3SB1A

Hydrogenase expression protein huph from thiobacillus denitrificans atcc 25259
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
120
structure length
119
Chain Sequence
b'ARSGNALPLLREIAEHLHHLLETGEASTIDLSALPLTPGDLEWLRAELGGGEVSVTLHDGASTLDETAFPGVWWIIHRNAQGAVTTQFIEVAFVPELVKSPRADVAAARAALVLRMADL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hydrogenase expression protein
publication title Hydrogenase expression protein HupH from Thiobacillus denitrificans ATCC 25259
rcsb
source organism Thiobacillus denitrificans
molecule tags Structural genomics, unknown function
total genus 35
structure length 119
sequence length 120
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04809 HupH_C HupH hydrogenase expression protein, C-terminal conserved region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.140 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 3sb1A01
3SB1A
chains in the Genus database with same CATH superfamily
2A1SA 2CTLA 3NCVA 1ZZJA 2AXYA 2JEAI 5DT9A 2QNDA 4KHPH 1V9NA 3KDGA 5K36G 1IBMH 2OPUA 1J5KA 1V8CA 3GR5A 2UXDH 4B3TH 4IFDG 1I6UA 5IWAH 4FJUA 4FJSA 4LF4H 1VBIA 1X4NA 4H8AA 1TUAA 2FMRA 2HH3A 2PY9A 4OD6A 2UU9H 2NN6G 2CTMA 2CPQA 3J7AK 2CTEA 4EC5A 4YY3H 2K1HA 4NXMH 3RF2A 3T1YH 1HNZH 5LMNH 1X4MA 4LF8H 2OPVA 2HHHH 4AQYH 1XNQH 4JI5H 2M6QA 2VQFH 4YHHH 4B3SH 4JYAH 2MJHA 1X9ZA 3V69A 4B8CD 3OETA 4OCHA 1DTJA 4JI2H 3OTOH 4G08A 1ZTGA 4JI0H 4DR4H 4DR1H 2HH2A 3EZJA 1XMQH 4JI6H 2CTKA 1Z2IA 4DR2H 4B3RH 3U1KA 2O4CA 2UXCH 4QMFB 1XRHA 2VKCA 4NBQA 4DV6H 2JEBI 4JI4H 4LF5H 2CWFA 1SEIA 3VKEA 1ZZKA 4JI7H 4NZRM 2BL5A 2E5LH 1WTJA 1X0AA 1J4WA 4BA2I 5A2QW 3L7ZC 2Y3MA 5FLXW 4JVHA 1ZZIA 1FKAH 2LTLA 3GKUA 5C0XG 4DR5H 5LL6b 4DUZH 2VQEH 4DV1H 1ODHA 3SB1A 4NZTM 2BA0A 4BA1I 4DV4H 5JEAG 2F4VH 2JVZA 2E3UA 4DV3H 1IBLH 3J80W 2UXBH 1HNWH 2CWHA 1AN7A 2JE6I 3FAUA 2CTFA 2YQRA 4OX9H 4K0KH 4DV7H 1FJGH 4GKJH 1K1GA 1HR0H 4JI8H 2Z0SA 2ZM6H 3OSSD 3AEVB 4WANA 4X65H 4WALA 1N34H 1N33H 2UUBH 4JI1H 4PDBA 4JI3H 4AIMA 4LF6H 4DV5H 4AM3A 2UUAH 4DR6H 2UUCH 1PQXA 2LF0A 4LIJA 4E9JA 4X66H 2ANNA 1KHMA 4LF7H 4DUYH 2D9IA 2LRRA 3J81W 2ZQEA 2X06A 1WVNA 4DV0H 4JV5H 3QD7X 1J5EH 4B3MH 2DGRA 1IBKH 2ANRA 3JAMW 4JVYA 1N32H 1UG8A 3I0PA 2M8WA 4X62H 4DR3H 2FPHX 2G8YA 2PQUA 4LFCH 1WE8A 4LFAH 1S20A 5BR8H 2CPMA 2CTJA 4DV2H 1DT4A 3GABA 1NXUA 3UOEA 4X64H 4OO1G 3T1HH 2P2RA 2PT7G 1WHRA 1XMOH 5LMUH 4DR7H 4LF9H 1MSZA 1HNXH 4GKKH 1F0XA 1VIHA 1N36H 2JZXA 4NXNH 2JA9A 2FFMA 4LFBH 5IT9W 3KDKA 1I94H 1S03G 1XNRH 1EC6A 1VIGA 2LTMA 4B8TA
chains in the Genus database with same CATH topology
3NCVA 4KHPH 5DT9A 3KDGA 1IBMH 3GR5A 2UXDH 4B3TH 1I6UA 5IWAH 4LF4H 4OD6A 2UU9H 3J7AK 4EC5A 4YY3H 4NXMH 3RF2A 3T1YH 1HNZH 5LMNH 4LF8H 2HHHH 4AQYH 1XNQH 4JI5H 2VQFH 4YHHH 4B3SH 4JYAH 1X9ZA 4B8CD 3OETA 4OCHA 4JI2H 3OTOH 4JI0H 4G08A 4DR4H 4DR1H 3EZJA 1XMQH 4JI6H 4DR2H 4B3RH 2O4CA 2UXCH 2VKCA 4DV6H 4LF5H 4JI4H 1SEIA 4JI7H 4NZRM 2E5LH 5A2QW 5FLXW 2Y3MA 1FKAH 4DR5H 5LL6b 4DUZH 2VQEH 4DV1H 1ODHA 3SB1A 4NZTM 4DV4H 2F4VH 4DV3H 1IBLH 3J80W 2UXBH 1HNWH 1AN7A 3FAUA 4OX9H 4K0KH 4DV7H 1FJGH 4GKJH 1HR0H 4JI8H 2ZM6H 3OSSD 4X65H 1N34H 1N33H 2UUBH 4JI1H 4PDBA 4JI3H 4LF6H 4DV5H 2UUAH 4DR6H 2UUCH 2LF0A 4E9JA 4X66H 4LF7H 4DUYH 2D9IA 3J81W 2ZQEA 4DV0H 4JV5H 3QD7X 1J5EH 4B3MH 1IBKH 3JAMW 1N32H 4X62H 4DR3H 2FPHX 4LFCH 4LFAH 5BR8H 4DV2H 3GABA 4X64H 3T1HH 2PT7G 1XMOH 5LMUH 4DR7H 4LF9H 1HNXH 4GKKH 1F0XA 1N36H 4NXNH 5IT9W 4LFBH 3KDKA 1I94H 1S03G 1XNRH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SB1 A; 
#chains in the Genus database with same CATH topology
 2A1S A;  2CTL A;  3NCV A;  1ZZJ A;  2AXY A;  2JEA I;  5DT9 A;  2QND A;  4KHP H;  1V9N A;  3KDG A;  5K36 G;  1IBM H;  2OPU A;  1J5K A;  1V8C A;  3GR5 A;  2UXD H;  4B3T H;  4IFD G;  1I6U A;  5IWA H;  4FJU A;  4FJS A;  4LF4 H;  1VBI A;  1X4N A;  4H8A A;  1TUA A;  2FMR A;  2HH3 A;  2PY9 A;  4OD6 A;  2UU9 H;  2NN6 G;  2CTM A;  2CPQ A;  3J7A K;  2CTE A;  4EC5 A;  4YY3 H;  2K1H A;  4NXM H;  3RF2 A;  3T1Y H;  1HNZ H;  5LMN H;  1X4M A;  4LF8 H;  2OPV A;  2HHH H;  4AQY H;  1XNQ H;  4JI5 H;  2M6Q A;  2VQF H;  4YHH H;  4B3S H;  4JYA H;  2MJH A;  1X9Z A;  3V69 A;  4B8C D;  3OET A;  4OCH A;  1DTJ A;  4JI2 H;  3OTO H;  4G08 A;  1ZTG A;  4JI0 H;  4DR4 H;  4DR1 H;  2HH2 A;  3EZJ A;  1XMQ H;  4JI6 H;  2CTK A;  1Z2I A;  4DR2 H;  4B3R H;  3U1K A;  2O4C A;  2UXC H;  4QMF B;  1XRH A;  2VKC A;  4NBQ A;  4DV6 H;  2JEB I;  4JI4 H;  4LF5 H;  2CWF A;  1SEI A;  3VKE A;  1ZZK A;  4JI7 H;  4NZR M;  2BL5 A;  2E5L H;  1WTJ A;  1X0A A;  1J4W A;  4BA2 I;  5A2Q W;  3L7Z C;  2Y3M A;  5FLX W;  4JVH A;  1ZZI A;  1FKA H;  2LTL A;  3GKU A;  5C0X G;  4DR5 H;  5LL6 b;  4DUZ H;  2VQE H;  4DV1 H;  1ODH A;  3SB1 A;  4NZT M;  2BA0 A;  4BA1 I;  4DV4 H;  5JEA G;  2F4V H;  2JVZ A;  2E3U A;  4DV3 H;  1IBL H;  3J80 W;  2UXB H;  1HNW H;  2CWH A;  1AN7 A;  2JE6 I;  3FAU A;  2CTF A;  2YQR A;  4OX9 H;  4K0K H;  4DV7 H;  1FJG H;  4GKJ H;  1K1G A;  1HR0 H;  4JI8 H;  2Z0S A;  2ZM6 H;  3OSS D;  3AEV B;  4WAN A;  4X65 H;  4WAL A;  1N34 H;  1N33 H;  2UUB H;  4JI1 H;  4PDB A;  4JI3 H;  4AIM A;  4LF6 H;  4DV5 H;  4AM3 A;  2UUA H;  4DR6 H;  2UUC H;  1PQX A;  2LF0 A;  4LIJ A;  4E9J A;  4X66 H;  2ANN A;  1KHM A;  4LF7 H;  4DUY H;  2D9I A;  2LRR A;  3J81 W;  2ZQE A;  2X06 A;  1WVN A;  4DV0 H;  4JV5 H;  3QD7 X;  1J5E H;  4B3M H;  2DGR A;  1IBK H;  2ANR A;  3JAM W;  4JVY A;  1N32 H;  1UG8 A;  3I0P A;  2M8W A;  4X62 H;  4DR3 H;  2FPH X;  2G8Y A;  2PQU A;  4LFC H;  1WE8 A;  4LFA H;  1S20 A;  5BR8 H;  2CPM A;  2CTJ A;  4DV2 H;  1DT4 A;  3GAB A;  1NXU A;  3UOE A;  4X64 H;  4OO1 G;  3T1H H;  2P2R A;  2PT7 G;  1WHR A;  1XMO H;  5LMU H;  4DR7 H;  4LF9 H;  1MSZ A;  1HNX H;  4GKK H;  1F0X A;  1VIH A;  1N36 H;  2JZX A;  4NXN H;  2JA9 A;  2FFM A;  4LFB H;  5IT9 W;  3KDK A;  1I94 H;  1S03 G;  1XNR H;  1EC6 A;  1VIG A;  2LTM A;  4B8T A; 
#chains in the Genus database with same CATH homology
 3NCV A;  4KHP H;  5DT9 A;  3KDG A;  1IBM H;  3GR5 A;  2UXD H;  4B3T H;  1I6U A;  5IWA H;  4LF4 H;  4OD6 A;  2UU9 H;  3J7A K;  4EC5 A;  4YY3 H;  4NXM H;  3RF2 A;  3T1Y H;  1HNZ H;  5LMN H;  4LF8 H;  2HHH H;  4AQY H;  1XNQ H;  4JI5 H;  2VQF H;  4YHH H;  4B3S H;  4JYA H;  1X9Z A;  4B8C D;  3OET A;  4OCH A;  4JI2 H;  3OTO H;  4JI0 H;  4G08 A;  4DR4 H;  4DR1 H;  3EZJ A;  1XMQ H;  4JI6 H;  4DR2 H;  4B3R H;  2O4C A;  2UXC H;  2VKC A;  4DV6 H;  4LF5 H;  4JI4 H;  1SEI A;  4JI7 H;  4NZR M;  2E5L H;  5A2Q W;  5FLX W;  2Y3M A;  1FKA H;  4DR5 H;  5LL6 b;  4DUZ H;  2VQE H;  4DV1 H;  1ODH A;  3SB1 A;  4NZT M;  4DV4 H;  2F4V H;  4DV3 H;  1IBL H;  3J80 W;  2UXB H;  1HNW H;  1AN7 A;  3FAU A;  4OX9 H;  4K0K H;  4DV7 H;  1FJG H;  4GKJ H;  1HR0 H;  4JI8 H;  2ZM6 H;  3OSS D;  4X65 H;  1N34 H;  1N33 H;  2UUB H;  4JI1 H;  4PDB A;  4JI3 H;  4LF6 H;  4DV5 H;  2UUA H;  4DR6 H;  2UUC H;  2LF0 A;  4E9J A;  4X66 H;  4LF7 H;  4DUY H;  2D9I A;  3J81 W;  2ZQE A;  4DV0 H;  4JV5 H;  3QD7 X;  1J5E H;  4B3M H;  1IBK H;  3JAM W;  1N32 H;  4X62 H;  4DR3 H;  2FPH X;  4LFC H;  4LFA H;  5BR8 H;  4DV2 H;  3GAB A;  4X64 H;  3T1H H;  2PT7 G;  1XMO H;  5LMU H;  4DR7 H;  4LF9 H;  1HNX H;  4GKK H;  1F0X A;  1N36 H;  4NXN H;  5IT9 W;  4LFB H;  3KDK A;  1I94 H;  1S03 G;  1XNR H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...