2MJHA

Solution structure of the gld-1 rna-binding domain in complex with rna
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
142
structure length
142
Chain Sequence
LPEPAGDMISITEKIYVPKNEYPDYNFVGRILGPRGMTAKQLEQDTGCKIMVRGKGSMRDKSKESAHRGKANWEHLEDDLHVLVQCEDTENRVHIKLQAALEQVKKLLIPAPEGTDELKRKQLMELAIINGTYRPMKSPNPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Female germline-specific tumor suppressor gld-1
publication title Structural and functional implications of the QUA2 domain on RNA recognition by GLD-1.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Rna binding protein
total genus 27
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2014-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 2mjhA00
2HH2A 2CTKA 3V69A 2DGRA 2CTFA 4B8TA 4LIJA 2OPVA 1X4NA 4IFDG 4WANA 5JEAG 5C0XG 1DT4A 1ZZIA 2QNDA 3AEVB 1VIHA 1J4WA 4JVYA 1DTJA 2CPQA 4AM3A 2MJHA 1ZZKA 4BA1I 2CTJA 2OPUA 2PY9A 2JVZA 4BA2I 1EC6A 2HH3A 2JE6I 4WALA 4AIMA 2NN6G 2FMRA 2JEAI 1WVNA 1K1GA 4NBQA 2AXYA 2E3UA 1ZTGA 1J5KA 2BA0A 2BL5A 3VKEA 1KHMA 2JA9A 2JZXA 2CTEA 2ANRA 2YQRA 1VIGA 2ANNA 2JEBI 4JVHA 2PQUA 4OO1G 2CTMA 5K36G 1TUAA 4QMFB 2Z0SA 3U1KA 1WE8A 3L7ZC 1ZZJA 2CTLA 2P2RA 1X4MA
chains in the Genus database with same CATH superfamily
2HH2A 5LL6b 3V69A 1XMQH 5BR8H 1XNQH 1FJGH 2OPVA 3GABA 5LMUH 4DV2H 4DV1H 4IFDG 3OETA 5JEAG 1DT4A 1HNXH 1I6UA 3AEVB 1VIHA 4LF9H 4DV5H 4G08A 4NZRM 1XNRH 2CTJA 2OPUA 2ZM6H 5IT9W 2PY9A 2JVZA 2HH3A 3I0PA 2NN6G 2FMRA 1V9NA 1WVNA 1K1GA 2AXYA 1ZTGA 2E3UA 2BL5A 4DV7H 2FFMA 4B3RH 2CTEA 4JI3H 4JI7H 1VIGA 2JEBI 4DR7H 4AQYH 4LFCH 4JI8H 3OSSD 2PQUA 1HNZH 5K36G 2M8WA 4LF6H 1S20A 3SB1A 3OTOH 4DR2H 4E9JA 1ZZJA 2UU9H 2CTLA 3RF2A 4OD6A 2CTKA 3J80W 4B3MH 2DGRA 4B8TA 4PDBA 4LIJA 1X4NA 4YY3H 4DV4H 4JV5H 2ZQEA 5C0XG 3T1YH 3QD7X 4KHPH 1DTJA 3J7AK 2MJHA 3UOEA 3KDKA 4YHHH 4LFBH 3KDGA 4WALA 2K1HA 4X62H 4AIMA 4LFAH 2JEAI 4NBQA 2LTLA 4NXMH 1N32H 1Z2IA 2JA9A 1S03G 2YQRA 4NXNH 4DR6H 4JI4H 2UXBH 2LF0A 1VBIA 5LMNH 3T1HH 4JVHA 1F0XA 1SEIA 4OO1G 4X64H 4JYAH 1PQXA 1V8CA 2Z0SA 5DT9A 4DR4H 4DR5H 1X4MA 1N36H 4K0KH 1X9ZA 4B3SH 2CTFA 2M6QA 1ZZIA 5FLXW 1I94H 2VKCA 1HR0H 2CPQA 4AM3A 1ZZKA 3EZJA 2O4CA 1N33H 1WTJA 2LTMA 2UUCH 1J5EH 4H8AA 3GR5A 5A2QW 2A1SA 4JI0H 1KHMA 2CWFA 4LF7H 4GKJH 2UXDH 2ANRA 4LF4H 4JI2H 1WHRA 1X0AA 2UUAH 2F4VH 2CTMA 2UUBH 1TUAA 3U1KA 4B3TH 1WE8A 3L7ZC 4B8CD 3J81W 1MSZA 1J4WA 1XRHA 1FKAH 4DUZH 2HHHH 2P2RA 1N34H 4DV0H 4JI5H 1IBMH 2VQEH 3GKUA 4NZTM 2VQFH 3JAMW 1XMOH 4WANA 4JVYA 4DUYH 1AN7A 2QNDA 4BA1I 4OCHA 4OX9H 2G8YA 5IWAH 2E5LH 2Y3MA 4BA2I 1EC6A 2UXCH 4LF5H 2JE6I 4FJUA 4JI6H 1NXUA 4LF8H 4DV6H 2CWHA 1J5KA 2FPHX 2BA0A 3VKEA 4FJSA 2PT7G 2CPMA 2X06A 2JZXA 2LRRA 4X66H 1ODHA 4GKKH 4DR1H 4DV3H 1IBLH 4X65H 2ANNA 1IBKH 1UG8A 2D9IA 3NCVA 3FAUA 4QMFB 4DR3H 4JI1H 1HNWH 4EC5A
chains in the Genus database with same CATH topology
2HH2A 2CTKA 3V69A 2DGRA 2CTFA 4B8TA 4LIJA 2OPVA 1X4NA 4IFDG 4WANA 5JEAG 5C0XG 1DT4A 1ZZIA 2QNDA 3AEVB 1VIHA 1J4WA 4JVYA 1DTJA 2CPQA 4AM3A 2MJHA 1ZZKA 4BA1I 2CTJA 2OPUA 2PY9A 2JVZA 4BA2I 1EC6A 2HH3A 2JE6I 4WALA 4AIMA 2NN6G 2FMRA 2JEAI 1WVNA 1K1GA 4NBQA 2AXYA 2E3UA 1ZTGA 1J5KA 2BA0A 2BL5A 3VKEA 1KHMA 2JA9A 2JZXA 2CTEA 2ANRA 2YQRA 1VIGA 2ANNA 2JEBI 4JVHA 2PQUA 4OO1G 2CTMA 5K36G 1TUAA 4QMFB 2Z0SA 3U1KA 1WE8A 3L7ZC 1ZZJA 2CTLA 2P2RA 1X4MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HH2 A;  2CTK A;  3V69 A;  2DGR A;  2CTF A;  4B8T A;  4LIJ A;  2OPV A;  1X4N A;  4IFD G;  4WAN A;  5JEA G;  5C0X G;  1DT4 A;  1ZZI A;  2QND A;  3AEV B;  1VIH A;  1J4W A;  4JVY A;  1DTJ A;  2CPQ A;  4AM3 A;  2MJH A;  1ZZK A;  4BA1 I;  2CTJ A;  2OPU A;  2PY9 A;  2JVZ A;  4BA2 I;  1EC6 A;  2HH3 A;  2JE6 I;  4WAL A;  4AIM A;  2NN6 G;  2FMR A;  2JEA I;  1WVN A;  1K1G A;  4NBQ A;  2AXY A;  2E3U A;  1ZTG A;  1J5K A;  2BA0 A;  2BL5 A;  3VKE A;  1KHM A;  2JA9 A;  2JZX A;  2CTE A;  2ANR A;  2YQR A;  1VIG A;  2ANN A;  2JEB I;  4JVH A;  2PQU A;  4OO1 G;  2CTM A;  5K36 G;  1TUA A;  4QMF B;  2Z0S A;  3U1K A;  1WE8 A;  3L7Z C;  1ZZJ A;  2CTL A;  2P2R A;  1X4M A; 
#chains in the Genus database with same CATH topology
 2HH2 A;  5LL6 b;  3V69 A;  1XMQ H;  5BR8 H;  1XNQ H;  1FJG H;  2OPV A;  3GAB A;  5LMU H;  4DV2 H;  4DV1 H;  4IFD G;  3OET A;  5JEA G;  1DT4 A;  1HNX H;  1I6U A;  3AEV B;  1VIH A;  4LF9 H;  4DV5 H;  4G08 A;  4NZR M;  1XNR H;  2CTJ A;  2OPU A;  2ZM6 H;  5IT9 W;  2PY9 A;  2JVZ A;  2HH3 A;  3I0P A;  2NN6 G;  2FMR A;  1V9N A;  1WVN A;  1K1G A;  2AXY A;  1ZTG A;  2E3U A;  2BL5 A;  4DV7 H;  2FFM A;  4B3R H;  2CTE A;  4JI3 H;  4JI7 H;  1VIG A;  2JEB I;  4DR7 H;  4AQY H;  4LFC H;  4JI8 H;  3OSS D;  2PQU A;  1HNZ H;  5K36 G;  2M8W A;  4LF6 H;  1S20 A;  3SB1 A;  3OTO H;  4DR2 H;  4E9J A;  1ZZJ A;  2UU9 H;  2CTL A;  3RF2 A;  4OD6 A;  2CTK A;  3J80 W;  4B3M H;  2DGR A;  4B8T A;  4PDB A;  4LIJ A;  1X4N A;  4YY3 H;  4DV4 H;  4JV5 H;  2ZQE A;  5C0X G;  3T1Y H;  3QD7 X;  4KHP H;  1DTJ A;  3J7A K;  2MJH A;  3UOE A;  3KDK A;  4YHH H;  4LFB H;  3KDG A;  4WAL A;  2K1H A;  4X62 H;  4AIM A;  4LFA H;  2JEA I;  4NBQ A;  2LTL A;  4NXM H;  1N32 H;  1Z2I A;  2JA9 A;  1S03 G;  2YQR A;  4NXN H;  4DR6 H;  4JI4 H;  2UXB H;  2LF0 A;  1VBI A;  5LMN H;  3T1H H;  4JVH A;  1F0X A;  1SEI A;  4OO1 G;  4X64 H;  4JYA H;  1PQX A;  1V8C A;  2Z0S A;  5DT9 A;  4DR4 H;  4DR5 H;  1X4M A;  1N36 H;  4K0K H;  1X9Z A;  4B3S H;  2CTF A;  2M6Q A;  1ZZI A;  5FLX W;  1I94 H;  2VKC A;  1HR0 H;  2CPQ A;  4AM3 A;  1ZZK A;  3EZJ A;  2O4C A;  1N33 H;  1WTJ A;  2LTM A;  2UUC H;  1J5E H;  4H8A A;  3GR5 A;  5A2Q W;  2A1S A;  4JI0 H;  1KHM A;  2CWF A;  4LF7 H;  4GKJ H;  2UXD H;  2ANR A;  4LF4 H;  4JI2 H;  1WHR A;  1X0A A;  2UUA H;  2F4V H;  2CTM A;  2UUB H;  1TUA A;  3U1K A;  4B3T H;  1WE8 A;  3L7Z C;  4B8C D;  3J81 W;  1MSZ A;  1J4W A;  1XRH A;  1FKA H;  4DUZ H;  2HHH H;  2P2R A;  1N34 H;  4DV0 H;  4JI5 H;  1IBM H;  2VQE H;  3GKU A;  4NZT M;  2VQF H;  3JAM W;  1XMO H;  4WAN A;  4JVY A;  4DUY H;  1AN7 A;  2QND A;  4BA1 I;  4OCH A;  4OX9 H;  2G8Y A;  5IWA H;  2E5L H;  2Y3M A;  4BA2 I;  1EC6 A;  2UXC H;  4LF5 H;  2JE6 I;  4FJU A;  4JI6 H;  1NXU A;  4LF8 H;  4DV6 H;  2CWH A;  1J5K A;  2FPH X;  2BA0 A;  3VKE A;  4FJS A;  2PT7 G;  2CPM A;  2X06 A;  2JZX A;  2LRR A;  4X66 H;  1ODH A;  4GKK H;  4DR1 H;  4DV3 H;  1IBL H;  4X65 H;  2ANN A;  1IBK H;  1UG8 A;  2D9I A;  3NCV A;  3FAU A;  4QMF B;  4DR3 H;  4JI1 H;  1HNW H;  4EC5 A; 
#chains in the Genus database with same CATH homology
 2HH2 A;  2CTK A;  3V69 A;  2DGR A;  2CTF A;  4B8T A;  4LIJ A;  2OPV A;  1X4N A;  4IFD G;  4WAN A;  5JEA G;  5C0X G;  1DT4 A;  1ZZI A;  2QND A;  3AEV B;  1VIH A;  1J4W A;  4JVY A;  1DTJ A;  2CPQ A;  4AM3 A;  2MJH A;  1ZZK A;  4BA1 I;  2CTJ A;  2OPU A;  2PY9 A;  2JVZ A;  4BA2 I;  1EC6 A;  2HH3 A;  2JE6 I;  4WAL A;  4AIM A;  2NN6 G;  2FMR A;  2JEA I;  1WVN A;  1K1G A;  4NBQ A;  2AXY A;  2E3U A;  1ZTG A;  1J5K A;  2BA0 A;  2BL5 A;  3VKE A;  1KHM A;  2JA9 A;  2JZX A;  2CTE A;  2ANR A;  2YQR A;  1VIG A;  2ANN A;  2JEB I;  4JVH A;  2PQU A;  4OO1 G;  2CTM A;  5K36 G;  1TUA A;  4QMF B;  2Z0S A;  3U1K A;  1WE8 A;  3L7Z C;  1ZZJ A;  2CTL A;  2P2R A;  1X4M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...