2OPUA

Solution nmr structure of the first domain of ksrp
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
89
structure length
89
Chain Sequence
ISSQLGPIHPPPRTSMTEEYRVPDGMVGLIIGRGGEQINKIQQDSGCKVQISPDSGGLPERSVSLTGAPESVQKAKMMLDDIVSRGRGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KHSRP protein
publication title Phosphorylation-mediated unfolding of a KH domain regulates KSRP localization via 14-3-3 binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 24
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2007-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 2opuA00
4AIMA 4QMFB 2ANRA 1VIGA 2HH2A 5C0XG 1DTJA 2NN6G 4BA2I 1KHMA 3L7ZC 5JEAG 1DT4A 1K1GA 4OO1G 2CTJA 2CTFA 2YQRA 2CTMA 2P2RA 2CTLA 4JVYA 1ZZKA 2MJHA 4JVHA 5K36G 1ZTGA 1WE8A 2PY9A 2CTKA 1X4MA 2BL5A 3VKEA 2FMRA 2HH3A 2OPVA 2CPQA 1TUAA 4WALA 2PQUA 2JVZA 2AXYA 1J4WA 2OPUA 2JEAI 2DGRA 4NBQA 4BA1I 3AEVB 4LIJA 4B8TA 1ZZJA 3V69A 1EC6A 2JEBI 1X4NA 2Z0SA 4AM3A 4IFDG 3U1KA 1VIHA 2BA0A 2JZXA 1J5KA 4WANA 1WVNA 2E3UA 2JE6I 2CTEA 2QNDA 1ZZIA 2ANNA 2JA9A
chains in the Genus database with same CATH superfamily
4QMFB 4FJSA 1HNWH 4DR1H 4JI7H 1DTJA 3RF2A 5JEAG 2VQFH 1DT4A 4K0KH 3GKUA 1K1GA 2A1SA 4OO1G 4EC5A 3OETA 1FJGH 4JI6H 2UXDH 1XRHA 2P2RA 2CTLA 2FPHX 4LFAH 3EZJA 4GKKH 1X9ZA 1ZTGA 3GR5A 4B8CD 2LTMA 2CPQA 1TUAA 1XMQH 2VQEH 1WTJA 4B3MH 4BA1I 1N34H 4B8TA 2JEBI 4AM3A 1N32H 4WANA 2BA0A 4OD6A 4DV0H 2UXBH 4YY3H 1ZZIA 4NXNH 4GKJH 2HH2A 2LF0A 5C0XG 1KHMA 2UUBH 1IBMH 2F4VH 1I6UA 4OCHA 1UG8A 4PDBA 3JAMW 4NZRM 2LTLA 4DV5H 3OSSD 2YQRA 1IBLH 5LMUH 4LF4H 4JYAH 4DV3H 4B3SH 4X64H 1XNRH 2PY9A 2CTKA 4B3RH 1X4MA 4DV6H 3J81W 3VKEA 2OPVA 3KDGA 4YHHH 2UUAH 2OPUA 4OX9H 5IT9W 4DV7H 4JI2H 4LIJA 2ZQEA 4JI8H 4JI3H 4DV4H 4DV1H 4JI5H 1X4NA 4KHPH 3KDKA 4DUZH 3NCVA 3U1KA 1VIHA 4DR3H 1XMOH 1J5KA 4LF9H 4LFCH 4IFDG 4AQYH 1J5EH 2JE6I 4JV5H 1HNXH 1FKAH 1HR0H 4DR4H 2ANRA 1VIGA 2Y3MA 5LL6b 4G08A 3J80W 3J7AK 4FJUA 3T1HH 2UU9H 4LF8H 4LFBH 1SEIA 4X65H 2LRRA 5FLXW 4LF7H 2CWFA 4B3TH 1NXUA 2CTFA 4DR2H 5DT9A 4JVYA 3QD7X 3AEVB 4DR5H 4DR6H 4X66H 1N33H 2HH3A 1AN7A 4H8AA 2E5LH 4JI0H 4JI4H 2PQUA 4NZTM 2JEAI 1PQXA 1S20A 2ZM6H 3V69A 2O4CA 2CWHA 1EC6A 2UXCH 2JZXA 2K1HA 2VKCA 3FAUA 2CTEA 4DR7H 2ANNA 4AIMA 3GABA 1I94H 1S03G 3UOEA 2NN6G 1V9NA 4BA2I 3L7ZC 1VBIA 4NXMH 1WHRA 1Z2IA 2M6QA 1ODHA 3I0PA 4LF5H 2CPMA 1V8CA 1IBKH 2CTJA 1HNZH 2CTMA 1ZZKA 3T1YH 1MSZA 2MJHA 4JI1H 4JVHA 5K36G 1WE8A 2HHHH 2BL5A 2D9IA 2FMRA 5IWAH 5BR8H 2M8WA 3OTOH 4WALA 4E9JA 5LMNH 2JVZA 2AXYA 1J4WA 2X06A 2G8YA 1F0XA 2DGRA 4NBQA 4X62H 2UUCH 5A2QW 1N36H 1XNQH 1ZZJA 2Z0SA 2FFMA 3SB1A 4DV2H 4LF6H 1WVNA 2E3UA 1X0AA 2QNDA 4DUYH 2PT7G 2JA9A
chains in the Genus database with same CATH topology
4AIMA 4QMFB 2ANRA 1VIGA 2HH2A 5C0XG 1DTJA 2NN6G 4BA2I 1KHMA 3L7ZC 5JEAG 1DT4A 1K1GA 4OO1G 2CTJA 2CTFA 2YQRA 2CTMA 2P2RA 2CTLA 4JVYA 1ZZKA 2MJHA 4JVHA 5K36G 1ZTGA 1WE8A 2PY9A 2CTKA 1X4MA 2BL5A 3VKEA 2FMRA 2HH3A 2OPVA 2CPQA 1TUAA 4WALA 2PQUA 2JVZA 2AXYA 1J4WA 2OPUA 2JEAI 2DGRA 4NBQA 4BA1I 3AEVB 4LIJA 4B8TA 1ZZJA 3V69A 1EC6A 2JEBI 1X4NA 2Z0SA 4AM3A 4IFDG 3U1KA 1VIHA 2BA0A 2JZXA 1J5KA 4WANA 1WVNA 2E3UA 2JE6I 2CTEA 2QNDA 1ZZIA 2ANNA 2JA9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AIM A;  4QMF B;  2ANR A;  1VIG A;  2HH2 A;  5C0X G;  1DTJ A;  2NN6 G;  4BA2 I;  1KHM A;  3L7Z C;  5JEA G;  1DT4 A;  1K1G A;  4OO1 G;  2CTJ A;  2CTF A;  2YQR A;  2CTM A;  2P2R A;  2CTL A;  4JVY A;  1ZZK A;  2MJH A;  4JVH A;  5K36 G;  1ZTG A;  1WE8 A;  2PY9 A;  2CTK A;  1X4M A;  2BL5 A;  3VKE A;  2FMR A;  2HH3 A;  2OPV A;  2CPQ A;  1TUA A;  4WAL A;  2PQU A;  2JVZ A;  2AXY A;  1J4W A;  2OPU A;  2JEA I;  2DGR A;  4NBQ A;  4BA1 I;  3AEV B;  4LIJ A;  4B8T A;  1ZZJ A;  3V69 A;  1EC6 A;  2JEB I;  1X4N A;  2Z0S A;  4AM3 A;  4IFD G;  3U1K A;  1VIH A;  2BA0 A;  2JZX A;  1J5K A;  4WAN A;  1WVN A;  2E3U A;  2JE6 I;  2CTE A;  2QND A;  1ZZI A;  2ANN A;  2JA9 A; 
#chains in the Genus database with same CATH topology
 4QMF B;  4FJS A;  1HNW H;  4DR1 H;  4JI7 H;  1DTJ A;  3RF2 A;  5JEA G;  2VQF H;  1DT4 A;  4K0K H;  3GKU A;  1K1G A;  2A1S A;  4OO1 G;  4EC5 A;  3OET A;  1FJG H;  4JI6 H;  2UXD H;  1XRH A;  2P2R A;  2CTL A;  2FPH X;  4LFA H;  3EZJ A;  4GKK H;  1X9Z A;  1ZTG A;  3GR5 A;  4B8C D;  2LTM A;  2CPQ A;  1TUA A;  1XMQ H;  2VQE H;  1WTJ A;  4B3M H;  4BA1 I;  1N34 H;  4B8T A;  2JEB I;  4AM3 A;  1N32 H;  4WAN A;  2BA0 A;  4OD6 A;  4DV0 H;  2UXB H;  4YY3 H;  1ZZI A;  4NXN H;  4GKJ H;  2HH2 A;  2LF0 A;  5C0X G;  1KHM A;  2UUB H;  1IBM H;  2F4V H;  1I6U A;  4OCH A;  1UG8 A;  4PDB A;  3JAM W;  4NZR M;  2LTL A;  4DV5 H;  3OSS D;  2YQR A;  1IBL H;  5LMU H;  4LF4 H;  4JYA H;  4DV3 H;  4B3S H;  4X64 H;  1XNR H;  2PY9 A;  2CTK A;  4B3R H;  1X4M A;  4DV6 H;  3J81 W;  3VKE A;  2OPV A;  3KDG A;  4YHH H;  2UUA H;  2OPU A;  4OX9 H;  5IT9 W;  4DV7 H;  4JI2 H;  4LIJ A;  2ZQE A;  4JI8 H;  4JI3 H;  4DV4 H;  4DV1 H;  4JI5 H;  1X4N A;  4KHP H;  3KDK A;  4DUZ H;  3NCV A;  3U1K A;  1VIH A;  4DR3 H;  1XMO H;  1J5K A;  4LF9 H;  4LFC H;  4IFD G;  4AQY H;  1J5E H;  2JE6 I;  4JV5 H;  1HNX H;  1FKA H;  1HR0 H;  4DR4 H;  2ANR A;  1VIG A;  2Y3M A;  5LL6 b;  4G08 A;  3J80 W;  3J7A K;  4FJU A;  3T1H H;  2UU9 H;  4LF8 H;  4LFB H;  1SEI A;  4X65 H;  2LRR A;  5FLX W;  4LF7 H;  2CWF A;  4B3T H;  1NXU A;  2CTF A;  4DR2 H;  5DT9 A;  4JVY A;  3QD7 X;  3AEV B;  4DR5 H;  4DR6 H;  4X66 H;  1N33 H;  2HH3 A;  1AN7 A;  4H8A A;  2E5L H;  4JI0 H;  4JI4 H;  2PQU A;  4NZT M;  2JEA I;  1PQX A;  1S20 A;  2ZM6 H;  3V69 A;  2O4C A;  2CWH A;  1EC6 A;  2UXC H;  2JZX A;  2K1H A;  2VKC A;  3FAU A;  2CTE A;  4DR7 H;  2ANN A;  4AIM A;  3GAB A;  1I94 H;  1S03 G;  3UOE A;  2NN6 G;  1V9N A;  4BA2 I;  3L7Z C;  1VBI A;  4NXM H;  1WHR A;  1Z2I A;  2M6Q A;  1ODH A;  3I0P A;  4LF5 H;  2CPM A;  1V8C A;  1IBK H;  2CTJ A;  1HNZ H;  2CTM A;  1ZZK A;  3T1Y H;  1MSZ A;  2MJH A;  4JI1 H;  4JVH A;  5K36 G;  1WE8 A;  2HHH H;  2BL5 A;  2D9I A;  2FMR A;  5IWA H;  5BR8 H;  2M8W A;  3OTO H;  4WAL A;  4E9J A;  5LMN H;  2JVZ A;  2AXY A;  1J4W A;  2X06 A;  2G8Y A;  1F0X A;  2DGR A;  4NBQ A;  4X62 H;  2UUC H;  5A2Q W;  1N36 H;  1XNQ H;  1ZZJ A;  2Z0S A;  2FFM A;  3SB1 A;  4DV2 H;  4LF6 H;  1WVN A;  2E3U A;  1X0A A;  2QND A;  4DUY H;  2PT7 G;  2JA9 A; 
#chains in the Genus database with same CATH homology
 4AIM A;  4QMF B;  2ANR A;  1VIG A;  2HH2 A;  5C0X G;  1DTJ A;  2NN6 G;  4BA2 I;  1KHM A;  3L7Z C;  5JEA G;  1DT4 A;  1K1G A;  4OO1 G;  2CTJ A;  2CTF A;  2YQR A;  2CTM A;  2P2R A;  2CTL A;  4JVY A;  1ZZK A;  2MJH A;  4JVH A;  5K36 G;  1ZTG A;  1WE8 A;  2PY9 A;  2CTK A;  1X4M A;  2BL5 A;  3VKE A;  2FMR A;  2HH3 A;  2OPV A;  2CPQ A;  1TUA A;  4WAL A;  2PQU A;  2JVZ A;  2AXY A;  1J4W A;  2OPU A;  2JEA I;  2DGR A;  4NBQ A;  4BA1 I;  3AEV B;  4LIJ A;  4B8T A;  1ZZJ A;  3V69 A;  1EC6 A;  2JEB I;  1X4N A;  2Z0S A;  4AM3 A;  4IFD G;  3U1K A;  1VIH A;  2BA0 A;  2JZX A;  1J5K A;  4WAN A;  1WVN A;  2E3U A;  2JE6 I;  2CTE A;  2QND A;  1ZZI A;  2ANN A;  2JA9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...