3GKUA

Crystal structure of a probable rna-binding protein from clostridium symbiosum atcc 14940
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
208
structure length
206
Chain Sequence
MDMVTVTAKTVEEAVTKALIELQTTSDKLTYEIVEKGSAGFIGSKPAIIRAKRKETLQDKAIEFLEQVFDAMNMAVDISVEYNETEKEMNVNLKGDDMGILIGKRGQTLDSLQYLVSLVVNKSSSDYIRVKLDTENYRERRKETLETLAKNIAYKVKRTKRSVSLEPMNPYERRIIHAALQNDKYVVTRSDGEEPFRHVIISLKRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of a probable RNA-binding protein from Clostridium symbiosum ATCC 14940
rcsb
source organism Clostridium symbiosum atcc 14940
molecule tags Rna binding protein
molecule keywords Probable RNA-binding protein
total genus 55
structure length 206
sequence length 208
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01424 R3H R3H domain
A PF13083 KH_4 KH domain
A PF14804 Jag_N Jag N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.80 Alpha Beta 2-Layer Sandwich Defensin A-like probable RNA-binding protein from clostridium symbiosum atcc 14940 3gkuA01
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 3gkuA02
3.30.1370.50 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 R3H-like domain 3gkuA03
4NOZA 4JI0C 2UUBC 4YHHC 4JI3C 4GKJC 4DV2C 2A1SA 4AQYC 2QL8A 1USPA 5BR8C 4JI8C 1HH2P 4LF5C 2LRRA 4OX9C 1N36C 1WF3A 2EGTA 4X65C 4LF4C 3JAMD 4LFBC 1N2FA 1XNRC 4JI7C 1EGAA 2CPMA 4JI1C 1N32C 2VQEC 1MSZA 4JI4C 1IBMC 4DV5C 3OTOC 4DCTA 1MKYA 4DV7C 4DR2C 2UU9C 4NXMC 3AF5A 1XMOC 2ASBA 1PA4A 1LQLA 4LF8C 5LMUC 4DV6C 1FJGC 4DR7C 4DR3C 3I07A 2UUCC 4DCVA 1HNXC 2OPLB 2HHHC 1HR0C 2OPLA 2CY1A 4DV4C 1NYEA 4JI5C 2E8EA 4JV5C 2JMPA 5A2QD 1JOSA 4XX2A 1HNWC 1WH9A 4LF9C 2E8FA 2E5LC 1I94C 4B3RC 4KHPC 4DCSA 4YY3C 2UXCC 2HJGA 1K0RA 4MH4A 4JYAC 4B3TC 2PN2A 4DR5C 4MTNA 4BSZA 2UUAC 1N33C 2CXCA 3T1YC 4JI6C 2UXDC 1KKGA 3IEUA 4DR1C 1J5EC 1IBLC 5LMNC 1WHRA 1USPB 2F4VC 1UKKA 4JI2C 1N34C 3R9XA 4DR6C 2ONFA 1UG8A 1ZB8A 1IBKC 3GKUA 4DR4C 3J81D 2PT7G 4NXNC 4LFAC 2XR1A 2BJOA 1VLAA 4LF6C 3CJEA 3LUSA 4DUZC 1HNZC 3IEVA 3EERA 2E8CA 5FLXD 3AF6A 4DUYC 4DV1C 1XNQC 5IWAC 4DCUA 3T1HC 4B3SC 4X66C 4DV3C 4X62C 4GKKC 4X64C 2UXBC 2KZFA 2DYJA 2ATWA 1QWIA 1ZB9A 2VQFC 4K0KC 4LFCC 2ZM6C 2YCBA 5IT9D 2D7VA 1L2FA 2E7GA 3R9WA 1ML8A 1XMQC 4DV0C 4B3MC 3J80D 4LF7C
chains in the Genus database with same CATH superfamily
2VQFH 1N36H 1NH5A 2LY6A 5AQKA 4YHHC 4JI1H 1T5DX 5K8FA 2LJMA 3SF4D 2LF0A 4R1MA 1NRBA 5LMNH 4DV2H 2D1QA 4CQKA 1USPA 2N66A 1HH2P 3OSSD 2E3GA 5KYTA 5FPDA 4LFBC 1MR4A 1MXAA 3KC6A 4H5TA 4JYAH 2I61A 2CPMA 2P02A 4JI4H 3T1YH 3OTOC 1TI5A 5KYVA 2UU9C 1BUPA 1K8BA 4KBOA 4LFCH 2E2FA 1XMOC 2ASBA 1PA4A 1LQLA 3KDGA 4JI2H 2E0GA 5AQQA 5AQHA 2QWRA 5CZXA 4DR7C 2M8WA 2G2KA 2Z51A 3I07A 2B3CA 2BRZA 2A7TA 5AE1A 2QWNA 2KBJA 2HHHC 1V25A 3A4IA 1HR0C 2M5OA 4JI5H 4DV4C 5BPLA 2AYAA 5AQUA 4DV6H 1VEHA 3K6RA 3PBKA 5ADZA 3LGXA 1SN1A 2E88A 4XX2A 1ZU3A 1N4NA 4LFAH 2QW0X 3D2EB 1X0AA 3QFPA 1GPTA 4HPVA 3VNSA 1I94H 4B3RH 2DPLA 2E8FA 3G7SA 2BL5A 2OPVA 4KHPC 2UXCC 5BURA 4LIJA 1CN2A 2CTLA 1OMYA 5EX5A 1YJ7A 4DR5C 1XNQH 5K36G 2JEAI 2CTMA 1LQIA 2CXCA 4DV3H 3IMLA 3E7WA 5BR8H 1V60A 1IBLC 1T7AA 3FZLA 1NY8A 3PROC 3V69A 1XHJA 2K1HA 4FUTA 1TH5A 1UG8A 5IFIA 4DV4H 5AQWA 3A26A 2D56A 1XS3A 1FLOA 2PT7G 3IPLA 1C56A 5BSMA 1T5HX 4RM2A 1DQ7A 4LF6C 4OO1G 3TUFA 4DUZC 1ULTA 2P2BA 4HHFA 3ETCA 3LNVA 4H5WA 1ZZJA 4KYPA 4PUIA 1HNWH 5IWAC 4DCUA 1WE8A 2ASCA 2N69A 2D1SA 2OO4A 2WP0C 2P2JA 3UEBA 3T1HC 1XRHA 2BUPA 5AQGA 2KZFA 2ATWA 5FPNA 2SN3A 3ATVA 3CQ1A 2F4VH 3VKEA 4H5VA 4OCHA 4RLFA 2Y27A 1HJOA 3AEVB 3R2VA 2UUBH 2YCBA 4AB0A 1VNBA 5K85A 2N2RA 5AE3A 4NZRM 5JEAG 1FUGA 1PU1A 1V26A 1T1TA 3SO4A 2Z0SA 4JVHA 3FE1A 4FJSA 4B3MC 1ZUTA 3J80D 3UX3A 3S82A 2CWFA 3I33A 3D2EA 2UUBC 1NGIA 4JI3C 1SN4A 1ATRA 4RLQA 1Z2IA 4DV2C 3T1HH 4AM3A 2QWOA 2A1SA 2QL8A 3TR3A 4LE5A 4DR1H 3I0PA 3FZMA 1WMTA 3QI7A 4DG9A 4OX9C 4X65C 4LF4C 4AEIA 3RG2A 3JAMD 4HWIA 1FJGH 1LQQA 2LR3A 1CHZA 2YQRA 2CTKA 1NGFA 1NGJA 3GR5A 2VQEC 1SEGA 1T7BA 4WANA 4NXNH 4V1DC 3DHVA 1O9TA 4JI4C 1J5KA 3VNRA 1MKYA 2Y4OA 4NXMC 2LTMA 5AQPA 2YC1C 1V8CA 5LMUC 3BK3C 2JA9A 3IUCA 4DR3C 4FL9A 1ZVEA 4X66H 2G8YA 2YBRC 2MJHA 4JI7H 2DGRA 2P2FA 2E0HA 1HNXC 2QNDA 3NCVA 2OPLA 1RY2A 5BSUA 4B8TA 3DAYA 4JI5C 1UWDA 2JE6I 2JMPA 3ATUA 5LMUH 1KHMA 3CW4A 2P2RA 1P7LA 1QM4A 3N2QA 4DV1H 1WH9A 3GPCA 3LDPA 5H9UA 5AQXA 1XRSB 3D2FA 1HNZH 1AN7A 4L7IA 2E5LC 5BN9A 1ICAA 1ATSA 4FSVA 2KDNA 3NPDA 5A19A 4AIMA 1K1GA 1X9ZA 1NRAA 4RVNA 2X06A 4JI3H 5EXWA 2KJAA 1ODHA 3L95X 4MTNA 4DR4H 5KK4A 5AQLA 1XRCA 1KKGA 3FAUA 4DR1C 1J5EC 4D56A 5LMNC 1WHRA 3RF2A 1UKKA 4JI2C 1N34C 3R9XA 4OXIA 2ONFA 4DR6C 5AQJA 3I08A 2DHMA 4DR7H 2D9IA 2OPUA 4GXRA 2NY8X 1PX9A 1NGGA 2E3FA 1ZB8A 1BA0A 5AQOA 3GKUA 4DR4C 3KOYA 1T0ZA 4JVYA 2BH1X 4UJ0A 2D1TA 5BSVA 3AY0A 3CJEA 1JXCA 3KVGA 4LF9H 5LL6b 1WTJA 4FUQA 1B3CA 2Y4NA 2D1RA 3JAMW 2P2MA 5IWAH 1I6FA 2YEOA 3QFUA 1XRBA 1XNRH 4NBQA 3LNOA 4GKKC 2YWCA 3A25A 1J5EH 1HPMA 4GS5A 3E7XA 2VZEA 2ANRA 5T8SA 4IFDG 1N34H 4DR6H 2VQFC 1PTXA 1ZYWA 1XMOH 3KHWA 2LKBA 1UGLA 5AQRA 1I2UA 4LFBH 5FPMA 2ANNA 2UUAH 2D7VA 2NY9X 2B68A 3L4IA 3R9WA 4X62H 1B7DA 1XMQC 4B3MH 2YIPA 2MM9A 4UAFE 2OBVA 4RVOA 4E9JA 4DR2H 4K0KC 1F0XA 2HH2A 3L56A 1NGAA 3UOEA 4HE7A 4NDNA 4R1LA 1QQMA 2LI7A 4KTVA 1ZVGA 4G1IA 4JI0C 5BSRA 5A2QW 1NGCA 1AMUA 1DJTA 1O92A 2CU6A 1N32H 2ATBA 4AQYH 3D2FB 4JM1A 2JNVA 4TPSB 1HNXH 1EC6A 1QQOA 5BR8C 2PQUA 2MBKA 4JI8C 4ISBA 4IR7A 4LF5C 3UZ0A 2LRRA 2VKCA 5A1GA 3FZKA 1GPSA 5A1IA 1N36C 2KGQA 5FLXW 1OZZA 5AQYA 1QQNA 2KSKA 1KAYA 5AQVA 1EGAA 5FPEA 4JI7C 1N32C 3B7WA 1I2VA 4RMNA 4DCTA 4QMFB 3CW8X 4DR2C 1T7EA 2K35A 3KOZA 4LF7H 1V9NA 2LN8A 4I9FA 2NN6G 5C0XG 3CQXA 4I9GA 4DV6C 5AE2A 1FJGC 2CTJA 4X65H 4PUHA 4LF4H 3J81W 4GKKH 4AAZA 3PSMA 1N33H 4FJUA 2UUCC 2OPLB 4WALA 1IBLH 2QVXX 4D4IA 3J80W 1WCJA 3EZJA 4L2ZA 5AQMA 3LDQA 2CY1A 5AQTA 2E8EA 1JOSA 3NYRA 5BUQA 5EY4A 3LDOA 4EC5A 1VIGA 4PDBA 3N54B 4LF9C 4ZJZA 5BUSA 1NGDA 4L4QA 4PZPA 4DCSA 1P0AA 4YY3C 2HJGA 4BC7A 4JYAC 3JXUA 4B3TC 5DV9A 5E7QA 1S03G 2LTLA 5F2RA 2UUAC 3LDLA 4IZ6A 3T1YC 4UAEF 1C55A 3IEUA 3UX2A 1YUWA 1USPB 1FKAH 4LF8H 2QWQA 1NGBA 4GNIA 1NE5A 2UU9H 2YILA 1JZAA 1ZFUA 2BJOA 2QXLA 5F0XA 1VLAA 4R0MA 1JZBA 1ZZKA 4DV5H 3LUSA 3O2EA 1HNZC 2E5LH 4D57A 2KYQA 2E8CA 5FLXD 4DV1C 5EVZA 4DUYH 5T8TA 2NCLA 2PY9A 4B3SC 4WV3A 4X66C 2VSQA 4X64C 5BSWA 5AQZA 1BRZA 2UXBC 2DYJA 3C5EA 3FCCA 3CQ3A 4PUGA 1BK8A 1ZB9A 2MZ0A 3A8YA 3KOXA 3CQ2A 2QWPA 1MD9A 2ZM6C 4GXQA 2M6QA 1KV0A 5BPNA 1IBKH 4BC9A 3L6QA 2CPQA 1P00A 4DR3H 2BA0A 2KBKA 3C7NB 5AQFA 2E7GA 2P20A 5GTDA 2VQEH 5JRHA 1PG4A 4DV0C 2UXBH 4LF6H 2JVZA 1LQHA 3SB1A 1RG9A 1KAZA 5BN8A 1JKZA 4LF7C 4KHPH 4NOZA 3RV2A 4JI0H 3QMLA 2QVYX 3HSCA 2Y3MA 5AQSA 1WT7A 4GKJC 2HH3A 4B3SH 2LT8A 3KOWA 1O93A 4EATA 4AQYC 3KP1A 2AXYA 2UXDH 1BA1A 4ZLPA 1HR0H 1GPMA 2E3UA 3VNQA 2ZZMA 2V7BA 1P4EC 4JI8H 1WF3A 2EGTA 1DT4A 1S3XA 4YY3H 1N2FA 1XNRC 4BA1I 1XRAA 4JI1C 3E7UX 3CW9A 2E8AA 2O4CA 4KTTA 1MSZA 1BCGA 1IBMC 1BA3A 4U5YD 1POIA 4DV5C 4JI6H 1TUAA 4DV7C 1L4VA 2GL1A 2WD9A 1P4EA 5AQNA 4K0KH 1MDFA 3AF5A 3DLPX 2ZM6H 4LF8C 4B8CD 4NZTM 1FH3A 4OD6A 1NPIA 5BSTA 5CZVA 2CWHA 3FZFA 4YHHH 5IT9W 1IB8A 4H8AA 4IO8A 3GL1A 2JEBI 2MCQA 2PROA 4DCVA 3PESA 2UUCH 3A9UA 4H5RA 2KHOA 1PG3A 1ZYVA 2JDQD 1O90A 4G36A 3TDEA 2YWBA 1NYEA 5AQIA 4PHTA 2VY6A 5A2QD 5F1XA 4JV5C 1DTJA 3EQ6A 1M6XC 2ZQEA 1SNBA 2MN5A 1MDBA 3GR1A 4D4GA 3GDQA 1HNWC 3FZHA 5KEIA 3U1KA 3OTOH 4H5NA 3FCEA 4DUZH 1PE4A 2QVZX 3KDKA 1NGEA 1I94C 2D28C 4B3RC 2YX1A 1NXUA 1K0RA 4MH4A 1MXCA 1WVNA 2CTEA 2PN2A 4GKJH 4JV5H 3GABA 2KZ0A 4BSZA 1LCIA 2ZZNA 1N33C 3LDNA 4G37A 2MMAB 4PROC 4JI6C 2UXDC 1M6XA 1NGHA 1IBMH 1KAXA 4BA2I 1VBIA 1HX1A 2HHHH 4FTFA 2F4VC 2CTFA 3L7ZC 2KPYA 2N2QA 2FMRA 4BCAA 3KXWA 1AYJA 2QW9A 1IBKC 3AY9A 2QWLA 2D27A 3J81D 4OYCA 4NXNC 4DR5H 1PQXA 3ETOA 4LFAC 2KBHA 2XR1A 2JZXA 3H2TA 5AR0A 2YIOA 3OETA 4DV7H 1XMQH 4G08A 2M5HA 2FFMA 4ODJA 3M3ZA 2M8BB 3TQIA 3E7RL 4DG8A 1J4WA 3GR0A 4LF5H 4WS9A 3IEVA 2V7ZA 1AHOA 2QWMA 3EERA 5LCIA 1X4MA 3AF6A 4BBYA 4DUYC 1X4NA 5DT9A 1XNQC 5CY0A 1BMRA 2LY5A 3UOWA 1MYNA 4RM3A 1I6UA 4DV3C 4X62C 1VIHA 3QD7X 4X64H 1QWIA 1VNAA 1I6GA 2UXCH 5BPMA 4LFCC 2P2QA 1DKGD 2GMOA 3LAXA 1ZTGA 1SEIA 4B3TH 4NXMH 3J7AK 3C7NA 3L8CA 3NI2A 2FPHX 5IT9D 3KP0A 3NYQA 1L2FA 4UADE 3A9VA 3R44A 2LJ7A 1ML8A 1S20A 1MXBA 4DV0H 1WWNA 1ZZIA 4OX9H 4K0BA
chains in the Genus database with same CATH topology
4YHHC 1T5DX 5K8FA 4R1MA 2D1QA 1USPA 1HH2P 5KYTA 4LFBC 1MXAA 2CPMA 2P02A 3OTOC 5KYVA 2UU9C 1XMOC 2ASBA 1PA4A 1LQLA 2E0GA 5CZXA 4DR7C 3I07A 5AE1A 2HHHC 1V25A 3A4IA 1HR0C 4DV4C 2AYAA 3PBKA 5ADZA 3LGXA 4XX2A 2QW0X 4HPVA 3VNSA 2DPLA 2E8FA 3G7SA 4KHPC 2UXCC 5BURA 1YJ7A 4DR5C 2CXCA 3IMLA 3E7WA 1IBLC 3PROC 4FUTA 1UG8A 5IFIA 2PT7G 3IPLA 5BSMA 1T5HX 4RM2A 4LF6C 3TUFA 4DUZC 1ULTA 2P2BA 3ETCA 3LNVA 5IWAC 4DCUA 2OO4A 2D1SA 3T1HC 2WP0C 2P2JA 2KZFA 2ATWA 4RLFA 2Y27A 2YCBA 5K85A 5AE3A 1FUGA 1V26A 3SO4A 4B3MC 3J80D 3S82A 2UUBC 4JI3C 4RLQA 4DV2C 2A1SA 2QL8A 4LE5A 4DG9A 4OX9C 4X65C 4LF4C 3RG2A 3JAMD 2VQEC 3DHVA 1O9TA 4JI4C 3VNRA 1MKYA 2Y4OA 4NXMC 5LMUC 4DR3C 2P2FA 1HNXC 2OPLA 1RY2A 5BSUA 3DAYA 4JI5C 2JMPA 1P7LA 1QM4A 3N2QA 1WH9A 3GPCA 5H9UA 4L7IA 2E5LC 3NPDA 5A19A 4RVNA 3L95X 4MTNA 1XRCA 1KKGA 4DR1C 1J5EC 4D56A 5LMNC 1WHRA 1UKKA 4JI2C 1N34C 3R9XA 4OXIA 2ONFA 4DR6C 3I08A 4GXRA 1ZB8A 3GKUA 4DR4C 2BH1X 2D1TA 5BSVA 3CJEA 4FUQA 2Y4NA 2D1RA 2P2MA 1XRBA 4GKKC 2YWCA 4GS5A 3E7XA 2VZEA 5T8SA 2VQFC 2D7VA 3R9WA 1XMQC 2OBVA 4RVOA 4K0KC 4NDNA 4R1LA 4KTVA 4G1IA 4JI0C 5BSRA 1AMUA 1O92A 4JM1A 4TPSB 5BR8C 4JI8C 4ISBA 4IR7A 4LF5C 3UZ0A 2LRRA 5A1GA 1N36C 5A1IA 4JI7C 1EGAA 1N32C 3B7WA 4RMNA 4DCTA 3CW8X 4DR2C 4I9FA 4I9GA 4DV6C 1FJGC 5AE2A 2UUCC 2OPLB 2QVXX 4D4IA 4L2ZA 2CY1A 2E8EA 1JOSA 3NYRA 5BUQA 3N54B 4LF9C 4ZJZA 5BUSA 4L4QA 4PZPA 4DCSA 4YY3C 2HJGA 4BC7A 4JYAC 4B3TC 5DV9A 5E7QA 2UUAC 4IZ6A 3T1YC 3IEUA 1USPB 2BJOA 1VLAA 4R0MA 3LUSA 1HNZC 4D57A 2E8CA 5FLXD 4DV1C 5T8TA 4B3SC 4WV3A 4X66C 2VSQA 4X64C 5BSWA 2UXBC 2DYJA 3C5EA 3FCCA 1ZB9A 1MD9A 2ZM6C 4GXQA 4BC9A 2E7GA 5GTDA 2P20A 5JRHA 1PG4A 4DV0C 1RG9A 4LF7C 4NOZA 3RV2A 2QVYX 4GKJC 1O93A 4EATA 4AQYC 4ZLPA 1GPMA 3VNQA 2V7BA 1WF3A 2EGTA 1N2FA 1XNRC 1XRAA 4JI1C 3CW9A 4KTTA 1MSZA 1IBMC 1BA3A 4U5YD 4DV5C 4DV7C 2WD9A 1MDFA 3AF5A 3DLPX 4LF8C 5BSTA 5CZVA 2PROA 4DCVA 3PESA 3A9UA 1PG3A 1O90A 4G36A 3TDEA 2YWBA 1NYEA 4PHTA 4JV5C 5A2QD 3EQ6A 1HNWC 1MDBA 4D4GA 3GR1A 5KEIA 3FCEA 2QVZX 1I94C 4B3RC 2D28C 1K0RA 4MH4A 1MXCA 2PN2A 4BSZA 1LCIA 1N33C 4G37A 4PROC 4JI6C 2UXDC 4FTFA 2F4VC 4BCAA 3KXWA 1IBKC 2D27A 3J81D 4OYCA 4NXNC 3ETOA 4LFAC 2XR1A 3H2TA 4ODJA 3TQIA 4DG8A 3GR0A 4WS9A 3IEVA 3EERA 3AF6A 4BBYA 4DUYC 1XNQC 3UOWA 4RM3A 4DV3C 4X62C 1QWIA 4LFCC 2P2QA 3LAXA 3NI2A 3L8CA 5IT9D 3NYQA 1L2FA 3A9VA 3R44A 1ML8A 1MXBA 4K0BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NOZ A;  4JI0 C;  2UUB C;  4YHH C;  4JI3 C;  4GKJ C;  4DV2 C;  2A1S A;  4AQY C;  2QL8 A;  1USP A;  5BR8 C;  4JI8 C;  1HH2 P;  4LF5 C;  2LRR A;  4OX9 C;  1N36 C;  1WF3 A;  2EGT A;  4X65 C;  4LF4 C;  3JAM D;  4LFB C;  1N2F A;  1XNR C;  4JI7 C;  1EGA A;  2CPM A;  4JI1 C;  1N32 C;  2VQE C;  1MSZ A;  4JI4 C;  1IBM C;  4DV5 C;  3OTO C;  4DCT A;  1MKY A;  4DV7 C;  4DR2 C;  2UU9 C;  4NXM C;  3AF5 A;  1XMO C;  2ASB A;  1PA4 A;  1LQL A;  4LF8 C;  5LMU C;  4DV6 C;  1FJG C;  4DR7 C;  4DR3 C;  3I07 A;  2UUC C;  4DCV A;  1HNX C;  2OPL B;  2HHH C;  1HR0 C;  2OPL A;  2CY1 A;  4DV4 C;  1NYE A;  4JI5 C;  2E8E A;  4JV5 C;  2JMP A;  5A2Q D;  1JOS A;  4XX2 A;  1HNW C;  1WH9 A;  4LF9 C;  2E8F A;  2E5L C;  1I94 C;  4B3R C;  4KHP C;  4DCS A;  4YY3 C;  2UXC C;  2HJG A;  1K0R A;  4MH4 A;  4JYA C;  4B3T C;  2PN2 A;  4DR5 C;  4MTN A;  4BSZ A;  2UUA C;  1N33 C;  2CXC A;  3T1Y C;  4JI6 C;  2UXD C;  1KKG A;  3IEU A;  4DR1 C;  1J5E C;  1IBL C;  5LMN C;  1WHR A;  1USP B;  2F4V C;  1UKK A;  4JI2 C;  1N34 C;  3R9X A;  4DR6 C;  2ONF A;  1UG8 A;  1ZB8 A;  1IBK C;  3GKU A;  4DR4 C;  3J81 D;  2PT7 G;  4NXN C;  4LFA C;  2XR1 A;  2BJO A;  1VLA A;  4LF6 C;  3CJE A;  3LUS A;  4DUZ C;  1HNZ C;  3IEV A;  3EER A;  2E8C A;  5FLX D;  3AF6 A;  4DUY C;  4DV1 C;  1XNQ C;  5IWA C;  4DCU A;  3T1H C;  4B3S C;  4X66 C;  4DV3 C;  4X62 C;  4GKK C;  4X64 C;  2UXB C;  2KZF A;  2DYJ A;  2ATW A;  1QWI A;  1ZB9 A;  2VQF C;  4K0K C;  4LFC C;  2ZM6 C;  2YCB A;  5IT9 D;  2D7V A;  1L2F A;  2E7G A;  3R9W A;  1ML8 A;  1XMQ C;  4DV0 C;  4B3M C;  3J80 D;  4LF7 C; 
#chains in the Genus database with same CATH topology
 2VQF H;  1N36 H;  1NH5 A;  2LY6 A;  5AQK A;  4YHH C;  4JI1 H;  1T5D X;  5K8F A;  2LJM A;  3SF4 D;  2LF0 A;  4R1M A;  1NRB A;  5LMN H;  4DV2 H;  2D1Q A;  4CQK A;  1USP A;  2N66 A;  1HH2 P;  3OSS D;  2E3G A;  5KYT A;  5FPD A;  4LFB C;  1MR4 A;  1MXA A;  3KC6 A;  4H5T A;  4JYA H;  2I61 A;  2CPM A;  2P02 A;  4JI4 H;  3T1Y H;  3OTO C;  1TI5 A;  5KYV A;  2UU9 C;  1BUP A;  1K8B A;  4KBO A;  4LFC H;  2E2F A;  1XMO C;  2ASB A;  1PA4 A;  1LQL A;  3KDG A;  4JI2 H;  2E0G A;  5AQQ A;  5AQH A;  2QWR A;  5CZX A;  4DR7 C;  2M8W A;  2G2K A;  2Z51 A;  3I07 A;  2B3C A;  2BRZ A;  2A7T A;  5AE1 A;  2QWN A;  2KBJ A;  2HHH C;  1V25 A;  3A4I A;  1HR0 C;  2M5O A;  4JI5 H;  4DV4 C;  5BPL A;  2AYA A;  5AQU A;  4DV6 H;  1VEH A;  3K6R A;  3PBK A;  5ADZ A;  3LGX A;  1SN1 A;  2E88 A;  4XX2 A;  1ZU3 A;  1N4N A;  4LFA H;  2QW0 X;  3D2E B;  1X0A A;  3QFP A;  1GPT A;  4HPV A;  3VNS A;  1I94 H;  4B3R H;  2DPL A;  2E8F A;  3G7S A;  2BL5 A;  2OPV A;  4KHP C;  2UXC C;  5BUR A;  4LIJ A;  1CN2 A;  2CTL A;  1OMY A;  5EX5 A;  1YJ7 A;  4DR5 C;  1XNQ H;  5K36 G;  2JEA I;  2CTM A;  1LQI A;  2CXC A;  4DV3 H;  3IML A;  3E7W A;  5BR8 H;  1V60 A;  1IBL C;  1T7A A;  3FZL A;  1NY8 A;  3PRO C;  3V69 A;  1XHJ A;  2K1H A;  4FUT A;  1TH5 A;  1UG8 A;  5IFI A;  4DV4 H;  5AQW A;  3A26 A;  2D56 A;  1XS3 A;  1FLO A;  2PT7 G;  3IPL A;  1C56 A;  5BSM A;  1T5H X;  4RM2 A;  1DQ7 A;  4LF6 C;  4OO1 G;  3TUF A;  4DUZ C;  1ULT A;  2P2B A;  4HHF A;  3ETC A;  3LNV A;  4H5W A;  1ZZJ A;  4KYP A;  4PUI A;  1HNW H;  5IWA C;  4DCU A;  1WE8 A;  2ASC A;  2N69 A;  2D1S A;  2OO4 A;  2WP0 C;  2P2J A;  3UEB A;  3T1H C;  1XRH A;  2BUP A;  5AQG A;  2KZF A;  2ATW A;  5FPN A;  2SN3 A;  3ATV A;  3CQ1 A;  2F4V H;  3VKE A;  4H5V A;  4OCH A;  4RLF A;  2Y27 A;  1HJO A;  3AEV B;  3R2V A;  2UUB H;  2YCB A;  4AB0 A;  1VNB A;  5K85 A;  2N2R A;  5AE3 A;  4NZR M;  5JEA G;  1FUG A;  1PU1 A;  1V26 A;  1T1T A;  3SO4 A;  2Z0S A;  4JVH A;  3FE1 A;  4FJS A;  4B3M C;  1ZUT A;  3J80 D;  3UX3 A;  3S82 A;  2CWF A;  3I33 A;  3D2E A;  2UUB C;  1NGI A;  4JI3 C;  1SN4 A;  1ATR A;  4RLQ A;  1Z2I A;  4DV2 C;  3T1H H;  4AM3 A;  2QWO A;  2A1S A;  2QL8 A;  3TR3 A;  4LE5 A;  4DR1 H;  3I0P A;  3FZM A;  1WMT A;  3QI7 A;  4DG9 A;  4OX9 C;  4X65 C;  4LF4 C;  4AEI A;  3RG2 A;  3JAM D;  4HWI A;  1FJG H;  1LQQ A;  2LR3 A;  1CHZ A;  2YQR A;  2CTK A;  1NGF A;  1NGJ A;  3GR5 A;  2VQE C;  1SEG A;  1T7B A;  4WAN A;  4NXN H;  4V1D C;  3DHV A;  1O9T A;  4JI4 C;  1J5K A;  3VNR A;  1MKY A;  2Y4O A;  4NXM C;  2LTM A;  5AQP A;  2YC1 C;  1V8C A;  5LMU C;  3BK3 C;  2JA9 A;  3IUC A;  4DR3 C;  4FL9 A;  1ZVE A;  4X66 H;  2G8Y A;  2YBR C;  2MJH A;  4JI7 H;  2DGR A;  2P2F A;  2E0H A;  1HNX C;  2QND A;  3NCV A;  2OPL A;  1RY2 A;  5BSU A;  4B8T A;  3DAY A;  4JI5 C;  1UWD A;  2JE6 I;  2JMP A;  3ATU A;  5LMU H;  1KHM A;  3CW4 A;  2P2R A;  1P7L A;  1QM4 A;  3N2Q A;  4DV1 H;  1WH9 A;  3GPC A;  3LDP A;  5H9U A;  5AQX A;  1XRS B;  3D2F A;  1HNZ H;  1AN7 A;  4L7I A;  2E5L C;  5BN9 A;  1ICA A;  1ATS A;  4FSV A;  2KDN A;  3NPD A;  5A19 A;  4AIM A;  1K1G A;  1X9Z A;  1NRA A;  4RVN A;  2X06 A;  4JI3 H;  5EXW A;  2KJA A;  1ODH A;  3L95 X;  4MTN A;  4DR4 H;  5KK4 A;  5AQL A;  1XRC A;  1KKG A;  3FAU A;  4DR1 C;  1J5E C;  4D56 A;  5LMN C;  1WHR A;  3RF2 A;  1UKK A;  4JI2 C;  1N34 C;  3R9X A;  4OXI A;  2ONF A;  4DR6 C;  5AQJ A;  3I08 A;  2DHM A;  4DR7 H;  2D9I A;  2OPU A;  4GXR A;  2NY8 X;  1PX9 A;  1NGG A;  2E3F A;  1ZB8 A;  1BA0 A;  5AQO A;  3GKU A;  4DR4 C;  3KOY A;  1T0Z A;  4JVY A;  2BH1 X;  4UJ0 A;  2D1T A;  5BSV A;  3AY0 A;  3CJE A;  1JXC A;  3KVG A;  4LF9 H;  5LL6 b;  1WTJ A;  4FUQ A;  1B3C A;  2Y4N A;  2D1R A;  3JAM W;  2P2M A;  5IWA H;  1I6F A;  2YEO A;  3QFU A;  1XRB A;  1XNR H;  4NBQ A;  3LNO A;  4GKK C;  2YWC A;  3A25 A;  1J5E H;  1HPM A;  4GS5 A;  3E7X A;  2VZE A;  2ANR A;  5T8S A;  4IFD G;  1N34 H;  4DR6 H;  2VQF C;  1PTX A;  1ZYW A;  1XMO H;  3KHW A;  2LKB A;  1UGL A;  5AQR A;  1I2U A;  4LFB H;  5FPM A;  2ANN A;  2UUA H;  2D7V A;  2NY9 X;  2B68 A;  3L4I A;  3R9W A;  4X62 H;  1B7D A;  1XMQ C;  4B3M H;  2YIP A;  2MM9 A;  4UAF E;  2OBV A;  4RVO A;  4E9J A;  4DR2 H;  4K0K C;  1F0X A;  2HH2 A;  3L56 A;  1NGA A;  3UOE A;  4HE7 A;  4NDN A;  4R1L A;  1QQM A;  2LI7 A;  4KTV A;  1ZVG A;  4G1I A;  4JI0 C;  5BSR A;  5A2Q W;  1NGC A;  1AMU A;  1DJT A;  1O92 A;  2CU6 A;  1N32 H;  2ATB A;  4AQY H;  3D2F B;  4JM1 A;  2JNV A;  4TPS B;  1HNX H;  1EC6 A;  1QQO A;  5BR8 C;  2PQU A;  2MBK A;  4JI8 C;  4ISB A;  4IR7 A;  4LF5 C;  3UZ0 A;  2LRR A;  2VKC A;  5A1G A;  3FZK A;  1GPS A;  5A1I A;  1N36 C;  2KGQ A;  5FLX W;  1OZZ A;  5AQY A;  1QQN A;  2KSK A;  1KAY A;  5AQV A;  1EGA A;  5FPE A;  4JI7 C;  1N32 C;  3B7W A;  1I2V A;  4RMN A;  4DCT A;  4QMF B;  3CW8 X;  4DR2 C;  1T7E A;  2K35 A;  3KOZ A;  4LF7 H;  1V9N A;  2LN8 A;  4I9F A;  2NN6 G;  5C0X G;  3CQX A;  4I9G A;  4DV6 C;  5AE2 A;  1FJG C;  2CTJ A;  4X65 H;  4PUH A;  4LF4 H;  3J81 W;  4GKK H;  4AAZ A;  3PSM A;  1N33 H;  4FJU A;  2UUC C;  2OPL B;  4WAL A;  1IBL H;  2QVX X;  4D4I A;  3J80 W;  1WCJ A;  3EZJ A;  4L2Z A;  5AQM A;  3LDQ A;  2CY1 A;  5AQT A;  2E8E A;  1JOS A;  3NYR A;  5BUQ A;  5EY4 A;  3LDO A;  4EC5 A;  1VIG A;  4PDB A;  3N54 B;  4LF9 C;  4ZJZ A;  5BUS A;  1NGD A;  4L4Q A;  4PZP A;  4DCS A;  1P0A A;  4YY3 C;  2HJG A;  4BC7 A;  4JYA C;  3JXU A;  4B3T C;  5DV9 A;  5E7Q A;  1S03 G;  2LTL A;  5F2R A;  2UUA C;  3LDL A;  4IZ6 A;  3T1Y C;  4UAE F;  1C55 A;  3IEU A;  3UX2 A;  1YUW A;  1USP B;  1FKA H;  4LF8 H;  2QWQ A;  1NGB A;  4GNI A;  1NE5 A;  2UU9 H;  2YIL A;  1JZA A;  1ZFU A;  2BJO A;  2QXL A;  5F0X A;  1VLA A;  4R0M A;  1JZB A;  1ZZK A;  4DV5 H;  3LUS A;  3O2E A;  1HNZ C;  2E5L H;  4D57 A;  2KYQ A;  2E8C A;  5FLX D;  4DV1 C;  5EVZ A;  4DUY H;  5T8T A;  2NCL A;  2PY9 A;  4B3S C;  4WV3 A;  4X66 C;  2VSQ A;  4X64 C;  5BSW A;  5AQZ A;  1BRZ A;  2UXB C;  2DYJ A;  3C5E A;  3FCC A;  3CQ3 A;  4PUG A;  1BK8 A;  1ZB9 A;  2MZ0 A;  3A8Y A;  3KOX A;  3CQ2 A;  2QWP A;  1MD9 A;  2ZM6 C;  4GXQ A;  2M6Q A;  1KV0 A;  5BPN A;  1IBK H;  4BC9 A;  3L6Q A;  2CPQ A;  1P00 A;  4DR3 H;  2BA0 A;  2KBK A;  3C7N B;  5AQF A;  2E7G A;  2P20 A;  5GTD A;  2VQE H;  5JRH A;  1PG4 A;  4DV0 C;  2UXB H;  4LF6 H;  2JVZ A;  1LQH A;  3SB1 A;  1RG9 A;  1KAZ A;  5BN8 A;  1JKZ A;  4LF7 C;  4KHP H;  4NOZ A;  3RV2 A;  4JI0 H;  3QML A;  2QVY X;  3HSC A;  2Y3M A;  5AQS A;  1WT7 A;  4GKJ C;  2HH3 A;  4B3S H;  2LT8 A;  3KOW A;  1O93 A;  4EAT A;  4AQY C;  3KP1 A;  2AXY A;  2UXD H;  1BA1 A;  4ZLP A;  1HR0 H;  1GPM A;  2E3U A;  3VNQ A;  2ZZM A;  2V7B A;  1P4E C;  4JI8 H;  1WF3 A;  2EGT A;  1DT4 A;  1S3X A;  4YY3 H;  1N2F A;  1XNR C;  4BA1 I;  1XRA A;  4JI1 C;  3E7U X;  3CW9 A;  2E8A A;  2O4C A;  4KTT A;  1MSZ A;  1BCG A;  1IBM C;  1BA3 A;  4U5Y D;  1POI A;  4DV5 C;  4JI6 H;  1TUA A;  4DV7 C;  1L4V A;  2GL1 A;  2WD9 A;  1P4E A;  5AQN A;  4K0K H;  1MDF A;  3AF5 A;  3DLP X;  2ZM6 H;  4LF8 C;  4B8C D;  4NZT M;  1FH3 A;  4OD6 A;  1NPI A;  5BST A;  5CZV A;  2CWH A;  3FZF A;  4YHH H;  5IT9 W;  1IB8 A;  4H8A A;  4IO8 A;  3GL1 A;  2JEB I;  2MCQ A;  2PRO A;  4DCV A;  3PES A;  2UUC H;  3A9U A;  4H5R A;  2KHO A;  1PG3 A;  1ZYV A;  2JDQ D;  1O90 A;  4G36 A;  3TDE A;  2YWB A;  1NYE A;  5AQI A;  4PHT A;  2VY6 A;  5A2Q D;  5F1X A;  4JV5 C;  1DTJ A;  3EQ6 A;  1M6X C;  2ZQE A;  1SNB A;  2MN5 A;  1MDB A;  3GR1 A;  4D4G A;  3GDQ A;  1HNW C;  3FZH A;  5KEI A;  3U1K A;  3OTO H;  4H5N A;  3FCE A;  4DUZ H;  1PE4 A;  2QVZ X;  3KDK A;  1NGE A;  1I94 C;  2D28 C;  4B3R C;  2YX1 A;  1NXU A;  1K0R A;  4MH4 A;  1MXC A;  1WVN A;  2CTE A;  2PN2 A;  4GKJ H;  4JV5 H;  3GAB A;  2KZ0 A;  4BSZ A;  1LCI A;  2ZZN A;  1N33 C;  3LDN A;  4G37 A;  2MMA B;  4PRO C;  4JI6 C;  2UXD C;  1M6X A;  1NGH A;  1IBM H;  1KAX A;  4BA2 I;  1VBI A;  1HX1 A;  2HHH H;  4FTF A;  2F4V C;  2CTF A;  3L7Z C;  2KPY A;  2N2Q A;  2FMR A;  4BCA A;  3KXW A;  1AYJ A;  2QW9 A;  1IBK C;  3AY9 A;  2QWL A;  2D27 A;  3J81 D;  4OYC A;  4NXN C;  4DR5 H;  1PQX A;  3ETO A;  4LFA C;  2KBH A;  2XR1 A;  2JZX A;  3H2T A;  5AR0 A;  2YIO A;  3OET A;  4DV7 H;  1XMQ H;  4G08 A;  2M5H A;  2FFM A;  4ODJ A;  3M3Z A;  2M8B B;  3TQI A;  3E7R L;  4DG8 A;  1J4W A;  3GR0 A;  4LF5 H;  4WS9 A;  3IEV A;  2V7Z A;  1AHO A;  2QWM A;  3EER A;  5LCI A;  1X4M A;  3AF6 A;  4BBY A;  4DUY C;  1X4N A;  5DT9 A;  1XNQ C;  5CY0 A;  1BMR A;  2LY5 A;  3UOW A;  1MYN A;  4RM3 A;  1I6U A;  4DV3 C;  4X62 C;  1VIH A;  3QD7 X;  4X64 H;  1QWI A;  1VNA A;  1I6G A;  2UXC H;  5BPM A;  4LFC C;  2P2Q A;  1DKG D;  2GMO A;  3LAX A;  1ZTG A;  1SEI A;  4B3T H;  4NXM H;  3J7A K;  3C7N A;  3L8C A;  3NI2 A;  2FPH X;  5IT9 D;  3KP0 A;  3NYQ A;  1L2F A;  4UAD E;  3A9V A;  3R44 A;  2LJ7 A;  1ML8 A;  1S20 A;  1MXB A;  4DV0 H;  1WWN A;  1ZZI A;  4OX9 H;  4K0B A; 
#chains in the Genus database with same CATH homology
 4YHH C;  1T5D X;  5K8F A;  4R1M A;  2D1Q A;  1USP A;  1HH2 P;  5KYT A;  4LFB C;  1MXA A;  2CPM A;  2P02 A;  3OTO C;  5KYV A;  2UU9 C;  1XMO C;  2ASB A;  1PA4 A;  1LQL A;  2E0G A;  5CZX A;  4DR7 C;  3I07 A;  5AE1 A;  2HHH C;  1V25 A;  3A4I A;  1HR0 C;  4DV4 C;  2AYA A;  3PBK A;  5ADZ A;  3LGX A;  4XX2 A;  2QW0 X;  4HPV A;  3VNS A;  2DPL A;  2E8F A;  3G7S A;  4KHP C;  2UXC C;  5BUR A;  1YJ7 A;  4DR5 C;  2CXC A;  3IML A;  3E7W A;  1IBL C;  3PRO C;  4FUT A;  1UG8 A;  5IFI A;  2PT7 G;  3IPL A;  5BSM A;  1T5H X;  4RM2 A;  4LF6 C;  3TUF A;  4DUZ C;  1ULT A;  2P2B A;  3ETC A;  3LNV A;  5IWA C;  4DCU A;  2OO4 A;  2D1S A;  3T1H C;  2WP0 C;  2P2J A;  2KZF A;  2ATW A;  4RLF A;  2Y27 A;  2YCB A;  5K85 A;  5AE3 A;  1FUG A;  1V26 A;  3SO4 A;  4B3M C;  3J80 D;  3S82 A;  2UUB C;  4JI3 C;  4RLQ A;  4DV2 C;  2A1S A;  2QL8 A;  4LE5 A;  4DG9 A;  4OX9 C;  4X65 C;  4LF4 C;  3RG2 A;  3JAM D;  2VQE C;  3DHV A;  1O9T A;  4JI4 C;  3VNR A;  1MKY A;  2Y4O A;  4NXM C;  5LMU C;  4DR3 C;  2P2F A;  1HNX C;  2OPL A;  1RY2 A;  5BSU A;  3DAY A;  4JI5 C;  2JMP A;  1P7L A;  1QM4 A;  3N2Q A;  1WH9 A;  3GPC A;  5H9U A;  4L7I A;  2E5L C;  3NPD A;  5A19 A;  4RVN A;  3L95 X;  4MTN A;  1XRC A;  1KKG A;  4DR1 C;  1J5E C;  4D56 A;  5LMN C;  1WHR A;  1UKK A;  4JI2 C;  1N34 C;  3R9X A;  4OXI A;  2ONF A;  4DR6 C;  3I08 A;  4GXR A;  1ZB8 A;  3GKU A;  4DR4 C;  2BH1 X;  2D1T A;  5BSV A;  3CJE A;  4FUQ A;  2Y4N A;  2D1R A;  2P2M A;  1XRB A;  4GKK C;  2YWC A;  4GS5 A;  3E7X A;  2VZE A;  5T8S A;  2VQF C;  2D7V A;  3R9W A;  1XMQ C;  2OBV A;  4RVO A;  4K0K C;  4NDN A;  4R1L A;  4KTV A;  4G1I A;  4JI0 C;  5BSR A;  1AMU A;  1O92 A;  4JM1 A;  4TPS B;  5BR8 C;  4JI8 C;  4ISB A;  4IR7 A;  4LF5 C;  3UZ0 A;  2LRR A;  5A1G A;  1N36 C;  5A1I A;  4JI7 C;  1EGA A;  1N32 C;  3B7W A;  4RMN A;  4DCT A;  3CW8 X;  4DR2 C;  4I9F A;  4I9G A;  4DV6 C;  1FJG C;  5AE2 A;  2UUC C;  2OPL B;  2QVX X;  4D4I A;  4L2Z A;  2CY1 A;  2E8E A;  1JOS A;  3NYR A;  5BUQ A;  3N54 B;  4LF9 C;  4ZJZ A;  5BUS A;  4L4Q A;  4PZP A;  4DCS A;  4YY3 C;  2HJG A;  4BC7 A;  4JYA C;  4B3T C;  5DV9 A;  5E7Q A;  2UUA C;  4IZ6 A;  3T1Y C;  3IEU A;  1USP B;  2BJO A;  1VLA A;  4R0M A;  3LUS A;  1HNZ C;  4D57 A;  2E8C A;  5FLX D;  4DV1 C;  5T8T A;  4B3S C;  4WV3 A;  4X66 C;  2VSQ A;  4X64 C;  5BSW A;  2UXB C;  2DYJ A;  3C5E A;  3FCC A;  1ZB9 A;  1MD9 A;  2ZM6 C;  4GXQ A;  4BC9 A;  2E7G A;  5GTD A;  2P20 A;  5JRH A;  1PG4 A;  4DV0 C;  1RG9 A;  4LF7 C;  4NOZ A;  3RV2 A;  2QVY X;  4GKJ C;  1O93 A;  4EAT A;  4AQY C;  4ZLP A;  1GPM A;  3VNQ A;  2V7B A;  1WF3 A;  2EGT A;  1N2F A;  1XNR C;  1XRA A;  4JI1 C;  3CW9 A;  4KTT A;  1MSZ A;  1IBM C;  1BA3 A;  4U5Y D;  4DV5 C;  4DV7 C;  2WD9 A;  1MDF A;  3AF5 A;  3DLP X;  4LF8 C;  5BST A;  5CZV A;  2PRO A;  4DCV A;  3PES A;  3A9U A;  1PG3 A;  1O90 A;  4G36 A;  3TDE A;  2YWB A;  1NYE A;  4PHT A;  4JV5 C;  5A2Q D;  3EQ6 A;  1HNW C;  1MDB A;  4D4G A;  3GR1 A;  5KEI A;  3FCE A;  2QVZ X;  1I94 C;  4B3R C;  2D28 C;  1K0R A;  4MH4 A;  1MXC A;  2PN2 A;  4BSZ A;  1LCI A;  1N33 C;  4G37 A;  4PRO C;  4JI6 C;  2UXD C;  4FTF A;  2F4V C;  4BCA A;  3KXW A;  1IBK C;  2D27 A;  3J81 D;  4OYC A;  4NXN C;  3ETO A;  4LFA C;  2XR1 A;  3H2T A;  4ODJ A;  3TQI A;  4DG8 A;  3GR0 A;  4WS9 A;  3IEV A;  3EER A;  3AF6 A;  4BBY A;  4DUY C;  1XNQ C;  3UOW A;  4RM3 A;  4DV3 C;  4X62 C;  1QWI A;  4LFC C;  2P2Q A;  3LAX A;  3NI2 A;  3L8C A;  5IT9 D;  3NYQ A;  1L2F A;  3A9V A;  3R44 A;  1ML8 A;  1MXB A;  4K0B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...