3GKUA

Crystal structure of a probable rna-binding protein from clostridium symbiosum atcc 14940
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
208
structure length
206
Chain Sequence
b'MDMVTVTAKTVEEAVTKALIELQTTSDKLTYEIVEKGSAGFIGSKPAIIRAKRKETLQDKAIEFLEQVFDAMNMAVDISVEYNETEKEMNVNLKGDDMGILIGKRGQTLDSLQYLVSLVVNKSSSDYIRVKLDTENYRERRKETLETLAKNIAYKVKRTKRSVSLEPMNPYERRIIHAALQNDKYVVTRSDGEEPFRHVIISLKRE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable RNA-binding protein
publication title The crystal structure of a probable RNA-binding protein from Clostridium symbiosum ATCC 14940
rcsb
source organism Clostridium symbiosum atcc 14940
molecule tags Rna binding protein
total genus 55
structure length 206
sequence length 208
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01424 R3H R3H domain
A PF13083 KH_4 KH domain
A PF14804 Jag_N Jag N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.80 Alpha Beta 2-Layer Sandwich Defensin A-like probable RNA-binding protein from clostridium symbiosum atcc 14940 3gkuA01
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 3gkuA02
3.30.1370.50 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 R3H-like domain 3gkuA03
1HH2P 2UUCC 4LFBC 1N32C 4DR2C 2XR1A 4JI6C 4LF9C 3OTOC 2UXDC 1USPB 4DCSA 4DV2C 2E7GA 2VQEC 4DV3C 1J5EC 2CXCA 3I07A 3LUSA 4JV5C 3AF6A 2CPMA 2ASBA 1K0RA 3CJEA 4JI1C 4DV4C 5LMUC 2OPLB 3AF5A 4DR5C 1XNQC 2QL8A 4XX2A 4X65C 4DCTA 1MKYA 4GKKC 1PA4A 1IBLC 4X66C 5LMNC 1ML8A 4DCUA 4AQYC 1JOSA 3T1HC 1USPA 2UUAC 1L2FA 4JI5C 4JI4C 1HR0C 4MTNA 4JI3C 4DR3C 1XNRC 2CY1A 1XMQC 3R9WA 1IBMC 4DR1C 1LQLA 2E8FA 4YHHC 5BR8C 4B3TC 2A1SA 2OPLA 2E8CA 2UU9C 2ZM6C 2F4VC 1NYEA 4LFCC 2DYJA 4DR7C 4LF8C 1XMOC 1I94C 1ZB9A 2EGTA 2UXCC 1ZB8A 4B3RC 4JI0C 4NOZA 4LF5C 4GKJC 1IBKC 1WF3A 4K0KC 3IEVA 3R9XA 1KKGA 1WH9A 4X64C 4BSZA 1N36C 2JMPA 2HHHC 4YY3C 4KHPC 4NXNC 1VLAA 2YCBA 1N33C 3IEUA 4DCVA 2VQFC 1HNXC 2BJOA 4NXMC 1QWIA 1UG8A 4X62C 4B3SC 4LF4C 1FJGC 3J80D 4DUYC 4DR6C 4DR4C 2UUBC 1N2FA 1N34C 1HNZC 4LF7C 2UXBC 2E5LC 4MH4A 1MSZA 4LFAC 4OX9C 4DV5C 4JI7C 4B3MC 4JI2C 4DV0C 4JI8C 4DUZC 2E8EA 3JAMD 5IT9D 4LF6C 4JYAC 1HNWC 3T1YC 4DV7C 5FLXD 5A2QD 2ATWA 1UKKA 2ONFA 2PT7G 5IWAC 3EERA 1WHRA 2D7VA 2PN2A 3J81D 3GKUA 2KZFA 1EGAA 4DV1C 2HJGA 2LRRA 4DV6C
chains in the Genus database with same CATH superfamily
3NI2A 2UUCC 5C0XG 1BUPA 5AQUA 1N32C 2LR3A 1T0ZA 2P2RA 2XR1A 2AXYA 2ATBA 2D1TA 2UUBH 4FJUA 3FCCA 2E88A 4RLFA 4FSVA 3NCVA 3LDLA 2V7BA 4OO1G 1YJ7A 4WANA 4DV3C 1J5EC 2CXCA 3DLPX 3AF6A 1X4NA 2P2QA 4B3MH 1PX9A 3C5EA 2KBHA 1C56A 3TUFA 4DUZH 2QVYX 4OXIA 4FL9A 1GPSA 4H5NA 1PG3A 2QNDA 2E0HA 3D2FB 3E7WA 1ULTA 1V8CA 3HSCA 3JAMW 4PUIA 5AQHA 2ASCA 4DCUA 2GL1A 5KYTA 1LCIA 3CQ2A 5BPMA 3T1HC 4JI6H 2JE6I 3OTOH 4LF9H 4RM3A 1ODHA 4JI4C 2UXDH 1NGHA 3AY9A 2E2FA 2MMAB 4MTNA 1XNRC 1XMQC 5EXWA 5GTDA 3D2EA 5E7QA 4BA2I 2CTKA 3RV2A 5BURA 3GR5A 4YHHC 2OPLA 5F2RA 1QQOA 3UX2A 4FJSA 1I6FA 1NYEA 1HPMA 5CZXA 2ZZNA 4OCHA 2DYJA 3A4IA 5LMUH 1OZZA 2E3UA 3EQ6A 4DR5H 4LE5A 5DV9A 2Y3MA 3A8YA 5FPMA 4X65H 2LN8A 1ZB8A 2LY5A 1KAYA 3UOEA 3CW4A 4E9JA 1AMUA 2ZZMA 1KHMA 5AQQA 3KP0A 2VKCA 2YQRA 1KKGA 1WH9A 4X64C 2KYQA 4X64H 4JI3H 3L56A 5AQNA 3A25A 2P2JA 1J4WA 4ZJZA 1V26A 2LT8A 5ADZA 3K6RA 3LGXA 4B3TH 5EY4A 4X62C 4V1DC 4B3SC 4LF4C 1MYNA 1FJGC 1NGGA 3J80D 2OPUA 4LF8H 1NGJA 1HNZC 1S03G 4FTFA 5EVZA 3ETCA 3UOWA 1XMOH 2QWQA 5K36G 4MH4A 2UXCH 4JVYA 1MSZA 5AE3A 2N2RA 2E3FA 5BSUA 1OMYA 4LF5H 3EZJA 4NZTM 1ZVGA 4JI2C 3VKEA 1I6UA 2YWBA 4CQKA 5IT9D 4LF6C 4JYAC 1HNWC 1ZZJA 4JI2H 4DV7C 2B3CA 4JYAH 3LDPA 3ATVA 2ONFA 4KBOA 1ZUTA 2MBKA 2A7TA 2YC1C 2PN2A 1N4NA 1N36H 1NRBA 3J81D 4YY3H 2PQUA 5AQVA 5BN8A 5AQZA 1N33H 1ZVEA 2D56A 3NPDA 4DV6C 3QFUA 1HH2P 4NXMH 5BSVA 1ATRA 4IR7A 5BN9A 4DR2C 2MN5A 1DTJA 2CPQA 5AQSA 2QW0X 5AQWA 2LY6A 3A26A 4HWIA 4EC5A 1KV0A 2Y4OA 2E7GA 2LI7A 3O2EA 4KTTA 4K0BA 1FLOA 5FPDA 1XRBA 2NN6G 3LUSA 4BBYA 2O4CA 4JV5C 1PQXA 4DV5H 2YX1A 1V9NA 2CPMA 3KHWA 1NGDA 4JV5H 5T8SA 3CQ3A 1QQMA 1AYJA 2HH2A 2X06A 3CJEA 4JI1C 1X9ZA 3T1YH 3L95X 2KPYA 4JI1H 1XRAA 1T5DX 2YILA 1XNQC 2PROA 2QL8A 3N54B 4L7IA 1SN1A 3C7NA 1WT7A 3KOWA 4DCTA 3RG2A 3CQXA 4X66C 5LMNC 3FZFA 2UUCH 1ML8A 5FLXW 2MZ0A 1N32H 5LMNH 1NXUA 2Z0SA 2P2BA 5AR0A 1L2FA 4G36A 4JI5C 1NY8A 1O9TA 3GDQA 1TH5A 3FE1A 1HR0C 1CHZA 3KP1A 5CZVA 4NBQA 4DR3C 1JXCA 2V7ZA 2CY1A 5AE2A 1IBMC 3KOXA 1WVNA 1TUAA 3I0PA 3L7ZC 4DV3H 3NYRA 1J5EH 4DR1C 2DGRA 2WD9A 2A1SA 5BUSA 2M5OA 3LDQA 2E8CA 2CTMA 2D1QA 3TR3A 1XRSB 5AQJA 3UX3A 4DR7C 3D2FA 2DHMA 1XS3A 4G1IA 1T7EA 1I94C 2OPVA 1UGLA 3KVGA 2EGTA 4JI0C 4GKJC 1IBKC 3L4IA 4JI0H 1WF3A 3BK3C 3IUCA 2BH1X 3KOZA 4K0KC 1WMTA 1O93A 1K1GA 4GKJH 1NH5A 2ZQEA 2PY9A 3T1HH 3IEVA 1I6GA 1QM4A 2MCQA 1NGAA 1KAXA 4OYCA 5BSWA 4JI4H 1MXCA 4HE7A 2NY8X 1XNRH 1SN4A 2CU6A 1VLAA 1XMQH 1HNXC 1WWNA 2BJOA 2YIPA 1DKGD 1UG8A 4YHHH 5AQMA 4B8CD 4AB0A 3TQIA 3SB1A 4UAFE 4FUTA 2MM9A 2KSKA 1N2FA 1YUWA 2NCLA 1ZU3A 4LF7C 2UXBC 3UEBA 1MXAA 4OX9C 1BA0A 4KTVA 3S82A 4JI7C 2KHOA 3GPCA 4DV0C 4JI8C 2KZ0A 5KK4A 2QWLA 5K85A 4BCAA 5A2QD 4PZPA 4RVOA 1UKKA 5F1XA 5IWAC 1FUGA 1I2VA 2M8WA 1J5KA 3VNSA 5IWAH 3DAYA 3FAUA 4JM1A 4WV3A 2D27A 5LL6b 2YWCA 2Y4NA 1BA3A 3H2TA 4DV1C 5DT9A 1ZFUA 2VZEA 3GR1A 4LFBC 4NZRM 1DT4A 1K8BA 2LJ7A 4X62H 4PDBA 1P7LA 4B3SH 4PUGA 4LF4H 4LFBH 4DG8A 1FJGH 2CTJA 4IZ6A 1HNZH 1SEGA 1USPB 4DCSA 4DV2C 5AQFA 5AQKA 1P00A 1BCGA 2VQEC 2CTLA 3QMLA 4DV2H 2D9IA 2VQEH 2QXLA 3KOYA 2FPHX 1L4VA 3ATUA 2LJMA 4LF6H 3L6QA 1HNWH 4AEIA 2QWPA 1O90A 1RY2A 2JZXA 4DV7H 4DV4C 3PSMA 3I08A 3DHVA 5BSRA 2CTEA 1V60A 1MXBA 3M3ZA 1MKYA 4GKKC 4PROC 1PA4A 3QI7A 3QD7X 2CTFA 1XHJA 1IBLC 5IT9W 3AEVB 4DV6H 4GKKH 4H5VA 2QVZX 4AQYC 4ODJA 5BUQA 1JOSA 4DR2H 1RG9A 4GXRA 2UUAC 4RLQA 1P0AA 4QMFB 3J81W 4IO8A 4L4QA 5AQXA 3J7AK 2P2FA 4D56A 3R9WA 1ATSA 5BSMA 2JDQD 2WP0C 4JVHA 2P2MA 1LQLA 1MDFA 1GPMA 4WS9A 5AQTA 3N2QA 3QFPA 3LDNA 2ZM6C 2E3GA 5AQOA 2UU9C 4LFCC 3FZMA 4BC7A 2F4VC 4DV0H 4L2ZA 2DPLA 1B3CA 3GR0A 1XNQH 2E8AA 4GNIA 1ZB9A 1ZYWA 3PROC 3V69A 3E7XA 1PE4A 4D4GA 4B3RC 2FFMA 4NOZA 4DG9A 2BA0A 4GS5A 4PHTA 5JEAG 1PU1A 2HH3A 4X66H 1FH3A 2JEBI 1C55A 1NGFA 5AQGA 4IFDG 2ANNA 3FZHA 3FZLA 2D28C 5AQYA 3A9VA 1ZTGA 3LAXA 3KDKA 1DJTA 4JI5H 4I9GA 1GPTA 3CW9A 2HHHC 5A19A 1P4EC 2VY6A 1HR0H 1HX1A 4KHPC 4DR3H 4NXNC 4KHPH 3IEUA 1IBMH 2VQFC 2LTLA 1BMRA 1Z2IA 2E0GA 4DR1H 1NPIA 5BPNA 2SN3A 3C7NB 2KJAA 5A1IA 4D4IA 2G8YA 4DR6C 3FZKA 4DR7H 3TDEA 2UUBC 3SF4D 1N34C 4DR6H 2QWMA 2OBVA 3L8CA 1N34H 1I94H 1VNBA 5FPEA 4HPVA 1EC6A 3SO4A 1MR4A 1NGCA 1B7DA 5T8TA 4BA1I 1IBKH 2N2QA 4B3MC 1PG4A 4DUZC 2P20A 3JAMD 4K0KH 1X4MA 1ZYVA 2ATWA 5AQPA 5JRHA 3NYQA 5KEIA 2D7VA 2FMRA 4UAEF 2QWNA 2Z51A 3GKUA 2JNVA 2NY9X 2K1HA 2KZFA 1EGAA 1WE8A 1BRZA 1VEHA 2LF0A 2HJGA 4FUQA 2BL5A 2LRRA 4LIJA 1HNXH 1KAZA 1HJOA 1SEIA 2K35A 1T5HX 4U5YD 3AY0A 2KGQA 3RF2A 4JI6C 1I2UA 3CQ1A 1CN2A 3OTOC 4LF9C 1X0AA 2VQFH 1NGBA 1T1TA 5AE1A 1MDBA 4PUHA 3KXWA 4G08A 1S3XA 2UXDC 5AQRA 3ETOA 4LF7H 2UXBH 3LNOA 3I07A 1FKAH 4OX9H 3E7UX 4JI7H 2ASBA 4JI8H 1K0RA 1V25A 4NDNA 1SNBA 2KBKA 2VSQA 2CWHA 2D1SA 2JVZA 3LNVA 3D2EB 3KDGA 3R44A 4AM3A 2M6QA 4R1LA 1F0XA 5LMUC 2OO4A 2OPLB 3I33A 3R2VA 4UADE 3AF5A 3CW8X 4DR5C 4KYPA 1XRHA 3KC6A 4R1MA 4XX2A 1WCJA 4X65C 2MJHA 2BUPA 2M5HA 1UWDA 4G37A 4DV1H 5KYVA 1ICAA 2Y27A 4H5RA 1POIA 3JXUA 5A2QW 3FCEA 2AYAA 1WTJA 1NGEA 1USPA 2BRZA 1AHOA 4HHFA 1NE5A 5IFIA 3U1KA 3PBKA 4JI3C 3GABA 4AIMA 4GXQA 2YEOA 5EX5A 5FPNA 1LQIA 5K8FA 2G2KA 5BPLA 2QVXX 2D1RA 4ISBA 3J80W 2ANRA 2E8FA 2KDNA 5BR8C 4B3TC 3A9UA 5H9UA 2CWFA 3G7SA 5BR8H 5LCIA 1M6XA 4DV4H 1VIHA 1JZAA 4LF8C 2LTMA 1BA1A 3VNQA 1XMOC 2QW9A 2JEAI 4RMNA 2UXCC 1T7AA 5BSTA 1P4EA 1NGIA 4D57A 4R0MA 4LF5C 1IBLH 1AN7A 1VIGA 4AQYH 3GL1A 1T7BA 1QQNA 2N66A 4TPSB 1VBIA 3R9XA 2UUAH 5CY0A 4AAZA 4H5TA 2I61A 4BSZA 2JMPA 1N36C 3IMLA 4YY3C 1LQQA 4I9FA 2LKBA 2P02A 3E7RL 2KBJA 2YBRC 2YCBA 1N33C 3OSSD 4DCVA 1IB8A 1NRAA 5A1GA 4NXMC 2YIOA 5AQLA 1QWIA 1XRCA 2QWOA 1JZBA 2UU9H 2ZM6H 2F4VH 4LFCH 5F0XA 4H5WA 4DUYC 2M8BB 4DR4C 4OD6A 2N69A 3B7WA 4DUYH 3VNRA 4RVNA 4DR4H 4ZLPA 1ZZIA 2E5LC 3UZ0A 1DQ7A 3PESA 3OETA 4UJ0A 1S20A 4B8TA 2B68A 4LFAC 2E5LH 4B3RH 1O92A 4DV5C 1M6XC 3LDOA 4RM2A 4BC9A 1MD9A 4LFAH 2GMOA 1JKZA 2E8EA 4EATA 4H8AA 2QWRA 3T1YC 5FLXD 1PTXA 3IPLA 2PT7G 1VNAA 1TI5A 3EERA 1WHRA 5AQIA 2HHHH 1LQHA 1BK8A 4NXNH 2JA9A 1ZZKA 4WALA
chains in the Genus database with same CATH topology
3NI2A 2UUCC 1N32C 2XR1A 2D1TA 3FCCA 4RLFA 2V7BA 1YJ7A 4DV3C 1J5EC 2CXCA 3DLPX 3AF6A 2P2QA 3TUFA 3C5EA 2QVYX 4OXIA 1PG3A 3E7WA 1ULTA 4DCUA 5KYTA 1LCIA 3T1HC 4RM3A 4JI4C 4MTNA 1XNRC 1XMQC 5GTDA 5E7QA 3RV2A 5BURA 4YHHC 2OPLA 5CZXA 1NYEA 2DYJA 3A4IA 3EQ6A 4LE5A 5DV9A 1ZB8A 1AMUA 1KKGA 1WH9A 4X64C 2P2JA 4ZJZA 1V26A 5ADZA 3LGXA 4X62C 4B3SC 4LF4C 1FJGC 3J80D 1HNZC 4FTFA 3ETCA 3UOWA 4MH4A 1MSZA 5AE3A 5BSUA 4JI2C 2YWBA 4LF6C 5IT9D 4JYAC 1HNWC 4DV7C 2ONFA 2PN2A 3J81D 3NPDA 4DV6C 1HH2P 5BSVA 4IR7A 4DR2C 2QW0X 2Y4OA 2E7GA 4KTTA 4K0BA 1XRBA 3LUSA 4BBYA 4JV5C 2CPMA 5T8SA 3CJEA 4JI1C 3L95X 1XRAA 1T5DX 1XNQC 2PROA 2QL8A 3N54B 4L7IA 4DCTA 3RG2A 4X66C 5LMNC 1ML8A 2P2BA 1L2FA 4G36A 4JI5C 1O9TA 1HR0C 5CZVA 4DR3C 2CY1A 5AE2A 1IBMC 3NYRA 4DR1C 2WD9A 2A1SA 5BUSA 2E8CA 2D1QA 4DR7C 4G1IA 1I94C 2EGTA 4JI0C 4GKJC 1IBKC 1WF3A 2BH1X 4K0KC 1O93A 3IEVA 1QM4A 4OYCA 5BSWA 1MXCA 1VLAA 1HNXC 2BJOA 1UG8A 3TQIA 4FUTA 1N2FA 4LF7C 2UXBC 1MXAA 4OX9C 4KTVA 3S82A 4JI7C 3GPCA 4DV0C 4JI8C 5K85A 4BCAA 5A2QD 4PZPA 4RVOA 1UKKA 5IWAC 1FUGA 3VNSA 3DAYA 4JM1A 4WV3A 2D27A 2YWCA 2Y4NA 4DV1C 1BA3A 3H2TA 2VZEA 3GR1A 4LFBC 1P7LA 4DG8A 4IZ6A 1USPB 4DCSA 4DV2C 2VQEC 1O90A 1RY2A 4DV4C 3I08A 3DHVA 5BSRA 1MXBA 1MKYA 4GKKC 4PROC 1PA4A 1IBLC 2QVZX 4AQYC 4ODJA 5BUQA 1JOSA 1RG9A 4GXRA 2UUAC 4RLQA 4L4QA 2P2FA 4D56A 3R9WA 5BSMA 2WP0C 2P2MA 1LQLA 1MDFA 1GPMA 4WS9A 3N2QA 2ZM6C 2UU9C 2F4VC 4LFCC 4BC7A 4L2ZA 2DPLA 3GR0A 1ZB9A 3PROC 3E7XA 4D4GA 4B3RC 4NOZA 4DG9A 4GS5A 4PHTA 2D28C 3A9VA 3LAXA 4I9GA 3CW9A 2HHHC 5A19A 4KHPC 4NXNC 3IEUA 2VQFC 2E0GA 5A1IA 4D4IA 4DR6C 3TDEA 2UUBC 1N34C 2OBVA 3L8CA 4HPVA 3SO4A 5T8TA 4B3MC 1PG4A 4DUZC 2P20A 3JAMD 2ATWA 5JRHA 3NYQA 5KEIA 2D7VA 3GKUA 2KZFA 1EGAA 2HJGA 4FUQA 2LRRA 1T5HX 4U5YD 4JI6C 4LF9C 3OTOC 5AE1A 1MDBA 3KXWA 2UXDC 3ETOA 3I07A 2ASBA 1K0RA 1V25A 4NDNA 2VSQA 2D1SA 3LNVA 3R44A 4R1LA 5LMUC 2OO4A 2OPLB 3CW8X 3AF5A 4DR5C 4R1MA 4XX2A 4X65C 4G37A 5KYVA 2Y27A 3FCEA 2AYAA 1USPA 5IFIA 3PBKA 4JI3C 4GXQA 5K8FA 2QVXX 2D1RA 4ISBA 2E8FA 5BR8C 4B3TC 3A9UA 5H9UA 3G7SA 4LF8C 3VNQA 1XMOC 4RMNA 2UXCC 5BSTA 4D57A 4R0MA 4LF5C 4TPSB 3R9XA 4BSZA 1N36C 2JMPA 3IMLA 4YY3C 4I9FA 2P02A 2YCBA 1N33C 4DCVA 5A1GA 4NXMC 1QWIA 1XRCA 4DUYC 4DR4C 3B7WA 3VNRA 4RVNA 4ZLPA 2E5LC 3UZ0A 3PESA 4LFAC 1O92A 4DV5C 4RM2A 4BC9A 1MD9A 2E8EA 4EATA 3T1YC 5FLXD 3IPLA 2PT7G 3EERA 1WHRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HH2 P;  2UUC C;  4LFB C;  1N32 C;  4DR2 C;  2XR1 A;  4JI6 C;  4LF9 C;  3OTO C;  2UXD C;  1USP B;  4DCS A;  4DV2 C;  2E7G A;  2VQE C;  4DV3 C;  1J5E C;  2CXC A;  3I07 A;  3LUS A;  4JV5 C;  3AF6 A;  2CPM A;  2ASB A;  1K0R A;  3CJE A;  4JI1 C;  4DV4 C;  5LMU C;  2OPL B;  3AF5 A;  4DR5 C;  1XNQ C;  2QL8 A;  4XX2 A;  4X65 C;  4DCT A;  1MKY A;  4GKK C;  1PA4 A;  1IBL C;  4X66 C;  5LMN C;  1ML8 A;  4DCU A;  4AQY C;  1JOS A;  3T1H C;  1USP A;  2UUA C;  1L2F A;  4JI5 C;  4JI4 C;  1HR0 C;  4MTN A;  4JI3 C;  4DR3 C;  1XNR C;  2CY1 A;  1XMQ C;  3R9W A;  1IBM C;  4DR1 C;  1LQL A;  2E8F A;  4YHH C;  5BR8 C;  4B3T C;  2A1S A;  2OPL A;  2E8C A;  2UU9 C;  2ZM6 C;  2F4V C;  1NYE A;  4LFC C;  2DYJ A;  4DR7 C;  4LF8 C;  1XMO C;  1I94 C;  1ZB9 A;  2EGT A;  2UXC C;  1ZB8 A;  4B3R C;  4JI0 C;  4NOZ A;  4LF5 C;  4GKJ C;  1IBK C;  1WF3 A;  4K0K C;  3IEV A;  3R9X A;  1KKG A;  1WH9 A;  4X64 C;  4BSZ A;  1N36 C;  2JMP A;  2HHH C;  4YY3 C;  4KHP C;  4NXN C;  1VLA A;  2YCB A;  1N33 C;  3IEU A;  4DCV A;  2VQF C;  1HNX C;  2BJO A;  4NXM C;  1QWI A;  1UG8 A;  4X62 C;  4B3S C;  4LF4 C;  1FJG C;  3J80 D;  4DUY C;  4DR6 C;  4DR4 C;  2UUB C;  1N2F A;  1N34 C;  1HNZ C;  4LF7 C;  2UXB C;  2E5L C;  4MH4 A;  1MSZ A;  4LFA C;  4OX9 C;  4DV5 C;  4JI7 C;  4B3M C;  4JI2 C;  4DV0 C;  4JI8 C;  4DUZ C;  2E8E A;  3JAM D;  5IT9 D;  4LF6 C;  4JYA C;  1HNW C;  3T1Y C;  4DV7 C;  5FLX D;  5A2Q D;  2ATW A;  1UKK A;  2ONF A;  2PT7 G;  5IWA C;  3EER A;  1WHR A;  2D7V A;  2PN2 A;  3J81 D;  3GKU A;  2KZF A;  1EGA A;  4DV1 C;  2HJG A;  2LRR A;  4DV6 C; 
#chains in the Genus database with same CATH topology
 3NI2 A;  2UUC C;  5C0X G;  1BUP A;  5AQU A;  1N32 C;  2LR3 A;  1T0Z A;  2P2R A;  2XR1 A;  2AXY A;  2ATB A;  2D1T A;  2UUB H;  4FJU A;  3FCC A;  2E88 A;  4RLF A;  4FSV A;  3NCV A;  3LDL A;  2V7B A;  4OO1 G;  1YJ7 A;  4WAN A;  4DV3 C;  1J5E C;  2CXC A;  3DLP X;  3AF6 A;  1X4N A;  2P2Q A;  4B3M H;  1PX9 A;  3C5E A;  2KBH A;  1C56 A;  3TUF A;  4DUZ H;  2QVY X;  4OXI A;  4FL9 A;  1GPS A;  4H5N A;  1PG3 A;  2QND A;  2E0H A;  3D2F B;  3E7W A;  1ULT A;  1V8C A;  3HSC A;  3JAM W;  4PUI A;  5AQH A;  2ASC A;  4DCU A;  2GL1 A;  5KYT A;  1LCI A;  3CQ2 A;  5BPM A;  3T1H C;  4JI6 H;  2JE6 I;  3OTO H;  4LF9 H;  4RM3 A;  1ODH A;  4JI4 C;  2UXD H;  1NGH A;  3AY9 A;  2E2F A;  2MMA B;  4MTN A;  1XNR C;  1XMQ C;  5EXW A;  5GTD A;  3D2E A;  5E7Q A;  4BA2 I;  2CTK A;  3RV2 A;  5BUR A;  3GR5 A;  4YHH C;  2OPL A;  5F2R A;  1QQO A;  3UX2 A;  4FJS A;  1I6F A;  1NYE A;  1HPM A;  5CZX A;  2ZZN A;  4OCH A;  2DYJ A;  3A4I A;  5LMU H;  1OZZ A;  2E3U A;  3EQ6 A;  4DR5 H;  4LE5 A;  5DV9 A;  2Y3M A;  3A8Y A;  5FPM A;  4X65 H;  2LN8 A;  1ZB8 A;  2LY5 A;  1KAY A;  3UOE A;  3CW4 A;  4E9J A;  1AMU A;  2ZZM A;  1KHM A;  5AQQ A;  3KP0 A;  2VKC A;  2YQR A;  1KKG A;  1WH9 A;  4X64 C;  2KYQ A;  4X64 H;  4JI3 H;  3L56 A;  5AQN A;  3A25 A;  2P2J A;  1J4W A;  4ZJZ A;  1V26 A;  2LT8 A;  5ADZ A;  3K6R A;  3LGX A;  4B3T H;  5EY4 A;  4X62 C;  4V1D C;  4B3S C;  4LF4 C;  1MYN A;  1FJG C;  1NGG A;  3J80 D;  2OPU A;  4LF8 H;  1NGJ A;  1HNZ C;  1S03 G;  4FTF A;  5EVZ A;  3ETC A;  3UOW A;  1XMO H;  2QWQ A;  5K36 G;  4MH4 A;  2UXC H;  4JVY A;  1MSZ A;  5AE3 A;  2N2R A;  2E3F A;  5BSU A;  1OMY A;  4LF5 H;  3EZJ A;  4NZT M;  1ZVG A;  4JI2 C;  3VKE A;  1I6U A;  2YWB A;  4CQK A;  5IT9 D;  4LF6 C;  4JYA C;  1HNW C;  1ZZJ A;  4JI2 H;  4DV7 C;  2B3C A;  4JYA H;  3LDP A;  3ATV A;  2ONF A;  4KBO A;  1ZUT A;  2MBK A;  2A7T A;  2YC1 C;  2PN2 A;  1N4N A;  1N36 H;  1NRB A;  3J81 D;  4YY3 H;  2PQU A;  5AQV A;  5BN8 A;  5AQZ A;  1N33 H;  1ZVE A;  2D56 A;  3NPD A;  4DV6 C;  3QFU A;  1HH2 P;  4NXM H;  5BSV A;  1ATR A;  4IR7 A;  5BN9 A;  4DR2 C;  2MN5 A;  1DTJ A;  2CPQ A;  5AQS A;  2QW0 X;  5AQW A;  2LY6 A;  3A26 A;  4HWI A;  4EC5 A;  1KV0 A;  2Y4O A;  2E7G A;  2LI7 A;  3O2E A;  4KTT A;  4K0B A;  1FLO A;  5FPD A;  1XRB A;  2NN6 G;  3LUS A;  4BBY A;  2O4C A;  4JV5 C;  1PQX A;  4DV5 H;  2YX1 A;  1V9N A;  2CPM A;  3KHW A;  1NGD A;  4JV5 H;  5T8S A;  3CQ3 A;  1QQM A;  1AYJ A;  2HH2 A;  2X06 A;  3CJE A;  4JI1 C;  1X9Z A;  3T1Y H;  3L95 X;  2KPY A;  4JI1 H;  1XRA A;  1T5D X;  2YIL A;  1XNQ C;  2PRO A;  2QL8 A;  3N54 B;  4L7I A;  1SN1 A;  3C7N A;  1WT7 A;  3KOW A;  4DCT A;  3RG2 A;  3CQX A;  4X66 C;  5LMN C;  3FZF A;  2UUC H;  1ML8 A;  5FLX W;  2MZ0 A;  1N32 H;  5LMN H;  1NXU A;  2Z0S A;  2P2B A;  5AR0 A;  1L2F A;  4G36 A;  4JI5 C;  1NY8 A;  1O9T A;  3GDQ A;  1TH5 A;  3FE1 A;  1HR0 C;  1CHZ A;  3KP1 A;  5CZV A;  4NBQ A;  4DR3 C;  1JXC A;  2V7Z A;  2CY1 A;  5AE2 A;  1IBM C;  3KOX A;  1WVN A;  1TUA A;  3I0P A;  3L7Z C;  4DV3 H;  3NYR A;  1J5E H;  4DR1 C;  2DGR A;  2WD9 A;  2A1S A;  5BUS A;  2M5O A;  3LDQ A;  2E8C A;  2CTM A;  2D1Q A;  3TR3 A;  1XRS B;  5AQJ A;  3UX3 A;  4DR7 C;  3D2F A;  2DHM A;  1XS3 A;  4G1I A;  1T7E A;  1I94 C;  2OPV A;  1UGL A;  3KVG A;  2EGT A;  4JI0 C;  4GKJ C;  1IBK C;  3L4I A;  4JI0 H;  1WF3 A;  3BK3 C;  3IUC A;  2BH1 X;  3KOZ A;  4K0K C;  1WMT A;  1O93 A;  1K1G A;  4GKJ H;  1NH5 A;  2ZQE A;  2PY9 A;  3T1H H;  3IEV A;  1I6G A;  1QM4 A;  2MCQ A;  1NGA A;  1KAX A;  4OYC A;  5BSW A;  4JI4 H;  1MXC A;  4HE7 A;  2NY8 X;  1XNR H;  1SN4 A;  2CU6 A;  1VLA A;  1XMQ H;  1HNX C;  1WWN A;  2BJO A;  2YIP A;  1DKG D;  1UG8 A;  4YHH H;  5AQM A;  4B8C D;  4AB0 A;  3TQI A;  3SB1 A;  4UAF E;  4FUT A;  2MM9 A;  2KSK A;  1N2F A;  1YUW A;  2NCL A;  1ZU3 A;  4LF7 C;  2UXB C;  3UEB A;  1MXA A;  4OX9 C;  1BA0 A;  4KTV A;  3S82 A;  4JI7 C;  2KHO A;  3GPC A;  4DV0 C;  4JI8 C;  2KZ0 A;  5KK4 A;  2QWL A;  5K85 A;  4BCA A;  5A2Q D;  4PZP A;  4RVO A;  1UKK A;  5F1X A;  5IWA C;  1FUG A;  1I2V A;  2M8W A;  1J5K A;  3VNS A;  5IWA H;  3DAY A;  3FAU A;  4JM1 A;  4WV3 A;  2D27 A;  5LL6 b;  2YWC A;  2Y4N A;  1BA3 A;  3H2T A;  4DV1 C;  5DT9 A;  1ZFU A;  2VZE A;  3GR1 A;  4LFB C;  4NZR M;  1DT4 A;  1K8B A;  2LJ7 A;  4X62 H;  4PDB A;  1P7L A;  4B3S H;  4PUG A;  4LF4 H;  4LFB H;  4DG8 A;  1FJG H;  2CTJ A;  4IZ6 A;  1HNZ H;  1SEG A;  1USP B;  4DCS A;  4DV2 C;  5AQF A;  5AQK A;  1P00 A;  1BCG A;  2VQE C;  2CTL A;  3QML A;  4DV2 H;  2D9I A;  2VQE H;  2QXL A;  3KOY A;  2FPH X;  1L4V A;  3ATU A;  2LJM A;  4LF6 H;  3L6Q A;  1HNW H;  4AEI A;  2QWP A;  1O90 A;  1RY2 A;  2JZX A;  4DV7 H;  4DV4 C;  3PSM A;  3I08 A;  3DHV A;  5BSR A;  2CTE A;  1V60 A;  1MXB A;  3M3Z A;  1MKY A;  4GKK C;  4PRO C;  1PA4 A;  3QI7 A;  3QD7 X;  2CTF A;  1XHJ A;  1IBL C;  5IT9 W;  3AEV B;  4DV6 H;  4GKK H;  4H5V A;  2QVZ X;  4AQY C;  4ODJ A;  5BUQ A;  1JOS A;  4DR2 H;  1RG9 A;  4GXR A;  2UUA C;  4RLQ A;  1P0A A;  4QMF B;  3J81 W;  4IO8 A;  4L4Q A;  5AQX A;  3J7A K;  2P2F A;  4D56 A;  3R9W A;  1ATS A;  5BSM A;  2JDQ D;  2WP0 C;  4JVH A;  2P2M A;  1LQL A;  1MDF A;  1GPM A;  4WS9 A;  5AQT A;  3N2Q A;  3QFP A;  3LDN A;  2ZM6 C;  2E3G A;  5AQO A;  2UU9 C;  4LFC C;  3FZM A;  4BC7 A;  2F4V C;  4DV0 H;  4L2Z A;  2DPL A;  1B3C A;  3GR0 A;  1XNQ H;  2E8A A;  4GNI A;  1ZB9 A;  1ZYW A;  3PRO C;  3V69 A;  3E7X A;  1PE4 A;  4D4G A;  4B3R C;  2FFM A;  4NOZ A;  4DG9 A;  2BA0 A;  4GS5 A;  4PHT A;  5JEA G;  1PU1 A;  2HH3 A;  4X66 H;  1FH3 A;  2JEB I;  1C55 A;  1NGF A;  5AQG A;  4IFD G;  2ANN A;  3FZH A;  3FZL A;  2D28 C;  5AQY A;  3A9V A;  1ZTG A;  3LAX A;  3KDK A;  1DJT A;  4JI5 H;  4I9G A;  1GPT A;  3CW9 A;  2HHH C;  5A19 A;  1P4E C;  2VY6 A;  1HR0 H;  1HX1 A;  4KHP C;  4DR3 H;  4NXN C;  4KHP H;  3IEU A;  1IBM H;  2VQF C;  2LTL A;  1BMR A;  1Z2I A;  2E0G A;  4DR1 H;  1NPI A;  5BPN A;  2SN3 A;  3C7N B;  2KJA A;  5A1I A;  4D4I A;  2G8Y A;  4DR6 C;  3FZK A;  4DR7 H;  3TDE A;  2UUB C;  3SF4 D;  1N34 C;  4DR6 H;  2QWM A;  2OBV A;  3L8C A;  1N34 H;  1I94 H;  1VNB A;  5FPE A;  4HPV A;  1EC6 A;  3SO4 A;  1MR4 A;  1NGC A;  1B7D A;  5T8T A;  4BA1 I;  1IBK H;  2N2Q A;  4B3M C;  1PG4 A;  4DUZ C;  2P20 A;  3JAM D;  4K0K H;  1X4M A;  1ZYV A;  2ATW A;  5AQP A;  5JRH A;  3NYQ A;  5KEI A;  2D7V A;  2FMR A;  4UAE F;  2QWN A;  2Z51 A;  3GKU A;  2JNV A;  2NY9 X;  2K1H A;  2KZF A;  1EGA A;  1WE8 A;  1BRZ A;  1VEH A;  2LF0 A;  2HJG A;  4FUQ A;  2BL5 A;  2LRR A;  4LIJ A;  1HNX H;  1KAZ A;  1HJO A;  1SEI A;  2K35 A;  1T5H X;  4U5Y D;  3AY0 A;  2KGQ A;  3RF2 A;  4JI6 C;  1I2U A;  3CQ1 A;  1CN2 A;  3OTO C;  4LF9 C;  1X0A A;  2VQF H;  1NGB A;  1T1T A;  5AE1 A;  1MDB A;  4PUH A;  3KXW A;  4G08 A;  1S3X A;  2UXD C;  5AQR A;  3ETO A;  4LF7 H;  2UXB H;  3LNO A;  3I07 A;  1FKA H;  4OX9 H;  3E7U X;  4JI7 H;  2ASB A;  4JI8 H;  1K0R A;  1V25 A;  4NDN A;  1SNB A;  2KBK A;  2VSQ A;  2CWH A;  2D1S A;  2JVZ A;  3LNV A;  3D2E B;  3KDG A;  3R44 A;  4AM3 A;  2M6Q A;  4R1L A;  1F0X A;  5LMU C;  2OO4 A;  2OPL B;  3I33 A;  3R2V A;  4UAD E;  3AF5 A;  3CW8 X;  4DR5 C;  4KYP A;  1XRH A;  3KC6 A;  4R1M A;  4XX2 A;  1WCJ A;  4X65 C;  2MJH A;  2BUP A;  2M5H A;  1UWD A;  4G37 A;  4DV1 H;  5KYV A;  1ICA A;  2Y27 A;  4H5R A;  1POI A;  3JXU A;  5A2Q W;  3FCE A;  2AYA A;  1WTJ A;  1NGE A;  1USP A;  2BRZ A;  1AHO A;  4HHF A;  1NE5 A;  5IFI A;  3U1K A;  3PBK A;  4JI3 C;  3GAB A;  4AIM A;  4GXQ A;  2YEO A;  5EX5 A;  5FPN A;  1LQI A;  5K8F A;  2G2K A;  5BPL A;  2QVX X;  2D1R A;  4ISB A;  3J80 W;  2ANR A;  2E8F A;  2KDN A;  5BR8 C;  4B3T C;  3A9U A;  5H9U A;  2CWF A;  3G7S A;  5BR8 H;  5LCI A;  1M6X A;  4DV4 H;  1VIH A;  1JZA A;  4LF8 C;  2LTM A;  1BA1 A;  3VNQ A;  1XMO C;  2QW9 A;  2JEA I;  4RMN A;  2UXC C;  1T7A A;  5BST A;  1P4E A;  1NGI A;  4D57 A;  4R0M A;  4LF5 C;  1IBL H;  1AN7 A;  1VIG A;  4AQY H;  3GL1 A;  1T7B A;  1QQN A;  2N66 A;  4TPS B;  1VBI A;  3R9X A;  2UUA H;  5CY0 A;  4AAZ A;  4H5T A;  2I61 A;  4BSZ A;  2JMP A;  1N36 C;  3IML A;  4YY3 C;  1LQQ A;  4I9F A;  2LKB A;  2P02 A;  3E7R L;  2KBJ A;  2YBR C;  2YCB A;  1N33 C;  3OSS D;  4DCV A;  1IB8 A;  1NRA A;  5A1G A;  4NXM C;  2YIO A;  5AQL A;  1QWI A;  1XRC A;  2QWO A;  1JZB A;  2UU9 H;  2ZM6 H;  2F4V H;  4LFC H;  5F0X A;  4H5W A;  4DUY C;  2M8B B;  4DR4 C;  4OD6 A;  2N69 A;  3B7W A;  4DUY H;  3VNR A;  4RVN A;  4DR4 H;  4ZLP A;  1ZZI A;  2E5L C;  3UZ0 A;  1DQ7 A;  3PES A;  3OET A;  4UJ0 A;  1S20 A;  4B8T A;  2B68 A;  4LFA C;  2E5L H;  4B3R H;  1O92 A;  4DV5 C;  1M6X C;  3LDO A;  4RM2 A;  4BC9 A;  1MD9 A;  4LFA H;  2GMO A;  1JKZ A;  2E8E A;  4EAT A;  4H8A A;  2QWR A;  3T1Y C;  5FLX D;  1PTX A;  3IPL A;  2PT7 G;  1VNA A;  1TI5 A;  3EER A;  1WHR A;  5AQI A;  2HHH H;  1LQH A;  1BK8 A;  4NXN H;  2JA9 A;  1ZZK A;  4WAL A; 
#chains in the Genus database with same CATH homology
 3NI2 A;  2UUC C;  1N32 C;  2XR1 A;  2D1T A;  3FCC A;  4RLF A;  2V7B A;  1YJ7 A;  4DV3 C;  1J5E C;  2CXC A;  3DLP X;  3AF6 A;  2P2Q A;  3TUF A;  3C5E A;  2QVY X;  4OXI A;  1PG3 A;  3E7W A;  1ULT A;  4DCU A;  5KYT A;  1LCI A;  3T1H C;  4RM3 A;  4JI4 C;  4MTN A;  1XNR C;  1XMQ C;  5GTD A;  5E7Q A;  3RV2 A;  5BUR A;  4YHH C;  2OPL A;  5CZX A;  1NYE A;  2DYJ A;  3A4I A;  3EQ6 A;  4LE5 A;  5DV9 A;  1ZB8 A;  1AMU A;  1KKG A;  1WH9 A;  4X64 C;  2P2J A;  4ZJZ A;  1V26 A;  5ADZ A;  3LGX A;  4X62 C;  4B3S C;  4LF4 C;  1FJG C;  3J80 D;  1HNZ C;  4FTF A;  3ETC A;  3UOW A;  4MH4 A;  1MSZ A;  5AE3 A;  5BSU A;  4JI2 C;  2YWB A;  4LF6 C;  5IT9 D;  4JYA C;  1HNW C;  4DV7 C;  2ONF A;  2PN2 A;  3J81 D;  3NPD A;  4DV6 C;  1HH2 P;  5BSV A;  4IR7 A;  4DR2 C;  2QW0 X;  2Y4O A;  2E7G A;  4KTT A;  4K0B A;  1XRB A;  3LUS A;  4BBY A;  4JV5 C;  2CPM A;  5T8S A;  3CJE A;  4JI1 C;  3L95 X;  1XRA A;  1T5D X;  1XNQ C;  2PRO A;  2QL8 A;  3N54 B;  4L7I A;  4DCT A;  3RG2 A;  4X66 C;  5LMN C;  1ML8 A;  2P2B A;  1L2F A;  4G36 A;  4JI5 C;  1O9T A;  1HR0 C;  5CZV A;  4DR3 C;  2CY1 A;  5AE2 A;  1IBM C;  3NYR A;  4DR1 C;  2WD9 A;  2A1S A;  5BUS A;  2E8C A;  2D1Q A;  4DR7 C;  4G1I A;  1I94 C;  2EGT A;  4JI0 C;  4GKJ C;  1IBK C;  1WF3 A;  2BH1 X;  4K0K C;  1O93 A;  3IEV A;  1QM4 A;  4OYC A;  5BSW A;  1MXC A;  1VLA A;  1HNX C;  2BJO A;  1UG8 A;  3TQI A;  4FUT A;  1N2F A;  4LF7 C;  2UXB C;  1MXA A;  4OX9 C;  4KTV A;  3S82 A;  4JI7 C;  3GPC A;  4DV0 C;  4JI8 C;  5K85 A;  4BCA A;  5A2Q D;  4PZP A;  4RVO A;  1UKK A;  5IWA C;  1FUG A;  3VNS A;  3DAY A;  4JM1 A;  4WV3 A;  2D27 A;  2YWC A;  2Y4N A;  4DV1 C;  1BA3 A;  3H2T A;  2VZE A;  3GR1 A;  4LFB C;  1P7L A;  4DG8 A;  4IZ6 A;  1USP B;  4DCS A;  4DV2 C;  2VQE C;  1O90 A;  1RY2 A;  4DV4 C;  3I08 A;  3DHV A;  5BSR A;  1MXB A;  1MKY A;  4GKK C;  4PRO C;  1PA4 A;  1IBL C;  2QVZ X;  4AQY C;  4ODJ A;  5BUQ A;  1JOS A;  1RG9 A;  4GXR A;  2UUA C;  4RLQ A;  4L4Q A;  2P2F A;  4D56 A;  3R9W A;  5BSM A;  2WP0 C;  2P2M A;  1LQL A;  1MDF A;  1GPM A;  4WS9 A;  3N2Q A;  2ZM6 C;  2UU9 C;  2F4V C;  4LFC C;  4BC7 A;  4L2Z A;  2DPL A;  3GR0 A;  1ZB9 A;  3PRO C;  3E7X A;  4D4G A;  4B3R C;  4NOZ A;  4DG9 A;  4GS5 A;  4PHT A;  2D28 C;  3A9V A;  3LAX A;  4I9G A;  3CW9 A;  2HHH C;  5A19 A;  4KHP C;  4NXN C;  3IEU A;  2VQF C;  2E0G A;  5A1I A;  4D4I A;  4DR6 C;  3TDE A;  2UUB C;  1N34 C;  2OBV A;  3L8C A;  4HPV A;  3SO4 A;  5T8T A;  4B3M C;  1PG4 A;  4DUZ C;  2P20 A;  3JAM D;  2ATW A;  5JRH A;  3NYQ A;  5KEI A;  2D7V A;  3GKU A;  2KZF A;  1EGA A;  2HJG A;  4FUQ A;  2LRR A;  1T5H X;  4U5Y D;  4JI6 C;  4LF9 C;  3OTO C;  5AE1 A;  1MDB A;  3KXW A;  2UXD C;  3ETO A;  3I07 A;  2ASB A;  1K0R A;  1V25 A;  4NDN A;  2VSQ A;  2D1S A;  3LNV A;  3R44 A;  4R1L A;  5LMU C;  2OO4 A;  2OPL B;  3CW8 X;  3AF5 A;  4DR5 C;  4R1M A;  4XX2 A;  4X65 C;  4G37 A;  5KYV A;  2Y27 A;  3FCE A;  2AYA A;  1USP A;  5IFI A;  3PBK A;  4JI3 C;  4GXQ A;  5K8F A;  2QVX X;  2D1R A;  4ISB A;  2E8F A;  5BR8 C;  4B3T C;  3A9U A;  5H9U A;  3G7S A;  4LF8 C;  3VNQ A;  1XMO C;  4RMN A;  2UXC C;  5BST A;  4D57 A;  4R0M A;  4LF5 C;  4TPS B;  3R9X A;  4BSZ A;  1N36 C;  2JMP A;  3IML A;  4YY3 C;  4I9F A;  2P02 A;  2YCB A;  1N33 C;  4DCV A;  5A1G A;  4NXM C;  1QWI A;  1XRC A;  4DUY C;  4DR4 C;  3B7W A;  3VNR A;  4RVN A;  4ZLP A;  2E5L C;  3UZ0 A;  3PES A;  4LFA C;  1O92 A;  4DV5 C;  4RM2 A;  4BC9 A;  1MD9 A;  2E8E A;  4EAT A;  3T1Y C;  5FLX D;  3IPL A;  2PT7 G;  3EER A;  1WHR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...