3SB1A

Hydrogenase expression protein huph from thiobacillus denitrificans atcc 25259
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
120
structure length
119
Chain Sequence
ARSGNALPLLREIAEHLHHLLETGEASTIDLSALPLTPGDLEWLRAELGGGEVSVTLHDGASTLDETAFPGVWWIIHRNAQGAVTTQFIEVAFVPELVKSPRADVAAARAALVLRMADL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hydrogenase expression protein
publication title Hydrogenase expression protein HupH from Thiobacillus denitrificans ATCC 25259
rcsb
source organism Thiobacillus denitrificans
molecule tags Structural genomics, unknown function
total genus 35
structure length 119
sequence length 120
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04809 HupH_C HupH hydrogenase expression protein, C-terminal conserved region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.140 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 3sb1A01
3SB1A
chains in the Genus database with same CATH superfamily
1VBIA 2ANRA 1WVNA 3QD7X 1UG8A 1J5KA 3OETA 4DR2H 2VQEH 1J4WA 4X62H 4AIMA 4X64H 2FPHX 3AEVB 2YQRA 1HR0H 2JEAI 3J7AK 2LTMA 1S03G 4B8CD 2E3UA 1PQXA 2ZM6H 2JEBI 3UOEA 4DR1H 3FAUA 4LF8H 1V9NA 1WTJA 2A1SA 2HH2A 4DV6H 1XRHA 2ANNA 2FMRA 3T1YH 4JVYA 1WE8A 4WALA 4JI2H 1X4NA 3JAMW 4LF6H 5LL6b 1X9ZA 2CPMA 2JZXA 5DT9A 4YHHH 3KDGA 1N32H 2CWFA 4LIJA 2K1HA 4JI3H 4DV4H 4PDBA 4YY3H 3GABA 2CWHA 4DUYH 4DR4H 2UXCH 4LF5H 4DV0H 1XNRH 4GKKH 2O4CA 3V69A 5IWAH 4AM3A 2JA9A 1ZZKA 1XMOH 4BA1I 2CTKA 4LFAH 1N34H 2Z0SA 4JI0H 5JEAG 2UUAH 1AN7A 4DR7H 4B8TA 4QMFB 2NN6G 2DGRA 4DV1H 4LFBH 1EC6A 2MJHA 2CTJA 4NZRM 4BA2I 3OTOH 2HHHH 2OPUA 1IBLH 1F0XA 2LF0A 2JVZA 3L7ZC 5LMUH 4NZTM 5FLXW 1FJGH 1KHMA 3J81W 2UUCH 1Z2IA 2AXYA 4JI8H 4K0KH 1J5EH 2G8YA 1XNQH 2F4VH 4OD6A 4JVHA 3NCVA 2D9IA 5C0XG 2OPVA 2CTEA 4FJUA 1VIGA 4OX9H 2PY9A 1ODHA 3VKEA 4JI6H 2JE6I 5K36G 1HNZH 2LTLA 2M6QA 3I0PA 2QNDA 4X65H 1ZZJA 3J80W 1IBKH 4JI7H 4B3RH 2HH3A 4IFDG 2VQFH 4GKJH 4NXNH 3KDKA 2BL5A 5BR8H 5IT9W 2LRRA 2BA0A 2UXBH 4AQYH 4DV2H 3EZJA 4NBQA 4G08A 2X06A 1V8CA 1X4MA 4OCHA 4LFCH 4DV5H 2CPQA 4WANA 1SEIA 4B3MH 4JYAH 4OO1G 1WHRA 1ZZIA 2FFMA 4H8AA 1K1GA 1I94H 2UXDH 4DR3H 1ZTGA 4DR5H 1DTJA 2CTMA 2CTLA 5A2QW 2E5LH 4DV3H 4LF7H 2M8WA 4JV5H 1X0AA 1N36H 2UU9H 1VIHA 4KHPH 4EC5A 3RF2A 4JI5H 1FKAH 1TUAA 1S20A 3GKUA 4FJSA 4LF9H 4DUZH 1I6UA 1IBMH 2CTFA 1DT4A 4DV7H 1HNXH 2Y3MA 3U1KA 4B3TH 4JI1H 4E9JA 4NXMH 3SB1A 4X66H 4DR6H 5LMNH 2PQUA 3GR5A 2PT7G 2P2RA 4JI4H 1N33H 1MSZA 1NXUA 2ZQEA 3T1HH 2VKCA 2UUBH 4B3SH 3OSSD 1HNWH 4LF4H 1XMQH
chains in the Genus database with same CATH topology
3QD7X 3OETA 4DR2H 2VQEH 4X62H 4X64H 2FPHX 1HR0H 3J7AK 1S03G 4B8CD 2ZM6H 4DR1H 3FAUA 4LF8H 4DV6H 3T1YH 4JI2H 3JAMW 4LF6H 5LL6b 1X9ZA 5DT9A 4YHHH 3KDGA 1N32H 4JI3H 4DV4H 4PDBA 4YY3H 3GABA 4DUYH 4DR4H 2UXCH 4LF5H 4DV0H 1XNRH 4GKKH 2O4CA 5IWAH 1XMOH 4LFAH 1N34H 4JI0H 2UUAH 1AN7A 4DR7H 4DV1H 4LFBH 4NZRM 3OTOH 2HHHH 1IBLH 1F0XA 2LF0A 5LMUH 4NZTM 5FLXW 1FJGH 3J81W 2UUCH 4JI8H 4K0KH 1J5EH 1XNQH 2F4VH 4OD6A 3NCVA 2D9IA 4OX9H 1ODHA 4JI6H 1HNZH 4X65H 3J80W 1IBKH 4JI7H 4B3RH 2VQFH 4GKJH 4NXNH 3KDKA 5BR8H 5IT9W 2UXBH 4AQYH 4DV2H 3EZJA 4G08A 4OCHA 4LFCH 4DV5H 1SEIA 4B3MH 4JYAH 1I94H 2UXDH 4DR3H 4DR5H 4LF7H 5A2QW 2E5LH 4DV3H 4JV5H 1N36H 2UU9H 4KHPH 4EC5A 3RF2A 4JI5H 1FKAH 4LF9H 4DUZH 1I6UA 1IBMH 1HNXH 4DV7H 2Y3MA 4B3TH 4JI1H 4E9JA 4NXMH 3SB1A 4X66H 4DR6H 5LMNH 3GR5A 2PT7G 4JI4H 1N33H 2ZQEA 3T1HH 2VKCA 2UUBH 4B3SH 3OSSD 1HNWH 4LF4H 1XMQH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SB1 A; 
#chains in the Genus database with same CATH topology
 1VBI A;  2ANR A;  1WVN A;  3QD7 X;  1UG8 A;  1J5K A;  3OET A;  4DR2 H;  2VQE H;  1J4W A;  4X62 H;  4AIM A;  4X64 H;  2FPH X;  3AEV B;  2YQR A;  1HR0 H;  2JEA I;  3J7A K;  2LTM A;  1S03 G;  4B8C D;  2E3U A;  1PQX A;  2ZM6 H;  2JEB I;  3UOE A;  4DR1 H;  3FAU A;  4LF8 H;  1V9N A;  1WTJ A;  2A1S A;  2HH2 A;  4DV6 H;  1XRH A;  2ANN A;  2FMR A;  3T1Y H;  4JVY A;  1WE8 A;  4WAL A;  4JI2 H;  1X4N A;  3JAM W;  4LF6 H;  5LL6 b;  1X9Z A;  2CPM A;  2JZX A;  5DT9 A;  4YHH H;  3KDG A;  1N32 H;  2CWF A;  4LIJ A;  2K1H A;  4JI3 H;  4DV4 H;  4PDB A;  4YY3 H;  3GAB A;  2CWH A;  4DUY H;  4DR4 H;  2UXC H;  4LF5 H;  4DV0 H;  1XNR H;  4GKK H;  2O4C A;  3V69 A;  5IWA H;  4AM3 A;  2JA9 A;  1ZZK A;  1XMO H;  4BA1 I;  2CTK A;  4LFA H;  1N34 H;  2Z0S A;  4JI0 H;  5JEA G;  2UUA H;  1AN7 A;  4DR7 H;  4B8T A;  4QMF B;  2NN6 G;  2DGR A;  4DV1 H;  4LFB H;  1EC6 A;  2MJH A;  2CTJ A;  4NZR M;  4BA2 I;  3OTO H;  2HHH H;  2OPU A;  1IBL H;  1F0X A;  2LF0 A;  2JVZ A;  3L7Z C;  5LMU H;  4NZT M;  5FLX W;  1FJG H;  1KHM A;  3J81 W;  2UUC H;  1Z2I A;  2AXY A;  4JI8 H;  4K0K H;  1J5E H;  2G8Y A;  1XNQ H;  2F4V H;  4OD6 A;  4JVH A;  3NCV A;  2D9I A;  5C0X G;  2OPV A;  2CTE A;  4FJU A;  1VIG A;  4OX9 H;  2PY9 A;  1ODH A;  3VKE A;  4JI6 H;  2JE6 I;  5K36 G;  1HNZ H;  2LTL A;  2M6Q A;  3I0P A;  2QND A;  4X65 H;  1ZZJ A;  3J80 W;  1IBK H;  4JI7 H;  4B3R H;  2HH3 A;  4IFD G;  2VQF H;  4GKJ H;  4NXN H;  3KDK A;  2BL5 A;  5BR8 H;  5IT9 W;  2LRR A;  2BA0 A;  2UXB H;  4AQY H;  4DV2 H;  3EZJ A;  4NBQ A;  4G08 A;  2X06 A;  1V8C A;  1X4M A;  4OCH A;  4LFC H;  4DV5 H;  2CPQ A;  4WAN A;  1SEI A;  4B3M H;  4JYA H;  4OO1 G;  1WHR A;  1ZZI A;  2FFM A;  4H8A A;  1K1G A;  1I94 H;  2UXD H;  4DR3 H;  1ZTG A;  4DR5 H;  1DTJ A;  2CTM A;  2CTL A;  5A2Q W;  2E5L H;  4DV3 H;  4LF7 H;  2M8W A;  4JV5 H;  1X0A A;  1N36 H;  2UU9 H;  1VIH A;  4KHP H;  4EC5 A;  3RF2 A;  4JI5 H;  1FKA H;  1TUA A;  1S20 A;  3GKU A;  4FJS A;  4LF9 H;  4DUZ H;  1I6U A;  1IBM H;  2CTF A;  1DT4 A;  4DV7 H;  1HNX H;  2Y3M A;  3U1K A;  4B3T H;  4JI1 H;  4E9J A;  4NXM H;  3SB1 A;  4X66 H;  4DR6 H;  5LMN H;  2PQU A;  3GR5 A;  2PT7 G;  2P2R A;  4JI4 H;  1N33 H;  1MSZ A;  1NXU A;  2ZQE A;  3T1H H;  2VKC A;  2UUB H;  4B3S H;  3OSS D;  1HNW H;  4LF4 H;  1XMQ H; 
#chains in the Genus database with same CATH homology
 3QD7 X;  3OET A;  4DR2 H;  2VQE H;  4X62 H;  4X64 H;  2FPH X;  1HR0 H;  3J7A K;  1S03 G;  4B8C D;  2ZM6 H;  4DR1 H;  3FAU A;  4LF8 H;  4DV6 H;  3T1Y H;  4JI2 H;  3JAM W;  4LF6 H;  5LL6 b;  1X9Z A;  5DT9 A;  4YHH H;  3KDG A;  1N32 H;  4JI3 H;  4DV4 H;  4PDB A;  4YY3 H;  3GAB A;  4DUY H;  4DR4 H;  2UXC H;  4LF5 H;  4DV0 H;  1XNR H;  4GKK H;  2O4C A;  5IWA H;  1XMO H;  4LFA H;  1N34 H;  4JI0 H;  2UUA H;  1AN7 A;  4DR7 H;  4DV1 H;  4LFB H;  4NZR M;  3OTO H;  2HHH H;  1IBL H;  1F0X A;  2LF0 A;  5LMU H;  4NZT M;  5FLX W;  1FJG H;  3J81 W;  2UUC H;  4JI8 H;  4K0K H;  1J5E H;  1XNQ H;  2F4V H;  4OD6 A;  3NCV A;  2D9I A;  4OX9 H;  1ODH A;  4JI6 H;  1HNZ H;  4X65 H;  3J80 W;  1IBK H;  4JI7 H;  4B3R H;  2VQF H;  4GKJ H;  4NXN H;  3KDK A;  5BR8 H;  5IT9 W;  2UXB H;  4AQY H;  4DV2 H;  3EZJ A;  4G08 A;  4OCH A;  4LFC H;  4DV5 H;  1SEI A;  4B3M H;  4JYA H;  1I94 H;  2UXD H;  4DR3 H;  4DR5 H;  4LF7 H;  5A2Q W;  2E5L H;  4DV3 H;  4JV5 H;  1N36 H;  2UU9 H;  4KHP H;  4EC5 A;  3RF2 A;  4JI5 H;  1FKA H;  4LF9 H;  4DUZ H;  1I6U A;  1IBM H;  1HNX H;  4DV7 H;  2Y3M A;  4B3T H;  4JI1 H;  4E9J A;  4NXM H;  3SB1 A;  4X66 H;  4DR6 H;  5LMN H;  3GR5 A;  2PT7 G;  4JI4 H;  1N33 H;  2ZQE A;  3T1H H;  2VKC A;  2UUB H;  4B3S H;  3OSS D;  1HNW H;  4LF4 H;  1XMQ H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...