA 2A1SA 4FUQA 1IBKC 4GKKC 1K0RA 3DAYA 1RG9A 3R9WA 5JRHA 5T8SA 5BR8C 2F4VC 5FLXD 4R0MA 1N2FA 1O90A 1XMQC 5GTDA 4GXRA 4DG9A 3A9VA 4LFAC 3AF5A 1PA4A 2P20A 3VNRA 5A1GA 3T1HC 4DV2C 1USPA 4DR2C 2ZM6C 3L95X 1QWIA 4YY3C 2E8EA 1O9TA 3CW9A 3VNSA 3VNQA 4U5YD 4AQYC 5BSWA 4DR1C 4DV5C 4FUTA 4GS5A 4BSZA 4MH4A 1IBMC 2WP0C 4WV3A 4X62C 4G37A 4RVOA 1N33C 2OPLB 4LF6C 2CPMA 1XMOC 1N32C 2ASBA 3DLPX 2HHHC 2E7GA 3ETOA 4RM3A 4RVNA 1J5EC 3C5EA 1EGAA 1PG4A 3CJEA 3CW8X 2D1QA 5A19A 2D1RA 1P7LA 3IPLA 2OO4A 4JI5C 4BBYA 2Y27A 4D57A 4OYCA 3UOWA 5BSRA 4K0KC 3EERA 5BUSA 2E8CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ML8 A;  4LF4 C;  4JI2 C;  1LQL A;  3R9X A;  4GKK C;  1K0R A;  3IEV A;  1I94 C;  1MSZ A;  4B3M C;  4XX2 A;  4DV4 C;  2BJO A;  3R9W A;  4B3S C;  4LF9 C;  5BR8 C;  2PN2 A;  4DR3 C;  3JAM D;  2HJG A;  4JI3 C;  4NXM C;  2QL8 A;  2F4V C;  5FLX D;  4JI4 C;  4KHP C;  1HNW C;  1N2F A;  1XMQ C;  5LMU C;  1JOS A;  4DCS A;  4YHH C;  4LF8 C;  3IEU A;  1VLA A;  1ZB8 A;  4X66 C;  4LFA C;  3AF5 A;  1FJG C;  2ATW A;  1PA4 A;  3J80 D;  1IBL C;  2XR1 A;  2PT7 G;  2VQE C;  4LF5 C;  1HNX C;  4JYA C;  2UXC C;  2UUA C;  1UG8 A;  1MKY A;  4JV5 C;  4JI1 C;  4OX9 C;  1HNZ C;  3T1H C;  4DUZ C;  4DV3 C;  4DV2 C;  1USP A;  4DR2 C;  2ZM6 C;  4X64 C;  3J81 D;  4DV0 C;  1WHR A;  1ZB9 A;  4X65 C;  1QWI A;  4YY3 C;  4DCU A;  4JI8 C;  2E8E A;  1HR0 C;  5IWA C;  4DCT A;  4LFC C;  4LFB C;  2VQF C;  2CY1 A;  2UU9 C;  4AQY C;  2OPL A;  1USP B;  1KKG A;  4DR7 C;  3I07 A;  4DR1 C;  4DV5 C;  2DYJ A;  4BSZ A;  4MH4 A;  1IBM C;  4MTN A;  2E8F A;  3OTO C;  1WH9 A;  4X62 C;  4DV1 C;  2UXB C;  4DR4 C;  2ONF A;  1N33 C;  2OPL B;  4LF6 C;  5IT9 D;  2CPM A;  4DUY C;  4DR5 C;  2E5L C;  3LUS A;  1HH2 P;  1XMO C;  2EGT A;  2ASB A;  1XNR C;  1N32 C;  4JI0 C;  2HHH C;  4NOZ A;  3T1Y C;  1XNQ C;  2E7G A;  2D7V A;  1WF3 A;  4DV7 C;  2UUC C;  4JI7 C;  1J5E C;  1EGA A;  3CJE A;  2UUB C;  3GKU A;  2KZF A;  4DCV A;  1N34 C;  1L2F A;  4B3T C;  2JMP A;  1UKK A;  4DV6 C;  4JI5 C;  4JI6 C;  4B3R C;  4GKJ C;  4DR6 C;  1N36 C;  2YCB A;  3AF6 A;  4LF7 C;  5A2Q D;  1NYE A;  4K0K C;  3EER A;  2UXD C;  2A1S A;  2LRR A;  2CXC A;  4NXN C;  5LMN C;  1IBK C;  2E8C A; 
#chains in the Genus database with same CATH topology
 4GKJ H;  4KBO A;  5IT9 W;  2LN8 A;  1I94 C;  2D1S A;  2QW9 A;  3PBK A;  4DV4 C;  2UXD H;  2BJO A;  3E7R L;  5EXW A;  2KZ0 A;  3DHV A;  4TPS B;  3LDO A;  4NXN H;  1V25 A;  1HJO A;  5LMN H;  2E8A A;  2HJG A;  4JI2 H;  1T7E A;  1MDB A;  4JI4 C;  4KHP C;  4YHH H;  3SO4 A;  1HNW C;  2V7B A;  2MM9 A;  2BL5 A;  3A9U A;  2CPQ A;  5LMU C;  1JOS A;  4DCS A;  4B3S H;  3GAB A;  1VLA A;  1TI5 A;  1ZB8 A;  1PE4 A;  3OSS D;  5K8F A;  2HH3 A;  2M8W A;  2YBR C;  4ODJ A;  4DV2 H;  4G1I A;  2ATW A;  3CQ3 A;  2QWR A;  2KBK A;  1M6X A;  1C56 A;  5IFI A;  3FZM A;  1B7D A;  2N2R A;  2P02 A;  1JXC A;  4LF5 C;  4X66 H;  5AQQ A;  4L7I A;  1MKY A;  3E7X A;  4JI1 C;  4JV5 C;  1NE5 A;  1HNZ C;  1FKA H;  3FCC A;  2YQR A;  3KP0 A;  4HPV A;  3M3Z A;  2YIO A;  2DGR A;  5T8T A;  4AQY H;  4DUZ C;  1VBI A;  4DV3 C;  3GDQ A;  1V26 A;  4DV5 H;  4DR1 H;  1WHR A;  5AE2 A;  1O93 A;  1YUW A;  1T5H X;  4X65 C;  4JI8 C;  5AQO A;  1WTJ A;  1P4E C;  2UUA H;  1MXB A;  3A25 A;  5K85 A;  4OX9 H;  3ETC A;  2CTK A;  2GL1 A;  2QWN A;  2JDQ D;  5FLX W;  3KXW A;  1EC6 A;  4LFC C;  2YX1 A;  4LFB C;  1WWN A;  5BST A;  4BC9 A;  1N33 H;  3N54 B;  5A1I A;  2UU9 C;  5LCI A;  1USP B;  2KHO A;  3LDN A;  4DR7 C;  5AQX A;  1KKG A;  1Z2I A;  4FTF A;  1HR0 H;  5BN9 A;  5IWA H;  1PTX A;  2NY8 X;  4MTN A;  2GMO A;  4H5T A;  3GL1 A;  1WH9 A;  4EC5 A;  5AQH A;  2M8B B;  3I33 A;  1VEH A;  3B7W A;  1SEI A;  4DR4 C;  5AQN A;  3PES A;  2HH2 A;  4IZ6 A;  4H8A A;  2NY9 X;  3TR3 A;  1DJT A;  3GR0 A;  5BPM A;  2YC1 C;  4DUY C;  4DR5 C;  4FJU A;  3J7A K;  3UZ0 A;  4DV1 H;  5BPN A;  4JI5 H;  1I2V A;  3L8C A;  1O92 A;  2QVY X;  4B8T A;  2JZX A;  3R2V A;  1T0Z A;  1NRB A;  3SF4 D;  3ATU A;  4OD6 A;  3GKU A;  4UAD E;  1XNR H;  2P2F A;  4AAZ A;  3L6Q A;  3RG2 A;  2JE6 I;  2I61 A;  2QWM A;  2B68 A;  1GPS A;  4DCV A;  1X4N A;  4AEI A;  2PY9 A;  1BA0 A;  4WAL A;  4DV7 H;  1I6G A;  4B3T C;  2UUC H;  2JMP A;  3KDG A;  2BRZ A;  2VSQ A;  1SEG A;  1XRH A;  1I94 H;  4DV6 C;  4D4G A;  1ODH A;  4JI6 C;  4KTT A;  2UUB H;  4DR6 C;  4LIJ A;  1NH5 A;  4R1M A;  2YCB A;  3AY9 A;  3G7S A;  2LTL A;  2AYA A;  2KDN A;  1NGC A;  5A2Q D;  1NGB A;  4LF7 C;  4BA2 I;  5FPN A;  2DPL A;  3UX3 A;  1HNW H;  3NI2 A;  2LRR A;  1DKG D;  1PG3 A;  2CXC A;  5AQW A;  4RMN A;  3QI7 A;  2P2B A;  3R9X A;  4LF4 C;  1NGG A;  1WCJ A;  1N36 H;  1KAZ A;  1J4W A;  2OPU A;  5A2Q W;  5BSU A;  1MSZ A;  3QFU A;  4NZR M;  4B3M C;  4XX2 A;  1ZTG A;  3I0P A;  1DTJ A;  5BPL A;  2JVZ A;  4LF9 C;  4NBQ A;  1SNB A;  1IBK H;  4JI3 C;  3NYQ A;  4NXM C;  2O4C A;  4GKK H;  4IO8 A;  3NYR A;  4AM3 A;  3E7W A;  1P4E A;  2VY6 A;  5K36 G;  4FSV A;  4GXQ A;  5F1X A;  3EZJ A;  4YHH C;  4LF8 C;  5BR8 H;  2PQU A;  1ZZK A;  3L7Z C;  1OMY A;  5DT9 A;  2LY6 A;  5F2R A;  1FJG C;  1BK8 A;  3C7N B;  2B3C A;  2MCQ A;  1XMQ H;  4JI8 H;  2DHM A;  1IBL C;  2XR1 A;  4RLF A;  2VQE C;  2QWP A;  1HNX C;  4PRO C;  4ISB A;  3QFP A;  3QD7 X;  1YJ7 A;  2ANN A;  4JYA C;  2UXC C;  4LFA H;  2QXL A;  1UG8 A;  2G8Y A;  2WD9 A;  2JA9 A;  2BUP A;  3NPD A;  4OO1 G;  2UU9 H;  4FL9 A;  3C7N A;  1NGH A;  4LE5 A;  2QWQ A;  4DR7 H;  1WE8 A;  3I08 A;  3J81 D;  4DV0 C;  1QQM A;  4DCU A;  5H9U A;  3KP1 A;  1MXC A;  3T1H H;  4PUI A;  2YWC A;  4BCA A;  3J81 W;  4DR2 H;  2VQF C;  2Y4O A;  1WMT A;  1BCG A;  4OXI A;  2ZM6 H;  4H5V A;  4UAE F;  2CY1 A;  3GR1 A;  2BA0 A;  3KHW A;  3R44 A;  4YY3 H;  2QW0 X;  4DUY H;  1GPM A;  3GR5 A;  3FZK A;  5AQF A;  2CTE A;  1V8C A;  2D28 C;  2E8F A;  4RM2 A;  3OTO C;  4I9G A;  2P2M A;  5DV9 A;  1KAY A;  4QMF B;  2D56 A;  3KOX A;  3FZF A;  2CTF A;  4R1L A;  2ONF A;  1NGE A;  1VNB A;  4B8C D;  2E5L C;  1IBM H;  1HH2 P;  2LTM A;  4JI0 C;  4X62 H;  4PUH A;  4NOZ A;  3CQ2 A;  2KBH A;  2V7Z A;  4HHF A;  2NN6 G;  1MR4 A;  1WF3 A;  4DR6 H;  3TUF A;  1PQX A;  2QWO A;  4JI7 C;  1NXU A;  4LF6 H;  1POI A;  1XMO H;  1LCI A;  5KYT A;  1N32 H;  2KGQ A;  3LAX A;  1PX9 A;  1AYJ A;  2HHH H;  2MN5 A;  2PRO A;  1V60 A;  1L2F A;  1ZZJ A;  2VKC A;  5BUS A;  5FPE A;  2BH1 X;  2LKB A;  1J5K A;  1J5E H;  1ZFU A;  1RY2 A;  4AB0 A;  3EQ6 A;  4B3R C;  4GKJ C;  2ASC A;  5C0X G;  3BK3 C;  5BUQ A;  1JZB A;  3AF6 A;  5BUR A;  3KOY A;  1S3X A;  2UXD C;  4V1D C;  1NYE A;  4JI3 H;  4NXM H;  5EY4 A;  4RLQ A;  1K1G A;  4AIM A;  4IR7 A;  4NXN C;  4HWI A;  2QND A;  4UJ0 A;  5LMN C;  4JVY A;  1AMU A;  1VNA A;  1ML8 A;  3H2T A;  1LQL A;  4JI2 C;  3V69 A;  1XRB A;  1ZYV A;  1K8B A;  1LQI A;  4PHT A;  1X9Z A;  2NCL A;  2ZQE A;  3UX2 A;  5AQU A;  5ADZ A;  1XRA A;  3IEV A;  1HX1 A;  5LL6 b;  3FE1 A;  4HE7 A;  1ZZI A;  4K0K H;  1XS3 A;  2KYQ A;  3AEV B;  3S82 A;  5AQS A;  1GPT A;  4B3S C;  1FJG H;  2PN2 A;  1PU1 A;  4DR3 C;  3JAM D;  1KAX A;  2P2J A;  2QVZ X;  2QL8 A;  2E3U A;  2K35 A;  1I2U A;  3L56 A;  2Y4N A;  5BSV A;  4DV4 H;  2UXC H;  3D2E B;  5JEA G;  2CWF A;  1FUG A;  3IEU A;  2KPY A;  4L2Z A;  1NGJ A;  4X66 C;  5AE1 A;  3KVG A;  3UOE A;  1ZU3 A;  1QQO A;  3N2Q A;  4JI4 H;  4KHP H;  3LGX A;  2K1H A;  1T5D X;  1X0A A;  4G08 A;  5LMU H;  2ZZM A;  3RV2 A;  1S20 A;  3J80 D;  1BMR A;  2PT7 G;  5E7Q A;  3D2E A;  5AQR A;  2X06 A;  2MMA B;  1KV0 A;  5AQK A;  4KYP A;  2UUA C;  1XRC A;  1MDF A;  4OX9 C;  3L4I A;  1AN7 A;  4DG8 A;  2E88 A;  3T1Y H;  1BUP A;  1L4V A;  5FPM A;  2G2K A;  3PRO C;  4E9J A;  4LF5 H;  4X64 C;  4G36 A;  1ZYW A;  1ZB9 A;  2E2F A;  2MBK A;  4WS9 A;  1UGL A;  2FMR A;  1HR0 C;  4JI1 H;  1HNZ H;  4JV5 H;  3KOZ A;  5IWA C;  3A4I A;  2N66 A;  4ZJZ A;  1T7A A;  1CHZ A;  4DCT A;  4DUZ H;  4DV3 H;  2LI7 A;  1XRS B;  1VIG A;  4CQK A;  1VIH A;  1BA3 A;  4I9F A;  5AQJ A;  3IML A;  4X65 H;  2OPL A;  2Z51 A;  4K0B A;  3I07 A;  4JI0 H;  3O2E A;  2DYJ A;  5CZX A;  2QWL A;  1S03 G;  1KHM A;  5AQP A;  1MXA A;  4LFC H;  4LFB H;  2VZE A;  3CQ1 A;  3TQI A;  2LJ7 A;  2YWB A;  1LQH A;  2D27 A;  5CZV A;  4DV1 C;  3PSM A;  5AQT A;  2UXB C;  1QM4 A;  3A26 A;  4D4I A;  2OBV A;  4EAT A;  2YIP A;  2A7T A;  5KYV A;  5IT9 D;  2ATB A;  1P00 A;  2ANR A;  1ULT A;  3LUS A;  1V9N A;  2EGT A;  1XNR C;  5BSM A;  5EX5 A;  3T1Y C;  1XNQ C;  4BC7 A;  2P2Q A;  4BA1 I;  2N2Q A;  4L4Q A;  5KEI A;  3D2F B;  2D7V A;  2M6Q A;  4B3R H;  3A8Y A;  4D56 A;  4DV7 C;  2UUC C;  4DR4 H;  3TDE A;  2CTM A;  2Z0S A;  4NZT M;  4H5R A;  4PZP A;  2LJM A;  4DR5 H;  2UUB C;  2QVX X;  4LF8 H;  2KZF A;  3UEB A;  1OZZ A;  4JM1 A;  1DT4 A;  3IUC A;  5AE3 A;  1N34 C;  1P0A A;  3NCV A;  4KTV A;  3FZH A;  2CTL A;  3KC6 A;  3D2F A;  2CWH A;  1LQQ A;  1T1T A;  3CQX A;  1UKK A;  3LNV A;  2E0G A;  4ZLP A;  2N69 A;  2M5H A;  3FCE A;  2D1T A;  1N36 C;  1ZVE A;  3LDQ A;  4DR3 H;  1T7B A;  4NDN A;  5AQL A;  4B3T H;  1HPM A;  3GPC A;  2A1S A;  2YIL A;  4UAF E;  2LY5 A;  4DV6 H;  1NGF A;  2MZ0 A;  4FUQ A;  1BA1 A;  4JI6 H;  1IBK C;  1WT7 A;  2LT8 A;  4GKK C;  1K0R A;  1XHJ A;  3DAY A;  1BRZ A;  4PDB A;  4LF7 H;  3U1K A;  5EVZ A;  1RG9 A;  2JNV A;  3R9W A;  5JRH A;  1IB8 A;  2JEA I;  5T8S A;  5BR8 C;  3QML A;  1SN1 A;  1SN4 A;  1C55 A;  3SB1 A;  4LF4 H;  5BN8 A;  5FLX D;  4R0M A;  2F4V C;  1N2F A;  1O90 A;  1XMQ C;  4B3M H;  5GTD A;  4GXR A;  1FLO A;  4LF9 H;  2CU6 A;  4DG9 A;  3FAU A;  5KK4 A;  3A9V A;  4LFA C;  1F0X A;  1ATS A;  1ZUT A;  3AF5 A;  4X64 H;  2E0H A;  1ATR A;  1TH5 A;  1PA4 A;  1UWD A;  2YEO A;  2SN3 A;  2P20 A;  5AQM A;  5AQI A;  3VNR A;  1QQN A;  5A1G A;  2CTJ A;  5FPD A;  1AHO A;  2ZZN A;  1FH3 A;  3T1H C;  2E3F A;  1WVN A;  2FFM A;  2E3G A;  4H5W A;  2LR3 A;  4DV2 C;  1IBL H;  1USP A;  4DR2 C;  2ZM6 C;  2VQE H;  3CW4 A;  1HNX H;  3ATV A;  3L95 X;  1QWI A;  4YY3 C;  4JYA H;  2E8E A;  3AY0 A;  3JAM W;  2P2R A;  3LDP A;  3HSC A;  1O9T A;  2UXB H;  2OPV A;  1MYN A;  3CW9 A;  1NGA A;  3VNS A;  3VNQ A;  2MJH A;  4U5Y D;  4DV0 H;  2KJA A;  3OET A;  4FJS A;  1JZA A;  4GNI A;  1CN2 A;  2AXY A;  4AQY C;  3RF2 A;  5BSW A;  1M6X C;  1NRA A;  5AQG A;  4DV5 C;  4DR1 C;  3K6R A;  1XNQ H;  4FUT A;  1X4M A;  4GS5 A;  4PUG A;  4MH4 A;  4BSZ A;  1IBM C;  5AQV A;  3LDL A;  2WP0 C;  4JVH A;  4WV3 A;  2VQF H;  1I6F A;  3FZL A;  4X62 C;  3E7U X;  4G37 A;  3J80 W;  1JKZ A;  5AQZ A;  3LNO A;  4RVO A;  1N33 C;  1N34 H;  2OPL B;  4LF6 C;  2CPM A;  1XMO C;  1N32 C;  2ASB A;  2JEB I;  3OTO H;  4H5N A;  3DLP X;  2HHH C;  5CY0 A;  2E7G A;  3ETO A;  3KOW A;  4RM3 A;  5AR0 A;  4RVN A;  1J5E C;  3C5E A;  1NGI A;  1EGA A;  1PG4 A;  3CJE A;  1N4N A;  3VKE A;  2E5L H;  3CW8 X;  2D1Q A;  5A19 A;  1NGD A;  1NY8 A;  2LF0 A;  1TUA A;  5AQY A;  2D9I A;  2D1R A;  2KSK A;  1ZVG A;  5F0X A;  1P7L A;  3IPL A;  1B3C A;  2OO4 A;  4JI7 H;  1NPI A;  4JI5 C;  2KBJ A;  3JXU A;  4BBY A;  2Y27 A;  4D57 A;  2Y3M A;  4OYC A;  4IFD G;  2FPH X;  1DQ7 A;  3UOW A;  1ICA A;  5BSR A;  4K0K C;  4WAN A;  3EER A;  4OCH A;  2F4V H;  1I6U A;  2M5O A;  3KDK A;  1MD9 A;  2E8C A; 
#chains in the Genus database with same CATH homology
 1I94 C;  2D1S A;  3PBK A;  4DV4 C;  2BJO A;  3DHV A;  4TPS B;  1V25 A;  2HJG A;  1MDB A;  4JI4 C;  4KHP C;  3SO4 A;  1HNW C;  2V7B A;  3A9U A;  5LMU C;  1JOS A;  4DCS A;  1VLA A;  1ZB8 A;  5K8F A;  4ODJ A;  4G1I A;  2ATW A;  5IFI A;  2P02 A;  4LF5 C;  4L7I A;  1MKY A;  3E7X A;  4JI1 C;  4JV5 C;  1HNZ C;  3FCC A;  4HPV A;  5T8T A;  4DUZ C;  4DV3 C;  1V26 A;  1WHR A;  5AE2 A;  1O93 A;  4X65 C;  1T5H X;  4JI8 C;  1MXB A;  5K85 A;  3ETC A;  3KXW A;  4LFC C;  4LFB C;  5BST A;  4BC9 A;  3N54 B;  5A1I A;  2UU9 C;  1USP B;  1KKG A;  4DR7 C;  4FTF A;  4MTN A;  1WH9 A;  3B7W A;  4DR4 C;  3PES A;  4IZ6 A;  3GR0 A;  4DUY C;  4DR5 C;  3UZ0 A;  3L8C A;  1O92 A;  2QVY X;  3GKU A;  2P2F A;  3RG2 A;  4DCV A;  4B3T C;  2JMP A;  2VSQ A;  4DV6 C;  4D4G A;  4JI6 C;  4KTT A;  4DR6 C;  4R1M A;  2YCB A;  3G7S A;  2AYA A;  5A2Q D;  4LF7 C;  2DPL A;  3NI2 A;  2LRR A;  1PG3 A;  2CXC A;  4RMN A;  2P2B A;  3R9X A;  4LF4 C;  5BSU A;  1MSZ A;  4B3M C;  4XX2 A;  4LF9 C;  4JI3 C;  3NYQ A;  4NXM C;  3NYR A;  3E7W A;  4GXQ A;  4YHH C;  4LF8 C;  1FJG C;  1IBL C;  2XR1 A;  4RLF A;  2VQE C;  1HNX C;  4PRO C;  4ISB A;  1YJ7 A;  4JYA C;  2UXC C;  1UG8 A;  2WD9 A;  3NPD A;  4LE5 A;  3I08 A;  3J81 D;  4DV0 C;  4DCU A;  5H9U A;  1MXC A;  2YWC A;  4BCA A;  2VQF C;  2Y4O A;  4OXI A;  2CY1 A;  3GR1 A;  3R44 A;  2QW0 X;  1GPM A;  2D28 C;  2E8F A;  4RM2 A;  3OTO C;  4I9G A;  2P2M A;  5DV9 A;  4R1L A;  2ONF A;  2E5L C;  1HH2 P;  4JI0 C;  4NOZ A;  1WF3 A;  3TUF A;  4JI7 C;  1LCI A;  5KYT A;  3LAX A;  2PRO A;  1L2F A;  2BH1 X;  1RY2 A;  3EQ6 A;  4B3R C;  4GKJ C;  5BUQ A;  3AF6 A;  5BUR A;  2UXD C;  1NYE A;  4RLQ A;  4IR7 A;  4NXN C;  5LMN C;  1AMU A;  1ML8 A;  3H2T A;  4JI2 C;  1LQL A;  1XRB A;  4PHT A;  5ADZ A;  3IEV A;  1XRA A;  3S82 A;  4B3S C;  2PN2 A;  4DR3 C;  3JAM D;  2P2J A;  2QVZ X;  2QL8 A;  2Y4N A;  5BSV A;  1FUG A;  3IEU A;  4L2Z A;  4X66 C;  5AE1 A;  3N2Q A;  3LGX A;  1T5D X;  3RV2 A;  3J80 D;  2PT7 G;  5E7Q A;  2UUA C;  1XRC A;  1MDF A;  4OX9 C;  1MD9 A;  4DG8 A;  3PRO C;  4X64 C;  4G36 A;  1ZB9 A;  4WS9 A;  1HR0 C;  5IWA C;  3A4I A;  4ZJZ A;  4DCT A;  1BA3 A;  4I9F A;  3IML A;  2OPL A;  4K0B A;  3I07 A;  2DYJ A;  5CZX A;  1MXA A;  2VZE A;  3TQI A;  2YWB A;  2D27 A;  5CZV A;  4DV1 C;  2UXB C;  1QM4 A;  4D4I A;  2OBV A;  4EAT A;  5KYV A;  5IT9 D;  1ULT A;  3LUS A;  2EGT A;  1XNR C;  5BSM A;  3T1Y C;  1XNQ C;  4BC7 A;  2P2Q A;  4L4Q A;  5KEI A;  2D7V A;  4D56 A;  4DV7 C;  2UUC C;  3TDE A;  4PZP A;  2UUB C;  2QVX X;  2KZF A;  4JM1 A;  5AE3 A;  1N34 C;  4KTV A;  4ZLP A;  1UKK A;  3LNV A;  2E0G A;  3FCE A;  2D1T A;  1N36 C;  4NDN A;  3GPC A;  2A1S A;  4FUQ A;  1IBK C;  4GKK C;  1K0R A;  3DAY A;  1RG9 A;  3R9W A;  5JRH A;  5T8S A;  5BR8 C;  2F4V C;  5FLX D;  4R0M A;  1N2F A;  1O90 A;  1XMQ C;  5GTD A;  4GXR A;  4DG9 A;  3A9V A;  4LFA C;  3AF5 A;  1PA4 A;  2P20 A;  3VNR A;  5A1G A;  3T1H C;  4DV2 C;  1USP A;  4DR2 C;  2ZM6 C;  3L95 X;  1QWI A;  4YY3 C;  2E8E A;  1O9T A;  3CW9 A;  3VNS A;  3VNQ A;  4U5Y D;  4AQY C;  5BSW A;  4DR1 C;  4DV5 C;  4FUT A;  4GS5 A;  4BSZ A;  4MH4 A;  1IBM C;  2WP0 C;  4WV3 A;  4X62 C;  4G37 A;  4RVO A;  1N33 C;  2OPL B;  4LF6 C;  2CPM A;  1XMO C;  1N32 C;  2ASB A;  3DLP X;  2HHH C;  2E7G A;  3ETO A;  4RM3 A;  4RVN A;  1J5E C;  3C5E A;  1EGA A;  1PG4 A;  3CJE A;  3CW8 X;  2D1Q A;  5A19 A;  2D1R A;  1P7L A;  3IPL A;  2OO4 A;  4JI5 C;  4BBY A;  2Y27 A;  4D57 A;  4OYC A;  3UOW A;  5BSR A;  4K0K C;  3EER A;  5BUS A;  2E8C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...