2OPUA

Solution nmr structure of the first domain of ksrp
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
89
structure length
89
Chain Sequence
ISSQLGPIHPPPRTSMTEEYRVPDGMVGLIIGRGGEQINKIQQDSGCKVQISPDSGGLPERSVSLTGAPESVQKAKMMLDDIVSRGRGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords KHSRP protein
publication title Phosphorylation-mediated unfolding of a KH domain regulates KSRP localization via 14-3-3 binding.
pubmed doi rcsb
source organism Homo sapiens
total genus 24
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2007-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 2opuA00
1ZZJA 2ANRA 1VIGA 2ANNA 4IFDG 2CTMA 4NBQA 1DTJA 2CTEA 4JVYA 3V69A 2CTLA 2QNDA 1TUAA 1ZZIA 2MJHA 2BA0A 2JEAI 2OPUA 2CTJA 4BA2I 1X4MA 1J5KA 3VKEA 4AM3A 2P2RA 2JVZA 1ZZKA 2JZXA 2CPQA 5C0XG 2PQUA 4LIJA 4OO1G 4BA1I 2CTFA 2BL5A 2HH2A 2AXYA 4QMFB 2JA9A 2CTKA 2JEBI 2PY9A 4JVHA 2FMRA 2DGRA 2HH3A 1DT4A 2OPVA 1KHMA 1WVNA 5K36G 3U1KA 4B8TA 2Z0SA 3L7ZC 1K1GA 1ZTGA 4AIMA 1VIHA 2YQRA 2NN6G 1WE8A 5JEAG 1EC6A 2JE6I 1X4NA 2E3UA 3AEVB 4WANA 4WALA 1J4WA
chains in the Genus database with same CATH superfamily
1ZZJA 3NCVA 2CWHA 5BR8H 2CTMA 2VKCA 4DV4H 4JI8H 2M8WA 1DTJA 2CTEA 2HHHH 4B3MH 4AQYH 1PQXA 2A1SA 4LF6H 1FJGH 2LTLA 2ZM6H 2JZXA 1Z2IA 4OD6A 2CTFA 2BL5A 2HH2A 4JYAH 2JEBI 4GKJH 3EZJA 3GABA 2E5LH 1HNXH 2OPVA 1KHMA 3I0PA 1V8CA 3U1KA 2Z0SA 4GKKH 1S20A 2UXDH 4AIMA 2FFMA 4FJSA 1EC6A 4JI3H 4H8AA 4NXMH 4WALA 4X65H 1N32H 1VBIA 1VIGA 2LTMA 5IT9W 3QD7X 2F4VH 3RF2A 4G08A 1J5EH 4NBQA 4B8CD 4X62H 3OSSD 3JAMW 2M6QA 4DR5H 3V69A 4JVYA 4DUYH 2CWFA 4LF5H 1HNWH 2MJHA 4YHHH 2OPUA 3AEVB 4NZTM 2K1HA 3VKEA 4AM3A 1ZZKA 3SB1A 4E9JA 4DV5H 2PT7G 4LFCH 2UUCH 2CTKA 2PY9A 4OX9H 5K36G 1HR0H 4JV5H 4JI0H 1ZTGA 5FLXW 1XMQH 1VIHA 4LF4H 4LFAH 1S03G 2NN6G 5JEAG 4DV1H 4DR4H 2UXCH 2E3UA 2UUAH 5DT9A 3J81W 4YY3H 2UUBH 3J80W 4DV7H 5LL6b 1N34H 1I94H 1HNZH 1XMOH 1TUAA 2CPMA 1ZZIA 4LF8H 2JEAI 2X06A 4BA2I 1X4MA 1SEIA 3J7AK 1J5KA 1WTJA 4KHPH 1XNRH 3KDKA 2P2RA 5C0XG 4K0KH 1NXUA 2CPQA 4OO1G 4LIJA 2UU9H 1UG8A 2Y3MA 1MSZA 4BA1I 2VQEH 3T1YH 4QMFB 1IBMH 4DV3H 2FMRA 4JI4H 1DT4A 1ODHA 4LF7H 2UXBH 1XNQH 1K1GA 4B3RH 4DV0H 4B3SH 3GR5A 1IBKH 1WE8A 5LMNH 2JE6I 4X66H 1X4NA 4LF9H 5A2QW 1F0XA 2ANNA 4DR2H 4WANA 2ANRA 3FAUA 5LMUH 4DR6H 4IFDG 5IWAH 2O4CA 4DV2H 3OTOH 4JI6H 4X64H 3GKUA 2CTLA 4DR1H 1AN7A 2QNDA 1X0AA 1N36H 2BA0A 1XRHA 2CTJA 2ZQEA 4DUZH 4JI5H 3OETA 4PDBA 2JVZA 3T1HH 1I6UA 4DR7H 2LF0A 1FKAH 2PQUA 1N33H 4NZRM 4JI2H 2AXYA 4JVHA 2JA9A 2DGRA 2HH3A 2D9IA 2FPHX 1WVNA 4LFBH 4B8TA 2LRRA 3L7ZC 4JI7H 4EC5A 4JI1H 2G8YA 4DR3H 1IBLH 2VQFH 4B3TH 2YQRA 4NXNH 1X9ZA 4OCHA 3UOEA 1WHRA 4FJUA 1V9NA 4DV6H 3KDGA 1J4WA
chains in the Genus database with same CATH topology
1ZZJA 2ANRA 1VIGA 2ANNA 4IFDG 2CTMA 4NBQA 1DTJA 2CTEA 4JVYA 3V69A 2CTLA 2QNDA 1TUAA 1ZZIA 2MJHA 2BA0A 2JEAI 2OPUA 2CTJA 4BA2I 1X4MA 1J5KA 3VKEA 4AM3A 2P2RA 2JVZA 1ZZKA 2JZXA 2CPQA 5C0XG 2PQUA 4LIJA 4OO1G 4BA1I 2CTFA 2BL5A 2HH2A 2AXYA 4QMFB 2JA9A 2CTKA 2JEBI 2PY9A 4JVHA 2FMRA 2DGRA 2HH3A 1DT4A 2OPVA 1KHMA 1WVNA 5K36G 3U1KA 4B8TA 2Z0SA 3L7ZC 1K1GA 1ZTGA 4AIMA 1VIHA 2YQRA 2NN6G 1WE8A 5JEAG 1EC6A 2JE6I 1X4NA 2E3UA 3AEVB 4WANA 4WALA 1J4WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZZJ A;  2ANR A;  1VIG A;  2ANN A;  4IFD G;  2CTM A;  4NBQ A;  1DTJ A;  2CTE A;  4JVY A;  3V69 A;  2CTL A;  2QND A;  1TUA A;  1ZZI A;  2MJH A;  2BA0 A;  2JEA I;  2OPU A;  2CTJ A;  4BA2 I;  1X4M A;  1J5K A;  3VKE A;  4AM3 A;  2P2R A;  2JVZ A;  1ZZK A;  2JZX A;  2CPQ A;  5C0X G;  2PQU A;  4LIJ A;  4OO1 G;  4BA1 I;  2CTF A;  2BL5 A;  2HH2 A;  2AXY A;  4QMF B;  2JA9 A;  2CTK A;  2JEB I;  2PY9 A;  4JVH A;  2FMR A;  2DGR A;  2HH3 A;  1DT4 A;  2OPV A;  1KHM A;  1WVN A;  5K36 G;  3U1K A;  4B8T A;  2Z0S A;  3L7Z C;  1K1G A;  1ZTG A;  4AIM A;  1VIH A;  2YQR A;  2NN6 G;  1WE8 A;  5JEA G;  1EC6 A;  2JE6 I;  1X4N A;  2E3U A;  3AEV B;  4WAN A;  4WAL A;  1J4W A; 
#chains in the Genus database with same CATH topology
 1ZZJ A;  3NCV A;  2CWH A;  5BR8 H;  2CTM A;  2VKC A;  4DV4 H;  4JI8 H;  2M8W A;  1DTJ A;  2CTE A;  2HHH H;  4B3M H;  4AQY H;  1PQX A;  2A1S A;  4LF6 H;  1FJG H;  2LTL A;  2ZM6 H;  2JZX A;  1Z2I A;  4OD6 A;  2CTF A;  2BL5 A;  2HH2 A;  4JYA H;  2JEB I;  4GKJ H;  3EZJ A;  3GAB A;  2E5L H;  1HNX H;  2OPV A;  1KHM A;  3I0P A;  1V8C A;  3U1K A;  2Z0S A;  4GKK H;  1S20 A;  2UXD H;  4AIM A;  2FFM A;  4FJS A;  1EC6 A;  4JI3 H;  4H8A A;  4NXM H;  4WAL A;  4X65 H;  1N32 H;  1VBI A;  1VIG A;  2LTM A;  5IT9 W;  3QD7 X;  2F4V H;  3RF2 A;  4G08 A;  1J5E H;  4NBQ A;  4B8C D;  4X62 H;  3OSS D;  3JAM W;  2M6Q A;  4DR5 H;  3V69 A;  4JVY A;  4DUY H;  2CWF A;  4LF5 H;  1HNW H;  2MJH A;  4YHH H;  2OPU A;  3AEV B;  4NZT M;  2K1H A;  3VKE A;  4AM3 A;  1ZZK A;  3SB1 A;  4E9J A;  4DV5 H;  2PT7 G;  4LFC H;  2UUC H;  2CTK A;  2PY9 A;  4OX9 H;  5K36 G;  1HR0 H;  4JV5 H;  4JI0 H;  1ZTG A;  5FLX W;  1XMQ H;  1VIH A;  4LF4 H;  4LFA H;  1S03 G;  2NN6 G;  5JEA G;  4DV1 H;  4DR4 H;  2UXC H;  2E3U A;  2UUA H;  5DT9 A;  3J81 W;  4YY3 H;  2UUB H;  3J80 W;  4DV7 H;  5LL6 b;  1N34 H;  1I94 H;  1HNZ H;  1XMO H;  1TUA A;  2CPM A;  1ZZI A;  4LF8 H;  2JEA I;  2X06 A;  4BA2 I;  1X4M A;  1SEI A;  3J7A K;  1J5K A;  1WTJ A;  4KHP H;  1XNR H;  3KDK A;  2P2R A;  5C0X G;  4K0K H;  1NXU A;  2CPQ A;  4OO1 G;  4LIJ A;  2UU9 H;  1UG8 A;  2Y3M A;  1MSZ A;  4BA1 I;  2VQE H;  3T1Y H;  4QMF B;  1IBM H;  4DV3 H;  2FMR A;  4JI4 H;  1DT4 A;  1ODH A;  4LF7 H;  2UXB H;  1XNQ H;  1K1G A;  4B3R H;  4DV0 H;  4B3S H;  3GR5 A;  1IBK H;  1WE8 A;  5LMN H;  2JE6 I;  4X66 H;  1X4N A;  4LF9 H;  5A2Q W;  1F0X A;  2ANN A;  4DR2 H;  4WAN A;  2ANR A;  3FAU A;  5LMU H;  4DR6 H;  4IFD G;  5IWA H;  2O4C A;  4DV2 H;  3OTO H;  4JI6 H;  4X64 H;  3GKU A;  2CTL A;  4DR1 H;  1AN7 A;  2QND A;  1X0A A;  1N36 H;  2BA0 A;  1XRH A;  2CTJ A;  2ZQE A;  4DUZ H;  4JI5 H;  3OET A;  4PDB A;  2JVZ A;  3T1H H;  1I6U A;  4DR7 H;  2LF0 A;  1FKA H;  2PQU A;  1N33 H;  4NZR M;  4JI2 H;  2AXY A;  4JVH A;  2JA9 A;  2DGR A;  2HH3 A;  2D9I A;  2FPH X;  1WVN A;  4LFB H;  4B8T A;  2LRR A;  3L7Z C;  4JI7 H;  4EC5 A;  4JI1 H;  2G8Y A;  4DR3 H;  1IBL H;  2VQF H;  4B3T H;  2YQR A;  4NXN H;  1X9Z A;  4OCH A;  3UOE A;  1WHR A;  4FJU A;  1V9N A;  4DV6 H;  3KDG A;  1J4W A; 
#chains in the Genus database with same CATH homology
 1ZZJ A;  2ANR A;  1VIG A;  2ANN A;  4IFD G;  2CTM A;  4NBQ A;  1DTJ A;  2CTE A;  4JVY A;  3V69 A;  2CTL A;  2QND A;  1TUA A;  1ZZI A;  2MJH A;  2BA0 A;  2JEA I;  2OPU A;  2CTJ A;  4BA2 I;  1X4M A;  1J5K A;  3VKE A;  4AM3 A;  2P2R A;  2JVZ A;  1ZZK A;  2JZX A;  2CPQ A;  5C0X G;  2PQU A;  4LIJ A;  4OO1 G;  4BA1 I;  2CTF A;  2BL5 A;  2HH2 A;  2AXY A;  4QMF B;  2JA9 A;  2CTK A;  2JEB I;  2PY9 A;  4JVH A;  2FMR A;  2DGR A;  2HH3 A;  1DT4 A;  2OPV A;  1KHM A;  1WVN A;  5K36 G;  3U1K A;  4B8T A;  2Z0S A;  3L7Z C;  1K1G A;  1ZTG A;  4AIM A;  1VIH A;  2YQR A;  2NN6 G;  1WE8 A;  5JEA G;  1EC6 A;  2JE6 I;  1X4N A;  2E3U A;  3AEV B;  4WAN A;  4WAL A;  1J4W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...