3SB1A

Hydrogenase expression protein huph from thiobacillus denitrificans atcc 25259
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
120
structure length
119
Chain Sequence
ARSGNALPLLREIAEHLHHLLETGEASTIDLSALPLTPGDLEWLRAELGGGEVSVTLHDGASTLDETAFPGVWWIIHRNAQGAVTTQFIEVAFVPELVKSPRADVAAARAALVLRMADL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Hydrogenase expression protein HupH from Thiobacillus denitrificans ATCC 25259
rcsb
source organism Thiobacillus denitrificans
molecule tags Structural genomics, unknown function
molecule keywords hydrogenase expression protein
total genus 35
structure length 119
sequence length 120
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04809 HupH_C HupH hydrogenase expression protein, C-terminal conserved region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.140 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 3sb1A01
3SB1A
chains in the Genus database with same CATH superfamily
2UUBH 2CTLA 1HNZH 4JI7H 2HHHH 5LMUH 2CTEA 4JI2H 4B8CD 4DR4H 4JI8H 2YQRA 4AQYH 1EC6A 4JI6H 2D9IA 4DR2H 4JI1H 4JI5H 2JA9A 4DUYH 2JZXA 1XNRH 1N32H 4YY3H 3VKEA 1V9NA 3EZJA 3JAMW 1X0AA 4IFDG 1J5KA 5BR8H 2F4VH 2E3UA 4DV7H 2CTJA 4NXMH 2CTFA 4DV5H 3GR5A 2BA0A 4B3RH 2CPMA 2LRRA 4NZRM 2HH2A 2FMRA 2DGRA 4LFBH 1X9ZA 4DV1H 5LL6b 4LIJA 1XRHA 2UXBH 5DT9A 4X62H 3U1KA 1X4NA 1SEIA 4OCHA 5FLXW 2ANNA 1VIGA 3UOEA 2FPHX 4DUZH 1I94H 3L7ZC 4JYAH 5IT9W 4X64H 4LF9H 4FJSA 1Z2IA 4LF5H 2CWFA 2JVZA 2ZQEA 4DR6H 2CPQA 1WHRA 2Y3MA 4DR3H 4DR5H 3J81W 2MJHA 4LF4H 4JI4H 2JE6I 2AXYA 3J7AK 3QD7X 1MSZA 3KDKA 3OTOH 4OO1G 2QNDA 4OX9H 2O4CA 4DR7H 4DV6H 2G8YA 2LTLA 1K1GA 1XNQH 2VKCA 3KDGA 4KHPH 4B3TH 1IBLH 4GKKH 1TUAA 2UXDH 1X4MA 2OPUA 1S03G 1WTJA 4JI3H 1I6UA 2LF0A 2UXCH 2FFMA 1AN7A 3OETA 2CWHA 4B3SH 4X66H 1PQXA 5LMNH 4OD6A 1F0XA 3J80W 4DV0H 4K0KH 4EC5A 4B8TA 3I0PA 4DV4H 2CTKA 4DR1H 1HR0H 4AM3A 4WANA 1NXUA 3V69A 4AIMA 1VBIA 4JI0H 2PT7G 4GKJH 4JVHA 1XMQH 4YHHH 3T1HH 1DT4A 1WVNA 2JEBI 4LF8H 3RF2A 4FJUA 2UUAH 4LF6H 2M6QA 1ZZJA 2VQEH 4LF7H 5JEAG 2BL5A 2M8WA 1S20A 2HH3A 1ZZIA 2UU9H 1IBMH 1DTJA 3AEVB 3SB1A 2PY9A 4WALA 2NN6G 1HNWH 4JVYA 1UG8A 4LFCH 4NZTM 1WE8A 4H8AA 4BA1I 4QMFB 1N34H 1HNXH 3GKUA 4DV3H 1XMOH 4JV5H 4BA2I 4NBQA 1VIHA 2CTMA 2E5LH 2LTMA 2JEAI 4X65H 1FKAH 4G08A 3GABA 2K1HA 2UUCH 4E9JA 1ODHA 1KHMA 1V8CA 3FAUA 1N33H 2A1SA 2P2RA 4PDBA 2ZM6H 2Z0SA 3OSSD 5A2QW 1IBKH 2VQFH 1ZTGA 2ANRA 3T1YH 1J5EH 5IWAH 4NXNH 4B3MH 1ZZKA 2X06A 5K36G 2PQUA 1FJGH 5C0XG 1N36H 4LFAH 3NCVA 1J4WA 4DV2H 2OPVA
chains in the Genus database with same CATH topology
2UUBH 1HNZH 4JI7H 2HHHH 5LMUH 4JI2H 4B8CD 4DR4H 4JI8H 4AQYH 4JI6H 2D9IA 4DR2H 4JI1H 4JI5H 1N32H 4DUYH 1XNRH 4YY3H 3EZJA 3JAMW 4DR7H 5BR8H 2F4VH 4DV7H 4NXMH 4DV5H 3GR5A 4B3RH 4NZRM 4LFBH 1X9ZA 4DV1H 5LL6b 2UXBH 5DT9A 4X62H 4OCHA 1SEIA 5FLXW 2FPHX 4DUZH 1I94H 4JYAH 5IT9W 4X64H 4LF9H 4LF5H 2ZQEA 4DR6H 2Y3MA 4DR3H 4DR5H 3J81W 4LF4H 4JI4H 3J7AK 3QD7X 3OTOH 3KDKA 4OX9H 2O4CA 4DV6H 1XNQH 2VKCA 3KDGA 4KHPH 4B3TH 1IBLH 4GKKH 2UXDH 1S03G 4JI3H 1I6UA 2LF0A 2UXCH 1AN7A 3OETA 4B3SH 4X66H 5LMNH 4OD6A 1F0XA 3J80W 4DV0H 4K0KH 4EC5A 1HR0H 4DV4H 4DR1H 4JI0H 2PT7G 4GKJH 1XMQH 4YHHH 3T1HH 4LF8H 3RF2A 2UUAH 4LF6H 2VQEH 4LF7H 2UU9H 1IBMH 3SB1A 1HNWH 4LFCH 4NZTM 1HNXH 1N34H 4DV3H 1XMOH 4JV5H 2E5LH 4X65H 1FKAH 4G08A 3GABA 2UUCH 4E9JA 1ODHA 3FAUA 1N33H 4PDBA 2ZM6H 5A2QW 3OSSD 1IBKH 2VQFH 3T1YH 1J5EH 5IWAH 4NXNH 4B3MH 1FJGH 1N36H 4LFAH 3NCVA 4DV2H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SB1 A; 
#chains in the Genus database with same CATH topology
 2UUB H;  2CTL A;  1HNZ H;  4JI7 H;  2HHH H;  5LMU H;  2CTE A;  4JI2 H;  4B8C D;  4DR4 H;  4JI8 H;  2YQR A;  4AQY H;  1EC6 A;  4JI6 H;  2D9I A;  4DR2 H;  4JI1 H;  4JI5 H;  2JA9 A;  4DUY H;  2JZX A;  1XNR H;  1N32 H;  4YY3 H;  3VKE A;  1V9N A;  3EZJ A;  3JAM W;  1X0A A;  4IFD G;  1J5K A;  5BR8 H;  2F4V H;  2E3U A;  4DV7 H;  2CTJ A;  4NXM H;  2CTF A;  4DV5 H;  3GR5 A;  2BA0 A;  4B3R H;  2CPM A;  2LRR A;  4NZR M;  2HH2 A;  2FMR A;  2DGR A;  4LFB H;  1X9Z A;  4DV1 H;  5LL6 b;  4LIJ A;  1XRH A;  2UXB H;  5DT9 A;  4X62 H;  3U1K A;  1X4N A;  1SEI A;  4OCH A;  5FLX W;  2ANN A;  1VIG A;  3UOE A;  2FPH X;  4DUZ H;  1I94 H;  3L7Z C;  4JYA H;  5IT9 W;  4X64 H;  4LF9 H;  4FJS A;  1Z2I A;  4LF5 H;  2CWF A;  2JVZ A;  2ZQE A;  4DR6 H;  2CPQ A;  1WHR A;  2Y3M A;  4DR3 H;  4DR5 H;  3J81 W;  2MJH A;  4LF4 H;  4JI4 H;  2JE6 I;  2AXY A;  3J7A K;  3QD7 X;  1MSZ A;  3KDK A;  3OTO H;  4OO1 G;  2QND A;  4OX9 H;  2O4C A;  4DR7 H;  4DV6 H;  2G8Y A;  2LTL A;  1K1G A;  1XNQ H;  2VKC A;  3KDG A;  4KHP H;  4B3T H;  1IBL H;  4GKK H;  1TUA A;  2UXD H;  1X4M A;  2OPU A;  1S03 G;  1WTJ A;  4JI3 H;  1I6U A;  2LF0 A;  2UXC H;  2FFM A;  1AN7 A;  3OET A;  2CWH A;  4B3S H;  4X66 H;  1PQX A;  5LMN H;  4OD6 A;  1F0X A;  3J80 W;  4DV0 H;  4K0K H;  4EC5 A;  4B8T A;  3I0P A;  4DV4 H;  2CTK A;  4DR1 H;  1HR0 H;  4AM3 A;  4WAN A;  1NXU A;  3V69 A;  4AIM A;  1VBI A;  4JI0 H;  2PT7 G;  4GKJ H;  4JVH A;  1XMQ H;  4YHH H;  3T1H H;  1DT4 A;  1WVN A;  2JEB I;  4LF8 H;  3RF2 A;  4FJU A;  2UUA H;  4LF6 H;  2M6Q A;  1ZZJ A;  2VQE H;  4LF7 H;  5JEA G;  2BL5 A;  2M8W A;  1S20 A;  2HH3 A;  1ZZI A;  2UU9 H;  1IBM H;  1DTJ A;  3AEV B;  3SB1 A;  2PY9 A;  4WAL A;  2NN6 G;  1HNW H;  4JVY A;  1UG8 A;  4LFC H;  4NZT M;  1WE8 A;  4H8A A;  4BA1 I;  4QMF B;  1N34 H;  1HNX H;  3GKU A;  4DV3 H;  1XMO H;  4JV5 H;  4BA2 I;  4NBQ A;  1VIH A;  2CTM A;  2E5L H;  2LTM A;  2JEA I;  4X65 H;  1FKA H;  4G08 A;  3GAB A;  2K1H A;  2UUC H;  4E9J A;  1ODH A;  1KHM A;  1V8C A;  3FAU A;  1N33 H;  2A1S A;  2P2R A;  4PDB A;  2ZM6 H;  2Z0S A;  3OSS D;  5A2Q W;  1IBK H;  2VQF H;  1ZTG A;  2ANR A;  3T1Y H;  1J5E H;  5IWA H;  4NXN H;  4B3M H;  1ZZK A;  2X06 A;  5K36 G;  2PQU A;  1FJG H;  5C0X G;  1N36 H;  4LFA H;  3NCV A;  1J4W A;  4DV2 H;  2OPV A; 
#chains in the Genus database with same CATH homology
 2UUB H;  1HNZ H;  4JI7 H;  2HHH H;  5LMU H;  4JI2 H;  4B8C D;  4DR4 H;  4JI8 H;  4AQY H;  4JI6 H;  2D9I A;  4DR2 H;  4JI1 H;  4JI5 H;  1N32 H;  4DUY H;  1XNR H;  4YY3 H;  3EZJ A;  3JAM W;  4DR7 H;  5BR8 H;  2F4V H;  4DV7 H;  4NXM H;  4DV5 H;  3GR5 A;  4B3R H;  4NZR M;  4LFB H;  1X9Z A;  4DV1 H;  5LL6 b;  2UXB H;  5DT9 A;  4X62 H;  4OCH A;  1SEI A;  5FLX W;  2FPH X;  4DUZ H;  1I94 H;  4JYA H;  5IT9 W;  4X64 H;  4LF9 H;  4LF5 H;  2ZQE A;  4DR6 H;  2Y3M A;  4DR3 H;  4DR5 H;  3J81 W;  4LF4 H;  4JI4 H;  3J7A K;  3QD7 X;  3OTO H;  3KDK A;  4OX9 H;  2O4C A;  4DV6 H;  1XNQ H;  2VKC A;  3KDG A;  4KHP H;  4B3T H;  1IBL H;  4GKK H;  2UXD H;  1S03 G;  4JI3 H;  1I6U A;  2LF0 A;  2UXC H;  1AN7 A;  3OET A;  4B3S H;  4X66 H;  5LMN H;  4OD6 A;  1F0X A;  3J80 W;  4DV0 H;  4K0K H;  4EC5 A;  1HR0 H;  4DV4 H;  4DR1 H;  4JI0 H;  2PT7 G;  4GKJ H;  1XMQ H;  4YHH H;  3T1H H;  4LF8 H;  3RF2 A;  2UUA H;  4LF6 H;  2VQE H;  4LF7 H;  2UU9 H;  1IBM H;  3SB1 A;  1HNW H;  4LFC H;  4NZT M;  1HNX H;  1N34 H;  4DV3 H;  1XMO H;  4JV5 H;  2E5L H;  4X65 H;  1FKA H;  4G08 A;  3GAB A;  2UUC H;  4E9J A;  1ODH A;  3FAU A;  1N33 H;  4PDB A;  2ZM6 H;  5A2Q W;  3OSS D;  1IBK H;  2VQF H;  3T1Y H;  1J5E H;  5IWA H;  4NXN H;  4B3M H;  1FJG H;  1N36 H;  4LFA H;  3NCV A;  4DV2 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...