3GKUA

Crystal structure of a probable rna-binding protein from clostridium symbiosum atcc 14940
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
208
structure length
206
Chain Sequence
MDMVTVTAKTVEEAVTKALIELQTTSDKLTYEIVEKGSAGFIGSKPAIIRAKRKETLQDKAIEFLEQVFDAMNMAVDISVEYNETEKEMNVNLKGDDMGILIGKRGQTLDSLQYLVSLVVNKSSSDYIRVKLDTENYRERRKETLETLAKNIAYKVKRTKRSVSLEPMNPYERRIIHAALQNDKYVVTRSDGEEPFRHVIISLKRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords Probable RNA-binding protein
publication title The crystal structure of a probable RNA-binding protein from Clostridium symbiosum ATCC 14940
rcsb
source organism Clostridium symbiosum atcc 14940
total genus 55
structure length 206
sequence length 208
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01424 R3H R3H domain
A PF13083 KH_4 KH domain
A PF14804 Jag_N Jag N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.80 Alpha Beta 2-Layer Sandwich Defensin A-like probable RNA-binding protein from clostridium symbiosum atcc 14940 3gkuA01
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 3gkuA02
3.30.1370.50 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 R3H-like domain 3gkuA03
1LQLA 4DUYC 5IT9D 5LMNC 1J5EC 4NXMC 1N36C 4DCVA 1N2FA 4NOZA 4DR2C 4LFBC 3R9XA 4LFCC 1UG8A 3IEUA 4DV7C 1XMQC 2UU9C 4LFAC 4BSZA 2XR1A 4GKJC 5FLXD 1HR0C 3I07A 4JI3C 2E8CA 4LF8C 4NXNC 3T1YC 4X65C 1I94C 4JI1C 2BJOA 2UUBC 4JI0C 4JI4C 3IEVA 4DV5C 4DR4C 4B3SC 2E8EA 2VQEC 1USPB 2E5LC 4LF9C 4KHPC 1IBMC 4MH4A 2HJGA 4XX2A 2QL8A 2CXCA 4X62C 2ONFA 4B3TC 1JOSA 4JI8C 3J80D 4MTNA 1KKGA 2JMPA 4JI5C 3J81D 3T1HC 4YHHC 2VQFC 4DR6C 4K0KC 5IWAC 4X64C 1FJGC 4LF7C 2F4VC 4GKKC 4LF5C 4B3RC 2DYJA 2KZFA 4YY3C 1HH2P 4DCTA 3OTOC 2UXCC 2UUAC 4AQYC 1WH9A 3CJEA 4X66C 3EERA 2YCBA 2ZM6C 4JI2C 2E8FA 2UXBC 2UXDC 1ZB9A 4DR3C 2ATWA 4JI6C 4DCSA 2HHHC 1K0RA 4DV3C 4JI7C 1HNWC 2LRRA 4DR7C 1USPA 4DR1C 1EGAA 1N33C 3R9WA 3AF5A 3JAMD 4DCUA 4DV0C 1PA4A 1VLAA 4LF6C 2E7GA 1ML8A 4JV5C 2PN2A 4DV2C 3GKUA 2D7VA 5A2QD 4LF4C 4DV1C 2OPLB 1NYEA 1QWIA 4B3MC 2CY1A 4DV4C 4DUZC 1MSZA 2A1SA 2ASBA 1N34C 4JYAC 1IBKC 2UUCC 1WF3A 2OPLA 5LMUC 1MKYA 4OX9C 2CPMA 1HNZC 1WHRA 1L2FA 1ZB8A 4DV6C 1UKKA 1HNXC 3LUSA 4DR5C 2PT7G 1IBLC 2EGTA 3AF6A 5BR8C 1XMOC 1XNRC 1XNQC 1N32C
chains in the Genus database with same CATH superfamily
1LQIA 3GR1A 4EC5A 1EC6A 2UXBH 2QWMA 4DR3H 1QQOA 4RVOA 5CZVA 4AB0A 3C5EA 4NXMC 4DV3H 3LGXA 1N36C 4IZ6A 4DCVA 5IFIA 2NY8X 3R9XA 4H5WA 1DKGD 2MJHA 2FMRA 4H5VA 1QM4A 4JV5H 1UGLA 1K1GA 4LF4H 3CQ2A 5BSMA 2YC1C 1HR0C 3I07A 1WE8A 3OSSD 2E8CA 3UZ0A 2QW9A 5IT9W 2JA9A 1ATRA 3FZHA 1P4EC 5AQZA 5FPEA 1CHZA 3IEVA 5A19A 3GL1A 1NXUA 2HH3A 4LF9C 1XRAA 4KHPC 2KGQA 3KDKA 1MD9A 1O92A 1HNZH 4XX2A 2A7TA 4KTVA 4WALA 1MXCA 2LY6A 1IBLH 5F0XA 4LF6H 3VKEA 1HX1A 1UWDA 3NI2A 2D27A 2CTMA 2CTKA 2E0HA 3I33A 1S3XA 3D2FA 3T1HC 1BA3A 5F2RA 2KBJA 2OPUA 3UOEA 4B3MH 1RY2A 3ETOA 5AQNA 1NY8A 2CU6A 2ZZNA 4LFBH 3QMLA 1MXBA 4GKKC 4JVYA 1SEGA 2P2BA 4DV7H 1JZBA 1YUWA 4B3RC 2SN3A 1T5HX 3KOYA 1N4NA 1HH2P 3OTOC 1M6XA 4RMNA 5LCIA 3KHWA 2KJAA 2KZ0A 2M5HA 4OYCA 2P20A 4FL9A 3EZJA 5LL6b 5CY0A 3TDEA 1O90A 1PG4A 3T1YH 3QI7A 3JXUA 4UADE 5BSUA 3S82A 2Y4OA 2VY6A 4DCSA 2AYAA 4DV5H 4B3SH 2HH2A 4LIJA 2D56A 1X0AA 2LJ7A 4V1DC 5AQTA 1VNAA 1V26A 1J5EH 4DCUA 5BSWA 1LQQA 1PA4A 2LTMA 4LF6C 1NGDA 2E3UA 3KXWA 5AQMA 2PN2A 1BMRA 1B3CA 3VNRA 1ZU3A 5AE3A 3GKUA 2D7VA 5DV9A 3GABA 4JVHA 3FCCA 1GPSA 5BSTA 3L95X 4JI8H 1ICAA 2CY1A 4B3MC 4JI5H 4DV4C 4LFAH 1NE5A 5EY4A 1AN7A 4IR7A 1AHOA 1JKZA 4G1IA 4DR6H 1V60A 3FZMA 1ZTGA 1FJGH 3UX3A 4JYAC 4JI3H 3CW8X 4LF7H 4FUQA 4ZLPA 1X4MA 4LF8H 4NXNH 2F4VH 2UUCC 4X65H 4JM1A 4NDNA 4OCHA 1M6XC 2LT8A 2CPMA 2UXCH 1L2FA 1DTJA 3RV2A 4AQYH 3GDQA 2GL1A 4TPSB 5A2QW 1JXCA 2ANNA 3DAYA 3IUCA 3IMLA 4CQKA 5BR8C 4FUTA 1XNRC 4BA1I 2ZM6H 2ZZMA 5AQYA 5DT9A 3SF4D 1ZUTA 1J5EC 5AQQA 1MYNA 4L7IA 1TUAA 5AQXA 1V9NA 4HWIA 1HNWH 2P2FA 1JZAA 3AEVB 4D57A 1I6UA 4DR2C 4OO1G 1B7DA 4YHHH 2JVZA 4RLFA 4DV0H 4LFCC 1T5DX 2JEAI 3R2VA 1P4EA 1MR4A 3ETCA 4UAEF 2QNDA 4KBOA 4DV2H 4LFAC 1WCJA 4BSZA 5A1GA 3D2EA 2CTEA 4GKJC 3A26A 1ZVEA 1NGGA 1ZZIA 4JI3C 4PUGA 4LF8C 4NXNC 4WANA 1L4VA 4X65C 1IB8A 1P00A 1VNBA 2UUBC 2GMOA 1DQ7A 4JI0C 2QWRA 4JI4C 4I9GA 2BL5A 2N69A 3L56A 2YX1A 2BUPA 5E7QA 1IBKH 4L2ZA 1USPB 2DPLA 3LDPA 5AQGA 1J4WA 5GTDA 3KVGA 2E5LC 3D2FB 3FZLA 4JI7H 4DR1H 4MH4A 5FPMA 2KBHA 2HJGA 5CZXA 1SEIA 4NBQA 2Y27A 5JEAG 2QL8A 3PESA 4G37A 1WMTA 4R1MA 4L4QA 4X62C 2ATBA 5FLXW 4B3TC 3OETA 4DR5H 1ODHA 2ANRA 1XMOH 2E8AA 1JOSA 4RVNA 1KKGA 2JMPA 5F1XA 3J81D 5LMNH 4DV1H 4YHHC 1XS3A 4EATA 1MDBA 1KV0A 1MXAA 4PUIA 2P2RA 2V7BA 5AQPA 4GXRA 1KAZA 2YEOA 1AYJA 1C56A 1VBIA 3LNOA 1DT4A 3FCEA 2N2QA 1BRZA 2DYJA 4HE7A 2M5OA 3V69A 5LMUH 1V25A 4HHFA 3VNQA 3J80W 1NGBA 2YBRC 1POIA 2QXLA 2E8FA 2JDQD 2WD9A 2UXBC 2KDNA 4OXIA 4DR3C 4RM3A 2MM9A 1P0AA 3UEBA 4DV3C 4JI7C 1N32H 2LRRA 1USPA 4DR1C 2VQEH 5EVZA 3AF5A 2VSQA 2LTLA 2NCLA 2I61A 2LKBA 3CW9A 5K85A 2QWLA 3NCVA 1IBMH 4IFDG 4JV5C 2LI7A 3NPDA 1O93A 3R44A 2LR3A 4LF4C 3KP1A 3EQ6A 4D4GA 4DV1C 4GS5A 2MN5A 5AQVA 4UJ0A 1XMQH 1T7AA 1QWIA 4B8CD 1XRCA 2QVYX 2VQFH 2E3FA 2KPYA 3QFUA 1GPTA 2Z51A 2ASBA 1ULTA 5IWAH 2P2JA 5AR0A 5K36G 2P2MA 4WS9A 1PX9A 1NGFA 5BN8A 1LCIA 3O2EA 3PROC 4AAZA 5BSRA 1I94H 2E0GA 4JI1H 3JAMW 4H5TA 4LF5H 5LMUC 1MKYA 1HPMA 2LF0A 2PY9A 1NGAA 1HNZC 3PSMA 3A9VA 2M8WA 1I2UA 2UUAH 1ZB8A 2MCQA 1O9TA 1UKKA 4E9JA 3LUSA 1IBLC 2DGRA 4X66H 4G08A 4JI2H 1N32C 3CW4A 2UXDH 2V7ZA 3IPLA 1NH5A 2KHOA 4JI6H 5IT9D 2HHHH 3RF2A 3D2EB 3NYRA 2FFMA 4DR7H 1N2FA 4RM2A 4LFBC 2KSKA 5AQSA 4K0KH 1UG8A 3IEUA 3A9UA 1I6GA 4DV7C 4X64H 1NGEA 2QWQA 4G36A 1XMQC 1OZZA 2LJMA 5BSVA 3N2QA 5KYVA 1KHMA 3L7ZC 2XR1A 4GXQA 2D1QA 4YY3H 3E7XA 3T1YC 5BURA 4ODJA 2BRZA 1I94C 4JI1C 2BJOA 4AEIA 3DLPX 4DV5C 4B3SC 2E8EA 1PU1A 1YJ7A 4D4IA 3KC6A 1ZZKA 2CTJA 1CN2A 3A4IA 5AQUA 5K8FA 4UAFE 5AQJA 1N33H 1FLOA 3J7AK 4DV6H 2D1RA 5AE2A 2B3CA 2LN8A 2ONFA 2WP0C 1NGHA 1I2VA 4R1LA 2K35A 2QWNA 4ZJZA 3LDOA 3C7NB 4JI8C 4MTNA 1XNQH 4PDBA 5BPNA 4JI5C 2MBKA 4NXMH 1N36H 4DR6C 4K0KC 4X64C 2QW0X 1FJGC 4LF7C 4FTFA 1FUGA 2F4VC 2CTLA 4DUZH 4PHTA 1ZYWA 3A8YA 5KYTA 4FJSA 1T1TA 1ZFUA 3SO4A 2OO4A 2KZFA 2N66A 1RG9A 4YY3C 3LDQA 4DCTA 2UXCC 3LNVA 4AQYC 1KAXA 5JRHA 1WH9A 3TR3A 1BA0A 2ASCA 3EERA 3L4IA 2YCBA 2ZM6C 3ATUA 3DHVA 2YIOA 1HNXH 5AQOA 4H8AA 1HNWC 3QD7X 3GR5A 1EGAA 3G7SA 1N33C 5AQRA 3R9WA 1P7LA 4DUYH 2YQRA 4LF9H 1T7BA 4DV0C 1J5KA 4KHPH 1VLAA 4ISBA 1NGJA 4IO8A 3TUFA 1ML8A 1XHJA 1BK8A 3BK3C 1MDFA 3CQ3A 3QFPA 4DV2C 5A2QD 3LDNA 5AQWA 2ZQEA 3C7NA 1NYEA 3L8CA 4OD6A 2UU9H 2OBVA 3T1HH 4DUZC 2A1SA 4D56A 4WV3A 2CTFA 2M6QA 1QQNA 1PTXA 3TQIA 1IBKC 1XRSB 1WF3A 4BBYA 5C0XG 4GKKH 2OPLA 1HJOA 1X4NA 2E88A 2JEBI 2K1HA 4B3RH 1BCGA 2KYQA 3N54B 3GPCA 3UX2A 2X06A 4DR4H 5KK4A 4H5NA 1WHRA 3OTOH 1OMYA 3LDLA 2G8YA 3FZKA 1HNXC 4BA2I 4DR5C 1TH5A 1AMUA 3FAUA 2EGTA 3VNSA 1XMOC 1VEHA 1LQLA 1WTJA 4DUYC 3FE1A 3KP0A 3AY0A 3PBKA 3FZFA 1T7EA 5LMNC 1PE4A 2P2QA 4LE5A 2BA0A 5BN9A 4NOZA 2Y4NA 4R0MA 4B8TA 4FSVA 3I08A 4QMFB 2YWBA 2LY5A 2UU9C 4H5RA 1ZVGA 2CWHA 1NPIA 4BCAA 1TI5A 5FLXD 5AQFA 2FPHX 3A25A 3E7UX 2VKCA 4DV4H 1BUPA 5ADZA 3ATVA 4FJUA 4JYAH 5AQIA 4DR4C 1QQMA 2VQEC 5KEIA 2KBKA 3KOWA 2UUCH 1Z2IA 1S20A 4PUHA 2NN6G 1SN4A 3AY9A 5FPNA 1PG3A 1IBMC 3KOXA 1SNBA 1K8BA 3H2TA 2E3GA 3GR0A 1XRHA 2CXCA 1F0XA 3UOWA 1ZYVA 5BR8H 2QWPA 2OPVA 1XNRH 2JNVA 3J80D 1NGIA 2BH1X 1KAYA 2M8BB 2VQFC 1ATSA 1NRBA 5IWAC 2YIPA 1GPMA 4DR2H 2JZXA 2B68A 3E7RL 4LFCH 1N34H 3L6QA 2YILA 1XRBA 4LF5C 2DHMA 1VIHA 3KDGA 3HSCA 3M3ZA 3K6RA 5T8SA 2QVZX 4AM3A 2UUAC 4PZPA 3LAXA 4GKJH 3CJEA 2CPQA 4AIMA 4X66C 4OX9H 4BC9A 1I6FA 4NZRM 3KOZA 2Y3MA 4JI2C 4BC7A 4I9FA 2UXDC 1DJTA 2NY9X 1ZB9A 2ATWA 3J81W 2UUBH 4JI6C 4JI0H 5AQHA 3NYQA 2HHHC 4JI4H 5AE1A 1K0RA 2Z0SA 4DG9A 4DR7C 1V8CA 1LQHA 3E7WA 1BA1A 1NGCA 2E2FA 2D28C 2E5LH 4DG8A 3JAMD 2JE6I 1WWNA 2D9IA 2QWOA 3I0PA 1T0ZA 3B7WA 4K0BA 3CQ1A 2E7GA 1C55A 5H9UA 2AXYA 2D1SA 2PQUA 4NZTM 2MZ0A 5BPLA 2QVXX 1FKAH 1WT7A 4U5YD 4X62H 2D1TA 2N2RA 4B3TH 2OPLB 2O4CA 3U1KA 2MMAB 4PROC 1NRAA 4GNIA 3CQXA 2CWFA 1MSZA 2YWCA 1N34C 1HR0H 5BPMA 4RLQA 1SN1A 5EXWA 2PROA 1FH3A 3SB1A 2VZEA 3RG2A 5T8TA 1WVNA 1ZZJA 1VIGA 5AQLA 5FPDA 4OX9C 1X9ZA 5A1IA 4KYPA 5BUSA 2G2KA 4DV6C 2P02A 5BUQA 4HPVA 1PQXA 5EX5A 2PT7G 5AQKA 3AF6A 1S03G 1XNQC 4KTTA
chains in the Genus database with same CATH topology
3GR1A 4RVOA 5CZVA 3C5EA 4NXMC 3LGXA 1N36C 4IZ6A 4DCVA 5IFIA 3R9XA 1QM4A 5BSMA 1HR0C 3I07A 2E8CA 3UZ0A 3IEVA 5A19A 4LF9C 1XRAA 4KHPC 1MD9A 1O92A 4XX2A 4KTVA 1MXCA 3NI2A 2D27A 3T1HC 1BA3A 1RY2A 3ETOA 1MXBA 4GKKC 2P2BA 4B3RC 1T5HX 1HH2P 3OTOC 4RMNA 4OYCA 2P20A 3TDEA 1O90A 1PG4A 5BSUA 3S82A 2Y4OA 4DCSA 2AYAA 1V26A 4DCUA 5BSWA 1PA4A 4LF6C 3KXWA 2PN2A 3VNRA 5AE3A 3GKUA 2D7VA 5DV9A 3FCCA 5BSTA 3L95X 4B3MC 2CY1A 4DV4C 4IR7A 4G1IA 4JYAC 3CW8X 4FUQA 4ZLPA 2UUCC 4JM1A 4NDNA 2CPMA 1L2FA 3RV2A 4TPSB 3DAYA 3IMLA 5BR8C 4FUTA 1XNRC 1J5EC 4L7IA 2P2FA 4D57A 4DR2C 4RLFA 4LFCC 1T5DX 3ETCA 4LFAC 5A1GA 4BSZA 4GKJC 4JI3C 4LF8C 4NXNC 4X65C 2UUBC 4JI0C 4JI4C 4I9GA 5E7QA 4L2ZA 1USPB 2DPLA 5GTDA 2E5LC 4MH4A 2HJGA 5CZXA 2Y27A 2QL8A 3PESA 4G37A 4R1MA 4L4QA 4X62C 4B3TC 1JOSA 4RVNA 1KKGA 2JMPA 3J81D 4YHHC 4EATA 1MDBA 1MXAA 2V7BA 4GXRA 3FCEA 2DYJA 1V25A 3VNQA 2E8FA 2WD9A 2UXBC 4OXIA 4DR3C 4RM3A 4DV3C 4JI7C 2LRRA 1USPA 4DR1C 3AF5A 2VSQA 3CW9A 5K85A 4JV5C 3NPDA 1O93A 3R44A 4LF4C 3EQ6A 4D4GA 4DV1C 4GS5A 1QWIA 1XRCA 2QVYX 2ASBA 1ULTA 2P2JA 2P2MA 4WS9A 3PROC 1LCIA 5BSRA 2E0GA 5LMUC 1MKYA 1HNZC 3A9VA 1ZB8A 1O9TA 1UKKA 3LUSA 1IBLC 1N32C 3IPLA 5IT9D 3NYRA 1N2FA 4RM2A 4LFBC 1UG8A 3IEUA 3A9UA 4DV7C 4G36A 1XMQC 5BSVA 3N2QA 5KYVA 2XR1A 4GXQA 2D1QA 3E7XA 3T1YC 5BURA 4ODJA 1I94C 4JI1C 2BJOA 3DLPX 4DV5C 4B3SC 2E8EA 1YJ7A 4D4IA 3A4IA 5K8FA 2D1RA 5AE2A 2ONFA 2WP0C 4R1LA 4ZJZA 4JI8C 4MTNA 4JI5C 4DR6C 4K0KC 4X64C 2QW0X 1FJGC 4LF7C 4FTFA 1FUGA 2F4VC 4PHTA 5KYTA 3SO4A 2OO4A 2KZFA 1RG9A 4YY3C 4DCTA 2UXCC 3LNVA 4AQYC 5JRHA 1WH9A 3EERA 2YCBA 2ZM6C 3DHVA 1HNWC 1EGAA 3G7SA 1N33C 3R9WA 1P7LA 4DV0C 1VLAA 4ISBA 3TUFA 1ML8A 1MDFA 4DV2C 5A2QD 1NYEA 3L8CA 2OBVA 4DUZC 2A1SA 4D56A 4WV3A 3TQIA 1IBKC 1WF3A 4BBYA 2OPLA 3N54B 3GPCA 1WHRA 1HNXC 4DR5C 1AMUA 2EGTA 1XMOC 3VNSA 1LQLA 4DUYC 3PBKA 5LMNC 2P2QA 4LE5A 4NOZA 2Y4NA 4R0MA 3I08A 2YWBA 2UU9C 4BCAA 5FLXD 5ADZA 4DR4C 2VQEC 5KEIA 1PG3A 1IBMC 3H2TA 3GR0A 2CXCA 3UOWA 3J80D 2BH1X 2VQFC 5IWAC 1GPMA 4LF5C 1XRBA 5T8SA 2QVZX 2UUAC 4PZPA 3LAXA 3CJEA 4X66C 4BC9A 4JI2C 4BC7A 4I9FA 2UXDC 1ZB9A 2ATWA 4JI6C 3NYQA 2HHHC 5AE1A 1K0RA 4DG9A 4DR7C 3E7WA 2D28C 4DG8A 3JAMD 3B7WA 4K0BA 2E7GA 5H9UA 2D1SA 2QVXX 4U5YD 2D1TA 2OPLB 4PROC 1MSZA 2YWCA 1N34C 4RLQA 2PROA 2VZEA 3RG2A 5T8TA 4OX9C 5A1IA 5BUSA 4DV6C 2P02A 5BUQA 4HPVA 2PT7G 3AF6A 1XNQC 4KTTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LQL A;  4DUY C;  5IT9 D;  5LMN C;  1J5E C;  4NXM C;  1N36 C;  4DCV A;  1N2F A;  4NOZ A;  4DR2 C;  4LFB C;  3R9X A;  4LFC C;  1UG8 A;  3IEU A;  4DV7 C;  1XMQ C;  2UU9 C;  4LFA C;  4BSZ A;  2XR1 A;  4GKJ C;  5FLX D;  1HR0 C;  3I07 A;  4JI3 C;  2E8C A;  4LF8 C;  4NXN C;  3T1Y C;  4X65 C;  1I94 C;  4JI1 C;  2BJO A;  2UUB C;  4JI0 C;  4JI4 C;  3IEV A;  4DV5 C;  4DR4 C;  4B3S C;  2E8E A;  2VQE C;  1USP B;  2E5L C;  4LF9 C;  4KHP C;  1IBM C;  4MH4 A;  2HJG A;  4XX2 A;  2QL8 A;  2CXC A;  4X62 C;  2ONF A;  4B3T C;  1JOS A;  4JI8 C;  3J80 D;  4MTN A;  1KKG A;  2JMP A;  4JI5 C;  3J81 D;  3T1H C;  4YHH C;  2VQF C;  4DR6 C;  4K0K C;  5IWA C;  4X64 C;  1FJG C;  4LF7 C;  2F4V C;  4GKK C;  4LF5 C;  4B3R C;  2DYJ A;  2KZF A;  4YY3 C;  1HH2 P;  4DCT A;  3OTO C;  2UXC C;  2UUA C;  4AQY C;  1WH9 A;  3CJE A;  4X66 C;  3EER A;  2YCB A;  2ZM6 C;  4JI2 C;  2E8F A;  2UXB C;  2UXD C;  1ZB9 A;  4DR3 C;  2ATW A;  4JI6 C;  4DCS A;  2HHH C;  1K0R A;  4DV3 C;  4JI7 C;  1HNW C;  2LRR A;  4DR7 C;  1USP A;  4DR1 C;  1EGA A;  1N33 C;  3R9W A;  3AF5 A;  3JAM D;  4DCU A;  4DV0 C;  1PA4 A;  1VLA A;  4LF6 C;  2E7G A;  1ML8 A;  4JV5 C;  2PN2 A;  4DV2 C;  3GKU A;  2D7V A;  5A2Q D;  4LF4 C;  4DV1 C;  2OPL B;  1NYE A;  1QWI A;  4B3M C;  2CY1 A;  4DV4 C;  4DUZ C;  1MSZ A;  2A1S A;  2ASB A;  1N34 C;  4JYA C;  1IBK C;  2UUC C;  1WF3 A;  2OPL A;  5LMU C;  1MKY A;  4OX9 C;  2CPM A;  1HNZ C;  1WHR A;  1L2F A;  1ZB8 A;  4DV6 C;  1UKK A;  1HNX C;  3LUS A;  4DR5 C;  2PT7 G;  1IBL C;  2EGT A;  3AF6 A;  5BR8 C;  1XMO C;  1XNR C;  1XNQ C;  1N32 C; 
#chains in the Genus database with same CATH topology
 1LQI A;  3GR1 A;  4EC5 A;  1EC6 A;  2UXB H;  2QWM A;  4DR3 H;  1QQO A;  4RVO A;  5CZV A;  4AB0 A;  3C5E A;  4NXM C;  4DV3 H;  3LGX A;  1N36 C;  4IZ6 A;  4DCV A;  5IFI A;  2NY8 X;  3R9X A;  4H5W A;  1DKG D;  2MJH A;  2FMR A;  4H5V A;  1QM4 A;  4JV5 H;  1UGL A;  1K1G A;  4LF4 H;  3CQ2 A;  5BSM A;  2YC1 C;  1HR0 C;  3I07 A;  1WE8 A;  3OSS D;  2E8C A;  3UZ0 A;  2QW9 A;  5IT9 W;  2JA9 A;  1ATR A;  3FZH A;  1P4E C;  5AQZ A;  5FPE A;  1CHZ A;  3IEV A;  5A19 A;  3GL1 A;  1NXU A;  2HH3 A;  4LF9 C;  1XRA A;  4KHP C;  2KGQ A;  3KDK A;  1MD9 A;  1O92 A;  1HNZ H;  4XX2 A;  2A7T A;  4KTV A;  4WAL A;  1MXC A;  2LY6 A;  1IBL H;  5F0X A;  4LF6 H;  3VKE A;  1HX1 A;  1UWD A;  3NI2 A;  2D27 A;  2CTM A;  2CTK A;  2E0H A;  3I33 A;  1S3X A;  3D2F A;  3T1H C;  1BA3 A;  5F2R A;  2KBJ A;  2OPU A;  3UOE A;  4B3M H;  1RY2 A;  3ETO A;  5AQN A;  1NY8 A;  2CU6 A;  2ZZN A;  4LFB H;  3QML A;  1MXB A;  4GKK C;  4JVY A;  1SEG A;  2P2B A;  4DV7 H;  1JZB A;  1YUW A;  4B3R C;  2SN3 A;  1T5H X;  3KOY A;  1N4N A;  1HH2 P;  3OTO C;  1M6X A;  4RMN A;  5LCI A;  3KHW A;  2KJA A;  2KZ0 A;  2M5H A;  4OYC A;  2P20 A;  4FL9 A;  3EZJ A;  5LL6 b;  5CY0 A;  3TDE A;  1O90 A;  1PG4 A;  3T1Y H;  3QI7 A;  3JXU A;  4UAD E;  5BSU A;  3S82 A;  2Y4O A;  2VY6 A;  4DCS A;  2AYA A;  4DV5 H;  4B3S H;  2HH2 A;  4LIJ A;  2D56 A;  1X0A A;  2LJ7 A;  4V1D C;  5AQT A;  1VNA A;  1V26 A;  1J5E H;  4DCU A;  5BSW A;  1LQQ A;  1PA4 A;  2LTM A;  4LF6 C;  1NGD A;  2E3U A;  3KXW A;  5AQM A;  2PN2 A;  1BMR A;  1B3C A;  3VNR A;  1ZU3 A;  5AE3 A;  3GKU A;  2D7V A;  5DV9 A;  3GAB A;  4JVH A;  3FCC A;  1GPS A;  5BST A;  3L95 X;  4JI8 H;  1ICA A;  2CY1 A;  4B3M C;  4JI5 H;  4DV4 C;  4LFA H;  1NE5 A;  5EY4 A;  1AN7 A;  4IR7 A;  1AHO A;  1JKZ A;  4G1I A;  4DR6 H;  1V60 A;  3FZM A;  1ZTG A;  1FJG H;  3UX3 A;  4JYA C;  4JI3 H;  3CW8 X;  4LF7 H;  4FUQ A;  4ZLP A;  1X4M A;  4LF8 H;  4NXN H;  2F4V H;  2UUC C;  4X65 H;  4JM1 A;  4NDN A;  4OCH A;  1M6X C;  2LT8 A;  2CPM A;  2UXC H;  1L2F A;  1DTJ A;  3RV2 A;  4AQY H;  3GDQ A;  2GL1 A;  4TPS B;  5A2Q W;  1JXC A;  2ANN A;  3DAY A;  3IUC A;  3IML A;  4CQK A;  5BR8 C;  4FUT A;  1XNR C;  4BA1 I;  2ZM6 H;  2ZZM A;  5AQY A;  5DT9 A;  3SF4 D;  1ZUT A;  1J5E C;  5AQQ A;  1MYN A;  4L7I A;  1TUA A;  5AQX A;  1V9N A;  4HWI A;  1HNW H;  2P2F A;  1JZA A;  3AEV B;  4D57 A;  1I6U A;  4DR2 C;  4OO1 G;  1B7D A;  4YHH H;  2JVZ A;  4RLF A;  4DV0 H;  4LFC C;  1T5D X;  2JEA I;  3R2V A;  1P4E A;  1MR4 A;  3ETC A;  4UAE F;  2QND A;  4KBO A;  4DV2 H;  4LFA C;  1WCJ A;  4BSZ A;  5A1G A;  3D2E A;  2CTE A;  4GKJ C;  3A26 A;  1ZVE A;  1NGG A;  1ZZI A;  4JI3 C;  4PUG A;  4LF8 C;  4NXN C;  4WAN A;  1L4V A;  4X65 C;  1IB8 A;  1P00 A;  1VNB A;  2UUB C;  2GMO A;  1DQ7 A;  4JI0 C;  2QWR A;  4JI4 C;  4I9G A;  2BL5 A;  2N69 A;  3L56 A;  2YX1 A;  2BUP A;  5E7Q A;  1IBK H;  4L2Z A;  1USP B;  2DPL A;  3LDP A;  5AQG A;  1J4W A;  5GTD A;  3KVG A;  2E5L C;  3D2F B;  3FZL A;  4JI7 H;  4DR1 H;  4MH4 A;  5FPM A;  2KBH A;  2HJG A;  5CZX A;  1SEI A;  4NBQ A;  2Y27 A;  5JEA G;  2QL8 A;  3PES A;  4G37 A;  1WMT A;  4R1M A;  4L4Q A;  4X62 C;  2ATB A;  5FLX W;  4B3T C;  3OET A;  4DR5 H;  1ODH A;  2ANR A;  1XMO H;  2E8A A;  1JOS A;  4RVN A;  1KKG A;  2JMP A;  5F1X A;  3J81 D;  5LMN H;  4DV1 H;  4YHH C;  1XS3 A;  4EAT A;  1MDB A;  1KV0 A;  1MXA A;  4PUI A;  2P2R A;  2V7B A;  5AQP A;  4GXR A;  1KAZ A;  2YEO A;  1AYJ A;  1C56 A;  1VBI A;  3LNO A;  1DT4 A;  3FCE A;  2N2Q A;  1BRZ A;  2DYJ A;  4HE7 A;  2M5O A;  3V69 A;  5LMU H;  1V25 A;  4HHF A;  3VNQ A;  3J80 W;  1NGB A;  2YBR C;  1POI A;  2QXL A;  2E8F A;  2JDQ D;  2WD9 A;  2UXB C;  2KDN A;  4OXI A;  4DR3 C;  4RM3 A;  2MM9 A;  1P0A A;  3UEB A;  4DV3 C;  4JI7 C;  1N32 H;  2LRR A;  1USP A;  4DR1 C;  2VQE H;  5EVZ A;  3AF5 A;  2VSQ A;  2LTL A;  2NCL A;  2I61 A;  2LKB A;  3CW9 A;  5K85 A;  2QWL A;  3NCV A;  1IBM H;  4IFD G;  4JV5 C;  2LI7 A;  3NPD A;  1O93 A;  3R44 A;  2LR3 A;  4LF4 C;  3KP1 A;  3EQ6 A;  4D4G A;  4DV1 C;  4GS5 A;  2MN5 A;  5AQV A;  4UJ0 A;  1XMQ H;  1T7A A;  1QWI A;  4B8C D;  1XRC A;  2QVY X;  2VQF H;  2E3F A;  2KPY A;  3QFU A;  1GPT A;  2Z51 A;  2ASB A;  1ULT A;  5IWA H;  2P2J A;  5AR0 A;  5K36 G;  2P2M A;  4WS9 A;  1PX9 A;  1NGF A;  5BN8 A;  1LCI A;  3O2E A;  3PRO C;  4AAZ A;  5BSR A;  1I94 H;  2E0G A;  4JI1 H;  3JAM W;  4H5T A;  4LF5 H;  5LMU C;  1MKY A;  1HPM A;  2LF0 A;  2PY9 A;  1NGA A;  1HNZ C;  3PSM A;  3A9V A;  2M8W A;  1I2U A;  2UUA H;  1ZB8 A;  2MCQ A;  1O9T A;  1UKK A;  4E9J A;  3LUS A;  1IBL C;  2DGR A;  4X66 H;  4G08 A;  4JI2 H;  1N32 C;  3CW4 A;  2UXD H;  2V7Z A;  3IPL A;  1NH5 A;  2KHO A;  4JI6 H;  5IT9 D;  2HHH H;  3RF2 A;  3D2E B;  3NYR A;  2FFM A;  4DR7 H;  1N2F A;  4RM2 A;  4LFB C;  2KSK A;  5AQS A;  4K0K H;  1UG8 A;  3IEU A;  3A9U A;  1I6G A;  4DV7 C;  4X64 H;  1NGE A;  2QWQ A;  4G36 A;  1XMQ C;  1OZZ A;  2LJM A;  5BSV A;  3N2Q A;  5KYV A;  1KHM A;  3L7Z C;  2XR1 A;  4GXQ A;  2D1Q A;  4YY3 H;  3E7X A;  3T1Y C;  5BUR A;  4ODJ A;  2BRZ A;  1I94 C;  4JI1 C;  2BJO A;  4AEI A;  3DLP X;  4DV5 C;  4B3S C;  2E8E A;  1PU1 A;  1YJ7 A;  4D4I A;  3KC6 A;  1ZZK A;  2CTJ A;  1CN2 A;  3A4I A;  5AQU A;  5K8F A;  4UAF E;  5AQJ A;  1N33 H;  1FLO A;  3J7A K;  4DV6 H;  2D1R A;  5AE2 A;  2B3C A;  2LN8 A;  2ONF A;  2WP0 C;  1NGH A;  1I2V A;  4R1L A;  2K35 A;  2QWN A;  4ZJZ A;  3LDO A;  3C7N B;  4JI8 C;  4MTN A;  1XNQ H;  4PDB A;  5BPN A;  4JI5 C;  2MBK A;  4NXM H;  1N36 H;  4DR6 C;  4K0K C;  4X64 C;  2QW0 X;  1FJG C;  4LF7 C;  4FTF A;  1FUG A;  2F4V C;  2CTL A;  4DUZ H;  4PHT A;  1ZYW A;  3A8Y A;  5KYT A;  4FJS A;  1T1T A;  1ZFU A;  3SO4 A;  2OO4 A;  2KZF A;  2N66 A;  1RG9 A;  4YY3 C;  3LDQ A;  4DCT A;  2UXC C;  3LNV A;  4AQY C;  1KAX A;  5JRH A;  1WH9 A;  3TR3 A;  1BA0 A;  2ASC A;  3EER A;  3L4I A;  2YCB A;  2ZM6 C;  3ATU A;  3DHV A;  2YIO A;  1HNX H;  5AQO A;  4H8A A;  1HNW C;  3QD7 X;  3GR5 A;  1EGA A;  3G7S A;  1N33 C;  5AQR A;  3R9W A;  1P7L A;  4DUY H;  2YQR A;  4LF9 H;  1T7B A;  4DV0 C;  1J5K A;  4KHP H;  1VLA A;  4ISB A;  1NGJ A;  4IO8 A;  3TUF A;  1ML8 A;  1XHJ A;  1BK8 A;  3BK3 C;  1MDF A;  3CQ3 A;  3QFP A;  4DV2 C;  5A2Q D;  3LDN A;  5AQW A;  2ZQE A;  3C7N A;  1NYE A;  3L8C A;  4OD6 A;  2UU9 H;  2OBV A;  3T1H H;  4DUZ C;  2A1S A;  4D56 A;  4WV3 A;  2CTF A;  2M6Q A;  1QQN A;  1PTX A;  3TQI A;  1IBK C;  1XRS B;  1WF3 A;  4BBY A;  5C0X G;  4GKK H;  2OPL A;  1HJO A;  1X4N A;  2E88 A;  2JEB I;  2K1H A;  4B3R H;  1BCG A;  2KYQ A;  3N54 B;  3GPC A;  3UX2 A;  2X06 A;  4DR4 H;  5KK4 A;  4H5N A;  1WHR A;  3OTO H;  1OMY A;  3LDL A;  2G8Y A;  3FZK A;  1HNX C;  4BA2 I;  4DR5 C;  1TH5 A;  1AMU A;  3FAU A;  2EGT A;  3VNS A;  1XMO C;  1VEH A;  1LQL A;  1WTJ A;  4DUY C;  3FE1 A;  3KP0 A;  3AY0 A;  3PBK A;  3FZF A;  1T7E A;  5LMN C;  1PE4 A;  2P2Q A;  4LE5 A;  2BA0 A;  5BN9 A;  4NOZ A;  2Y4N A;  4R0M A;  4B8T A;  4FSV A;  3I08 A;  4QMF B;  2YWB A;  2LY5 A;  2UU9 C;  4H5R A;  1ZVG A;  2CWH A;  1NPI A;  4BCA A;  1TI5 A;  5FLX D;  5AQF A;  2FPH X;  3A25 A;  3E7U X;  2VKC A;  4DV4 H;  1BUP A;  5ADZ A;  3ATV A;  4FJU A;  4JYA H;  5AQI A;  4DR4 C;  1QQM A;  2VQE C;  5KEI A;  2KBK A;  3KOW A;  2UUC H;  1Z2I A;  1S20 A;  4PUH A;  2NN6 G;  1SN4 A;  3AY9 A;  5FPN A;  1PG3 A;  1IBM C;  3KOX A;  1SNB A;  1K8B A;  3H2T A;  2E3G A;  3GR0 A;  1XRH A;  2CXC A;  1F0X A;  3UOW A;  1ZYV A;  5BR8 H;  2QWP A;  2OPV A;  1XNR H;  2JNV A;  3J80 D;  1NGI A;  2BH1 X;  1KAY A;  2M8B B;  2VQF C;  1ATS A;  1NRB A;  5IWA C;  2YIP A;  1GPM A;  4DR2 H;  2JZX A;  2B68 A;  3E7R L;  4LFC H;  1N34 H;  3L6Q A;  2YIL A;  1XRB A;  4LF5 C;  2DHM A;  1VIH A;  3KDG A;  3HSC A;  3M3Z A;  3K6R A;  5T8S A;  2QVZ X;  4AM3 A;  2UUA C;  4PZP A;  3LAX A;  4GKJ H;  3CJE A;  2CPQ A;  4AIM A;  4X66 C;  4OX9 H;  4BC9 A;  1I6F A;  4NZR M;  3KOZ A;  2Y3M A;  4JI2 C;  4BC7 A;  4I9F A;  2UXD C;  1DJT A;  2NY9 X;  1ZB9 A;  2ATW A;  3J81 W;  2UUB H;  4JI6 C;  4JI0 H;  5AQH A;  3NYQ A;  2HHH C;  4JI4 H;  5AE1 A;  1K0R A;  2Z0S A;  4DG9 A;  4DR7 C;  1V8C A;  1LQH A;  3E7W A;  1BA1 A;  1NGC A;  2E2F A;  2D28 C;  2E5L H;  4DG8 A;  3JAM D;  2JE6 I;  1WWN A;  2D9I A;  2QWO A;  3I0P A;  1T0Z A;  3B7W A;  4K0B A;  3CQ1 A;  2E7G A;  1C55 A;  5H9U A;  2AXY A;  2D1S A;  2PQU A;  4NZT M;  2MZ0 A;  5BPL A;  2QVX X;  1FKA H;  1WT7 A;  4U5Y D;  4X62 H;  2D1T A;  2N2R A;  4B3T H;  2OPL B;  2O4C A;  3U1K A;  2MMA B;  4PRO C;  1NRA A;  4GNI A;  3CQX A;  2CWF A;  1MSZ A;  2YWC A;  1N34 C;  1HR0 H;  5BPM A;  4RLQ A;  1SN1 A;  5EXW A;  2PRO A;  1FH3 A;  3SB1 A;  2VZE A;  3RG2 A;  5T8T A;  1WVN A;  1ZZJ A;  1VIG A;  5AQL A;  5FPD A;  4OX9 C;  1X9Z A;  5A1I A;  4KYP A;  5BUS A;  2G2K A;  4DV6 C;  2P02 A;  5BUQ A;  4HPV A;  1PQX A;  5EX5 A;  2PT7 G;  5AQK A;  3AF6 A;  1S03 G;  1XNQ C;  4KTT A; 
#chains in the Genus database with same CATH homology
 3GR1 A;  4RVO A;  5CZV A;  3C5E A;  4NXM C;  3LGX A;  1N36 C;  4IZ6 A;  4DCV A;  5IFI A;  3R9X A;  1QM4 A;  5BSM A;  1HR0 C;  3I07 A;  2E8C A;  3UZ0 A;  3IEV A;  5A19 A;  4LF9 C;  1XRA A;  4KHP C;  1MD9 A;  1O92 A;  4XX2 A;  4KTV A;  1MXC A;  3NI2 A;  2D27 A;  3T1H C;  1BA3 A;  1RY2 A;  3ETO A;  1MXB A;  4GKK C;  2P2B A;  4B3R C;  1T5H X;  1HH2 P;  3OTO C;  4RMN A;  4OYC A;  2P20 A;  3TDE A;  1O90 A;  1PG4 A;  5BSU A;  3S82 A;  2Y4O A;  4DCS A;  2AYA A;  1V26 A;  4DCU A;  5BSW A;  1PA4 A;  4LF6 C;  3KXW A;  2PN2 A;  3VNR A;  5AE3 A;  3GKU A;  2D7V A;  5DV9 A;  3FCC A;  5BST A;  3L95 X;  4B3M C;  2CY1 A;  4DV4 C;  4IR7 A;  4G1I A;  4JYA C;  3CW8 X;  4FUQ A;  4ZLP A;  2UUC C;  4JM1 A;  4NDN A;  2CPM A;  1L2F A;  3RV2 A;  4TPS B;  3DAY A;  3IML A;  5BR8 C;  4FUT A;  1XNR C;  1J5E C;  4L7I A;  2P2F A;  4D57 A;  4DR2 C;  4RLF A;  4LFC C;  1T5D X;  3ETC A;  4LFA C;  5A1G A;  4BSZ A;  4GKJ C;  4JI3 C;  4LF8 C;  4NXN C;  4X65 C;  2UUB C;  4JI0 C;  4JI4 C;  4I9G A;  5E7Q A;  4L2Z A;  1USP B;  2DPL A;  5GTD A;  2E5L C;  4MH4 A;  2HJG A;  5CZX A;  2Y27 A;  2QL8 A;  3PES A;  4G37 A;  4R1M A;  4L4Q A;  4X62 C;  4B3T C;  1JOS A;  4RVN A;  1KKG A;  2JMP A;  3J81 D;  4YHH C;  4EAT A;  1MDB A;  1MXA A;  2V7B A;  4GXR A;  3FCE A;  2DYJ A;  1V25 A;  3VNQ A;  2E8F A;  2WD9 A;  2UXB C;  4OXI A;  4DR3 C;  4RM3 A;  4DV3 C;  4JI7 C;  2LRR A;  1USP A;  4DR1 C;  3AF5 A;  2VSQ A;  3CW9 A;  5K85 A;  4JV5 C;  3NPD A;  1O93 A;  3R44 A;  4LF4 C;  3EQ6 A;  4D4G A;  4DV1 C;  4GS5 A;  1QWI A;  1XRC A;  2QVY X;  2ASB A;  1ULT A;  2P2J A;  2P2M A;  4WS9 A;  3PRO C;  1LCI A;  5BSR A;  2E0G A;  5LMU C;  1MKY A;  1HNZ C;  3A9V A;  1ZB8 A;  1O9T A;  1UKK A;  3LUS A;  1IBL C;  1N32 C;  3IPL A;  5IT9 D;  3NYR A;  1N2F A;  4RM2 A;  4LFB C;  1UG8 A;  3IEU A;  3A9U A;  4DV7 C;  4G36 A;  1XMQ C;  5BSV A;  3N2Q A;  5KYV A;  2XR1 A;  4GXQ A;  2D1Q A;  3E7X A;  3T1Y C;  5BUR A;  4ODJ A;  1I94 C;  4JI1 C;  2BJO A;  3DLP X;  4DV5 C;  4B3S C;  2E8E A;  1YJ7 A;  4D4I A;  3A4I A;  5K8F A;  2D1R A;  5AE2 A;  2ONF A;  2WP0 C;  4R1L A;  4ZJZ A;  4JI8 C;  4MTN A;  4JI5 C;  4DR6 C;  4K0K C;  4X64 C;  2QW0 X;  1FJG C;  4LF7 C;  4FTF A;  1FUG A;  2F4V C;  4PHT A;  5KYT A;  3SO4 A;  2OO4 A;  2KZF A;  1RG9 A;  4YY3 C;  4DCT A;  2UXC C;  3LNV A;  4AQY C;  5JRH A;  1WH9 A;  3EER A;  2YCB A;  2ZM6 C;  3DHV A;  1HNW C;  1EGA A;  3G7S A;  1N33 C;  3R9W A;  1P7L A;  4DV0 C;  1VLA A;  4ISB A;  3TUF A;  1ML8 A;  1MDF A;  4DV2 C;  5A2Q D;  1NYE A;  3L8C A;  2OBV A;  4DUZ C;  2A1S A;  4D56 A;  4WV3 A;  3TQI A;  1IBK C;  1WF3 A;  4BBY A;  2OPL A;  3N54 B;  3GPC A;  1WHR A;  1HNX C;  4DR5 C;  1AMU A;  2EGT A;  1XMO C;  3VNS A;  1LQL A;  4DUY C;  3PBK A;  5LMN C;  2P2Q A;  4LE5 A;  4NOZ A;  2Y4N A;  4R0M A;  3I08 A;  2YWB A;  2UU9 C;  4BCA A;  5FLX D;  5ADZ A;  4DR4 C;  2VQE C;  5KEI A;  1PG3 A;  1IBM C;  3H2T A;  3GR0 A;  2CXC A;  3UOW A;  3J80 D;  2BH1 X;  2VQF C;  5IWA C;  1GPM A;  4LF5 C;  1XRB A;  5T8S A;  2QVZ X;  2UUA C;  4PZP A;  3LAX A;  3CJE A;  4X66 C;  4BC9 A;  4JI2 C;  4BC7 A;  4I9F A;  2UXD C;  1ZB9 A;  2ATW A;  4JI6 C;  3NYQ A;  2HHH C;  5AE1 A;  1K0R A;  4DG9 A;  4DR7 C;  3E7W A;  2D28 C;  4DG8 A;  3JAM D;  3B7W A;  4K0B A;  2E7G A;  5H9U A;  2D1S A;  2QVX X;  4U5Y D;  2D1T A;  2OPL B;  4PRO C;  1MSZ A;  2YWC A;  1N34 C;  4RLQ A;  2PRO A;  2VZE A;  3RG2 A;  5T8T A;  4OX9 C;  5A1I A;  5BUS A;  4DV6 C;  2P02 A;  5BUQ A;  4HPV A;  2PT7 G;  3AF6 A;  1XNQ C;  4KTT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...