1EC6A

Crystal structure of nova-2 kh3 k-homology rna-binding domain bound to 20-mer rna hairpin
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
87
structure length
87
Chain Sequence
MKELVEIAVPENLVGAILGKGGKTLVEYQELTGARIQISKKGEFLPGTRNRRVTITGSPAATQAAQYLISQRVTYEQGVRASNPQKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein/rna
molecule keywords 20-MER RNA HAIRPIN
publication title Sequence-specific RNA binding by a Nova KH domain: implications for paraneoplastic disease and the fragile X syndrome.
pubmed doi rcsb
source organism Homo sapiens
total genus 27
structure length 87
sequence length 87
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 1ec6A00
1KHMA 4BA1I 2ANNA 1TUAA 2CTEA 2PY9A 1J5KA 2CPQA 2NN6G 2PQUA 4WALA 1DT4A 2JEBI 1ZZIA 2E3UA 4BA2I 2FMRA 4B8TA 2OPUA 2ANRA 4NBQA 4JVYA 4JVHA 1X4MA 3L7ZC 2JVZA 1WE8A 2CTKA 2OPVA 5C0XG 4OO1G 2DGRA 1ZZJA 2CTJA 2QNDA 2BL5A 2CTFA 4WANA 4IFDG 1VIGA 2JZXA 2JA9A 2Z0SA 2YQRA 2P2RA 4AIMA 4AM3A 1ZZKA 5JEAG 1VIHA 2HH2A 5K36G 2HH3A 3VKEA 2BA0A 1WVNA 2CTMA 3U1KA 1DTJA 2JE6I 3V69A 3AEVB 2JEAI 2MJHA 2CTLA 1J4WA 1X4NA 1EC6A 1K1GA 4LIJA 4QMFB 1ZTGA 2AXYA
chains in the Genus database with same CATH superfamily
5BR8H 3J81W 4B3TH 2FFMA 1IBKH 2E3UA 4JI7H 4BA2I 2FMRA 1VBIA 2VKCA 1X4MA 4JI2H 4DV0H 1N36H 5C0XG 4B3SH 2F4VH 2DGRA 4JV5H 1I94H 4IFDG 4H8AA 2PT7G 2JZXA 4NZTM 2YQRA 2LRRA 1FJGH 5K36G 2FPHX 3KDKA 1WVNA 3J80W 2VQEH 2E5LH 1UG8A 1DTJA 2JE6I 3V69A 5LMUH 2JEAI 4JI3H 3OETA 2G8YA 4DR5H 1HNZH 5DT9A 4NBQA 4LF4H 4DUZH 1ZTGA 4NXNH 4LF7H 4DR7H 4K0KH 4BA1I 2UXCH 2PY9A 1J5KA 2M6QA 4E9JA 4DR2H 2PQUA 1ZZIA 2D9IA 2JEBI 1N32H 4DR4H 1HNXH 3RF2A 2ANRA 4JVYA 1WTJA 1J5EH 2X06A 2O4CA 2ZM6H 2A1SA 2JVZA 4FJUA 5FLXW 4JI0H 2OPVA 4LFAH 3T1HH 3JAMW 4DUYH 4NZRM 2BL5A 3T1YH 4WANA 4DV7H 4DR3H 2LF0A 4OCHA 2JA9A 5LMNH 2UUCH 1XMOH 3GKUA 1ODHA 5A2QW 1MSZA 4YHHH 4JI6H 5LL6b 1K1GA 4LIJA 4DV5H 2Y3MA 4DV2H 4DV3H 1I6UA 4DR1H 1FKAH 4LFCH 1NXUA 2ANNA 4JI1H 2CWFA 4DV6H 2CPQA 4FJSA 1DT4A 1Z2IA 4JI8H 4X62H 4B3RH 4GKKH 4JVHA 3GABA 1S20A 2OPUA 1S03G 1XMQH 3EZJA 1F0XA 3L7ZC 1WE8A 4JI5H 2CTKA 4B8CD 2UUBH 4LF9H 4GKJH 1HNWH 4JYAH 4PDBA 2UXBH 2QNDA 2UXDH 3QD7X 3FAUA 2UUAH 1VIGA 4G08A 4AM3A 4OD6A 4AIMA 3SB1A 2LTLA 4AQYH 2HH3A 2BA0A 2CTMA 2CPMA 2HHHH 2MJHA 1IBMH 1X4NA 2M8WA 1PQXA 4DV1H 4X66H 1IBLH 4QMFB 1X9ZA 2AXYA 5IT9W 1WHRA 1KHMA 1XNRH 1TUAA 3NCVA 2UU9H 4LF6H 2CTEA 2VQFH 2NN6G 3OSSD 4WALA 4OX9H 4LFBH 2ZQEA 4B8TA 4NXMH 4YY3H 1AN7A 1XRHA 2CWHA 4X64H 1N34H 4KHPH 4OO1G 1ZZJA 2CTJA 2CTFA 5IWAH 4B3MH 1N33H 1V8CA 4EC5A 3KDGA 2P2RA 4LF5H 2Z0SA 4JI4H 4X65H 1ZZKA 2K1HA 1VIHA 2HH2A 1V9NA 5JEAG 3OTOH 3VKEA 3GR5A 3U1KA 1SEIA 3J7AK 3AEVB 3UOEA 1XNQH 2CTLA 3I0PA 2LTMA 4DV4H 1J4WA 4LF8H 4DR6H 1EC6A 1HR0H 1X0AA
chains in the Genus database with same CATH topology
1KHMA 4BA1I 2ANNA 1TUAA 2CTEA 2PY9A 1J5KA 2CPQA 2NN6G 2PQUA 4WALA 1DT4A 2JEBI 1ZZIA 2E3UA 4BA2I 2FMRA 4B8TA 2OPUA 2ANRA 4NBQA 4JVYA 4JVHA 1X4MA 3L7ZC 2JVZA 1WE8A 2CTKA 2OPVA 5C0XG 4OO1G 2DGRA 1ZZJA 2CTJA 2QNDA 2BL5A 2CTFA 4WANA 4IFDG 1VIGA 2JZXA 2JA9A 2Z0SA 2YQRA 2P2RA 4AIMA 4AM3A 1ZZKA 5JEAG 1VIHA 2HH2A 5K36G 2HH3A 3VKEA 2BA0A 1WVNA 2CTMA 3U1KA 1DTJA 2JE6I 3V69A 3AEVB 2JEAI 2MJHA 2CTLA 1J4WA 1X4NA 1EC6A 1K1GA 4LIJA 4QMFB 1ZTGA 2AXYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KHM A;  4BA1 I;  2ANN A;  1TUA A;  2CTE A;  2PY9 A;  1J5K A;  2CPQ A;  2NN6 G;  2PQU A;  4WAL A;  1DT4 A;  2JEB I;  1ZZI A;  2E3U A;  4BA2 I;  2FMR A;  4B8T A;  2OPU A;  2ANR A;  4NBQ A;  4JVY A;  4JVH A;  1X4M A;  3L7Z C;  2JVZ A;  1WE8 A;  2CTK A;  2OPV A;  5C0X G;  4OO1 G;  2DGR A;  1ZZJ A;  2CTJ A;  2QND A;  2BL5 A;  2CTF A;  4WAN A;  4IFD G;  1VIG A;  2JZX A;  2JA9 A;  2Z0S A;  2YQR A;  2P2R A;  4AIM A;  4AM3 A;  1ZZK A;  5JEA G;  1VIH A;  2HH2 A;  5K36 G;  2HH3 A;  3VKE A;  2BA0 A;  1WVN A;  2CTM A;  3U1K A;  1DTJ A;  2JE6 I;  3V69 A;  3AEV B;  2JEA I;  2MJH A;  2CTL A;  1J4W A;  1X4N A;  1EC6 A;  1K1G A;  4LIJ A;  4QMF B;  1ZTG A;  2AXY A; 
#chains in the Genus database with same CATH topology
 5BR8 H;  3J81 W;  4B3T H;  2FFM A;  1IBK H;  2E3U A;  4JI7 H;  4BA2 I;  2FMR A;  1VBI A;  2VKC A;  1X4M A;  4JI2 H;  4DV0 H;  1N36 H;  5C0X G;  4B3S H;  2F4V H;  2DGR A;  4JV5 H;  1I94 H;  4IFD G;  4H8A A;  2PT7 G;  2JZX A;  4NZT M;  2YQR A;  2LRR A;  1FJG H;  5K36 G;  2FPH X;  3KDK A;  1WVN A;  3J80 W;  2VQE H;  2E5L H;  1UG8 A;  1DTJ A;  2JE6 I;  3V69 A;  5LMU H;  2JEA I;  4JI3 H;  3OET A;  2G8Y A;  4DR5 H;  1HNZ H;  5DT9 A;  4NBQ A;  4LF4 H;  4DUZ H;  1ZTG A;  4NXN H;  4LF7 H;  4DR7 H;  4K0K H;  4BA1 I;  2UXC H;  2PY9 A;  1J5K A;  2M6Q A;  4E9J A;  4DR2 H;  2PQU A;  1ZZI A;  2D9I A;  2JEB I;  1N32 H;  4DR4 H;  1HNX H;  3RF2 A;  2ANR A;  4JVY A;  1WTJ A;  1J5E H;  2X06 A;  2O4C A;  2ZM6 H;  2A1S A;  2JVZ A;  4FJU A;  5FLX W;  4JI0 H;  2OPV A;  4LFA H;  3T1H H;  3JAM W;  4DUY H;  4NZR M;  2BL5 A;  3T1Y H;  4WAN A;  4DV7 H;  4DR3 H;  2LF0 A;  4OCH A;  2JA9 A;  5LMN H;  2UUC H;  1XMO H;  3GKU A;  1ODH A;  5A2Q W;  1MSZ A;  4YHH H;  4JI6 H;  5LL6 b;  1K1G A;  4LIJ A;  4DV5 H;  2Y3M A;  4DV2 H;  4DV3 H;  1I6U A;  4DR1 H;  1FKA H;  4LFC H;  1NXU A;  2ANN A;  4JI1 H;  2CWF A;  4DV6 H;  2CPQ A;  4FJS A;  1DT4 A;  1Z2I A;  4JI8 H;  4X62 H;  4B3R H;  4GKK H;  4JVH A;  3GAB A;  1S20 A;  2OPU A;  1S03 G;  1XMQ H;  3EZJ A;  1F0X A;  3L7Z C;  1WE8 A;  4JI5 H;  2CTK A;  4B8C D;  2UUB H;  4LF9 H;  4GKJ H;  1HNW H;  4JYA H;  4PDB A;  2UXB H;  2QND A;  2UXD H;  3QD7 X;  3FAU A;  2UUA H;  1VIG A;  4G08 A;  4AM3 A;  4OD6 A;  4AIM A;  3SB1 A;  2LTL A;  4AQY H;  2HH3 A;  2BA0 A;  2CTM A;  2CPM A;  2HHH H;  2MJH A;  1IBM H;  1X4N A;  2M8W A;  1PQX A;  4DV1 H;  4X66 H;  1IBL H;  4QMF B;  1X9Z A;  2AXY A;  5IT9 W;  1WHR A;  1KHM A;  1XNR H;  1TUA A;  3NCV A;  2UU9 H;  4LF6 H;  2CTE A;  2VQF H;  2NN6 G;  3OSS D;  4WAL A;  4OX9 H;  4LFB H;  2ZQE A;  4B8T A;  4NXM H;  4YY3 H;  1AN7 A;  1XRH A;  2CWH A;  4X64 H;  1N34 H;  4KHP H;  4OO1 G;  1ZZJ A;  2CTJ A;  2CTF A;  5IWA H;  4B3M H;  1N33 H;  1V8C A;  4EC5 A;  3KDG A;  2P2R A;  4LF5 H;  2Z0S A;  4JI4 H;  4X65 H;  1ZZK A;  2K1H A;  1VIH A;  2HH2 A;  1V9N A;  5JEA G;  3OTO H;  3VKE A;  3GR5 A;  3U1K A;  1SEI A;  3J7A K;  3AEV B;  3UOE A;  1XNQ H;  2CTL A;  3I0P A;  2LTM A;  4DV4 H;  1J4W A;  4LF8 H;  4DR6 H;  1EC6 A;  1HR0 H;  1X0A A; 
#chains in the Genus database with same CATH homology
 1KHM A;  4BA1 I;  2ANN A;  1TUA A;  2CTE A;  2PY9 A;  1J5K A;  2CPQ A;  2NN6 G;  2PQU A;  4WAL A;  1DT4 A;  2JEB I;  1ZZI A;  2E3U A;  4BA2 I;  2FMR A;  4B8T A;  2OPU A;  2ANR A;  4NBQ A;  4JVY A;  4JVH A;  1X4M A;  3L7Z C;  2JVZ A;  1WE8 A;  2CTK A;  2OPV A;  5C0X G;  4OO1 G;  2DGR A;  1ZZJ A;  2CTJ A;  2QND A;  2BL5 A;  2CTF A;  4WAN A;  4IFD G;  1VIG A;  2JZX A;  2JA9 A;  2Z0S A;  2YQR A;  2P2R A;  4AIM A;  4AM3 A;  1ZZK A;  5JEA G;  1VIH A;  2HH2 A;  5K36 G;  2HH3 A;  3VKE A;  2BA0 A;  1WVN A;  2CTM A;  3U1K A;  1DTJ A;  2JE6 I;  3V69 A;  3AEV B;  2JEA I;  2MJH A;  2CTL A;  1J4W A;  1X4N A;  1EC6 A;  1K1G A;  4LIJ A;  4QMF B;  1ZTG A;  2AXY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...