3GKUA

Crystal structure of a probable rna-binding protein from clostridium symbiosum atcc 14940
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
208
structure length
206
Chain Sequence
MDMVTVTAKTVEEAVTKALIELQTTSDKLTYEIVEKGSAGFIGSKPAIIRAKRKETLQDKAIEFLEQVFDAMNMAVDISVEYNETEKEMNVNLKGDDMGILIGKRGQTLDSLQYLVSLVVNKSSSDYIRVKLDTENYRERRKETLETLAKNIAYKVKRTKRSVSLEPMNPYERRIIHAALQNDKYVVTRSDGEEPFRHVIISLKRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of a probable RNA-binding protein from Clostridium symbiosum ATCC 14940
rcsb
source organism Clostridium symbiosum atcc 14940
molecule tags Rna binding protein
molecule keywords Probable RNA-binding protein
total genus 55
structure length 206
sequence length 208
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01424 R3H R3H domain
A PF13083 KH_4 KH domain
A PF14804 Jag_N Jag N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.80 Alpha Beta 2-Layer Sandwich Defensin A-like probable RNA-binding protein from clostridium symbiosum atcc 14940 3gkuA01
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 3gkuA02
3.30.1370.50 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 R3H-like domain 3gkuA03
2A1SA 3GKUA 2UU9C 4NXNC 2PN2A 1IBLC 1ZB8A 3I07A 1N36C 1USPB 4JI8C 4GKJC 4B3MC 4MH4A 2VQEC 3T1HC 1L2FA 4DV5C 4DV6C 4YY3C 4DR7C 2UXCC 4B3TC 2OPLA 4DR4C 2PT7G 2JMPA 2ASBA 4X62C 1PA4A 2UUCC 1MKYA 4DV0C 2DYJA 4JI0C 3R9XA 2CPMA 5A2QD 3IEVA 1WHRA 2UUBC 4JI3C 3OTOC 4X65C 2F4VC 2UXDC 2E8FA 4JI1C 1MSZA 4NOZA 4DR2C 4MTNA 5LMNC 2ZM6C 4DUZC 4DCSA 4DV4C 1N2FA 2UXBC 1WF3A 4DR3C 1UG8A 1LQLA 3AF6A 4DCUA 4OX9C 4LFAC 3AF5A 1FJGC 1HNZC 4JI6C 4JI4C 1IBKC 1QWIA 1J5EC 2OPLB 4X64C 4DR1C 2KZFA 4NXMC 1HH2P 4LFCC 1UKKA 4DCVA 2YCBA 4DR6C 4B3RC 1XNRC 2ATWA 3CJEA 1I94C 4LFBC 4JI7C 2LRRA 2D7VA 4DV2C 1ML8A 4DCTA 4LF6C 2BJOA 5IT9D 4GKKC 1K0RA 2CY1A 4AQYC 5FLXD 3JAMD 1JOSA 2E5LC 4DV1C 2UUAC 4B3SC 4JYAC 3LUSA 3EERA 1USPA 1N32C 5IWAC 4LF9C 5BR8C 1N33C 2QL8A 1XMOC 3IEUA 4BSZA 3T1YC 4DR5C 1HNXC 4LF8C 4X66C 1ZB9A 2E8EA 4LF4C 5LMUC 4LF7C 2ONFA 2HHHC 4XX2A 1KKGA 2XR1A 4DV7C 4DV3C 3R9WA 3J80D 4KHPC 4LF5C 1HNWC 4K0KC 4DUYC 1VLAA 2CXCA 2VQFC 1IBMC 4JI2C 1EGAA 2HJGA 1NYEA 4JI5C 2E7GA 4JV5C 3J81D 1HR0C 1WH9A 2E8CA 4YHHC 2EGTA 1XMQC 1XNQC 1N34C
chains in the Genus database with same CATH superfamily
3OSSD 3ATUA 3ETCA 2MZ0A 1L4VA 1BA0A 5A1IA 4I9FA 4D4IA 3KVGA 3LDQA 1JKZA 4YHHH 4GKJC 4DV3H 2KZ0A 1HR0H 4RVOA 1BUPA 3UX3A 3FZMA 4DV6C 4DR7C 1T5DX 3DLPX 1GPMA 2OPLA 4LF4H 3CQXA 2ASBA 5EY4A 2YX1A 2M8BB 1HNXH 4X62C 2F4VH 3FZFA 1MKYA 1C56A 5BSWA 2QWRA 2DYJA 5IT9W 3G7SA 2I61A 2K35A 1AMUA 1WWNA 3T1HH 5IWAH 2BL5A 2ATBA 1ZVGA 2HHHH 1N32H 1BCGA 3L8CA 2D1SA 2LI7A 1ZUTA 3QMLA 3GR0A 4PZPA 5A1GA 1S03G 4DR6H 1MDBA 1HPMA 1T7AA 1PTXA 2KBKA 3AY0A 4D4GA 4NBQA 2PQUA 2E8FA 2YWCA 3I08A 1MDFA 2JEBI 4JI1C 4QMFB 1MSZA 4DR2C 5K36G 3KOXA 1WTJA 2FMRA 2K1HA 2YC1C 4DV4C 1ZVEA 1N2FA 4OCHA 2UUCH 5BUQA 1UG8A 3L95X 4RVNA 1LQLA 1HNWH 1MYNA 1XNQH 3UZ0A 3N54B 4LFAC 2N66A 4JI6H 5AQHA 2P20A 3KOZA 1X4MA 2MJHA 4DR1C 5AQFA 1HH2P 1HJOA 1PQXA 3C7NB 2UXBH 3A9VA 3N2QA 3LNVA 1I94C 2QVYX 4JI7C 1IBKH 5AQTA 3E7UX 1ML8A 5LMNH 1ZU3A 4OO1G 1PU1A 3L7ZC 1ZZJA 2Z0SA 1K0RA 4IZ6A 3J81W 2E5LC 4BBYA 3E7RL 1VBIA 2KGQA 2N2RA 3JXUA 5BPNA 5AQNA 4RM3A 4ZJZA 2LTMA 2QVZX 2V7ZA 4X65H 2KYQA 3KP0A 2MM9A 3EERA 2ZQEA 4JM1A 3J7AK 3D2FB 2Y27A 3TDEA 2Y4OA 3B7WA 1MD9A 3HSCA 4EC5A 1POIA 1DJTA 2DHMA 1XRAA 1MR4A 4DR5C 3FZHA 1WVNA 1O93A 2MCQA 5CY0A 4H5RA 2XR1A 4DV7C 1NRBA 4H5NA 5EVZA 4LFBH 2OPVA 4KHPC 4LF5C 3PSMA 4K0KC 3O2EA 1QQNA 4L2ZA 5KK4A 4KTTA 5DT9A 5A19A 1WT7A 2YIPA 4DR1H 3LGXA 4UJ0A 2KBHA 4DV7H 1AYJA 3AY9A 3JAMW 2E8CA 2KHOA 4LFAH 1I6FA 5AQSA 2E3UA 3KXWA 3KC6A 4HE7A 2NY8X 4EATA 1N34C 1FUGA 1Z2IA 1NRAA 2HH2A 1KV0A 1O90A 4JI2H 5EXWA 1C55A 4X66H 4DR3H 1ZB8A 4AEIA 2LKBA 3OTOH 2E0HA 2VKCA 1USPB 4RM2A 4JI8C 1XMQH 2ZZMA 3NI2A 4MH4A 3C5EA 2VQEC 3T1HC 4DV5C 1S20A 2YBRC 2OO4A 1NGDA 3IMLA 1OZZA 4YY3C 4JI0H 2QWPA 4LF9H 1SN1A 2UXDH 1QQMA 3UOEA 1FLOA 3R44A 4JVYA 1CN2A 2WP0C 1P4EC 1P4EA 1XMOH 4B3TH 5AQOA 1PE4A 3IEVA 3NCVA 1WHRA 5AR0A 2JA9A 4PROC 1PG4A 5E7QA 1EC6A 1JZAA 4JI7H 3OTOC 1T5HX 1ATRA 2LT8A 5AQIA 2F4VC 4X62H 1IBLH 2AYAA 3EQ6A 4LE5A 4YY3H 2NCLA 2E88A 1SEGA 2QW0X 3S82A 4JVHA 1LQIA 1NGAA 1T7EA 1XRHA 1KHMA 4K0BA 4DCSA 4JI5H 2QWMA 1K8BA 3GL1A 3GPCA 2UXBC 5AQQA 5AQMA 5K8FA 3M3ZA 1WCJA 5FLXW 1N34H 3EZJA 3L4IA 1DTJA 3QFPA 4DCUA 3IPLA 2Y3MA 2ZM6H 3AF5A 4DUZH 2P2MA 4JI6C 4OD6A 4ZLPA 4JI4C 3TQIA 3UOWA 2ANRA 1QWIA 5KYVA 3QI7A 5H9UA 1I6GA 4G08A 4LIJA 2VQFH 1UKKA 5EX5A 4DCVA 4B3RC 2JNVA 2ATWA 5F0XA 2P2BA 2KJAA 4LFBC 1TUAA 3FZLA 1TI5A 4KHPH 5FPNA 2KSKA 2D7VA 1O9TA 2QXLA 3T1YH 3D2FA 2M5OA 3VKEA 1FJGH 2N69A 1NGBA 4LF6C 1N33H 3TR3A 5BSVA 1V9NA 2CWFA 5FLXD 3U1KA 2QNDA 1VEHA 1DKGD 5AE1A 3CW9A 5BSTA 5FPDA 2UUAC 2P2RA 4BA1I 3J80W 2GL1A 3LUSA 2M8WA 1USPA 1N32C 2M6QA 4DR4H 4R1MA 1UGLA 4DR7H 1N33C 2E3GA 4GNIA 2M5HA 3FCEA 1V25A 1XMOC 3IEUA 2KPYA 4BSZA 2CTKA 4AM3A 2CTJA 4H8AA 2LJ7A 1XNRH 4DR5H 1BMRA 1ZB9A 4G36A 2ONFA 1WE8A 1CHZA 3SO4A 2UUAH 5BPLA 4PUGA 5FPMA 4AB0A 4XX2A 1KKGA 1YUWA 5AQPA 1NGHA 4RLQA 3J80D 3OETA 4JV5H 1ICAA 1HNWC 3GR5A 4U5YD 2MMAB 2DGRA 4B3RH 4WANA 1IBMC 2CXCA 1T7BA 4LFCH 1EGAA 2HJGA 1JXCA 1NGEA 1RY2A 4RLFA 4WV3A 3QD7X 3NPDA 2LJMA 2VY6A 4DV2H 1NGIA 5T8TA 4YHHC 1I94H 5AQKA 4LF7C 2V7BA 2Z51A 1ATSA 5IFIA 3GKUA 1P7LA 5BSMA 2QWLA 4FUQA 2UU9C 4NXNC 2PN2A 4DV4H 2D56A 2CU6A 3I07A 1N36C 2BUPA 2VSQA 4NZTM 5T8SA 2B3CA 1L2FA 2VZEA 4DR2H 4IFDG 2YQRA 2P2FA 2UXCC 2CTMA 1BA3A 4DR4C 5LL6b 1ODHA 2PT7G 3VNSA 2DPLA 2AXYA 1T0ZA 2UUCC 2LR3A 5BN9A 2D1TA 2CWHA 1XS3A 3CW4A 4HWIA 5FPEA 1KAYA 4DV0C 5A2QD 2E8AA 4UADE 4DV5H 3E7XA 4CQKA 4FTFA 1B7DA 3SF4D 4JI3C 1N36H 3ETOA 4X65C 1NPIA 5JEAG 3FE1A 1NE5A 1X0AA 3PESA 4AQYH 2UXDC 1XRBA 2BRZA 1J5EH 2UXCH 4NOZA 1ZYVA 1F0XA 4JI4H 4BC9A 3BK3C 5LMNC 5F2RA 2G2KA 4G1IA 3I33A 1LQHA 2ZZNA 3IUCA 4I9GA 2QW9A 1WF3A 2E5LH 4NXNH 5AQWA 1DT4A 4LF7H 2G8YA 1I2UA 4PDBA 3AF6A 5BUSA 4DV6H 1FJGC 1HNZC 1M6XC 3KDGA 1X4NA 4L7IA 1V26A 3E7WA 1IBKC 3PBKA 4R1LA 2OPLB 4OYCA 4X64C 2KZFA 3FCCA 2YWBA 3CQ1A 1LQQA 2YCBA 4DR6C 3C7NA 1HX1A 4K0KH 1ZYWA 2LRRA 4DCTA 1J5KA 3LDPA 4GXRA 5BSRA 3QFUA 2BJOA 2X06A 5BR8H 1ULTA 2WD9A 4DV0H 1MXCA 2KBJA 5DV9A 2P2QA 1JOSA 5F1XA 4DV1C 4UAEF 4HPVA 1NGCA 4JYAC 2NN6G 4BCAA 1XRSB 4JI3H 1MXAA 4FJUA 3I0PA 1DQ7A 4IR7A 4LF9C 3RF2A 5BR8C 1K1GA 1PX9A 4FL9A 1SNBA 3KOWA 2N2QA 2QL8A 2VQEH 1B3CA 2GMOA 1TH5A 1XRCA 3T1YC 4BA2I 1ZFUA 4JYAH 1PG3A 2A7TA 1OMYA 2P2JA 2YEOA 3K6RA 4LF8C 4X66C 1S3XA 5ADZA 2OPUA 4LF4C 1YJ7A 5LMUC 2HHHC 3A8YA 3LDLA 3UX2A 2LY6A 3ATVA 1GPSA 2UUBH 2D27A 1WMTA 1BK8A 2D28C 1IB8A 2JDQD 1XHJA 2PROA 2HH3A 1BRZA 5C0XG 4DUYC 2CTFA 3LAXA 1VLAA 1T1TA 4JI2C 4X64H 3GDQA 5BSUA 2E7GA 3NYQA 1ZZKA 2E0GA 1HR0C 3A4IA 4B3MH 3DAYA 4WALA 2B68A 4G37A 2EGTA 1XMQC 2JZXA 1UWDA 5AQGA 4JI1H 1XNQC 4JI8H 5AQLA 2A1SA 5LMUH 1IBLC 4IO8A 5AE3A 5K85A 4ISBA 2QWOA 2YIOA 4FJSA 4B3MC 1VIGA 2QWQA 4B3TC 5AQRA 3LNOA 3A9UA 3LDNA 2JMPA 3KDKA 4H5WA 4RMNA 4DG8A 2D9IA 1PA4A 4PHTA 1J4WA 4LF8H 1JZBA 2CPQA 1V8CA 4FSVA 2MN5A 2E2FA 1NGFA 4HHFA 2CPMA 4JI0C 3R9XA 4GKKH 5KYTA 1NGGA 1P00A 2JE6I 1NH5A 4GXQA 2UUBC 2LTLA 2JEAI 2KDNA 3PROC 3KHWA 4WS9A 5GTDA 3CW8X 3R2VA 4KBOA 2QVXX 3UEBA 1FKAH 4B3SH 2QWNA 1ZTGA 5AQXA 4L4QA 2CTEA 4E9JA 4B8TA 4MTNA 2P02A 2ZM6C 4DUZC 1ZZIA 2LN8A 4H5TA 3NYRA 2LY5A 1NGJA 1I2VA 1BA1A 3KOYA 5AQJA 5CZVA 3VNQA 2D1QA 1KAXA 1VNAA 4D56A 4DR3C 1RG9A 5JRHA 1M6XA 3GABA 1AHOA 4LF5H 2FFMA 4OX9C 3D2EA 5LCIA 4NZRM 3LDOA 1O92A 3CQ3A 3H2TA 1HNZH 4NDNA 4H5VA 1J5EC 3L56A 3GR1A 2D1RA 4NXMC 3FZKA 4PUHA 4GS5A 4BC7A 4LFCC 2FPHX 1IBMH 3KP1A 2Y4NA 1XNRC 1QM4A 3CJEA 4AIMA 4KTVA 1GPTA 2YILA 3TUFA 5BURA 5AQVA 1MXBA 4DV2C 5BPMA 3L6QA 2O4CA 5BN8A 5AQUA 5IT9D 4GKKC 2CY1A 4AQYC 1NY8A 3JAMD 3DHVA 2JVZA 3CQ2A 1SN4A 4D57A 4TPSB 2OBVA 4B3SC 1VNBA 4OXIA 5AQYA 3VNRA 5IWAC 4AAZA 5CZXA 1NXUA 4V1DC 3AEVB 3A25A 2CTLA 5AE2A 1I6UA 1X9ZA 4DV1H 5KEIA 1HNXC 3FAUA 5A2QW 4DG9A 2UU9H 1AN7A 2MBKA 2E8EA 3A26A 1SEIA 1QQOA 1VIHA 2PY9A 4ODJA 2LF0A 2E3FA 1LCIA 4KYPA 2BA0A 4UAFE 4LF6H 3SB1A 2BH1X 4DV3C 3R9WA 4GKJH 4OX9H 4FUTA 2SN3A 4PUIA 3RG2A 4B8CD 2ANNA 3V69A 4DUYH 2VQFC 1N4NA 1FH3A 1NYEA 4JI5C 4NXMH 3D2EB 1P0AA 2NY9X 4JV5C 1V60A 4R0MA 3RV2A 3J81D 1KAZA 1WH9A 5AQZA 2ASCA
chains in the Genus database with same CATH topology
3ETCA 5A1IA 4I9FA 4D4IA 4GKJC 4RVOA 4DV6C 4DR7C 1T5DX 3DLPX 1GPMA 2OPLA 2ASBA 4X62C 1MKYA 5BSWA 2DYJA 3G7SA 1AMUA 3L8CA 2D1SA 3GR0A 4PZPA 5A1GA 1MDBA 4D4GA 2E8FA 2YWCA 3I08A 1MDFA 4JI1C 1MSZA 4DR2C 4DV4C 1N2FA 5BUQA 1UG8A 3L95X 4RVNA 1LQLA 3UZ0A 3N54B 4LFAC 2P20A 4DR1C 1HH2P 3A9VA 3N2QA 3LNVA 1I94C 2QVYX 4JI7C 1ML8A 1K0RA 4IZ6A 2E5LC 4BBYA 4RM3A 4ZJZA 2QVZX 3EERA 4JM1A 2Y27A 3TDEA 2Y4OA 3B7WA 1MD9A 1XRAA 4DR5C 1O93A 2XR1A 4DV7C 4KHPC 4LF5C 4K0KC 4L2ZA 4KTTA 5A19A 3LGXA 2E8CA 3KXWA 1N34C 4EATA 1FUGA 1O90A 1ZB8A 1USPB 4RM2A 4JI8C 3NI2A 4MH4A 3C5EA 2VQEC 3T1HC 4DV5C 3IMLA 2OO4A 4YY3C 3R44A 2WP0C 3IEVA 1WHRA 4PROC 1PG4A 5E7QA 3OTOC 1T5HX 2F4VC 2AYAA 3EQ6A 4LE5A 2QW0X 3S82A 4K0BA 4DCSA 3GPCA 2UXBC 5K8FA 4DCUA 3IPLA 3AF5A 2P2MA 4JI6C 4ZLPA 4JI4C 3TQIA 3UOWA 1QWIA 5KYVA 5H9UA 1UKKA 4DCVA 4B3RC 2ATWA 2P2BA 4LFBC 2D7VA 1O9TA 4LF6C 5BSVA 5FLXD 5AE1A 3CW9A 5BSTA 2UUAC 3LUSA 1USPA 1N32C 4R1MA 1N33C 3FCEA 1V25A 1XMOC 3IEUA 4BSZA 1ZB9A 4G36A 2ONFA 3SO4A 4XX2A 1KKGA 4RLQA 3J80D 1HNWC 4U5YD 1IBMC 2CXCA 1EGAA 2HJGA 1RY2A 4RLFA 4WV3A 3NPDA 5T8TA 4YHHC 4LF7C 2V7BA 5IFIA 3GKUA 1P7LA 5BSMA 4FUQA 2UU9C 4NXNC 2PN2A 3I07A 1N36C 2VSQA 5T8SA 1L2FA 2VZEA 2P2FA 2UXCC 1BA3A 4DR4C 2PT7G 3VNSA 2DPLA 2UUCC 2D1TA 4DV0C 5A2QD 3E7XA 4FTFA 4JI3C 3ETOA 4X65C 3PESA 2UXDC 1XRBA 4NOZA 4BC9A 5LMNC 4G1IA 4I9GA 1WF3A 3AF6A 5BUSA 1FJGC 1HNZC 4L7IA 1V26A 3E7WA 1IBKC 3PBKA 4R1LA 2OPLB 4X64C 4OYCA 2KZFA 3FCCA 2YWBA 2YCBA 4DR6C 2LRRA 4DCTA 4GXRA 5BSRA 2BJOA 1ULTA 2WD9A 1MXCA 5DV9A 2P2QA 1JOSA 4DV1C 4JYAC 4HPVA 4BCAA 1MXAA 4IR7A 4LF9C 5BR8C 2QL8A 1XRCA 3T1YC 1PG3A 2P2JA 4LF8C 4X66C 5ADZA 4LF4C 1YJ7A 5LMUC 2HHHC 2D27A 2D28C 2PROA 4DUYC 3LAXA 1VLAA 4JI2C 5BSUA 2E7GA 3NYQA 2E0GA 1HR0C 3A4IA 3DAYA 4G37A 1XMQC 2EGTA 1XNQC 2A1SA 1IBLC 5AE3A 5K85A 4ISBA 4B3MC 4B3TC 3A9UA 2JMPA 4RMNA 4DG8A 1PA4A 4PHTA 2CPMA 4JI0C 3R9XA 5KYTA 4GXQA 2UUBC 3PROC 4WS9A 5GTDA 3CW8X 2QVXX 4L4QA 4MTNA 2P02A 2ZM6C 4DUZC 3NYRA 5CZVA 3VNQA 4D56A 2D1QA 4DR3C 1RG9A 5JRHA 4OX9C 1O92A 3H2TA 4NDNA 1J5EC 3GR1A 2D1RA 4NXMC 4BC7A 4LFCC 4GS5A 2Y4NA 1XNRC 1QM4A 3CJEA 4KTVA 3TUFA 5BURA 1MXBA 4DV2C 5IT9D 4GKKC 2CY1A 4AQYC 3JAMD 3DHVA 4D57A 4B3SC 2OBVA 4TPSB 4OXIA 3VNRA 5IWAC 5CZXA 5AE2A 5KEIA 1HNXC 4DG9A 2E8EA 4ODJA 1LCIA 2BH1X 4DV3C 3R9WA 4FUTA 3RG2A 2VQFC 1NYEA 4JI5C 4JV5C 4R0MA 3J81D 3RV2A 1WH9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A1S A;  3GKU A;  2UU9 C;  4NXN C;  2PN2 A;  1IBL C;  1ZB8 A;  3I07 A;  1N36 C;  1USP B;  4JI8 C;  4GKJ C;  4B3M C;  4MH4 A;  2VQE C;  3T1H C;  1L2F A;  4DV5 C;  4DV6 C;  4YY3 C;  4DR7 C;  2UXC C;  4B3T C;  2OPL A;  4DR4 C;  2PT7 G;  2JMP A;  2ASB A;  4X62 C;  1PA4 A;  2UUC C;  1MKY A;  4DV0 C;  2DYJ A;  4JI0 C;  3R9X A;  2CPM A;  5A2Q D;  3IEV A;  1WHR A;  2UUB C;  4JI3 C;  3OTO C;  4X65 C;  2F4V C;  2UXD C;  2E8F A;  4JI1 C;  1MSZ A;  4NOZ A;  4DR2 C;  4MTN A;  5LMN C;  2ZM6 C;  4DUZ C;  4DCS A;  4DV4 C;  1N2F A;  2UXB C;  1WF3 A;  4DR3 C;  1UG8 A;  1LQL A;  3AF6 A;  4DCU A;  4OX9 C;  4LFA C;  3AF5 A;  1FJG C;  1HNZ C;  4JI6 C;  4JI4 C;  1IBK C;  1QWI A;  1J5E C;  2OPL B;  4X64 C;  4DR1 C;  2KZF A;  4NXM C;  1HH2 P;  4LFC C;  1UKK A;  4DCV A;  2YCB A;  4DR6 C;  4B3R C;  1XNR C;  2ATW A;  3CJE A;  1I94 C;  4LFB C;  4JI7 C;  2LRR A;  2D7V A;  4DV2 C;  1ML8 A;  4DCT A;  4LF6 C;  2BJO A;  5IT9 D;  4GKK C;  1K0R A;  2CY1 A;  4AQY C;  5FLX D;  3JAM D;  1JOS A;  2E5L C;  4DV1 C;  2UUA C;  4B3S C;  4JYA C;  3LUS A;  3EER A;  1USP A;  1N32 C;  5IWA C;  4LF9 C;  5BR8 C;  1N33 C;  2QL8 A;  1XMO C;  3IEU A;  4BSZ A;  3T1Y C;  4DR5 C;  1HNX C;  4LF8 C;  4X66 C;  1ZB9 A;  2E8E A;  4LF4 C;  5LMU C;  4LF7 C;  2ONF A;  2HHH C;  4XX2 A;  1KKG A;  2XR1 A;  4DV7 C;  4DV3 C;  3R9W A;  3J80 D;  4KHP C;  4LF5 C;  1HNW C;  4K0K C;  4DUY C;  1VLA A;  2CXC A;  2VQF C;  1IBM C;  4JI2 C;  1EGA A;  2HJG A;  1NYE A;  4JI5 C;  2E7G A;  4JV5 C;  3J81 D;  1HR0 C;  1WH9 A;  2E8C A;  4YHH C;  2EGT A;  1XMQ C;  1XNQ C;  1N34 C; 
#chains in the Genus database with same CATH topology
 3OSS D;  3ATU A;  3ETC A;  2MZ0 A;  1L4V A;  1BA0 A;  5A1I A;  4I9F A;  4D4I A;  3KVG A;  3LDQ A;  1JKZ A;  4YHH H;  4GKJ C;  4DV3 H;  2KZ0 A;  1HR0 H;  4RVO A;  1BUP A;  3UX3 A;  3FZM A;  4DV6 C;  4DR7 C;  1T5D X;  3DLP X;  1GPM A;  2OPL A;  4LF4 H;  3CQX A;  2ASB A;  5EY4 A;  2YX1 A;  2M8B B;  1HNX H;  4X62 C;  2F4V H;  3FZF A;  1MKY A;  1C56 A;  5BSW A;  2QWR A;  2DYJ A;  5IT9 W;  3G7S A;  2I61 A;  2K35 A;  1AMU A;  1WWN A;  3T1H H;  5IWA H;  2BL5 A;  2ATB A;  1ZVG A;  2HHH H;  1N32 H;  1BCG A;  3L8C A;  2D1S A;  2LI7 A;  1ZUT A;  3QML A;  3GR0 A;  4PZP A;  5A1G A;  1S03 G;  4DR6 H;  1MDB A;  1HPM A;  1T7A A;  1PTX A;  2KBK A;  3AY0 A;  4D4G A;  4NBQ A;  2PQU A;  2E8F A;  2YWC A;  3I08 A;  1MDF A;  2JEB I;  4JI1 C;  4QMF B;  1MSZ A;  4DR2 C;  5K36 G;  3KOX A;  1WTJ A;  2FMR A;  2K1H A;  2YC1 C;  4DV4 C;  1ZVE A;  1N2F A;  4OCH A;  2UUC H;  5BUQ A;  1UG8 A;  3L95 X;  4RVN A;  1LQL A;  1HNW H;  1MYN A;  1XNQ H;  3UZ0 A;  3N54 B;  4LFA C;  2N66 A;  4JI6 H;  5AQH A;  2P20 A;  3KOZ A;  1X4M A;  2MJH A;  4DR1 C;  5AQF A;  1HH2 P;  1HJO A;  1PQX A;  3C7N B;  2UXB H;  3A9V A;  3N2Q A;  3LNV A;  1I94 C;  2QVY X;  4JI7 C;  1IBK H;  5AQT A;  3E7U X;  1ML8 A;  5LMN H;  1ZU3 A;  4OO1 G;  1PU1 A;  3L7Z C;  1ZZJ A;  2Z0S A;  1K0R A;  4IZ6 A;  3J81 W;  2E5L C;  4BBY A;  3E7R L;  1VBI A;  2KGQ A;  2N2R A;  3JXU A;  5BPN A;  5AQN A;  4RM3 A;  4ZJZ A;  2LTM A;  2QVZ X;  2V7Z A;  4X65 H;  2KYQ A;  3KP0 A;  2MM9 A;  3EER A;  2ZQE A;  4JM1 A;  3J7A K;  3D2F B;  2Y27 A;  3TDE A;  2Y4O A;  3B7W A;  1MD9 A;  3HSC A;  4EC5 A;  1POI A;  1DJT A;  2DHM A;  1XRA A;  1MR4 A;  4DR5 C;  3FZH A;  1WVN A;  1O93 A;  2MCQ A;  5CY0 A;  4H5R A;  2XR1 A;  4DV7 C;  1NRB A;  4H5N A;  5EVZ A;  4LFB H;  2OPV A;  4KHP C;  4LF5 C;  3PSM A;  4K0K C;  3O2E A;  1QQN A;  4L2Z A;  5KK4 A;  4KTT A;  5DT9 A;  5A19 A;  1WT7 A;  2YIP A;  4DR1 H;  3LGX A;  4UJ0 A;  2KBH A;  4DV7 H;  1AYJ A;  3AY9 A;  3JAM W;  2E8C A;  2KHO A;  4LFA H;  1I6F A;  5AQS A;  2E3U A;  3KXW A;  3KC6 A;  4HE7 A;  2NY8 X;  4EAT A;  1N34 C;  1FUG A;  1Z2I A;  1NRA A;  2HH2 A;  1KV0 A;  1O90 A;  4JI2 H;  5EXW A;  1C55 A;  4X66 H;  4DR3 H;  1ZB8 A;  4AEI A;  2LKB A;  3OTO H;  2E0H A;  2VKC A;  1USP B;  4RM2 A;  4JI8 C;  1XMQ H;  2ZZM A;  3NI2 A;  4MH4 A;  3C5E A;  2VQE C;  3T1H C;  4DV5 C;  1S20 A;  2YBR C;  2OO4 A;  1NGD A;  3IML A;  1OZZ A;  4YY3 C;  4JI0 H;  2QWP A;  4LF9 H;  1SN1 A;  2UXD H;  1QQM A;  3UOE A;  1FLO A;  3R44 A;  4JVY A;  1CN2 A;  2WP0 C;  1P4E C;  1P4E A;  1XMO H;  4B3T H;  5AQO A;  1PE4 A;  3IEV A;  3NCV A;  1WHR A;  5AR0 A;  2JA9 A;  4PRO C;  1PG4 A;  5E7Q A;  1EC6 A;  1JZA A;  4JI7 H;  3OTO C;  1T5H X;  1ATR A;  2LT8 A;  5AQI A;  2F4V C;  4X62 H;  1IBL H;  2AYA A;  3EQ6 A;  4LE5 A;  4YY3 H;  2NCL A;  2E88 A;  1SEG A;  2QW0 X;  3S82 A;  4JVH A;  1LQI A;  1NGA A;  1T7E A;  1XRH A;  1KHM A;  4K0B A;  4DCS A;  4JI5 H;  2QWM A;  1K8B A;  3GL1 A;  3GPC A;  2UXB C;  5AQQ A;  5AQM A;  5K8F A;  3M3Z A;  1WCJ A;  5FLX W;  1N34 H;  3EZJ A;  3L4I A;  1DTJ A;  3QFP A;  4DCU A;  3IPL A;  2Y3M A;  2ZM6 H;  3AF5 A;  4DUZ H;  2P2M A;  4JI6 C;  4OD6 A;  4ZLP A;  4JI4 C;  3TQI A;  3UOW A;  2ANR A;  1QWI A;  5KYV A;  3QI7 A;  5H9U A;  1I6G A;  4G08 A;  4LIJ A;  2VQF H;  1UKK A;  5EX5 A;  4DCV A;  4B3R C;  2JNV A;  2ATW A;  5F0X A;  2P2B A;  2KJA A;  4LFB C;  1TUA A;  3FZL A;  1TI5 A;  4KHP H;  5FPN A;  2KSK A;  2D7V A;  1O9T A;  2QXL A;  3T1Y H;  3D2F A;  2M5O A;  3VKE A;  1FJG H;  2N69 A;  1NGB A;  4LF6 C;  1N33 H;  3TR3 A;  5BSV A;  1V9N A;  2CWF A;  5FLX D;  3U1K A;  2QND A;  1VEH A;  1DKG D;  5AE1 A;  3CW9 A;  5BST A;  5FPD A;  2UUA C;  2P2R A;  4BA1 I;  3J80 W;  2GL1 A;  3LUS A;  2M8W A;  1USP A;  1N32 C;  2M6Q A;  4DR4 H;  4R1M A;  1UGL A;  4DR7 H;  1N33 C;  2E3G A;  4GNI A;  2M5H A;  3FCE A;  1V25 A;  1XMO C;  3IEU A;  2KPY A;  4BSZ A;  2CTK A;  4AM3 A;  2CTJ A;  4H8A A;  2LJ7 A;  1XNR H;  4DR5 H;  1BMR A;  1ZB9 A;  4G36 A;  2ONF A;  1WE8 A;  1CHZ A;  3SO4 A;  2UUA H;  5BPL A;  4PUG A;  5FPM A;  4AB0 A;  4XX2 A;  1KKG A;  1YUW A;  5AQP A;  1NGH A;  4RLQ A;  3J80 D;  3OET A;  4JV5 H;  1ICA A;  1HNW C;  3GR5 A;  4U5Y D;  2MMA B;  2DGR A;  4B3R H;  4WAN A;  1IBM C;  2CXC A;  1T7B A;  4LFC H;  1EGA A;  2HJG A;  1JXC A;  1NGE A;  1RY2 A;  4RLF A;  4WV3 A;  3QD7 X;  3NPD A;  2LJM A;  2VY6 A;  4DV2 H;  1NGI A;  5T8T A;  4YHH C;  1I94 H;  5AQK A;  4LF7 C;  2V7B A;  2Z51 A;  1ATS A;  5IFI A;  3GKU A;  1P7L A;  5BSM A;  2QWL A;  4FUQ A;  2UU9 C;  4NXN C;  2PN2 A;  4DV4 H;  2D56 A;  2CU6 A;  3I07 A;  1N36 C;  2BUP A;  2VSQ A;  4NZT M;  5T8S A;  2B3C A;  1L2F A;  2VZE A;  4DR2 H;  4IFD G;  2YQR A;  2P2F A;  2UXC C;  2CTM A;  1BA3 A;  4DR4 C;  5LL6 b;  1ODH A;  2PT7 G;  3VNS A;  2DPL A;  2AXY A;  1T0Z A;  2UUC C;  2LR3 A;  5BN9 A;  2D1T A;  2CWH A;  1XS3 A;  3CW4 A;  4HWI A;  5FPE A;  1KAY A;  4DV0 C;  5A2Q D;  2E8A A;  4UAD E;  4DV5 H;  3E7X A;  4CQK A;  4FTF A;  1B7D A;  3SF4 D;  4JI3 C;  1N36 H;  3ETO A;  4X65 C;  1NPI A;  5JEA G;  3FE1 A;  1NE5 A;  1X0A A;  3PES A;  4AQY H;  2UXD C;  1XRB A;  2BRZ A;  1J5E H;  2UXC H;  4NOZ A;  1ZYV A;  1F0X A;  4JI4 H;  4BC9 A;  3BK3 C;  5LMN C;  5F2R A;  2G2K A;  4G1I A;  3I33 A;  1LQH A;  2ZZN A;  3IUC A;  4I9G A;  2QW9 A;  1WF3 A;  2E5L H;  4NXN H;  5AQW A;  1DT4 A;  4LF7 H;  2G8Y A;  1I2U A;  4PDB A;  3AF6 A;  5BUS A;  4DV6 H;  1FJG C;  1HNZ C;  1M6X C;  3KDG A;  1X4N A;  4L7I A;  1V26 A;  3E7W A;  1IBK C;  3PBK A;  4R1L A;  2OPL B;  4OYC A;  4X64 C;  2KZF A;  3FCC A;  2YWB A;  3CQ1 A;  1LQQ A;  2YCB A;  4DR6 C;  3C7N A;  1HX1 A;  4K0K H;  1ZYW A;  2LRR A;  4DCT A;  1J5K A;  3LDP A;  4GXR A;  5BSR A;  3QFU A;  2BJO A;  2X06 A;  5BR8 H;  1ULT A;  2WD9 A;  4DV0 H;  1MXC A;  2KBJ A;  5DV9 A;  2P2Q A;  1JOS A;  5F1X A;  4DV1 C;  4UAE F;  4HPV A;  1NGC A;  4JYA C;  2NN6 G;  4BCA A;  1XRS B;  4JI3 H;  1MXA A;  4FJU A;  3I0P A;  1DQ7 A;  4IR7 A;  4LF9 C;  3RF2 A;  5BR8 C;  1K1G A;  1PX9 A;  4FL9 A;  1SNB A;  3KOW A;  2N2Q A;  2QL8 A;  2VQE H;  1B3C A;  2GMO A;  1TH5 A;  1XRC A;  3T1Y C;  4BA2 I;  1ZFU A;  4JYA H;  1PG3 A;  2A7T A;  1OMY A;  2P2J A;  2YEO A;  3K6R A;  4LF8 C;  4X66 C;  1S3X A;  5ADZ A;  2OPU A;  4LF4 C;  1YJ7 A;  5LMU C;  2HHH C;  3A8Y A;  3LDL A;  3UX2 A;  2LY6 A;  3ATV A;  1GPS A;  2UUB H;  2D27 A;  1WMT A;  1BK8 A;  2D28 C;  1IB8 A;  2JDQ D;  1XHJ A;  2PRO A;  2HH3 A;  1BRZ A;  5C0X G;  4DUY C;  2CTF A;  3LAX A;  1VLA A;  1T1T A;  4JI2 C;  4X64 H;  3GDQ A;  5BSU A;  2E7G A;  3NYQ A;  1ZZK A;  2E0G A;  1HR0 C;  3A4I A;  4B3M H;  3DAY A;  4WAL A;  2B68 A;  4G37 A;  2EGT A;  1XMQ C;  2JZX A;  1UWD A;  5AQG A;  4JI1 H;  1XNQ C;  4JI8 H;  5AQL A;  2A1S A;  5LMU H;  1IBL C;  4IO8 A;  5AE3 A;  5K85 A;  4ISB A;  2QWO A;  2YIO A;  4FJS A;  4B3M C;  1VIG A;  2QWQ A;  4B3T C;  5AQR A;  3LNO A;  3A9U A;  3LDN A;  2JMP A;  3KDK A;  4H5W A;  4RMN A;  4DG8 A;  2D9I A;  1PA4 A;  4PHT A;  1J4W A;  4LF8 H;  1JZB A;  2CPQ A;  1V8C A;  4FSV A;  2MN5 A;  2E2F A;  1NGF A;  4HHF A;  2CPM A;  4JI0 C;  3R9X A;  4GKK H;  5KYT A;  1NGG A;  1P00 A;  2JE6 I;  1NH5 A;  4GXQ A;  2UUB C;  2LTL A;  2JEA I;  2KDN A;  3PRO C;  3KHW A;  4WS9 A;  5GTD A;  3CW8 X;  3R2V A;  4KBO A;  2QVX X;  3UEB A;  1FKA H;  4B3S H;  2QWN A;  1ZTG A;  5AQX A;  4L4Q A;  2CTE A;  4E9J A;  4B8T A;  4MTN A;  2P02 A;  2ZM6 C;  4DUZ C;  1ZZI A;  2LN8 A;  4H5T A;  3NYR A;  2LY5 A;  1NGJ A;  1I2V A;  1BA1 A;  3KOY A;  5AQJ A;  5CZV A;  3VNQ A;  2D1Q A;  1KAX A;  1VNA A;  4D56 A;  4DR3 C;  1RG9 A;  5JRH A;  1M6X A;  3GAB A;  1AHO A;  4LF5 H;  2FFM A;  4OX9 C;  3D2E A;  5LCI A;  4NZR M;  3LDO A;  1O92 A;  3CQ3 A;  3H2T A;  1HNZ H;  4NDN A;  4H5V A;  1J5E C;  3L56 A;  3GR1 A;  2D1R A;  4NXM C;  3FZK A;  4PUH A;  4GS5 A;  4BC7 A;  4LFC C;  2FPH X;  1IBM H;  3KP1 A;  2Y4N A;  1XNR C;  1QM4 A;  3CJE A;  4AIM A;  4KTV A;  1GPT A;  2YIL A;  3TUF A;  5BUR A;  5AQV A;  1MXB A;  4DV2 C;  5BPM A;  3L6Q A;  2O4C A;  5BN8 A;  5AQU A;  5IT9 D;  4GKK C;  2CY1 A;  4AQY C;  1NY8 A;  3JAM D;  3DHV A;  2JVZ A;  3CQ2 A;  1SN4 A;  4D57 A;  4TPS B;  2OBV A;  4B3S C;  1VNB A;  4OXI A;  5AQY A;  3VNR A;  5IWA C;  4AAZ A;  5CZX A;  1NXU A;  4V1D C;  3AEV B;  3A25 A;  2CTL A;  5AE2 A;  1I6U A;  1X9Z A;  4DV1 H;  5KEI A;  1HNX C;  3FAU A;  5A2Q W;  4DG9 A;  2UU9 H;  1AN7 A;  2MBK A;  2E8E A;  3A26 A;  1SEI A;  1QQO A;  1VIH A;  2PY9 A;  4ODJ A;  2LF0 A;  2E3F A;  1LCI A;  4KYP A;  2BA0 A;  4UAF E;  4LF6 H;  3SB1 A;  2BH1 X;  4DV3 C;  3R9W A;  4GKJ H;  4OX9 H;  4FUT A;  2SN3 A;  4PUI A;  3RG2 A;  4B8C D;  2ANN A;  3V69 A;  4DUY H;  2VQF C;  1N4N A;  1FH3 A;  1NYE A;  4JI5 C;  4NXM H;  3D2E B;  1P0A A;  2NY9 X;  4JV5 C;  1V60 A;  4R0M A;  3RV2 A;  3J81 D;  1KAZ A;  1WH9 A;  5AQZ A;  2ASC A; 
#chains in the Genus database with same CATH homology
 3ETC A;  5A1I A;  4I9F A;  4D4I A;  4GKJ C;  4RVO A;  4DV6 C;  4DR7 C;  1T5D X;  3DLP X;  1GPM A;  2OPL A;  2ASB A;  4X62 C;  1MKY A;  5BSW A;  2DYJ A;  3G7S A;  1AMU A;  3L8C A;  2D1S A;  3GR0 A;  4PZP A;  5A1G A;  1MDB A;  4D4G A;  2E8F A;  2YWC A;  3I08 A;  1MDF A;  4JI1 C;  1MSZ A;  4DR2 C;  4DV4 C;  1N2F A;  5BUQ A;  1UG8 A;  3L95 X;  4RVN A;  1LQL A;  3UZ0 A;  3N54 B;  4LFA C;  2P20 A;  4DR1 C;  1HH2 P;  3A9V A;  3N2Q A;  3LNV A;  1I94 C;  2QVY X;  4JI7 C;  1ML8 A;  1K0R A;  4IZ6 A;  2E5L C;  4BBY A;  4RM3 A;  4ZJZ A;  2QVZ X;  3EER A;  4JM1 A;  2Y27 A;  3TDE A;  2Y4O A;  3B7W A;  1MD9 A;  1XRA A;  4DR5 C;  1O93 A;  2XR1 A;  4DV7 C;  4KHP C;  4LF5 C;  4K0K C;  4L2Z A;  4KTT A;  5A19 A;  3LGX A;  2E8C A;  3KXW A;  1N34 C;  4EAT A;  1FUG A;  1O90 A;  1ZB8 A;  1USP B;  4RM2 A;  4JI8 C;  3NI2 A;  4MH4 A;  3C5E A;  2VQE C;  3T1H C;  4DV5 C;  3IML A;  2OO4 A;  4YY3 C;  3R44 A;  2WP0 C;  3IEV A;  1WHR A;  4PRO C;  1PG4 A;  5E7Q A;  3OTO C;  1T5H X;  2F4V C;  2AYA A;  3EQ6 A;  4LE5 A;  2QW0 X;  3S82 A;  4K0B A;  4DCS A;  3GPC A;  2UXB C;  5K8F A;  4DCU A;  3IPL A;  3AF5 A;  2P2M A;  4JI6 C;  4ZLP A;  4JI4 C;  3TQI A;  3UOW A;  1QWI A;  5KYV A;  5H9U A;  1UKK A;  4DCV A;  4B3R C;  2ATW A;  2P2B A;  4LFB C;  2D7V A;  1O9T A;  4LF6 C;  5BSV A;  5FLX D;  5AE1 A;  3CW9 A;  5BST A;  2UUA C;  3LUS A;  1USP A;  1N32 C;  4R1M A;  1N33 C;  3FCE A;  1V25 A;  1XMO C;  3IEU A;  4BSZ A;  1ZB9 A;  4G36 A;  2ONF A;  3SO4 A;  4XX2 A;  1KKG A;  4RLQ A;  3J80 D;  1HNW C;  4U5Y D;  1IBM C;  2CXC A;  1EGA A;  2HJG A;  1RY2 A;  4RLF A;  4WV3 A;  3NPD A;  5T8T A;  4YHH C;  4LF7 C;  2V7B A;  5IFI A;  3GKU A;  1P7L A;  5BSM A;  4FUQ A;  2UU9 C;  4NXN C;  2PN2 A;  3I07 A;  1N36 C;  2VSQ A;  5T8S A;  1L2F A;  2VZE A;  2P2F A;  2UXC C;  1BA3 A;  4DR4 C;  2PT7 G;  3VNS A;  2DPL A;  2UUC C;  2D1T A;  4DV0 C;  5A2Q D;  3E7X A;  4FTF A;  4JI3 C;  3ETO A;  4X65 C;  3PES A;  2UXD C;  1XRB A;  4NOZ A;  4BC9 A;  5LMN C;  4G1I A;  4I9G A;  1WF3 A;  3AF6 A;  5BUS A;  1FJG C;  1HNZ C;  4L7I A;  1V26 A;  3E7W A;  1IBK C;  3PBK A;  4R1L A;  2OPL B;  4X64 C;  4OYC A;  2KZF A;  3FCC A;  2YWB A;  2YCB A;  4DR6 C;  2LRR A;  4DCT A;  4GXR A;  5BSR A;  2BJO A;  1ULT A;  2WD9 A;  1MXC A;  5DV9 A;  2P2Q A;  1JOS A;  4DV1 C;  4JYA C;  4HPV A;  4BCA A;  1MXA A;  4IR7 A;  4LF9 C;  5BR8 C;  2QL8 A;  1XRC A;  3T1Y C;  1PG3 A;  2P2J A;  4LF8 C;  4X66 C;  5ADZ A;  4LF4 C;  1YJ7 A;  5LMU C;  2HHH C;  2D27 A;  2D28 C;  2PRO A;  4DUY C;  3LAX A;  1VLA A;  4JI2 C;  5BSU A;  2E7G A;  3NYQ A;  2E0G A;  1HR0 C;  3A4I A;  3DAY A;  4G37 A;  1XMQ C;  2EGT A;  1XNQ C;  2A1S A;  1IBL C;  5AE3 A;  5K85 A;  4ISB A;  4B3M C;  4B3T C;  3A9U A;  2JMP A;  4RMN A;  4DG8 A;  1PA4 A;  4PHT A;  2CPM A;  4JI0 C;  3R9X A;  5KYT A;  4GXQ A;  2UUB C;  3PRO C;  4WS9 A;  5GTD A;  3CW8 X;  2QVX X;  4L4Q A;  4MTN A;  2P02 A;  2ZM6 C;  4DUZ C;  3NYR A;  5CZV A;  3VNQ A;  4D56 A;  2D1Q A;  4DR3 C;  1RG9 A;  5JRH A;  4OX9 C;  1O92 A;  3H2T A;  4NDN A;  1J5E C;  3GR1 A;  2D1R A;  4NXM C;  4BC7 A;  4LFC C;  4GS5 A;  2Y4N A;  1XNR C;  1QM4 A;  3CJE A;  4KTV A;  3TUF A;  5BUR A;  1MXB A;  4DV2 C;  5IT9 D;  4GKK C;  2CY1 A;  4AQY C;  3JAM D;  3DHV A;  4D57 A;  4B3S C;  2OBV A;  4TPS B;  4OXI A;  3VNR A;  5IWA C;  5CZX A;  5AE2 A;  5KEI A;  1HNX C;  4DG9 A;  2E8E A;  4ODJ A;  1LCI A;  2BH1 X;  4DV3 C;  3R9W A;  4FUT A;  3RG2 A;  2VQF C;  1NYE A;  4JI5 C;  4JV5 C;  4R0M A;  3J81 D;  3RV2 A;  1WH9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...