The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
36
|
sequence length |
234
|
structure length |
226
|
Chain Sequence |
STFIFPGDSFPVDPTTPVKLGPGIYCDPNTQEIRPVNTGVLHVSTAYIDYSSKRYIPSVNDFVIGVIIGTFSDSYKVSLQNFSSSVSLSYMAFPNASKKNRPTLQVGDLVYARVCTAEKELEAEIECFDSTTGRDAGFGILEDGMIIDVNLNFARQLLFNNDFPLLKVLAAHTKFEVAIGLNGKIWVKCEELSNTLACYRTIMECCQKNDTAAFKDIAKRQFKEIL
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Structure of an Rrp6-RNA exosome complex bound to poly(A) RNA.
pubmed doi rcsb |
source organism |
Saccharomyces cerevisiae
|
molecule tags |
Hydrolase/rna
|
molecule keywords |
Exosome complex component RRP45
|
total genus |
36
|
structure length |
226
|
sequence length |
234
|
ec nomenclature | |
pdb deposition date | 2014-01-29 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
G | PF15985 | KH_6 | KH domain |
G | PF18311 | Rrp40_N | Exosome complex exonuclease Rrp40 N-terminal domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Beta Barrel | OB fold (Dihydrolipoamide Acetyltransferase, E2P) | OB fold (Dihydrolipoamide Acetyltransferase, E2P) | ||
Mainly Beta | Beta Barrel | OB fold (Dihydrolipoamide Acetyltransferase, E2P) | Nucleic acid-binding proteins | ||
Alpha Beta | 2-Layer Sandwich | Ribosomal Protein S8; Chain: A, domain 1 | K Homology domain, type 1 |