2MJHA

Solution structure of the gld-1 rna-binding domain in complex with rna
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
142
structure length
142
Chain Sequence
LPEPAGDMISITEKIYVPKNEYPDYNFVGRILGPRGMTAKQLEQDTGCKIMVRGKGSMRDKSKESAHRGKANWEHLEDDLHVLVQCEDTENRVHIKLQAALEQVKKLLIPAPEGTDELKRKQLMELAIINGTYRPMKSPNPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and functional implications of the QUA2 domain on RNA recognition by GLD-1.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Rna binding protein
molecule keywords Female germline-specific tumor suppressor gld-1
total genus 27
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2014-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 2mjhA00
2CTFA 1EC6A 2JZXA 2P2RA 2JEBI 2PY9A 4IFDG 1ZZJA 1DT4A 1WE8A 4JVYA 4OO1G 2CTJA 2PQUA 2JA9A 2HH3A 1KHMA 4NBQA 2OPVA 1VIGA 4WALA 2FMRA 2AXYA 4AIMA 4BA2I 1K1GA 2BL5A 2CTEA 2CTKA 2OPUA 2YQRA 1J4WA 2DGRA 4BA1I 2NN6G 2MJHA 4LIJA 4WANA 4AM3A 3L7ZC 2JE6I 3V69A 2Z0SA 1VIHA 1DTJA 2CPQA 2JVZA 2QNDA 4JVHA 1ZZIA 2CTLA 5C0XG 2E3UA 1TUAA 1J5KA 2CTMA 5JEAG 2ANRA 2ANNA 4B8TA 5K36G 3AEVB 2BA0A 1X4MA 4QMFB 2JEAI 1ZZKA 3U1KA 1ZTGA 3VKEA 1X4NA 1WVNA 2HH2A
chains in the Genus database with same CATH superfamily
4YHHH 2VQEH 2G8YA 4JVYA 1J5EH 1IBLH 3OTOH 1V9NA 2LRRA 3EZJA 2UU9H 1KHMA 2FPHX 2OPVA 1VIGA 4WALA 2UXDH 2ZQEA 4BA2I 2BL5A 4X62H 1J4WA 4OCHA 1IBMH 4AQYH 4JYAH 3L7ZC 3I0PA 3V69A 2CWHA 2Z0SA 4FJUA 3KDKA 4JVHA 1J5KA 4B3RH 4DR6H 1TUAA 2ANRA 4JI4H 2ANNA 4JI0H 4LF9H 1XNRH 4LFBH 2VKCA 4DV1H 4LF7H 1X4MA 4DV0H 1XRHA 1ZZKA 5LMUH 1X4NA 4EC5A 4GKJH 3T1YH 4G08A 2UUAH 1F0XA 4IFDG 1WE8A 2CWFA 1PQXA 5A2QW 1X0AA 2PT7G 5FLXW 2PQUA 2HH3A 5DT9A 4H8AA 1I94H 4X64H 1S03G 1Z2IA 1UG8A 2FMRA 2M8WA 2AXYA 2UUCH 1N32H 4NXNH 2M6QA 2CTEA 2ZM6H 1XMOH 2DGRA 2CPMA 2UXCH 4LIJA 4DR2H 4JV5H 3T1HH 4NZTM 3J81W 4OD6A 1VIHA 2QNDA 3GKUA 2CTLA 5C0XG 1HR0H 2UXBH 4DV7H 2F4VH 1IBKH 4DV3H 4X66H 2JEAI 4QMFB 2A1SA 3RF2A 1SEIA 1HNZH 1VBIA 3UOEA 1WTJA 4JI3H 1ODHA 1EC6A 2VQFH 2PY9A 4LF6H 1V8CA 1ZZJA 4FJSA 4NXMH 3OSSD 3SB1A 4JI6H 4B8CD 4LFAH 1MSZA 4DR7H 4DR1H 4B3MH 1K1GA 1HNXH 5IT9W 4LFCH 1FKAH 2CTKA 2YQRA 4LF5H 4BA1I 2Y3MA 2NN6G 1WHRA 2MJHA 2K1HA 3GABA 4DV5H 5BR8H 1DTJA 2CPQA 1N33H 3JAMW 5LMNH 1XMQH 1N34H 3J80W 2CTMA 4B3SH 4B8TA 4OX9H 4DR4H 4X65H 3FAUA 2BA0A 4JI5H 4GKKH 1WVNA 2HH2A 4YY3H 1X9ZA 1AN7A 4DUYH 1S20A 2CTFA 4NZRM 4LF8H 1XNQH 2JZXA 3KDGA 2P2RA 2JEBI 4JI8H 1HNWH 4KHPH 2E5LH 3J7AK 4PDBA 1DT4A 4OO1G 4DUZH 2CTJA 1I6UA 2JA9A 2O4CA 4LF4H 4NBQA 4JI2H 1FJGH 2LF0A 3GR5A 4AIMA 4DR5H 2UUBH 4DV6H 4DV2H 2LTMA 2OPUA 4DR3H 4DV4H 4JI1H 5LL6b 3QD7X 4WANA 4AM3A 2JE6I 3NCVA 3OETA 2JVZA 2X06A 1ZZIA 2E3UA 4K0KH 2LTLA 5JEAG 5K36G 2D9IA 3AEVB 2HHHH 1ZTGA 3U1KA 1N36H 3VKEA 4E9JA 4B3TH 1NXUA 5IWAH 4JI7H 2FFMA
chains in the Genus database with same CATH topology
2CTFA 1EC6A 2JZXA 2P2RA 2JEBI 2PY9A 4IFDG 1ZZJA 1DT4A 1WE8A 4JVYA 4OO1G 2CTJA 2PQUA 2JA9A 2HH3A 1KHMA 4NBQA 2OPVA 1VIGA 4WALA 2FMRA 2AXYA 4AIMA 4BA2I 1K1GA 2BL5A 2CTEA 2CTKA 2OPUA 2YQRA 1J4WA 2DGRA 4BA1I 2NN6G 2MJHA 4LIJA 4WANA 4AM3A 3L7ZC 2JE6I 3V69A 2Z0SA 1VIHA 1DTJA 2CPQA 2JVZA 2QNDA 4JVHA 1ZZIA 2CTLA 5C0XG 2E3UA 1TUAA 1J5KA 2CTMA 5JEAG 2ANRA 2ANNA 4B8TA 5K36G 3AEVB 2BA0A 1X4MA 4QMFB 2JEAI 1ZZKA 3U1KA 1ZTGA 3VKEA 1X4NA 1WVNA 2HH2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CTF A;  1EC6 A;  2JZX A;  2P2R A;  2JEB I;  2PY9 A;  4IFD G;  1ZZJ A;  1DT4 A;  1WE8 A;  4JVY A;  4OO1 G;  2CTJ A;  2PQU A;  2JA9 A;  2HH3 A;  1KHM A;  4NBQ A;  2OPV A;  1VIG A;  4WAL A;  2FMR A;  2AXY A;  4AIM A;  4BA2 I;  1K1G A;  2BL5 A;  2CTE A;  2CTK A;  2OPU A;  2YQR A;  1J4W A;  2DGR A;  4BA1 I;  2NN6 G;  2MJH A;  4LIJ A;  4WAN A;  4AM3 A;  3L7Z C;  2JE6 I;  3V69 A;  2Z0S A;  1VIH A;  1DTJ A;  2CPQ A;  2JVZ A;  2QND A;  4JVH A;  1ZZI A;  2CTL A;  5C0X G;  2E3U A;  1TUA A;  1J5K A;  2CTM A;  5JEA G;  2ANR A;  2ANN A;  4B8T A;  5K36 G;  3AEV B;  2BA0 A;  1X4M A;  4QMF B;  2JEA I;  1ZZK A;  3U1K A;  1ZTG A;  3VKE A;  1X4N A;  1WVN A;  2HH2 A; 
#chains in the Genus database with same CATH topology
 4YHH H;  2VQE H;  2G8Y A;  4JVY A;  1J5E H;  1IBL H;  3OTO H;  1V9N A;  2LRR A;  3EZJ A;  2UU9 H;  1KHM A;  2FPH X;  2OPV A;  1VIG A;  4WAL A;  2UXD H;  2ZQE A;  4BA2 I;  2BL5 A;  4X62 H;  1J4W A;  4OCH A;  1IBM H;  4AQY H;  4JYA H;  3L7Z C;  3I0P A;  3V69 A;  2CWH A;  2Z0S A;  4FJU A;  3KDK A;  4JVH A;  1J5K A;  4B3R H;  4DR6 H;  1TUA A;  2ANR A;  4JI4 H;  2ANN A;  4JI0 H;  4LF9 H;  1XNR H;  4LFB H;  2VKC A;  4DV1 H;  4LF7 H;  1X4M A;  4DV0 H;  1XRH A;  1ZZK A;  5LMU H;  1X4N A;  4EC5 A;  4GKJ H;  3T1Y H;  4G08 A;  2UUA H;  1F0X A;  4IFD G;  1WE8 A;  2CWF A;  1PQX A;  5A2Q W;  1X0A A;  2PT7 G;  5FLX W;  2PQU A;  2HH3 A;  5DT9 A;  4H8A A;  1I94 H;  4X64 H;  1S03 G;  1Z2I A;  1UG8 A;  2FMR A;  2M8W A;  2AXY A;  2UUC H;  1N32 H;  4NXN H;  2M6Q A;  2CTE A;  2ZM6 H;  1XMO H;  2DGR A;  2CPM A;  2UXC H;  4LIJ A;  4DR2 H;  4JV5 H;  3T1H H;  4NZT M;  3J81 W;  4OD6 A;  1VIH A;  2QND A;  3GKU A;  2CTL A;  5C0X G;  1HR0 H;  2UXB H;  4DV7 H;  2F4V H;  1IBK H;  4DV3 H;  4X66 H;  2JEA I;  4QMF B;  2A1S A;  3RF2 A;  1SEI A;  1HNZ H;  1VBI A;  3UOE A;  1WTJ A;  4JI3 H;  1ODH A;  1EC6 A;  2VQF H;  2PY9 A;  4LF6 H;  1V8C A;  1ZZJ A;  4FJS A;  4NXM H;  3OSS D;  3SB1 A;  4JI6 H;  4B8C D;  4LFA H;  1MSZ A;  4DR7 H;  4DR1 H;  4B3M H;  1K1G A;  1HNX H;  5IT9 W;  4LFC H;  1FKA H;  2CTK A;  2YQR A;  4LF5 H;  4BA1 I;  2Y3M A;  2NN6 G;  1WHR A;  2MJH A;  2K1H A;  3GAB A;  4DV5 H;  5BR8 H;  1DTJ A;  2CPQ A;  1N33 H;  3JAM W;  5LMN H;  1XMQ H;  1N34 H;  3J80 W;  2CTM A;  4B3S H;  4B8T A;  4OX9 H;  4DR4 H;  4X65 H;  3FAU A;  2BA0 A;  4JI5 H;  4GKK H;  1WVN A;  2HH2 A;  4YY3 H;  1X9Z A;  1AN7 A;  4DUY H;  1S20 A;  2CTF A;  4NZR M;  4LF8 H;  1XNQ H;  2JZX A;  3KDG A;  2P2R A;  2JEB I;  4JI8 H;  1HNW H;  4KHP H;  2E5L H;  3J7A K;  4PDB A;  1DT4 A;  4OO1 G;  4DUZ H;  2CTJ A;  1I6U A;  2JA9 A;  2O4C A;  4LF4 H;  4NBQ A;  4JI2 H;  1FJG H;  2LF0 A;  3GR5 A;  4AIM A;  4DR5 H;  2UUB H;  4DV6 H;  4DV2 H;  2LTM A;  2OPU A;  4DR3 H;  4DV4 H;  4JI1 H;  5LL6 b;  3QD7 X;  4WAN A;  4AM3 A;  2JE6 I;  3NCV A;  3OET A;  2JVZ A;  2X06 A;  1ZZI A;  2E3U A;  4K0K H;  2LTL A;  5JEA G;  5K36 G;  2D9I A;  3AEV B;  2HHH H;  1ZTG A;  3U1K A;  1N36 H;  3VKE A;  4E9J A;  4B3T H;  1NXU A;  5IWA H;  4JI7 H;  2FFM A; 
#chains in the Genus database with same CATH homology
 2CTF A;  1EC6 A;  2JZX A;  2P2R A;  2JEB I;  2PY9 A;  4IFD G;  1ZZJ A;  1DT4 A;  1WE8 A;  4JVY A;  4OO1 G;  2CTJ A;  2PQU A;  2JA9 A;  2HH3 A;  1KHM A;  4NBQ A;  2OPV A;  1VIG A;  4WAL A;  2FMR A;  2AXY A;  4AIM A;  4BA2 I;  1K1G A;  2BL5 A;  2CTE A;  2CTK A;  2OPU A;  2YQR A;  1J4W A;  2DGR A;  4BA1 I;  2NN6 G;  2MJH A;  4LIJ A;  4WAN A;  4AM3 A;  3L7Z C;  2JE6 I;  3V69 A;  2Z0S A;  1VIH A;  1DTJ A;  2CPQ A;  2JVZ A;  2QND A;  4JVH A;  1ZZI A;  2CTL A;  5C0X G;  2E3U A;  1TUA A;  1J5K A;  2CTM A;  5JEA G;  2ANR A;  2ANN A;  4B8T A;  5K36 G;  3AEV B;  2BA0 A;  1X4M A;  4QMF B;  2JEA I;  1ZZK A;  3U1K A;  1ZTG A;  3VKE A;  1X4N A;  1WVN A;  2HH2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...