2MJHA

Solution structure of the gld-1 rna-binding domain in complex with rna
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
142
structure length
142
Chain Sequence
LPEPAGDMISITEKIYVPKNEYPDYNFVGRILGPRGMTAKQLEQDTGCKIMVRGKGSMRDKSKESAHRGKANWEHLEDDLHVLVQCEDTENRVHIKLQAALEQVKKLLIPAPEGTDELKRKQLMELAIINGTYRPMKSPNPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Rna binding protein
molecule keywords Female germline-specific tumor suppressor gld-1
publication title Structural and functional implications of the QUA2 domain on RNA recognition by GLD-1.
pubmed doi rcsb
source organism Caenorhabditis elegans
total genus 27
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2014-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 2mjhA00
2DGRA 1KHMA 4JVYA 3L7ZC 2CTMA 1X4MA 2FMRA 4QMFB 1ZZJA 2CPQA 2JA9A 1ZZKA 4LIJA 2JEBI 2JE6I 1J5KA 4OO1G 2BA0A 1DTJA 2MJHA 1X4NA 2HH3A 1ZZIA 5C0XG 2ANRA 2CTKA 1VIGA 3AEVB 2BL5A 2OPUA 1K1GA 3VKEA 4B8TA 2CTFA 2CTEA 3U1KA 2QNDA 4BA1I 2CTJA 2YQRA 2P2RA 1ZTGA 2JZXA 2E3UA 1TUAA 2ANNA 1DT4A 2JEAI 1EC6A 4NBQA 1VIHA 2PY9A 1WE8A 2NN6G 4AIMA 4JVHA 2HH2A 1J4WA 4BA2I 2Z0SA 2PQUA 2JVZA 2OPVA 4AM3A 5K36G 1WVNA 2AXYA 2CTLA 5JEAG 4WANA 4IFDG 3V69A 4WALA
chains in the Genus database with same CATH superfamily
4E9JA 1FJGH 4LF9H 1IBMH 4DR4H 4OCHA 4GKKH 4X64H 1V8CA 4FJUA 4YHHH 4JI1H 1XNQH 1ZZJA 1N32H 2UXDH 1PQXA 2PT7G 4X65H 5IWAH 3T1YH 2JEBI 2A1SA 1I6UA 2BA0A 2LTMA 5DT9A 2MJHA 1X4NA 2M6QA 4JI5H 2ANRA 2VQFH 1VIGA 4LF7H 2BL5A 2Y3MA 4DR3H 1WTJA 4LF4H 1XMOH 4JI8H 4JV5H 4DV4H 1WHRA 1X9ZA 2P2RA 1N36H 4LF5H 2VQEH 1XNRH 3J7AK 4JYAH 4DUYH 3OETA 4JI6H 2AXYA 2UXCH 1XRHA 1HNWH 4JI3H 2UUBH 4KHPH 1X4MA 2O4CA 2LF0A 1V9NA 2CPQA 4G08A 1ODHA 1HR0H 2JE6I 3SB1A 1SEIA 5A2QW 3RF2A 1DTJA 3JAMW 3KDKA 4DV7H 2F4VH 4LFCH 4B3RH 1N33H 2ZQEA 4DR6H 2OPUA 4K0KH 1NXUA 3VKEA 3J80W 1IBLH 4DV2H 2CTFA 2CTEA 4B8TA 4DR2H 1HNZH 4DR7H 4BA1I 2FPHX 2M8WA 1MSZA 2JEAI 1ZTGA 2E3UA 5LL6b 1VIHA 1WE8A 3QD7X 4AIMA 4JVHA 2HH2A 4B8CD 2Z0SA 1WVNA 4DV0H 4JI2H 3T1HH 2CWHA 4IFDG 4DR1H 4LFAH 4WALA 3AEVB 4NZRM 2UUCH 4YY3H 2CTMA 4QMFB 1I94H 1X0AA 1FKAH 3I0PA 2JA9A 1ZZKA 1J5EH 4JI7H 4OX9H 2LTLA 4JI0H 3J81W 4X66H 2CTKA 4B3SH 4LF8H 4DV6H 2UU9H 2VKCA 3EZJA 2FFMA 4DUZH 2UUAH 1N34H 4DV5H 2X06A 2CTJA 4DV3H 2CPMA 2YQRA 4DR5H 3FAUA 2ANNA 2JZXA 4OD6A 1KHMA 1IBKH 4NBQA 2PY9A 4PDBA 2NN6G 5K36G 2D9IA 4X62H 4BA2I 2PQUA 4AM3A 5JEAG 2LRRA 4GKJH 2UXBH 4WANA 3OSSD 3UOEA 4EC5A 3OTOH 3GABA 4NXMH 2DGRA 4JVYA 2K1HA 3L7ZC 4AQYH 2FMRA 5LMUH 2ZM6H 1F0XA 4LIJA 1VBIA 4LFBH 1UG8A 2G8YA 1Z2IA 3KDGA 1J5KA 4OO1G 5BR8H 2HH3A 1ZZIA 1HNXH 5FLXW 5C0XG 4LF6H 1S03G 5LMNH 5IT9W 1K1GA 4H8AA 1XMQH 3GR5A 2CWFA 3U1KA 2QNDA 4FJSA 3NCVA 1S20A 2HHHH 4NXNH 3GKUA 1EC6A 1TUAA 1DT4A 1J4WA 1AN7A 2JVZA 2OPVA 4DV1H 4B3TH 4JI4H 2CTLA 4NZTM 4B3MH 3V69A 2E5LH
chains in the Genus database with same CATH topology
2DGRA 1KHMA 4JVYA 3L7ZC 2CTMA 1X4MA 2FMRA 4QMFB 1ZZJA 2CPQA 2JA9A 1ZZKA 4LIJA 2JEBI 2JE6I 1J5KA 4OO1G 2BA0A 1DTJA 2MJHA 1X4NA 2HH3A 1ZZIA 5C0XG 2ANRA 2CTKA 1VIGA 3AEVB 2BL5A 2OPUA 1K1GA 3VKEA 4B8TA 2CTFA 2CTEA 3U1KA 2QNDA 4BA1I 2CTJA 2YQRA 2P2RA 1ZTGA 2JZXA 2E3UA 1TUAA 2ANNA 1DT4A 2JEAI 1EC6A 4NBQA 1VIHA 2PY9A 1WE8A 2NN6G 4AIMA 4JVHA 2HH2A 1J4WA 4BA2I 2Z0SA 2PQUA 2JVZA 2OPVA 4AM3A 5K36G 1WVNA 2AXYA 2CTLA 5JEAG 4WANA 4IFDG 3V69A 4WALA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DGR A;  1KHM A;  4JVY A;  3L7Z C;  2CTM A;  1X4M A;  2FMR A;  4QMF B;  1ZZJ A;  2CPQ A;  2JA9 A;  1ZZK A;  4LIJ A;  2JEB I;  2JE6 I;  1J5K A;  4OO1 G;  2BA0 A;  1DTJ A;  2MJH A;  1X4N A;  2HH3 A;  1ZZI A;  5C0X G;  2ANR A;  2CTK A;  1VIG A;  3AEV B;  2BL5 A;  2OPU A;  1K1G A;  3VKE A;  4B8T A;  2CTF A;  2CTE A;  3U1K A;  2QND A;  4BA1 I;  2CTJ A;  2YQR A;  2P2R A;  1ZTG A;  2JZX A;  2E3U A;  1TUA A;  2ANN A;  1DT4 A;  2JEA I;  1EC6 A;  4NBQ A;  1VIH A;  2PY9 A;  1WE8 A;  2NN6 G;  4AIM A;  4JVH A;  2HH2 A;  1J4W A;  4BA2 I;  2Z0S A;  2PQU A;  2JVZ A;  2OPV A;  4AM3 A;  5K36 G;  1WVN A;  2AXY A;  2CTL A;  5JEA G;  4WAN A;  4IFD G;  3V69 A;  4WAL A; 
#chains in the Genus database with same CATH topology
 4E9J A;  1FJG H;  4LF9 H;  1IBM H;  4DR4 H;  4OCH A;  4GKK H;  4X64 H;  1V8C A;  4FJU A;  4YHH H;  4JI1 H;  1XNQ H;  1ZZJ A;  1N32 H;  2UXD H;  1PQX A;  2PT7 G;  4X65 H;  5IWA H;  3T1Y H;  2JEB I;  2A1S A;  1I6U A;  2BA0 A;  2LTM A;  5DT9 A;  2MJH A;  1X4N A;  2M6Q A;  4JI5 H;  2ANR A;  2VQF H;  1VIG A;  4LF7 H;  2BL5 A;  2Y3M A;  4DR3 H;  1WTJ A;  4LF4 H;  1XMO H;  4JI8 H;  4JV5 H;  4DV4 H;  1WHR A;  1X9Z A;  2P2R A;  1N36 H;  4LF5 H;  2VQE H;  1XNR H;  3J7A K;  4JYA H;  4DUY H;  3OET A;  4JI6 H;  2AXY A;  2UXC H;  1XRH A;  1HNW H;  4JI3 H;  2UUB H;  4KHP H;  1X4M A;  2O4C A;  2LF0 A;  1V9N A;  2CPQ A;  4G08 A;  1ODH A;  1HR0 H;  2JE6 I;  3SB1 A;  1SEI A;  5A2Q W;  3RF2 A;  1DTJ A;  3JAM W;  3KDK A;  4DV7 H;  2F4V H;  4LFC H;  4B3R H;  1N33 H;  2ZQE A;  4DR6 H;  2OPU A;  4K0K H;  1NXU A;  3VKE A;  3J80 W;  1IBL H;  4DV2 H;  2CTF A;  2CTE A;  4B8T A;  4DR2 H;  1HNZ H;  4DR7 H;  4BA1 I;  2FPH X;  2M8W A;  1MSZ A;  2JEA I;  1ZTG A;  2E3U A;  5LL6 b;  1VIH A;  1WE8 A;  3QD7 X;  4AIM A;  4JVH A;  2HH2 A;  4B8C D;  2Z0S A;  1WVN A;  4DV0 H;  4JI2 H;  3T1H H;  2CWH A;  4IFD G;  4DR1 H;  4LFA H;  4WAL A;  3AEV B;  4NZR M;  2UUC H;  4YY3 H;  2CTM A;  4QMF B;  1I94 H;  1X0A A;  1FKA H;  3I0P A;  2JA9 A;  1ZZK A;  1J5E H;  4JI7 H;  4OX9 H;  2LTL A;  4JI0 H;  3J81 W;  4X66 H;  2CTK A;  4B3S H;  4LF8 H;  4DV6 H;  2UU9 H;  2VKC A;  3EZJ A;  2FFM A;  4DUZ H;  2UUA H;  1N34 H;  4DV5 H;  2X06 A;  2CTJ A;  4DV3 H;  2CPM A;  2YQR A;  4DR5 H;  3FAU A;  2ANN A;  2JZX A;  4OD6 A;  1KHM A;  1IBK H;  4NBQ A;  2PY9 A;  4PDB A;  2NN6 G;  5K36 G;  2D9I A;  4X62 H;  4BA2 I;  2PQU A;  4AM3 A;  5JEA G;  2LRR A;  4GKJ H;  2UXB H;  4WAN A;  3OSS D;  3UOE A;  4EC5 A;  3OTO H;  3GAB A;  4NXM H;  2DGR A;  4JVY A;  2K1H A;  3L7Z C;  4AQY H;  2FMR A;  5LMU H;  2ZM6 H;  1F0X A;  4LIJ A;  1VBI A;  4LFB H;  1UG8 A;  2G8Y A;  1Z2I A;  3KDG A;  1J5K A;  4OO1 G;  5BR8 H;  2HH3 A;  1ZZI A;  1HNX H;  5FLX W;  5C0X G;  4LF6 H;  1S03 G;  5LMN H;  5IT9 W;  1K1G A;  4H8A A;  1XMQ H;  3GR5 A;  2CWF A;  3U1K A;  2QND A;  4FJS A;  3NCV A;  1S20 A;  2HHH H;  4NXN H;  3GKU A;  1EC6 A;  1TUA A;  1DT4 A;  1J4W A;  1AN7 A;  2JVZ A;  2OPV A;  4DV1 H;  4B3T H;  4JI4 H;  2CTL A;  4NZT M;  4B3M H;  3V69 A;  2E5L H; 
#chains in the Genus database with same CATH homology
 2DGR A;  1KHM A;  4JVY A;  3L7Z C;  2CTM A;  1X4M A;  2FMR A;  4QMF B;  1ZZJ A;  2CPQ A;  2JA9 A;  1ZZK A;  4LIJ A;  2JEB I;  2JE6 I;  1J5K A;  4OO1 G;  2BA0 A;  1DTJ A;  2MJH A;  1X4N A;  2HH3 A;  1ZZI A;  5C0X G;  2ANR A;  2CTK A;  1VIG A;  3AEV B;  2BL5 A;  2OPU A;  1K1G A;  3VKE A;  4B8T A;  2CTF A;  2CTE A;  3U1K A;  2QND A;  4BA1 I;  2CTJ A;  2YQR A;  2P2R A;  1ZTG A;  2JZX A;  2E3U A;  1TUA A;  2ANN A;  1DT4 A;  2JEA I;  1EC6 A;  4NBQ A;  1VIH A;  2PY9 A;  1WE8 A;  2NN6 G;  4AIM A;  4JVH A;  2HH2 A;  1J4W A;  4BA2 I;  2Z0S A;  2PQU A;  2JVZ A;  2OPV A;  4AM3 A;  5K36 G;  1WVN A;  2AXY A;  2CTL A;  5JEA G;  4WAN A;  4IFD G;  3V69 A;  4WAL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...