2OPUA

Solution nmr structure of the first domain of ksrp
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
89
structure length
89
Chain Sequence
ISSQLGPIHPPPRTSMTEEYRVPDGMVGLIIGRGGEQINKIQQDSGCKVQISPDSGGLPERSVSLTGAPESVQKAKMMLDDIVSRGRGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KHSRP protein
publication title Phosphorylation-mediated unfolding of a KH domain regulates KSRP localization via 14-3-3 binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 24
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2007-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 2opuA00
2DGRA 1K1GA 1TUAA 2JEBI 2JVZA 4LIJA 1X4NA 1X4MA 2BL5A 4BA2I 2QNDA 2BA0A 2CTMA 2ANRA 2JA9A 4BA1I 1KHMA 3L7ZC 2E3UA 4JVHA 2CTEA 5K36G 2CTKA 2ANNA 4AM3A 5JEAG 1ZZKA 1ZZIA 2CPQA 3AEVB 5C0XG 3U1KA 1WVNA 2JE6I 2FMRA 2OPVA 2HH2A 2MJHA 3VKEA 1ZTGA 3V69A 4WANA 4WALA 1WE8A 2NN6G 4B8TA 2PQUA 4OO1G 1EC6A 2OPUA 2CTLA 1DT4A 1ZZJA 4IFDG 2CTFA 1J5KA 4NBQA 2AXYA 1DTJA 2JEAI 2CTJA 2PY9A 2P2RA 2HH3A 1VIGA 1VIHA 4AIMA 2JZXA 2Z0SA 1J4WA 4JVYA 2YQRA 4QMFB
chains in the Genus database with same CATH superfamily
1X0AA 5IT9W 1MSZA 4JI2H 1IBMH 4OD6A 2UUBH 4PDBA 3NCVA 4DR7H 2VQEH 1WHRA 2BL5A 2ANRA 2BA0A 2JA9A 1V8CA 4DR3H 2CTKA 2LTLA 4B3RH 2CPQA 2Y3MA 3AEVB 2FMRA 2MJHA 3VKEA 2F4VH 1HNWH 4K0KH 2PQUA 1EC6A 2OPUA 1DT4A 4DR5H 2LRRA 4NZTM 4NZRM 1XRHA 3UOEA 2AXYA 4JI5H 2CTJA 5DT9A 1VIHA 2JZXA 2Z0SA 1N36H 4DV7H 2UXDH 1XMQH 4YHHH 1IBKH 1J5EH 2E5LH 1TUAA 4X65H 2D9IA 4DV3H 1X4NA 1HNXH 1X4MA 4X64H 4X66H 4NXMH 4BA2I 3T1YH 2VKCA 3L7ZC 2E3UA 4FJSA 4B3SH 1V9NA 5K36G 1WTJA 1HR0H 1ZZKA 1WVNA 2JE6I 3FAUA 4GKKH 3GR5A 4LFCH 4DV5H 4WANA 5LMUH 3OTOH 4B8TA 4DV0H 4EC5A 3J81W 4OO1G 2UUCH 1N34H 2UU9H 4E9JA 2LF0A 1J5KA 1N33H 1NXUA 2JEAI 4LF8H 2P2RA 4DR2H 4AIMA 3T1HH 4JI0H 4AQYH 2X06A 5FLXW 1K1GA 2CPMA 4OCHA 4DV4H 2JEBI 2HHHH 1X9ZA 2G8YA 2ZQEA 3QD7X 1XNRH 2CWFA 2QNDA 4JI4H 2CTMA 2VQFH 5LMNH 1XMOH 2FFMA 4LF4H 5IWAH 5A2QW 3J7AK 1SEIA 2CTEA 3I0PA 4AM3A 5JEAG 4KHPH 1ZZIA 4G08A 1F0XA 5C0XG 4X62H 2OPVA 2HH2A 4LFAH 1S03G 3SB1A 1I6UA 4LFBH 4DV1H 1ZTGA 3V69A 4LF7H 2A1SA 4LF6H 2O4CA 4WALA 1WE8A 1FKAH 4DR4H 4B3TH 1N32H 2ZM6H 4GKJH 4IFDG 2CTFA 2PT7G 1XNQH 2PY9A 1DTJA 3GKUA 4NXNH 2UUAH 2HH3A 1VIGA 3KDGA 3OETA 3KDKA 1IBLH 4DR1H 2DGRA 3JAMW 4JV5H 1I94H 4JI8H 3J80W 2M8WA 4FJUA 2JVZA 3EZJA 1S20A 4LIJA 5LL6b 2FPHX 4H8AA 4BA1I 4YY3H 1KHMA 4JYAH 4DUZH 4LF5H 4JVHA 4DV6H 1VBIA 2ANNA 2LTMA 2M6QA 1HNZH 4B3MH 4JI7H 1FJGH 1AN7A 3OSSD 3U1KA 5BR8H 4JI6H 4LF9H 4DUYH 1Z2IA 3GABA 2UXCH 1UG8A 3RF2A 4DV2H 2NN6G 4B8CD 4OX9H 4JI3H 2CTLA 1ZZJA 4DR6H 1PQXA 4NBQA 4JI1H 1ODHA 1J4WA 2UXBH 4JVYA 2YQRA 2K1HA 2CWHA 4QMFB
chains in the Genus database with same CATH topology
2DGRA 1K1GA 1TUAA 2JEBI 2JVZA 4LIJA 1X4NA 1X4MA 2BL5A 4BA2I 2QNDA 2BA0A 2CTMA 2ANRA 2JA9A 4BA1I 1KHMA 3L7ZC 2E3UA 4JVHA 2CTEA 5K36G 2CTKA 2ANNA 4AM3A 5JEAG 1ZZKA 1ZZIA 2CPQA 3AEVB 5C0XG 3U1KA 1WVNA 2JE6I 2FMRA 2OPVA 2HH2A 2MJHA 3VKEA 1ZTGA 3V69A 4WANA 4WALA 1WE8A 2NN6G 4B8TA 2PQUA 4OO1G 1EC6A 2OPUA 2CTLA 1DT4A 1ZZJA 4IFDG 2CTFA 1J5KA 4NBQA 2AXYA 1DTJA 2JEAI 2CTJA 2PY9A 2P2RA 2HH3A 1VIGA 1VIHA 4AIMA 2JZXA 2Z0SA 1J4WA 4JVYA 2YQRA 4QMFB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DGR A;  1K1G A;  1TUA A;  2JEB I;  2JVZ A;  4LIJ A;  1X4N A;  1X4M A;  2BL5 A;  4BA2 I;  2QND A;  2BA0 A;  2CTM A;  2ANR A;  2JA9 A;  4BA1 I;  1KHM A;  3L7Z C;  2E3U A;  4JVH A;  2CTE A;  5K36 G;  2CTK A;  2ANN A;  4AM3 A;  5JEA G;  1ZZK A;  1ZZI A;  2CPQ A;  3AEV B;  5C0X G;  3U1K A;  1WVN A;  2JE6 I;  2FMR A;  2OPV A;  2HH2 A;  2MJH A;  3VKE A;  1ZTG A;  3V69 A;  4WAN A;  4WAL A;  1WE8 A;  2NN6 G;  4B8T A;  2PQU A;  4OO1 G;  1EC6 A;  2OPU A;  2CTL A;  1DT4 A;  1ZZJ A;  4IFD G;  2CTF A;  1J5K A;  4NBQ A;  2AXY A;  1DTJ A;  2JEA I;  2CTJ A;  2PY9 A;  2P2R A;  2HH3 A;  1VIG A;  1VIH A;  4AIM A;  2JZX A;  2Z0S A;  1J4W A;  4JVY A;  2YQR A;  4QMF B; 
#chains in the Genus database with same CATH topology
 1X0A A;  5IT9 W;  1MSZ A;  4JI2 H;  1IBM H;  4OD6 A;  2UUB H;  4PDB A;  3NCV A;  4DR7 H;  2VQE H;  1WHR A;  2BL5 A;  2ANR A;  2BA0 A;  2JA9 A;  1V8C A;  4DR3 H;  2CTK A;  2LTL A;  4B3R H;  2CPQ A;  2Y3M A;  3AEV B;  2FMR A;  2MJH A;  3VKE A;  2F4V H;  1HNW H;  4K0K H;  2PQU A;  1EC6 A;  2OPU A;  1DT4 A;  4DR5 H;  2LRR A;  4NZT M;  4NZR M;  1XRH A;  3UOE A;  2AXY A;  4JI5 H;  2CTJ A;  5DT9 A;  1VIH A;  2JZX A;  2Z0S A;  1N36 H;  4DV7 H;  2UXD H;  1XMQ H;  4YHH H;  1IBK H;  1J5E H;  2E5L H;  1TUA A;  4X65 H;  2D9I A;  4DV3 H;  1X4N A;  1HNX H;  1X4M A;  4X64 H;  4X66 H;  4NXM H;  4BA2 I;  3T1Y H;  2VKC A;  3L7Z C;  2E3U A;  4FJS A;  4B3S H;  1V9N A;  5K36 G;  1WTJ A;  1HR0 H;  1ZZK A;  1WVN A;  2JE6 I;  3FAU A;  4GKK H;  3GR5 A;  4LFC H;  4DV5 H;  4WAN A;  5LMU H;  3OTO H;  4B8T A;  4DV0 H;  4EC5 A;  3J81 W;  4OO1 G;  2UUC H;  1N34 H;  2UU9 H;  4E9J A;  2LF0 A;  1J5K A;  1N33 H;  1NXU A;  2JEA I;  4LF8 H;  2P2R A;  4DR2 H;  4AIM A;  3T1H H;  4JI0 H;  4AQY H;  2X06 A;  5FLX W;  1K1G A;  2CPM A;  4OCH A;  4DV4 H;  2JEB I;  2HHH H;  1X9Z A;  2G8Y A;  2ZQE A;  3QD7 X;  1XNR H;  2CWF A;  2QND A;  4JI4 H;  2CTM A;  2VQF H;  5LMN H;  1XMO H;  2FFM A;  4LF4 H;  5IWA H;  5A2Q W;  3J7A K;  1SEI A;  2CTE A;  3I0P A;  4AM3 A;  5JEA G;  4KHP H;  1ZZI A;  4G08 A;  1F0X A;  5C0X G;  4X62 H;  2OPV A;  2HH2 A;  4LFA H;  1S03 G;  3SB1 A;  1I6U A;  4LFB H;  4DV1 H;  1ZTG A;  3V69 A;  4LF7 H;  2A1S A;  4LF6 H;  2O4C A;  4WAL A;  1WE8 A;  1FKA H;  4DR4 H;  4B3T H;  1N32 H;  2ZM6 H;  4GKJ H;  4IFD G;  2CTF A;  2PT7 G;  1XNQ H;  2PY9 A;  1DTJ A;  3GKU A;  4NXN H;  2UUA H;  2HH3 A;  1VIG A;  3KDG A;  3OET A;  3KDK A;  1IBL H;  4DR1 H;  2DGR A;  3JAM W;  4JV5 H;  1I94 H;  4JI8 H;  3J80 W;  2M8W A;  4FJU A;  2JVZ A;  3EZJ A;  1S20 A;  4LIJ A;  5LL6 b;  2FPH X;  4H8A A;  4BA1 I;  4YY3 H;  1KHM A;  4JYA H;  4DUZ H;  4LF5 H;  4JVH A;  4DV6 H;  1VBI A;  2ANN A;  2LTM A;  2M6Q A;  1HNZ H;  4B3M H;  4JI7 H;  1FJG H;  1AN7 A;  3OSS D;  3U1K A;  5BR8 H;  4JI6 H;  4LF9 H;  4DUY H;  1Z2I A;  3GAB A;  2UXC H;  1UG8 A;  3RF2 A;  4DV2 H;  2NN6 G;  4B8C D;  4OX9 H;  4JI3 H;  2CTL A;  1ZZJ A;  4DR6 H;  1PQX A;  4NBQ A;  4JI1 H;  1ODH A;  1J4W A;  2UXB H;  4JVY A;  2YQR A;  2K1H A;  2CWH A;  4QMF B; 
#chains in the Genus database with same CATH homology
 2DGR A;  1K1G A;  1TUA A;  2JEB I;  2JVZ A;  4LIJ A;  1X4N A;  1X4M A;  2BL5 A;  4BA2 I;  2QND A;  2BA0 A;  2CTM A;  2ANR A;  2JA9 A;  4BA1 I;  1KHM A;  3L7Z C;  2E3U A;  4JVH A;  2CTE A;  5K36 G;  2CTK A;  2ANN A;  4AM3 A;  5JEA G;  1ZZK A;  1ZZI A;  2CPQ A;  3AEV B;  5C0X G;  3U1K A;  1WVN A;  2JE6 I;  2FMR A;  2OPV A;  2HH2 A;  2MJH A;  3VKE A;  1ZTG A;  3V69 A;  4WAN A;  4WAL A;  1WE8 A;  2NN6 G;  4B8T A;  2PQU A;  4OO1 G;  1EC6 A;  2OPU A;  2CTL A;  1DT4 A;  1ZZJ A;  4IFD G;  2CTF A;  1J5K A;  4NBQ A;  2AXY A;  1DTJ A;  2JEA I;  2CTJ A;  2PY9 A;  2P2R A;  2HH3 A;  1VIG A;  1VIH A;  4AIM A;  2JZX A;  2Z0S A;  1J4W A;  4JVY A;  2YQR A;  4QMF B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...