3SB1A

Hydrogenase expression protein huph from thiobacillus denitrificans atcc 25259
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
120
structure length
119
Chain Sequence
ARSGNALPLLREIAEHLHHLLETGEASTIDLSALPLTPGDLEWLRAELGGGEVSVTLHDGASTLDETAFPGVWWIIHRNAQGAVTTQFIEVAFVPELVKSPRADVAAARAALVLRMADL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords hydrogenase expression protein
publication title Hydrogenase expression protein HupH from Thiobacillus denitrificans ATCC 25259
rcsb
source organism Thiobacillus denitrificans
total genus 35
structure length 119
sequence length 120
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04809 HupH_C HupH hydrogenase expression protein, C-terminal conserved region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.140 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 3sb1A01
3SB1A
chains in the Genus database with same CATH superfamily
1J4WA 1V9NA 3GABA 2JVZA 2UXBH 1NXUA 2BA0A 4DV4H 3NCVA 4NZRM 1N34H 2VQEH 2M8WA 4LF4H 4JVYA 2UXCH 1KHMA 4LIJA 2JZXA 5C0XG 5IWAH 1DT4A 3U1KA 1WTJA 2MJHA 3KDGA 2CPQA 5DT9A 4G08A 4DV2H 2PQUA 3SB1A 5BR8H 3T1HH 1WVNA 4OO1G 2ZM6H 2LTMA 1WHRA 2F4VH 4B3MH 4B3RH 2DGRA 2CTMA 3JAMW 5IT9W 4X65H 4X62H 4JI5H 1XMOH 1TUAA 1ODHA 5A2QW 2HH3A 1IBLH 1J5KA 2A1SA 2JE6I 3QD7X 2UUCH 3AEVB 1VIGA 2PT7G 2BL5A 4DV5H 4GKKH 1DTJA 4KHPH 2X06A 1X0AA 4DV7H 4B3TH 3J7AK 5K36G 2CWFA 4JI2H 3OTOH 1XMQH 2CTKA 1N32H 3L7ZC 2PY9A 1J5EH 1I6UA 2JA9A 4OX9H 2LRRA 3J81W 1ZZKA 2UUAH 4AQYH 2HHHH 4BA2I 4K0KH 4DR6H 3UOEA 2OPVA 1V8CA 4B8TA 4JVHA 4FJUA 4JI1H 2E3UA 4PDBA 1UG8A 4NZTM 4AIMA 3GR5A 1HNWH 2M6QA 1HR0H 1N36H 4LFAH 1AN7A 2LF0A 2JEAI 3KDKA 2CTEA 1MSZA 4EC5A 1Z2IA 4DR3H 1XNQH 2O4CA 3GKUA 2CTLA 4BA1I 4WALA 3OSSD 4DV1H 2ZQEA 2FPHX 4JYAH 4JI4H 1FKAH 4DR7H 1VIHA 2HH2A 2OPUA 4DV3H 1S03G 4B8CD 2P2RA 2Z0SA 4H8AA 4JI8H 4QMFB 4X66H 4YY3H 2AXYA 4LF7H 2CWHA 2D9IA 4NXMH 1XNRH 1IBKH 1WE8A 1X4MA 4DV6H 4JI6H 1F0XA 2Y3MA 1PQXA 4LFCH 1X4NA 2FFMA 4E9JA 5LMNH 3T1YH 4DR2H 1HNZH 3RF2A 4DV0H 4IFDG 2NN6G 2YQRA 2K1HA 1X9ZA 1ZZIA 4GKJH 4LF8H 4LF5H 2CTFA 2VKCA 5LL6b 1I94H 2UUBH 2UXDH 5LMUH 3VKEA 3V69A 4WANA 1EC6A 4OD6A 4JI3H 3FAUA 5FLXW 1IBMH 4LF9H 2CPMA 4DUZH 3EZJA 4X64H 4YHHH 1S20A 4NBQA 2UU9H 2FMRA 4JV5H 4DR5H 4JI0H 2ANNA 3J80W 4LF6H 2CTJA 4DR4H 1XRHA 2G8YA 3I0PA 4JI7H 1FJGH 2JEBI 5JEAG 1VBIA 2LTLA 4DUYH 2E5LH 4FJSA 4B3SH 4AM3A 1HNXH 2ANRA 4OCHA 2VQFH 4NXNH 4DR1H 2QNDA 4LFBH 1K1GA 1N33H 1SEIA 1ZTGA 3OETA 1ZZJA
chains in the Genus database with same CATH topology
3GABA 2UXBH 4DV4H 4LF4H 3NCVA 4NZRM 1N34H 2VQEH 2UXCH 5IWAH 3KDGA 5DT9A 4G08A 4DV2H 3SB1A 5BR8H 3T1HH 2ZM6H 2F4VH 4B3MH 4B3RH 3JAMW 5IT9W 4X65H 4X62H 4JI5H 1XMOH 1ODHA 5A2QW 1IBLH 3QD7X 2UUCH 2PT7G 4DV5H 4GKKH 4KHPH 4DV7H 4B3TH 3J7AK 4JI2H 3OTOH 1XMQH 1N32H 1J5EH 1I6UA 4OX9H 3J81W 2UUAH 4AQYH 2HHHH 4K0KH 4DR6H 4JI1H 4PDBA 4NZTM 3GR5A 1HNWH 1HR0H 1N36H 4LFAH 1AN7A 2LF0A 3KDKA 4EC5A 4DR3H 1XNQH 2O4CA 4DV1H 3OSSD 2ZQEA 2FPHX 4JYAH 4JI4H 1FKAH 4DR7H 4DV3H 1S03G 4B8CD 4JI8H 4X66H 4YY3H 4LF7H 4NXMH 1XNRH 2D9IA 1IBKH 4DV6H 4JI6H 1F0XA 2Y3MA 4LFCH 4E9JA 5LMNH 3T1YH 4DR2H 1HNZH 3RF2A 4DV0H 1X9ZA 4GKJH 4LF8H 4LF5H 2VKCA 5LL6b 1I94H 2UUBH 2UXDH 5LMUH 4OD6A 4JI3H 3FAUA 5FLXW 1IBMH 4LF9H 4DUZH 3EZJA 4X64H 4YHHH 2UU9H 4JV5H 4DR5H 4JI0H 3J80W 4LF6H 4DR4H 4JI7H 1FJGH 4DUYH 2E5LH 4B3SH 1HNXH 4OCHA 2VQFH 4NXNH 4DR1H 4LFBH 1N33H 1SEIA 3OETA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SB1 A; 
#chains in the Genus database with same CATH topology
 1J4W A;  1V9N A;  3GAB A;  2JVZ A;  2UXB H;  1NXU A;  2BA0 A;  4DV4 H;  3NCV A;  4NZR M;  1N34 H;  2VQE H;  2M8W A;  4LF4 H;  4JVY A;  2UXC H;  1KHM A;  4LIJ A;  2JZX A;  5C0X G;  5IWA H;  1DT4 A;  3U1K A;  1WTJ A;  2MJH A;  3KDG A;  2CPQ A;  5DT9 A;  4G08 A;  4DV2 H;  2PQU A;  3SB1 A;  5BR8 H;  3T1H H;  1WVN A;  4OO1 G;  2ZM6 H;  2LTM A;  1WHR A;  2F4V H;  4B3M H;  4B3R H;  2DGR A;  2CTM A;  3JAM W;  5IT9 W;  4X65 H;  4X62 H;  4JI5 H;  1XMO H;  1TUA A;  1ODH A;  5A2Q W;  2HH3 A;  1IBL H;  1J5K A;  2A1S A;  2JE6 I;  3QD7 X;  2UUC H;  3AEV B;  1VIG A;  2PT7 G;  2BL5 A;  4DV5 H;  4GKK H;  1DTJ A;  4KHP H;  2X06 A;  1X0A A;  4DV7 H;  4B3T H;  3J7A K;  5K36 G;  2CWF A;  4JI2 H;  3OTO H;  1XMQ H;  2CTK A;  1N32 H;  3L7Z C;  2PY9 A;  1J5E H;  1I6U A;  2JA9 A;  4OX9 H;  2LRR A;  3J81 W;  1ZZK A;  2UUA H;  4AQY H;  2HHH H;  4BA2 I;  4K0K H;  4DR6 H;  3UOE A;  2OPV A;  1V8C A;  4B8T A;  4JVH A;  4FJU A;  4JI1 H;  2E3U A;  4PDB A;  1UG8 A;  4NZT M;  4AIM A;  3GR5 A;  1HNW H;  2M6Q A;  1HR0 H;  1N36 H;  4LFA H;  1AN7 A;  2LF0 A;  2JEA I;  3KDK A;  2CTE A;  1MSZ A;  4EC5 A;  1Z2I A;  4DR3 H;  1XNQ H;  2O4C A;  3GKU A;  2CTL A;  4BA1 I;  4WAL A;  3OSS D;  4DV1 H;  2ZQE A;  2FPH X;  4JYA H;  4JI4 H;  1FKA H;  4DR7 H;  1VIH A;  2HH2 A;  2OPU A;  4DV3 H;  1S03 G;  4B8C D;  2P2R A;  2Z0S A;  4H8A A;  4JI8 H;  4QMF B;  4X66 H;  4YY3 H;  2AXY A;  4LF7 H;  2CWH A;  2D9I A;  4NXM H;  1XNR H;  1IBK H;  1WE8 A;  1X4M A;  4DV6 H;  4JI6 H;  1F0X A;  2Y3M A;  1PQX A;  4LFC H;  1X4N A;  2FFM A;  4E9J A;  5LMN H;  3T1Y H;  4DR2 H;  1HNZ H;  3RF2 A;  4DV0 H;  4IFD G;  2NN6 G;  2YQR A;  2K1H A;  1X9Z A;  1ZZI A;  4GKJ H;  4LF8 H;  4LF5 H;  2CTF A;  2VKC A;  5LL6 b;  1I94 H;  2UUB H;  2UXD H;  5LMU H;  3VKE A;  3V69 A;  4WAN A;  1EC6 A;  4OD6 A;  4JI3 H;  3FAU A;  5FLX W;  1IBM H;  4LF9 H;  2CPM A;  4DUZ H;  3EZJ A;  4X64 H;  4YHH H;  1S20 A;  4NBQ A;  2UU9 H;  2FMR A;  4JV5 H;  4DR5 H;  4JI0 H;  2ANN A;  3J80 W;  4LF6 H;  2CTJ A;  4DR4 H;  1XRH A;  2G8Y A;  3I0P A;  4JI7 H;  1FJG H;  2JEB I;  5JEA G;  1VBI A;  2LTL A;  4DUY H;  2E5L H;  4FJS A;  4B3S H;  4AM3 A;  1HNX H;  2ANR A;  4OCH A;  2VQF H;  4NXN H;  4DR1 H;  2QND A;  4LFB H;  1K1G A;  1N33 H;  1SEI A;  1ZTG A;  3OET A;  1ZZJ A; 
#chains in the Genus database with same CATH homology
 3GAB A;  2UXB H;  4DV4 H;  4LF4 H;  3NCV A;  4NZR M;  1N34 H;  2VQE H;  2UXC H;  5IWA H;  3KDG A;  5DT9 A;  4G08 A;  4DV2 H;  3SB1 A;  5BR8 H;  3T1H H;  2ZM6 H;  2F4V H;  4B3M H;  4B3R H;  3JAM W;  5IT9 W;  4X65 H;  4X62 H;  4JI5 H;  1XMO H;  1ODH A;  5A2Q W;  1IBL H;  3QD7 X;  2UUC H;  2PT7 G;  4DV5 H;  4GKK H;  4KHP H;  4DV7 H;  4B3T H;  3J7A K;  4JI2 H;  3OTO H;  1XMQ H;  1N32 H;  1J5E H;  1I6U A;  4OX9 H;  3J81 W;  2UUA H;  4AQY H;  2HHH H;  4K0K H;  4DR6 H;  4JI1 H;  4PDB A;  4NZT M;  3GR5 A;  1HNW H;  1HR0 H;  1N36 H;  4LFA H;  1AN7 A;  2LF0 A;  3KDK A;  4EC5 A;  4DR3 H;  1XNQ H;  2O4C A;  4DV1 H;  3OSS D;  2ZQE A;  2FPH X;  4JYA H;  4JI4 H;  1FKA H;  4DR7 H;  4DV3 H;  1S03 G;  4B8C D;  4JI8 H;  4X66 H;  4YY3 H;  4LF7 H;  4NXM H;  1XNR H;  2D9I A;  1IBK H;  4DV6 H;  4JI6 H;  1F0X A;  2Y3M A;  4LFC H;  4E9J A;  5LMN H;  3T1Y H;  4DR2 H;  1HNZ H;  3RF2 A;  4DV0 H;  1X9Z A;  4GKJ H;  4LF8 H;  4LF5 H;  2VKC A;  5LL6 b;  1I94 H;  2UUB H;  2UXD H;  5LMU H;  4OD6 A;  4JI3 H;  3FAU A;  5FLX W;  1IBM H;  4LF9 H;  4DUZ H;  3EZJ A;  4X64 H;  4YHH H;  2UU9 H;  4JV5 H;  4DR5 H;  4JI0 H;  3J80 W;  4LF6 H;  4DR4 H;  4JI7 H;  1FJG H;  4DUY H;  2E5L H;  4B3S H;  1HNX H;  4OCH A;  2VQF H;  4NXN H;  4DR1 H;  4LFB H;  1N33 H;  1SEI A;  3OET A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...