2MJHA

Solution structure of the gld-1 rna-binding domain in complex with rna
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
142
structure length
142
Chain Sequence
LPEPAGDMISITEKIYVPKNEYPDYNFVGRILGPRGMTAKQLEQDTGCKIMVRGKGSMRDKSKESAHRGKANWEHLEDDLHVLVQCEDTENRVHIKLQAALEQVKKLLIPAPEGTDELKRKQLMELAIINGTYRPMKSPNPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Female germline-specific tumor suppressor gld-1
publication title Structural and functional implications of the QUA2 domain on RNA recognition by GLD-1.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Rna binding protein
total genus 27
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2014-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 2mjhA00
2E3UA 1K1GA 2DGRA 2CTJA 2JE6I 5C0XG 2FMRA 4LIJA 2CPQA 2BL5A 1ZZIA 1TUAA 4IFDG 2CTLA 1X4MA 2Z0SA 2ANRA 1DTJA 5JEAG 2JEAI 4WANA 4NBQA 3U1KA 2HH2A 4BA1I 1J4WA 2ANNA 4OO1G 4QMFB 2BA0A 1J5KA 5K36G 2YQRA 1ZTGA 3AEVB 1X4NA 4AIMA 1DT4A 2NN6G 1VIGA 2CTFA 2QNDA 2CTEA 4WALA 4B8TA 2HH3A 2P2RA 2OPUA 4JVYA 1WE8A 3VKEA 1KHMA 2JZXA 2AXYA 2CTMA 4BA2I 3L7ZC 1ZZJA 2PY9A 4JVHA 1EC6A 2MJHA 3V69A 2CTKA 2JVZA 2PQUA 2JEBI 1ZZKA 2OPVA 2JA9A 1WVNA 1VIHA 4AM3A
chains in the Genus database with same CATH superfamily
2A1SA 2DGRA 1XRHA 4DR4H 1WHRA 4DV2H 4WANA 3EZJA 2ZM6H 2D9IA 1TUAA 2PT7G 5A2QW 3T1HH 1ZZIA 2Z0SA 4JI6H 2FPHX 3OETA 4DUZH 2JEAI 1IBLH 4JI2H 1N33H 5K36G 1X0AA 1S03G 4DR7H 1AN7A 5IT9W 4DR6H 4B3SH 5LL6b 2P2RA 2CTEA 4EC5A 4DR3H 3VKEA 4JI7H 3I0PA 3GKUA 2JZXA 1V8CA 4DV5H 2AXYA 2PY9A 4JI5H 2LTMA 2UXCH 2JA9A 1XNQH 1WVNA 2FFMA 1MSZA 1VIHA 4B3TH 4AM3A 3RF2A 4OCHA 2CWHA 4GKKH 1I6UA 3T1YH 4LIJA 4LF4H 4LF7H 4DV4H 2CPQA 5IWAH 1F0XA 4X66H 1N32H 1X9ZA 1X4MA 2CTLA 2VQFH 1N34H 1J5EH 4DV6H 2UUBH 2UXDH 4JI4H 3U1KA 1V9NA 4BA1I 3FAUA 2M6QA 1J5KA 4DR1H 4KHPH 2LF0A 1XNRH 4JYAH 5BR8H 2M8WA 2VQEH 5LMUH 4OD6A 4DV0H 1HNZH 4FJUA 3UOEA 4FJSA 1VIGA 2CTFA 4WALA 3SB1A 2LRRA 4NZTM 4JVHA 2MJHA 4X65H 2CTKA 5FLXW 2PQUA 1VBIA 1ZZKA 4LF8H 3OSSD 3GR5A 4LF9H 1IBMH 2E3UA 3J80W 4DV3H 2O4CA 5C0XG 2FMRA 2HHHH 2BL5A 4DV7H 2ANRA 5LMNH 1XMQH 2VKCA 5JEAG 2UUAH 4NBQA 2E5LH 2HH2A 4NXNH 4OX9H 4NZRM 2ZQEA 4OO1G 2BA0A 4B3RH 1I94H 1ZTGA 1HNWH 3AEVB 1X4NA 4LFAH 4YHHH 4H8AA 2F4VH 3QD7X 1WTJA 2NN6G 1UG8A 1ODHA 4JVYA 4LFCH 4X64H 4B8TA 2HH3A 1FJGH 2OPUA 2G8YA 3KDGA 4LFBH 4K0KH 4BA2I 4X62H 3L7ZC 1HR0H 1XMOH 1EC6A 4E9JA 1PQXA 2CPMA 2UUCH 2JEBI 4JI3H 4LF6H 1SEIA 4JI8H 4PDBA 3J81W 3OTOH 1K1GA 2K1HA 2CTJA 2JE6I 3GABA 2UU9H 2CWFA 4IFDG 2X06A 3KDKA 1Z2IA 1DTJA 4B3MH 1J4WA 4YY3H 2ANNA 4NXMH 4QMFB 1N36H 2YQRA 4DUYH 2Y3MA 4GKJH 4DV1H 4AIMA 1DT4A 4JV5H 1FKAH 1IBKH 2QNDA 5DT9A 1S20A 1WE8A 3JAMW 1KHMA 2UXBH 2CTMA 4B8CD 4DR5H 1ZZJA 1NXUA 3V69A 2JVZA 4DR2H 3NCVA 4JI1H 4JI0H 2OPVA 4G08A 3J7AK 2LTLA 1HNXH 4LF5H 4AQYH
chains in the Genus database with same CATH topology
2E3UA 1K1GA 2DGRA 2CTJA 2JE6I 5C0XG 2FMRA 4LIJA 2CPQA 2BL5A 1ZZIA 1TUAA 4IFDG 2CTLA 1X4MA 2Z0SA 2ANRA 1DTJA 5JEAG 2JEAI 4WANA 4NBQA 3U1KA 2HH2A 4BA1I 1J4WA 2ANNA 4OO1G 4QMFB 2BA0A 1J5KA 5K36G 2YQRA 1ZTGA 3AEVB 1X4NA 4AIMA 1DT4A 2NN6G 1VIGA 2CTFA 2QNDA 2CTEA 4WALA 4B8TA 2HH3A 2P2RA 2OPUA 4JVYA 1WE8A 3VKEA 1KHMA 2JZXA 2AXYA 2CTMA 4BA2I 3L7ZC 1ZZJA 2PY9A 4JVHA 1EC6A 2MJHA 3V69A 2CTKA 2JVZA 2PQUA 2JEBI 1ZZKA 2OPVA 2JA9A 1WVNA 1VIHA 4AM3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E3U A;  1K1G A;  2DGR A;  2CTJ A;  2JE6 I;  5C0X G;  2FMR A;  4LIJ A;  2CPQ A;  2BL5 A;  1ZZI A;  1TUA A;  4IFD G;  2CTL A;  1X4M A;  2Z0S A;  2ANR A;  1DTJ A;  5JEA G;  2JEA I;  4WAN A;  4NBQ A;  3U1K A;  2HH2 A;  4BA1 I;  1J4W A;  2ANN A;  4OO1 G;  4QMF B;  2BA0 A;  1J5K A;  5K36 G;  2YQR A;  1ZTG A;  3AEV B;  1X4N A;  4AIM A;  1DT4 A;  2NN6 G;  1VIG A;  2CTF A;  2QND A;  2CTE A;  4WAL A;  4B8T A;  2HH3 A;  2P2R A;  2OPU A;  4JVY A;  1WE8 A;  3VKE A;  1KHM A;  2JZX A;  2AXY A;  2CTM A;  4BA2 I;  3L7Z C;  1ZZJ A;  2PY9 A;  4JVH A;  1EC6 A;  2MJH A;  3V69 A;  2CTK A;  2JVZ A;  2PQU A;  2JEB I;  1ZZK A;  2OPV A;  2JA9 A;  1WVN A;  1VIH A;  4AM3 A; 
#chains in the Genus database with same CATH topology
 2A1S A;  2DGR A;  1XRH A;  4DR4 H;  1WHR A;  4DV2 H;  4WAN A;  3EZJ A;  2ZM6 H;  2D9I A;  1TUA A;  2PT7 G;  5A2Q W;  3T1H H;  1ZZI A;  2Z0S A;  4JI6 H;  2FPH X;  3OET A;  4DUZ H;  2JEA I;  1IBL H;  4JI2 H;  1N33 H;  5K36 G;  1X0A A;  1S03 G;  4DR7 H;  1AN7 A;  5IT9 W;  4DR6 H;  4B3S H;  5LL6 b;  2P2R A;  2CTE A;  4EC5 A;  4DR3 H;  3VKE A;  4JI7 H;  3I0P A;  3GKU A;  2JZX A;  1V8C A;  4DV5 H;  2AXY A;  2PY9 A;  4JI5 H;  2LTM A;  2UXC H;  2JA9 A;  1XNQ H;  1WVN A;  2FFM A;  1MSZ A;  1VIH A;  4B3T H;  4AM3 A;  3RF2 A;  4OCH A;  2CWH A;  4GKK H;  1I6U A;  3T1Y H;  4LIJ A;  4LF4 H;  4LF7 H;  4DV4 H;  2CPQ A;  5IWA H;  1F0X A;  4X66 H;  1N32 H;  1X9Z A;  1X4M A;  2CTL A;  2VQF H;  1N34 H;  1J5E H;  4DV6 H;  2UUB H;  2UXD H;  4JI4 H;  3U1K A;  1V9N A;  4BA1 I;  3FAU A;  2M6Q A;  1J5K A;  4DR1 H;  4KHP H;  2LF0 A;  1XNR H;  4JYA H;  5BR8 H;  2M8W A;  2VQE H;  5LMU H;  4OD6 A;  4DV0 H;  1HNZ H;  4FJU A;  3UOE A;  4FJS A;  1VIG A;  2CTF A;  4WAL A;  3SB1 A;  2LRR A;  4NZT M;  4JVH A;  2MJH A;  4X65 H;  2CTK A;  5FLX W;  2PQU A;  1VBI A;  1ZZK A;  4LF8 H;  3OSS D;  3GR5 A;  4LF9 H;  1IBM H;  2E3U A;  3J80 W;  4DV3 H;  2O4C A;  5C0X G;  2FMR A;  2HHH H;  2BL5 A;  4DV7 H;  2ANR A;  5LMN H;  1XMQ H;  2VKC A;  5JEA G;  2UUA H;  4NBQ A;  2E5L H;  2HH2 A;  4NXN H;  4OX9 H;  4NZR M;  2ZQE A;  4OO1 G;  2BA0 A;  4B3R H;  1I94 H;  1ZTG A;  1HNW H;  3AEV B;  1X4N A;  4LFA H;  4YHH H;  4H8A A;  2F4V H;  3QD7 X;  1WTJ A;  2NN6 G;  1UG8 A;  1ODH A;  4JVY A;  4LFC H;  4X64 H;  4B8T A;  2HH3 A;  1FJG H;  2OPU A;  2G8Y A;  3KDG A;  4LFB H;  4K0K H;  4BA2 I;  4X62 H;  3L7Z C;  1HR0 H;  1XMO H;  1EC6 A;  4E9J A;  1PQX A;  2CPM A;  2UUC H;  2JEB I;  4JI3 H;  4LF6 H;  1SEI A;  4JI8 H;  4PDB A;  3J81 W;  3OTO H;  1K1G A;  2K1H A;  2CTJ A;  2JE6 I;  3GAB A;  2UU9 H;  2CWF A;  4IFD G;  2X06 A;  3KDK A;  1Z2I A;  1DTJ A;  4B3M H;  1J4W A;  4YY3 H;  2ANN A;  4NXM H;  4QMF B;  1N36 H;  2YQR A;  4DUY H;  2Y3M A;  4GKJ H;  4DV1 H;  4AIM A;  1DT4 A;  4JV5 H;  1FKA H;  1IBK H;  2QND A;  5DT9 A;  1S20 A;  1WE8 A;  3JAM W;  1KHM A;  2UXB H;  2CTM A;  4B8C D;  4DR5 H;  1ZZJ A;  1NXU A;  3V69 A;  2JVZ A;  4DR2 H;  3NCV A;  4JI1 H;  4JI0 H;  2OPV A;  4G08 A;  3J7A K;  2LTL A;  1HNX H;  4LF5 H;  4AQY H; 
#chains in the Genus database with same CATH homology
 2E3U A;  1K1G A;  2DGR A;  2CTJ A;  2JE6 I;  5C0X G;  2FMR A;  4LIJ A;  2CPQ A;  2BL5 A;  1ZZI A;  1TUA A;  4IFD G;  2CTL A;  1X4M A;  2Z0S A;  2ANR A;  1DTJ A;  5JEA G;  2JEA I;  4WAN A;  4NBQ A;  3U1K A;  2HH2 A;  4BA1 I;  1J4W A;  2ANN A;  4OO1 G;  4QMF B;  2BA0 A;  1J5K A;  5K36 G;  2YQR A;  1ZTG A;  3AEV B;  1X4N A;  4AIM A;  1DT4 A;  2NN6 G;  1VIG A;  2CTF A;  2QND A;  2CTE A;  4WAL A;  4B8T A;  2HH3 A;  2P2R A;  2OPU A;  4JVY A;  1WE8 A;  3VKE A;  1KHM A;  2JZX A;  2AXY A;  2CTM A;  4BA2 I;  3L7Z C;  1ZZJ A;  2PY9 A;  4JVH A;  1EC6 A;  2MJH A;  3V69 A;  2CTK A;  2JVZ A;  2PQU A;  2JEB I;  1ZZK A;  2OPV A;  2JA9 A;  1WVN A;  1VIH A;  4AM3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...