1EC6A

Crystal structure of nova-2 kh3 k-homology rna-binding domain bound to 20-mer rna hairpin
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
87
structure length
87
Chain Sequence
b'MKELVEIAVPENLVGAILGKGGKTLVEYQELTGARIQISKKGEFLPGTRNRRVTITGSPAATQAAQYLISQRVTYEQGVRASNPQKV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 20-MER RNA HAIRPIN
publication title Sequence-specific RNA binding by a Nova KH domain: implications for paraneoplastic disease and the fragile X syndrome.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein/rna
total genus 27
structure length 87
sequence length 87
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 1ec6A00
2QNDA 2CTFA 2FMRA 2CTKA 2JE6I 4LIJA 4WANA 4NBQA 1WVNA 2CPQA 1KHMA 1VIGA 1VIHA 1X4MA 1WE8A 2JZXA 2JEBI 1K1GA 2BA0A 2Z0SA 2OPVA 4IFDG 4BA2I 2OPUA 2AXYA 2DGRA 2MJHA 3AEVB 2JVZA 4JVHA 4BA1I 2NN6G 4OO1G 1X4NA 2CTJA 2P2RA 2CTEA 4WALA 1ZZKA 3VKEA 3L7ZC 3U1KA 2ANRA 4QMFB 1ZTGA 1ZZIA 2E3UA 2CTMA 2BL5A 5JEAG 1J4WA 4AM3A 2HH3A 5K36G 2PY9A 1DT4A 2ANNA 2JEAI 2CTLA 1DTJA 1EC6A 1ZZJA 4JVYA 2PQUA 2JA9A 2HH2A 2YQRA 3V69A 4AIMA 5C0XG 1TUAA 4B8TA 1J5KA
chains in the Genus database with same CATH superfamily
2CTFA 2G8YA 1N33H 4WANA 4NBQA 5IWAH 2M6QA 1PQXA 1MSZA 1VIHA 4JI6H 2FPHX 1XMOH 2BA0A 1HNXH 2ZQEA 2M8WA 4DR5H 1I6UA 1HR0H 4OO1G 4X66H 2X06A 4YHHH 3VKEA 2F4VH 2ANRA 4DR4H 4FJUA 2E5LH 3NCVA 4GKJH 5LMUH 4JYAH 4DR3H 1F0XA 4JVYA 1AN7A 2YQRA 3SB1A 3V69A 5LL6b 4DV6H 5C0XG 5FLXW 1XNQH 2CPMA 3EZJA 4JI8H 4LF6H 4JV5H 1N34H 2CTKA 4DR1H 4B3MH 1X9ZA 1I94H 2FFMA 2CPQA 4OD6A 1KHMA 1VIGA 2UXBH 2JZXA 3OTOH 1HNWH 2UXCH 2OPVA 4NXNH 1NXUA 4LF7H 4IFDG 2AXYA 2MJHA 3J80W 4NZRM 5IT9W 2CWHA 2NN6G 4B3SH 4LF9H 2CTEA 2VQFH 4EC5A 4WALA 1S20A 3T1HH 3U1KA 3J7AK 1ZZIA 2ZM6H 4DV3H 2Y3MA 2BL5A 2D9IA 4AM3A 1FJGH 3GR5A 1HNZH 4YY3H 5K36G 1VBIA 1DTJA 2CTLA 2PT7G 4GKKH 4JI7H 3OETA 1J5KA 2LF0A 2JE6I 1N36H 2CWFA 1IBKH 1FKAH 3I0PA 1UG8A 3QD7X 1S03G 1XNRH 2HHHH 2VQEH 1X4MA 1WE8A 2JEBI 3FAUA 3RF2A 4DV7H 2LRRA 4DV2H 1X0AA 1N32H 2DGRA 2JVZA 4DR2H 1X4NA 2LTMA 4X62H 4DV1H 2P2RA 4DR7H 5BR8H 1ZZKA 2A1SA 3T1YH 3KDKA 4NXMH 4LF8H 1WHRA 1ZTGA 2E3UA 2UUAH 5JEAG 1J5EH 5LMNH 2LTLA 2UUBH 3GABA 1Z2IA 4LF5H 4LFAH 1V9NA 1EC6A 4DR6H 3JAMW 1ZZJA 1XMQH 2O4CA 2JA9A 2UU9H 2VKCA 1TUAA 4H8AA 4PDBA 5A2QW 4DUZH 2QNDA 2FMRA 4OCHA 4LIJA 4JI0H 4G08A 4JI5H 4LFBH 2UXDH 1WVNA 1ODHA 2K1HA 4JI1H 4B3RH 1K1GA 2Z0SA 1WTJA 4NZTM 4X64H 2OPUA 3AEVB 4BA2I 4JVHA 4K0KH 1XRHA 4BA1I 4AQYH 4LF4H 2CTJA 4KHPH 3UOEA 1IBLH 4JI4H 3L7ZC 4FJSA 4QMFB 4B3TH 4DV5H 2CTMA 4DUYH 4DV0H 3KDGA 1J4WA 4LFCH 1IBMH 4E9JA 4X65H 3OSSD 5DT9A 4OX9H 2HH3A 4B8CD 2PY9A 3J81W 1DT4A 2ANNA 2JEAI 1V8CA 3GKUA 4JI3H 1SEIA 4JI2H 2UUCH 2PQUA 2HH2A 4AIMA 4DV4H 4B8TA
chains in the Genus database with same CATH topology
2QNDA 2CTFA 2FMRA 2CTKA 2JE6I 4LIJA 4WANA 4NBQA 1WVNA 2CPQA 1KHMA 1VIGA 1VIHA 1X4MA 1WE8A 2JZXA 2JEBI 1K1GA 2BA0A 2Z0SA 2OPVA 4IFDG 4BA2I 2OPUA 2AXYA 2DGRA 2MJHA 3AEVB 2JVZA 4JVHA 4BA1I 2NN6G 4OO1G 1X4NA 2CTJA 2P2RA 2CTEA 4WALA 1ZZKA 3VKEA 3L7ZC 3U1KA 2ANRA 4QMFB 1ZTGA 1ZZIA 2E3UA 2CTMA 2BL5A 5JEAG 1J4WA 4AM3A 2HH3A 5K36G 2PY9A 1DT4A 2ANNA 2JEAI 2CTLA 1DTJA 1EC6A 1ZZJA 4JVYA 2PQUA 2JA9A 2HH2A 2YQRA 3V69A 4AIMA 5C0XG 1TUAA 4B8TA 1J5KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QND A;  2CTF A;  2FMR A;  2CTK A;  2JE6 I;  4LIJ A;  4WAN A;  4NBQ A;  1WVN A;  2CPQ A;  1KHM A;  1VIG A;  1VIH A;  1X4M A;  1WE8 A;  2JZX A;  2JEB I;  1K1G A;  2BA0 A;  2Z0S A;  2OPV A;  4IFD G;  4BA2 I;  2OPU A;  2AXY A;  2DGR A;  2MJH A;  3AEV B;  2JVZ A;  4JVH A;  4BA1 I;  2NN6 G;  4OO1 G;  1X4N A;  2CTJ A;  2P2R A;  2CTE A;  4WAL A;  1ZZK A;  3VKE A;  3L7Z C;  3U1K A;  2ANR A;  4QMF B;  1ZTG A;  1ZZI A;  2E3U A;  2CTM A;  2BL5 A;  5JEA G;  1J4W A;  4AM3 A;  2HH3 A;  5K36 G;  2PY9 A;  1DT4 A;  2ANN A;  2JEA I;  2CTL A;  1DTJ A;  1EC6 A;  1ZZJ A;  4JVY A;  2PQU A;  2JA9 A;  2HH2 A;  2YQR A;  3V69 A;  4AIM A;  5C0X G;  1TUA A;  4B8T A;  1J5K A; 
#chains in the Genus database with same CATH topology
 2CTF A;  2G8Y A;  1N33 H;  4WAN A;  4NBQ A;  5IWA H;  2M6Q A;  1PQX A;  1MSZ A;  1VIH A;  4JI6 H;  2FPH X;  1XMO H;  2BA0 A;  1HNX H;  2ZQE A;  2M8W A;  4DR5 H;  1I6U A;  1HR0 H;  4OO1 G;  4X66 H;  2X06 A;  4YHH H;  3VKE A;  2F4V H;  2ANR A;  4DR4 H;  4FJU A;  2E5L H;  3NCV A;  4GKJ H;  5LMU H;  4JYA H;  4DR3 H;  1F0X A;  4JVY A;  1AN7 A;  2YQR A;  3SB1 A;  3V69 A;  5LL6 b;  4DV6 H;  5C0X G;  5FLX W;  1XNQ H;  2CPM A;  3EZJ A;  4JI8 H;  4LF6 H;  4JV5 H;  1N34 H;  2CTK A;  4DR1 H;  4B3M H;  1X9Z A;  1I94 H;  2FFM A;  2CPQ A;  4OD6 A;  1KHM A;  1VIG A;  2UXB H;  2JZX A;  3OTO H;  1HNW H;  2UXC H;  2OPV A;  4NXN H;  1NXU A;  4LF7 H;  4IFD G;  2AXY A;  2MJH A;  3J80 W;  4NZR M;  5IT9 W;  2CWH A;  2NN6 G;  4B3S H;  4LF9 H;  2CTE A;  2VQF H;  4EC5 A;  4WAL A;  1S20 A;  3T1H H;  3U1K A;  3J7A K;  1ZZI A;  2ZM6 H;  4DV3 H;  2Y3M A;  2BL5 A;  2D9I A;  4AM3 A;  1FJG H;  3GR5 A;  1HNZ H;  4YY3 H;  5K36 G;  1VBI A;  1DTJ A;  2CTL A;  2PT7 G;  4GKK H;  4JI7 H;  3OET A;  1J5K A;  2LF0 A;  2JE6 I;  1N36 H;  2CWF A;  1IBK H;  1FKA H;  3I0P A;  1UG8 A;  3QD7 X;  1S03 G;  1XNR H;  2HHH H;  2VQE H;  1X4M A;  1WE8 A;  2JEB I;  3FAU A;  3RF2 A;  4DV7 H;  2LRR A;  4DV2 H;  1X0A A;  1N32 H;  2DGR A;  2JVZ A;  4DR2 H;  1X4N A;  2LTM A;  4X62 H;  4DV1 H;  2P2R A;  4DR7 H;  5BR8 H;  1ZZK A;  2A1S A;  3T1Y H;  3KDK A;  4NXM H;  4LF8 H;  1WHR A;  1ZTG A;  2E3U A;  2UUA H;  5JEA G;  1J5E H;  5LMN H;  2LTL A;  2UUB H;  3GAB A;  1Z2I A;  4LF5 H;  4LFA H;  1V9N A;  1EC6 A;  4DR6 H;  3JAM W;  1ZZJ A;  1XMQ H;  2O4C A;  2JA9 A;  2UU9 H;  2VKC A;  1TUA A;  4H8A A;  4PDB A;  5A2Q W;  4DUZ H;  2QND A;  2FMR A;  4OCH A;  4LIJ A;  4JI0 H;  4G08 A;  4JI5 H;  4LFB H;  2UXD H;  1WVN A;  1ODH A;  2K1H A;  4JI1 H;  4B3R H;  1K1G A;  2Z0S A;  1WTJ A;  4NZT M;  4X64 H;  2OPU A;  3AEV B;  4BA2 I;  4JVH A;  4K0K H;  1XRH A;  4BA1 I;  4AQY H;  4LF4 H;  2CTJ A;  4KHP H;  3UOE A;  1IBL H;  4JI4 H;  3L7Z C;  4FJS A;  4QMF B;  4B3T H;  4DV5 H;  2CTM A;  4DUY H;  4DV0 H;  3KDG A;  1J4W A;  4LFC H;  1IBM H;  4E9J A;  4X65 H;  3OSS D;  5DT9 A;  4OX9 H;  2HH3 A;  4B8C D;  2PY9 A;  3J81 W;  1DT4 A;  2ANN A;  2JEA I;  1V8C A;  3GKU A;  4JI3 H;  1SEI A;  4JI2 H;  2UUC H;  2PQU A;  2HH2 A;  4AIM A;  4DV4 H;  4B8T A; 
#chains in the Genus database with same CATH homology
 2QND A;  2CTF A;  2FMR A;  2CTK A;  2JE6 I;  4LIJ A;  4WAN A;  4NBQ A;  1WVN A;  2CPQ A;  1KHM A;  1VIG A;  1VIH A;  1X4M A;  1WE8 A;  2JZX A;  2JEB I;  1K1G A;  2BA0 A;  2Z0S A;  2OPV A;  4IFD G;  4BA2 I;  2OPU A;  2AXY A;  2DGR A;  2MJH A;  3AEV B;  2JVZ A;  4JVH A;  4BA1 I;  2NN6 G;  4OO1 G;  1X4N A;  2CTJ A;  2P2R A;  2CTE A;  4WAL A;  1ZZK A;  3VKE A;  3L7Z C;  3U1K A;  2ANR A;  4QMF B;  1ZTG A;  1ZZI A;  2E3U A;  2CTM A;  2BL5 A;  5JEA G;  1J4W A;  4AM3 A;  2HH3 A;  5K36 G;  2PY9 A;  1DT4 A;  2ANN A;  2JEA I;  2CTL A;  1DTJ A;  1EC6 A;  1ZZJ A;  4JVY A;  2PQU A;  2JA9 A;  2HH2 A;  2YQR A;  3V69 A;  4AIM A;  5C0X G;  1TUA A;  4B8T A;  1J5K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...