4OO1G

Structure of an rrp6-rna exosome complex bound to poly(a) rna
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
234
structure length
226
Chain Sequence
STFIFPGDSFPVDPTTPVKLGPGIYCDPNTQEIRPVNTGVLHVSTAYIDYSSKRYIPSVNDFVIGVIIGTFSDSYKVSLQNFSSSVSLSYMAFPNASKKNRPTLQVGDLVYARVCTAEKELEAEIECFDSTTGRDAGFGILEDGMIIDVNLNFARQLLFNNDFPLLKVLAAHTKFEVAIGLNGKIWVKCEELSNTLACYRTIMECCQKNDTAAFKDIAKRQFKEIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of an Rrp6-RNA exosome complex bound to poly(A) RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/rna
molecule keywords Exosome complex component RRP45
total genus 36
structure length 226
sequence length 234
ec nomenclature
pdb deposition date 2014-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF15985 KH_6 KH domain
G PF18311 Rrp40_N Exosome complex exonuclease Rrp40 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4oo1G01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4oo1G02
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 4oo1G03
1IL2A 1ASZA 5LMUL 5BR8L 4LW1A 2UXCL 1OXXK 3UDXA 1EQQA 1X3FA 4OWTB 1C9OA 3FP9A 4YWKA 3I4OA 3KOJA 3I56A 3HOVH 3RR5A 1VQJA 4GKJL 2UXCQ 2JA9A 2OPVA 4YCVA 2BE5C 1B8AA 4A93H 1JE5A 1IXRA 1TWAH 3PUZA 2DGYA 2IHEA 4Y7NH 4JBMA 1N9WA 3NELA 1GUOA 2K4KA 4DV7L 5IP9H 4HIKA 3HOUH 3NENA 2JA5G 3T1HQ 3VR5A 4HJ9A 4X62Q 1B7YB 4DNTB 5C0XG 2KENA 4A3MH 1NY4A 1C7YA 1IYUA 2RF4A 5E7NA 4IOCA 3AEVA 1VQGA 4DR5Q 1X55A 2V4DA 3I4NH 4JVYA 4JI4Q 1TUAA 1QJOA 1PH7A 3A8JE 2Z0SA 4GOPC 2N78A 3F1ZA 3K7UC 5IE8A 3RLFA 3SE0A 1L0WA 4A3KH 5IYCG 4NXNQ 1YNNC 2B29A 4KKUA 2JA7H 4A3MG 3T51B 4OX9L 1EYGA 2R6GA 3GTLH 2IT1A 1SMXA 2JA8H 5KNBA 3RLOA 5C44G 3F2BA 1I3QH 1VQFA 3HKSA 3K80C 2D0PA 2WB1E 4G7ZC 1BBUA 2A68C 1VQIA 4LFCL 5IT9c 5FLMH 5LMNW 1CUKA 4C3HH 2A6HC 2E8GA 3UDGA 3PF4A 1Y1WG 4TQUS 2AWNA 2UUBL 1PV4A 2R93G 4DAYB 2WAQE 4X64Q 3U4VA 4PZ7A 2NVQH 4JI1Q 4PV1C 1Q46A 4DR5L 3A7LA 3GO5A 2LXJA 2AUKA 3A8KE 1X9NA 4OGQC 1QVGA 5FJ8G 2WB1G 1K1GA 5DLQE 3OW2A 2UXDL 5M3FH 2K33A 3M4YA 3TRZA 3UE0A 2E5LL 3G71A 1WJJA 4X66Q 1EC6A 1V8QA 3IRBA 4PZ6A 3OPOA 4LUZA 1CFMA 2VL6A 1IYVA 4OONA 4LF7L 2RHSB 4OWWB 1K8AC 2R7ZH 1JT8A 3S15H 1TXYA 4LF5Q 3CF5A 1A62A 4HR7B 1E24A 2XTIA 2WAQG 3NBHB 4A3BH 3B6YA 4KHPQ 2CTLA 1L1OC 1XJVA 2B8GA 2HT1A 4LNQA 1OXUA 4LK1C 1FGUA 1K3RA 3HKZG 4LUOA 3CCRA 2EDGA 4DV5Q 3DXJC 5LMUQ 4K0KQ 4OO1I 1JJGA 2KCMA 1FR3A 4R4CA 3CCEA 1E2WA 3CCUA 5LMNL 2ZJQA 2ALYB 2EIFA 4IO9A 3UE1A 4OO1H 4DR2L 2RHQB 1L1OA 2BH8A 1XNRQ 2A6HD 1VQ4A 4YCWA 4AYBG 1VQ5A 4GNXA 1XNQL 4EX5A 2DGRA 1PA6A 4OWXB 5AJ3L 2ZTEA 4BY1G 4JI3Q 3SGIA 1YI2A 1DT4A 2CTJA 1GD7A 3AYHB 3D0FA 3UDIA 3D31A 4DV3Q 3CRLC 4YY3Q 2MFIA 3G4SA 1PH2A 4JBKA 4JI6Q 4P73A 4FDBA 1K8MA 1HR0Q 3BDOA 2QGQA 5BN4A 1Q81C 3QIAA 1GKHA 1G291 3GTMH 2PY9A 1BKBA 5A35A 1G51A 1VQHA 4K0KL 1H9MA 1YHQA 4LF6Q 1HZBA 2B63G 1E2VA 3ZJYC 4IOAA 4LJZC 1MKHA 4WJ4A 3M4PA 2CWPA 4MZ9A 4B3TL 1FL0A 1VDZA 4R4OA 1XPUA 2R92G 2ANNA 3J81j 4A3KG 3JAMc 2OTLA 1H9SA 2YV5A 3V69A 1B70B 1HCZA 4X65Q 1QZHA 3H3VH 3DLLA 2E74C 1NJIC 2VZAA 4DR4Q 4LFBQ 4ALPA 4LF4Q 4LF5L 1DGSA 3VR3A 1OXTA 3A5ZB 2B63H 4YHHL 4DK3C 1WVNA 4P71A 4APVA 1OTCA 4HIDA 5IWAQ 2NN6G 1SMYC 2JXMB 1KRSA 1WCMG 3PUXA 1KL9A 2JJQA 4X64L 2ZM6L 2QA4A 2AKWB 4DV2L 3AB9A 1UEBA 3QG1A 4DUYQ 2JEAI 2AMCB 3FKIH 4P75A 5IP7G 2MNAA 2Y0SE 4BY1H 2OQKA 5GQOA 3ND9A 1A0IA 1YJWA 4GN5A 2RCNA 4QY7A 1O7LA 3L7ZC 3RNUA 4YCUA 5M3MH 3F2DA 1N32L 1T5EA 1FYCA 2IX0A 2VQEQ 3RZOH 4B3RL 3ICEA 4UP7A 4A3DG 3E0EA 4OO1G 3M7NA 2VQEL 4LF7Q 3CC4A 1R9TH 2IX1A 4B3RQ 2YTYA 4DAMA 2LSSA 2B3GA 4YWMA 1X3GA 3J80i 2C35B 3BG3A 1M1KC 1HZAA 3CCQA 3HOZG 3GTGH 5IY0A 1EFWA 4LF9L 3KF6B 4A3IH 5IWAL 4OX9Q 4I7ZC 2Z6KC 4KKTA 4HJAA 4A3JG 2VUMG 2K32A 4DV2Q 5LMNQ 1YEZA 3M4QA 1ZZIA 4IFDH 4A3CH 3ULPA 3H15A 4AIMA 1IBLL 3KDFA 2VY3A 3W5OA 4L5SA 4JK1C 5C0XI 4DV1Q 4HJ5A 4B3TQ 3H3VI 3S2HH 5C4XG 3A74A 1VS0A 4L8JA 1SE8A 5M5XH 4MNOA 4GLAC 4JI3L 3VKEA 1TU2B 4DUZQ 2NZHA 3PCOB 3T1YQ 4R4QA 1G6PA 1Z47A 3LGJA 2B8FA 2O5IC 2UUCQ 2K50A 1VQKA 1IW7C 2AHOB 2I5MX 1FJGL 1NE3A 3S1NH 3PO2G 1V43A 4JI6L 2JZXA 1RL2A 1I6HH 5JEAH 4NXML 2K7VA 1I94Q 4DR7Q 1Y69U 3I4MH 1J6QA 3AFPA 4GLVB 4A76A 1Y1WH 4NXMQ 1PVOA 1VF5C 3CMEA 1HR0W 3PV0A 5FLMG 2JA6H 3I2ZA 2F52A 1JMCA 3S2DH 1PHJA 4BY7H 5C44H 1X4MA 2F3IA 3MXNB 2F4VQ 2CWAA 4TKOB 3BZCA 1KD1C 4JI5Q 1KQSA 4UPAA 4Y52H 4PMWA 3OTOL 3CAMA 4JI2L 1VQ8A 5K36H 5M5WH 4JCVE 2YQRA 1JJCB 3E9IA 2P2RA 4G7OC 3FPPA 2H5XA 2HIXA 3S24A 4DPGA 3K0XA 1CKNB 1PH1A 1Q82C 1FVIA 1SN8A 3KF6A 1EIFA 2EJMA 1DD2A 1MJCA 4DV0Q 2A8VA 2Q2HA 4HIMA 2ASBA 3I4NG 5GAHC 2A69D 2OPUA 4JVHA 5C0XH 3PUWA 1SROA 4QJFA 4IPGA 1EIYB 3PF5A 3TREA 4B3SQ 1YNXA 1HPCA 3A7AB 2I5LX 1TWHH 3HKZE 1ZYRC 1A6XA 3HOXG 4AQYQ 1LUZA 4PG3A 3HOUG 5IP9G 1K83H 3G48A 2I0QA 4BBSG 1ZZJA 3I55A 2F1MA 4IQZA 1MJEA 1I5FA 4C3IH 2MO1A 1ZKOA 1NTGA 2R7FA 2KA7A 4IPDA 2UUAQ 3HOVG 3MXUA 4B8TA 4IJHA 1VQNA 1GVPA 1HH2P 2N49A 2NZOA 4RMFA 2KHIA 3K7AH 2PPBC 4DV7Q 2HHHL 4GOPA 4C2MH 3CPFA 3H94A 3U58A 4JI7L 4DNIA 2PNHA 2HHHQ 3S1MH 3RN2A 4GN4B 3LNNA 1HNXQ 3H0GH 1HQMC 4KKSA 3SDZA 3G6EA 1Q1BA 1I94L 1IBKQ 1PMRA 2CTMA 2UUBQ 4GN3B 3CCMA 2CFMA 1K8OA 1K8GA 4JOIA 1HNWQ 4JI1L 1K0RA 1YHAA 2ZTCA 1GO3E 3NEMA 2MQHA 4TVAB 3EQLC 1W3SA 1ONLA 4LFAQ 4HJ8A 1VF7A 2Q2IA 4DKAC 4JV5L 1NMGA 1CKNA 3ER0A 4QQBX 5M5YH 3TQYA 2E2JH 2UUCL 1PH8A 3JAMi 2JK8A 3K8AA 3W1BA 1EWHA 2QNDA 4NB3A 1IYJB 3KF8B 4L5QA 4JI0L 4ME3A 1Z6HA 1J5EL 1K9MC 4BBSH 1HZ9A 5JJIA 1VQ9A 2EXDA 1WFQA 1CKOA 2K5VA 1VQAA 2CTKA 1WI5A 1Y1VG 3CCSA 3CC7A 5KNCA 4DK6C 3FMCA 4DV4L 2VNUD 1EQRA 1BDOA 1TWFH 3DM3A 5GROA 3J81c 3T56B 4QGUA 4A3GH 4YWLA 5IYBH 4DV4Q 2KHJA 1XNRL 2VUMH 1UE7A 3RLNA 5H1SE 1KRTA 1YITA 4GOPB 4POGA 3MEFA 2BH2A 4AYBE 5K36G 4R1JA 2OWOA 2N8NA 2VS1A 2Y0SG 3GDEA 3ERSX 3RZDH 1I50H 1DXMA 3PIPA 4A3LG 5JJKA 3JC66 3PO3H 3L0OA 5IYBG 3RN5A 4YY3L 2NVYH 1IBKL 2R93H 1SFOH 4DK1A 2ZT9C 5C3EG 4NBQA 4H02A 3J80c 1GM5A 1N36L 1D8LA 2YTVA 5HGQA 1AH9A 4LF8Q 3I4MG 1N36Q 3I73A 2FXQA 3M9BA 4C3JH 5JJLA 4GS3A 4DR2Q 3EBEA 1JB7A 2ZTDA 1TWGH 2KCCA 1X6OA 1HNZL 2E5LQ 3J7A5 4KI0A 1Q1EA 2OCEA 1XPOA 2WFWA 2EVBA 2Q8IB 4B3MQ 4GKKQ 1ZZKA 3M85A 2Z6KA 4EQ5A 1GHJA 3Q8DA 1Q90A 2IHFA 4QIWE 3KJPA 1S72A 4BXXH 3BU2A 2ANRA 1SLJA 3CQZH 3PUVA 3TS0A 3HOWH 4LIJA 1L2FA 4P74A 1Q7YC 1Q8KA 4WANA 3F2CA 2L15A 4JC0A 4DUYL 4JI4L 3TS2A 4P72A 4A3FG 5GADC 3HOZH 4IFDJ 2UXDQ 2CW0C 1S3OA 1KAWA 2PQAB 4UY8C 3S16H 2QF7A 2BA1A 4X66L 3VR6A 1XMOL 3CCVA 4A93G 3CCJA 1Q12A 1WOCA 4A3DH 1VQBA 3D4RA 1CTMA 3L2PA 3S1RH 1NMFA 5M3MG 4JI8L 4DV6L 2E2HH 1H9SB 4H0LC 5BN5A 4R4TA 4DR6Q 4JI0Q 4YHHQ 4RG1A 1Z7TA 4LUVA 1K73C 2E3UA 2N3SA 5GAGC 3CC2A 4LF9Q 5IYDG 3OYYA 1P8LA 3AQQA 4J15A 2CCZA 4KMUC 1KXLA 1WYDA 4NPSA 2HIVA 2NVXH 1X3EA 2JQOA 3AFQA 4A3EG 2JEBI 3TZUA 2XGTA 2PNRC 2LXKA 4WJ3M 1ZTGA 4GKJQ 4DR4L 2ATWA 1KHMA 3EN2A 1N33Q 2BDOA 2YTXA 1XMOQ 3VR4A 2UXBQ 2OQ0A 1X65A 4DV3L 1XNQQ 4A3FH 1GUSA 2ZJRA 3MFYA 1U0LA 1E22A 2D2CC 2GVAA 2V1CC 1HZCA 3I7FA 4LF4L 2EQSA 1VCIA 4KLKA 2GVBA 2KBNA 4JI8Q 2VW9A 1VQLA 3N6RA 2JVZA 3KLRA 3VR2A 2A6ED 2MO0A 2A69C 1BBWA 2YYZA 3QJYA 4BY7G 1PYSB 4DR3L 3KLWA 5FLXc 4DNRB 1HTPA 1LABA 4BXXG 1IBMQ 1E2ZA 4DR3Q 1YZ6A 1V9PA 2VQFL 2HH3A 3WDNA 4UP9A 1ASYA 1X4NA 1IBML 2K5NA 4LF6L 4L5RC 1SRUA 4WALA 4GKKL 2E2IH 2PI2E 2A6EC 3BZKA 3KYHC 4MTNA 3HOYH 2HQLA 3E9HA 4GZYC 3KDFB 1EWIA 1VQDA 3OTOQ 3HOYG 2K52A 1H95A 2NN6I 1UWVA 1XMQL 1Y8NB 3LWUA 1U5KA 2PI2A 3F8TA 5BN3A 4DR1Q 1UE6A 4OXPA 3VA7A 1VQPA 3PSIA 1DTJA 4X65L 3AEVB 1PH5A 5EAYA 4DV0L 4A4IA 2PCFB 4DR1L 1SR3A 4DR7L 4A3CG 2MJHA 1EUJA 1HR0L 1H9RA 4UP8A 3GD7A 3PO3G 2AXYA 4GLXA 1IW7D 1O78A 1GUNA 4A3JH 4B3SL 1KHIA 4HIOA 2D62A 4A3IG 2VQFQ 4A3LH 1KIXA 1XPRA 1UE5A 4GNXB 1CSQA 3CP0A 2LMCB 2CQOA 1T9HA 1J5KA 2A1AA 2R7ZG 1AE3A 1N33L 2ID0A 1VIGA 1P16A 4GNXC 1V1QA 3CD6A 3GTOH 1Y8PB 1XTDA 2K14A 5ELOA 2UU9L 3KFUA 1VQ7A 1H9JA 1BVSA 2L5TA 1QUQA 3U4ZA 4DV6Q 5M3FG 4A3EH 4IPHA 1Y1VH 1PH9A 5KNDA 2WP8J 1N34Q 2CTEA 4BA1I 2JE6I 3UDFA 2PQUA 2E76C 1YVCA 1YJNA 5IYDH 1GHKA 3EIVA 5IP7H 4DV5L 1A8VA 1HNXL 3FKIG 2Q2TA 4B3ML 3A0JA 3OW7A 1H9KA 1CKMA 1HJPA 2ZM6Q 1YNJC 2D0OA 1N8RC 1I6VC 1UE1A 3S17H 1HNWL 1A63A 1OXSC 4R4IA 2YU9H 2NN6H 1WCMH 3S14H 2F4VL 2OTJA 2CPQA 2K75A 3P20A 3WWVA 1YHBA 3KJOA 1IBLQ 3M4OH 4KN7C 1NBWA 1YBYA 2ES2A 3GTQH 1CI3M 1LTLA 5AJ3Q 1N32Q 2UUAL 2ZJPA 3J7ZC 4JYAQ 1XMQQ 2CTFA 4IPCA 1KC8C 3CCLA 3CRKC 1X54A 5IYCH 2QEXA 2R92H 3M3YH 1B9MA 1VQCA 3CXCA 1QVCA 5GAEC 3GTJH 1MIUA 1E1OA 4A75A 1Z9FA 2AUJD 3GTPH 1PYBA 3HOWG 1Y8OB 2A68D 1E7ZA 1J4WA 1AE2A 2I5HA 4JOIC 1VQ6A 1PFSA 4O2DA 1S40A 1PH4A 3GQBA 3S1QH 5BR8Q 4X6AH 2EJGC 2JA5H 4JBJA 3J81i 2PMZE 5C0XJ 1QVFA 2HH2A 4AH6A 1YJ9A 1QUQB 3ULJA 4JV5Q 1B9NA 5JEAJ 4QL5A 3VDYA 2UU9Q 5J3BA 1VIHA 1CSPA 4LWCA 3HOXH 1W2BA 4LFBL 5HY6A 1LACA 1FJGQ 2D5DA 3CW2C 3I72A 4L5TA 4JI5L 3T1HL 1PH6A 2BL5A 1EOVA 5C3EH 2AWOA 4KN4C 3TEHB 2FMRA 2DNCA 2K5HA 4AQYL 4QMFB 3A8IE 3FHWA 1M90C 1WE8A 4JBWA 4LF8L 1C0AA 2A19A 1X56A 2EJFC 1DCZA 2BE5D 3IKJA 1GJXA 1LM0A 2KCTA 2R7DA 4IJLA 5ELNA 3CPWA 1QZGA 2NVTH 4A3BG 1VQEA 3PUYA 1GUGA 1HNZQ 2DUDA 2E75C 1IZ6A 4JI7Q 4O0AA 4BBRH 4XTCS 4POFA 5C4JH 3PGZA 4DUZL 3T1YL 1YIJA 4A3GG 2PQAA 4PZ8A 1N34L 2Q2UA 3OOCA 3HGBA 1E1TA 4G7HC 3IFTA 1TWCH 4H44C 1Q86C 2JA6G 4IFDI 3T53B 2BA0A 3ND8A 1LYLA 5FJ8H 3PIOA 3CMAA 4X62L 3U1KA 2DNEA 5JEAG 2GN5A 3PO2H 1PH3A 3W3AA 2UXBL 3STBC 3HFZB 4LFAL 3A5UA 4BA2I 2IY5B 1TKWB 4DV1L 3GTKH 3NE5B 4H13C 1O7IA 4JG2A 4NXNL 3W1GA 4DK0A 5C4XH 4JI2Q 4JYAL 4XIGS 1RIPA 1Y14B 4BBRG 1JJ2A 2JA8G 1GUTA 3I4LA 3BJUA 3STBD 1L1OB 4IFDG 3U9SA 1E3PA 3K81C 4AM3A 2DN8A 3U50C 4RCNA 4LFCQ 2JA7G 1J5EQ 4DR6L 4KHZA 4HJ7A 3ULLA 4KHPL 1VQOA 1VQMA 2O5JC 1D7QA 2CKZB 1OXVA 3H0GG
chains in the Genus database with same CATH superfamily
5I2XA 1IL2A 1SMYD 1S4ZA 1EQQA 1X3PA 4KHVA 4OWTB 2UXCQ 1NSNS 2JA9A 1B8AA 3SR1A 2IHEA 2EY2A 1I6HB 4DV7L 2WV6D 5IP9H 3I4MB 3HOUH 3NENA 1S20A 3BVGA 2JA5G 4A3MH 1B7YB 2KENA 1II3A 3MA2B 2RF4A 4G57A 4JI1H 5A2QW 3I4NH 4OD6A 4JVYA 4JI4Q 1TUAA 2N78A 3MHBA 3SE0A 2KQ3A 4NXNQ 2JA7H 2L55A 3GTLH 1VQFA 5LMNW 1EFWA 1VQIA 4B3ML 4EVOA 2KECA 1PV4A 3U4VA 1EYAA 4JI1Q 3GO5A 2LXJA 1EY4A 2AUKA 4OGQC 4HMIA 4OHJA 5FJ8G 1QVGA 1K1GA 2UXDL 5M3FH 2K33A 3TRZA 1DYQA 1V8QA 4PZ6A 3OPOA 5DEHA 3H0GB 1F2YA 2P5ZX 4LF5Q 3NBHB 3SEBA 4A3BH 2XTIA 4KHPQ 2CTLA 1FNWA 1L1OC 3R8BA 2B8GA 2HT1A 3KBXA 4LK1C 4DV0H 1K3RA 1PRTD 1DZ1A 2J7ZA 2KCMA 1FR3A 2TSSA 1E2WA 2ICIA 4IUQA 3CCUA 2EIFA 1WTJA 3UE1A 2BH8A 3NTHA 1JR0D 4AYBG 3BYTB 4OWXB 1A3TA 4ZKBB 4BY1G 2JYOA 1GD7A 3C46A 3D31A 4JV5H 1FNUA 1GOZA 5JPNC 2MFIA 3GKUA 1EIGA 1MHWC 3FAUA 3VYTA 1HR0Q 4LMQD 3BDOA 2QGQA 5BN4A 1Q81C 1G8ZD 4A3GB 1BKBA 1VQHA 3ZJYC 4LJZC 1FL0A 1VDZA 1KLGD 2YV5A 3V69A 5NUCA 1BQQT 2NVTB 1DOMA 3EROA 3DLLA 2VZAA 2X06A 1N32H 4ALPA 4GKJH 1DGSA 1HXYD 4X64L 2QA4A 1X9NA 4RCOA 1TWGB 1F9PA 4P2CB 4BY1H 2MHVA 4M8AA 3NWTA 2I07B 2JN4A 5C3XA 4F87A 3ICEA 4UP7A 5T1GA 4DAMA 3HOZG 5IWAH 1HZAA 4IURA 2K1HA 3OHXC 2G8YA 1EU3A 3SK8A 1ZZIA 3M4QA 4IFDH 1IBLL 3W5OA 4HJ5A 5CMDA 1SNMA 1AP0A 5E4WC 3OSSD 4GLAC 4JI3L 1CZGA 1TU2B 4DUZQ 2NZHA 1G6PA 4PDBA 1Z47A 3S1NH 2IWHA 4Y7NB 1RL2A 4NXML 3L3OC 4DR7Q 2QKIC 1C8CA 2K05A 1Y1WH 4NXMQ 1PVOA 4IUVA 2JA6H 2F52A 3AU7A 3RF2A 1PHJA 2X69A 1X4MA 2F3IA 3MXNB 2F4VQ 4FJUA 2F3VA 1BF4A 2HHHH 4CDDC 2F0MA 2YQRA 1JJCB 3V2TA 4DPGA 2VUMG 1PH1A 1Q82C 4OO1I 1EIFA 2EJMA 4NP5A 3TBIB 3I4NG 1DD2A 2JA8B 2A69D 1I3QB 4JVHA 1EFID 4IPGA 4MIUA 4AQYH 3TREA 4B3SQ 2I5LX 3HKZE 2ICEC 1LUZA 4PG3A 3HOUG 1STHA 1K83H 2I0QA 3I55A 4DAYA 5IIFA 3WOEA 3NHHA 4PMCA 2MO1A 1HA6A 3HOVG 1NNXA 3D3RA 4IJHA 2SOBA 3K7AH 4DV7Q 4EGVA 5COYA 1TVXA 3CPFA 4C2MH 3S1MH 4FXKC 2PNHA 3LNNA 1HQMC 4KKSA 1IBKQ 1EYDA 1LTBD 3UI2A 2CFMA 1K8OA 4JI1L 3NEMA 4FXDA 3NTKA 2WAQB 1VF7A 1A2TA 1HFNA 1TIID 3QWNA 2RSNA 2UUCL 2PW7A 1PH8A 2A5HA 2Z4HA 3DWAA 3W1BA 1EWHA 4NB3A 4L5QA 4ME3A 2CQAA 2EXDA 4Q0FA 2K5VA 2CTKA 3FRPB 3CC7A 2NBFA 3P1HA 4DV4L 1BDOA 2F0WA 5IYBH 4DV4Q 1XNRL 3ITPA 3RLNA 3M3YB 2BH2A 2OWOA 5K36G 2HD3A 4R1JA 2N8NA 2Y0SG 2PZUA 5JJKA 3JC66 3LWEA 3L0OA 5IYBG 4YY3L 2NVYH 2R93H 4NBQA 3J80c 4EQPA 1WTRA 1AH9A 3URYA 4LF8Q 4C3JH 2N55A 4GS3A 3EBEA 5LL6S 1B3QA 3NBIA 1TWGH 1SNPA 2B2UC 2WFWA 4GKKQ 3M85A 1DJRD 3E6ZX 4OEMB 4QIWE 4BXXH 2EZVA 3VYUA 1SLJA 2DY7A 3PUVA 2NVQB 4V190 3F2CA 5J1ZA 3TS2A 4A3FG 2I46A 4IFDJ 1S3OA 1KAWA 4JI6H 2PQAB 3NCVA 4GKKH 3S16H 1CHQD 1TWCB 4R9WA 1Q12A 4C1NI 3L2PA 3D4RA 4DV7H 2CH4W 3CU7A 2B2VA 3I91A 4JI8L 4DV6L 2FMCA 1UNSA 5EKKA 1PDQA 1Z7TA 2KVMA 4KY7A 1D5MC 2N3SA 5GAGC 3CC2A 1AN7A 2E3UA 4NPSA 2NVXH 2JEBI 1ZTGA 4I7AA 5ISRA 4GKJQ 4IALA 3GABA 5G3LD 2LKVA 2OQ0A 1GUSA 3MFYA 1E22A 4LF4L 2EQSA 4KLKA 5J39A 3N6RA 2XN9C 3VR2A 1XWEA 2Z8LA 3TP7A 1LTGD 2LTLA 3DWQA 1PYSB 4K5WA 5FLXc 1MBYA 1LABA 2XWJB 1IBMQ 1EWCA 3SXHA 3KUPA 2K5NA 4LF6L 4L5RC 1SRUA 4DF7A 2A6EC 2E5LH 3J7AK 1VQDA 2K52A 2NN6I 1U5KA 2EYOA 5BN3A 3PSIA 1TY2A 1RCVD 2HDLA 4X65L 2KHSA 1SR3A 4KD4A 4C2MB 1EUJA 1H9RA 1VMPA 2G9HD 3K0YA 4XXEA 1IW7D 4A3KB 2FJ2A 3IFDA 4A3LH 4JI8H 3I3CA 1UE5A 2LMCB 3TP6A 1AEXA 1T9HA 1J5KA 2A1AA 3J81L 3GTOH 1V1QA 1QNKA 1S5BD 1B50A 1N33H 4ZLTF 5ELOA 2N88A 1H9JA 1QUQA 3U4ZA 1VQ7A 2A1SA 2O4XA 1Y1VH 1PFBA 4BA1I 2JE6I 1CZWA 1YVCA 1YJNA 2E2JB 3EIVA 1A8VA 2D0OA 5D14A 4DR1H 1I6VC 5JVG3 1BBXC 5EPLA 4R4IA 2NN6H 2CPQA 4CKBA 2K75A 2JP1A 2F0EA 2Z6BA 2ZXPA 2ES2A 1YBYA 3M4OH 1N32Q 5HURA 4XT1B 5IT9L 2UUAL 4JYAQ 5CBEE 1B9MA 1ODHA 1RODA 4NXMH 5LMNH 1WTPA 1PYBA 3DEPA 1Y8OB 2A68D 1ZYRD 1PFSA 2R93B 1PH4A 3GQBA 5BR8Q 2EJGC 5K5PA 1I4XA 3OSOA 3NXWA 2JA5H 4DUZH 2PMZE 2K01A 5C0XJ 3MVVA 2F0DA 2RQXA 4JV5Q 1B9NA 2OXPA 5JEAJ 3VDYA 1M4VA 4WRDA 2QDLA 1PTOD 3GTMB 2F0TA 5C5MA 2D5DA 2BL5A 2IW3A 1CQFA 2NUCA 4KN4C 1ENCA 2DNCA 3KF8A 2FMRA 4JI0H 1D6EC 1TR5A 3FHWA 4DR6H 3EVQA 1X56A 3TP8A 4A3BG 4X65H 1CT1D 1VQEA 1GUGA 4JI7Q 4BBRH 4DUZL 4XTCS 4POFA 3S16B 1PZKD 2HQEA 1N34L 1TWCH 3IFTA 5I4DA 3CMAA 2VKCA 4X62L 5FO8B 5BR8H 4XDXA 1SYGA 4O1NA 1WVLA 2WKCA 3W3AA 1B2TA 4KY6A 3HFZB 3FDTA 5CBAE 3A5UA 2IY5B 3Q0AA 4DV1L 4NMZA 2LS01 4JG2A 5KEEA 5C4XH 4RAUC 3I4LA 4JYAH 3U9SA 1L0YB 3NQIA 2FMMA 4A3IB 1J5EQ 1GXDC 1VQOA 1KLUD 2F0FA 3GP7A 1WD0A 2OF1A 4IUTA 4LF7H 4ABNA 2RSOA 2UXCL 3UDXA 3J7AF 4GKJL 3KOJA 3HP3A 3HOVH 3NSWA 2BE5C 2DGYA 1TWAH 3PUZA 1TY0A 2E2IB 1PYWD 1N9WA 1GUOA 3AMUA 3T1HQ 1NR2A 4ZUJA 4B9WA 4HJ9A 4DNTB 1QG7A 1NY4A 1EY8A 1KABA 1B44D 1EZ6A 1X55A 4LF5H 2Z0SA 3A8JE 2MP1A 3F1ZA 5IE8A 5FO9B 4A3KH 4KKUA 2F03A 1EYGA 2R6GA 4K2LA 1SMXA 3RLOA 4LF6H 3K80C 5IT9c 4LFCL 1BBUA 1TWHB 1Y1WG 4TQUS 1IKLA 2K03A 4DR5H 1JOOA 3QB3A 2NYZD 4DR5L 1F9QA 1LTID 4HEDA 3A8KE 3OW2A 2E5LL 1G2TA 3IRBA 4LUZA 4N9TA 3M4OB 1JT8A 4LF7L 1K8AC 3BDCA 1B3AA 3B6YA 2CHBD 4RWSC 4CJ1B 3QOJA 1OXUA 5ELDA 1FGUA 3TMEA 3PIO3 4U673 4LNQA 2R92B 5LMUQ 4H8AA 4R4CA 2G9DA 5LMNL 2ALYB 1K3BC 1NAPA 4IO9A 1PLFA 1XNRQ 3W2DA 5M5YB 2A6HD 2M9VA 4YCWA 1MD2D 4RHSA 5EKLA 4GNXA 1XNQL 4EX5A 2DGRA 3K58A 4YIJA 1RTNA 2ZTEA 2CTJA 2SNMA 1YI2A 2MJ8A 3D0FA 3UDIA 4CKEA 3R93A 4YY3Q 1S5ED 1QE6A 4JI6Q 4P73A 3QIAA 4C3HG 3GTMH 5A35A 1G51A 4K0KL 2VUMB 5I6WA 5FLXL 4IOAA 1MKHA 4WJ4A 3M4PA 2CWPA 4B3TL 3RZDB 3O13A 3PO3B 1ML0D 2NVYB 3K5NA 4LF4Q 2EXZA 3VR3A 3OETA 1X0AA 5EBCA 3K59A 4HIDA 4C3JB 2NN6G 1SMYC 2JJQA 1X32A 1KL9A 3PUXA 1I6UA 4DV2L 2ZM6H 3D4DA 2MNAA 2CVRA 2PO4A 4A93G 5GQOA 1A0IA 4DR4Q 4QY7A 3RNUA 4YCUA 3RZOH 3C1FA 2VQEQ 2UU9H 5D3DA 2EYHA 3E0EA 2VQEL 3CC4A 3CQZB 1UEAB 5CGKA 2LSSA 3C1EA 4DV4H 4DV5H 1I4PA 1DONA 1SYEA 5CV5A 1AW7A 1FJGH 5IGBA 1ET9A 3KDGA 3ULPA 5ELBA 4A3DB 2F0GA 4L5SA 4DV1Q 5DT9A 2QEJC 4H7BA 4Z9CB 4L8JA 4MNOA 4ULLA 1EY0A 5FOBB 2AHOB 1DM0B 1ILQA 2I5MX 3PO2G 1V43A 5JEAH 3HOUB 1J6QA 3AFPA 4GLVB 4O42A 4KJOA 5FLXW 5FLMG 1A3UA 1F2MA 2RBMA 5L37A 1IBKH 1I4RA 3I4NB 2CWAA 4FYDA 4TKOB 1KQSA 4UPAA 4PMWA 2AQ1B 5M5WH 2HCCA 4E9JA 2H5XA 2HIXA 1TS2A 4K0KH 3KF6A 1BXTA 2SEBD 2A8VA 5KRUA 5GAHC 2WACA 3PUWA 1EIYB 1YNXA 1HPCA 3OIPA 4AQYQ 4BBSG 5IP9G 1XX8A 4KJNA 5EKIA 5C4HA 2X6LA 4C3IH 2EY5A 2R7FA 2UUAQ 2K1BA 2PW5A 4B8TA 1GVPA 4CKCA 4GOPA 2HHHQ 3RN2A 4GN4B 5CV7A 1LTAD 3RD4A 5IGEA 2F4VH 3H0GH 3G6EA 1I94L 3SDZA 1KDAA 3GR5A 2F0HA 2UUBQ 4KK7A 1K8GA 4JOIA 4UDUC 2EYPA 4FNFA 4TVAB 4LFAQ 4HJ8A 5C6AA 1JC7A 2FPHX 2Q2IA 4JV5L 4RGMA 3ER0A 1SJED 2B2WC 3TQYA 2E2JH 3JAMi 5A2QE 1A2UA 5EJWA 4JI0L 1J5EL 1HZ9A 1STGA 4JVZA 5JJIA 1EOTA 2B2VC 3K5LA 1VQ9A 1CKOA 2F0LA 1VQAA 5CR3A 1WI5A 3QO2A 3Q6SA 3FMCA 3IL8A 4FF3A 1EQRA 2R93G 4RKBA 3DM3A 5IGDA 3J81c 3BS1A 1Q8IA 4YWLA 4DFAA 1EEID 2QCPX 1KRTA 4GOPB 5C3WA 3GDEA 4E6IA 5M9OA 3PIPA 5CV4A 3PO3H 1JOKA 4DK1A 3VA5A 4N8FA 1LT4D 4H02A 4KY5A 2JA5B 4YHHH 1R4QB 2J0TD 3FVQA 3I4MG 3R2TA 5JJLA 1Z2IA 3HOXB 1R4PB 5F2DA 2EVBA 4EQ5A 1GHJA 1S72A 4B3TH 3KJPA 1NCVA 3J80W 2ANRA 1R9TB 4HSVA 4P74A 4LIJA 4ZRZA 4JI4L 4FP5D 1RF2D 2CW0C 4UY8C 4X66L 3CCVA 3S1RH 1O80A 3S2HB 2WB1B 1NMFA 5M3MG 5M5XB 2E2HH 3Q24A 5BN5A 4R4TA 3VYSA 5AFWA 1YNND 4UHVA 4N9PA 3HS0C 2KJXA 4LUVA 3H91A 4LF9Q 2X6GA 5IYDG 3OYYA 4WJWA 3HG9A 2XGTA 2LXKA 1CA6A 2K04A 4DR4L 1KHMA 3EN2A 2R3ZA 1XMOQ 5C44B 2UXBQ 4DV3L 2GVAA 1U0LA 2UXBL 2D2CC 1VCIA 4ZKCB 1JOQA 1WTQA 2JVZA 4RH6A 2A69C 1BBWA 2SNSA 2YYZA 4N8X1 3S9WA 3KLWA 1ZEQX 1TS5A 2HH3A 1G6ZA 1E2ZA 1YZ6A 1ESRA 1STNA 3WDNA 1HNXH 2OEOA 2HQLA 2PZTA 3KDFB 1EWIA 1H95A 3HOYG 1UG8A 3NBHA 4RGTA 1Y8NB 3LWUA 4C3IB 2PI2A 4A3MB 2B39A 4DAPA 1VQPA 3AEVB 1UE6A 4OXPA 1PH5A 5EAYA 5IGCA 2KEEA 4J1MA 5ELCA 1AN8A 2L9HA 2MJHA 1HR0L 3PO3G 2AXYA 4DV2H 4GLXA 1GUNA 1PFNA 4A3IG 2EPBA 2VQFQ 1KIXA 1JQYD 1CSQA 4K2KA 3CP0A 1XNQH 4HSPA 3HRZC 4JI5H 2R7ZG 1AE3A 3CD6A 3QD7X 1XTDA 4G08A 3KFUA 1B1ZA 1BVSA 4DV6Q 2L5TA 4A3EH 2KUMA 1PH9A 1STYA 3UDFA 2E76C 2UXCH 5IP7H 1HUNA 3A0JA 3OW7A 1A63A 1UE1A 3N52A 1NUCA 2KCNA 4JPBW 3WWVA 2CH4A 1YHBA 3KJOA 1IBLQ 4KN7C 3GTQH 5JAVA 3MZ5A 1TWFB 3J7ZC 1XMQQ 2CTFA 4IPCA 1X54A 5IYCH 2R92H 3M3YH 1HNWH 1CM9A 3GTJH 1MIUA 4OIJA 3HOWG 1E7ZA 1I94H 2LY7A 2I5HA 4O2DA 5DAUA 4X62H 2J4XA 1SFOB 1S40A 2XIWA 2UXBH 3KBGA 3T1YH 4ODGA 4AH6A 4DV3H 1SE2A 1SYFA 3MTSA 4TSSA 2CWFA 1W2BA 1HNZH 2XSCA 1V1OA 1LACA 4L5TA 3GV6A 1WD1A 2O4CA 3TEHB 4DUYH 4QMFB 3A8IE 2BOSA 5DM63 3HOWB 1C0AA 2NVQH 1PRTF 3IKJA 1DCZA 2BE5D 1KTKA 1STAA 1JORA 2NVTH 3NPPA 3TSSA 2DUDA 1IZ6A 1DOKA 1KNEA 4O0AA 1PRTB 4A3GG 4CBVA 1ILPA 4X66H 4G7HC 4IFDI 5FK9C 3ND8A 5FJ8H 3PIOA 5JEAG 3MXGA 4BY1B 1LO5D 3PO2H 2G5DA 4AYBB 4BA2I 5CC4A 1RD9D 1WTWA 1PTOB 1HHVA 4NXNL 2NVXB 4JI2Q 1RIPA 4AM3A 2DN8A 3U50C 4RCNA 4LFCQ 3R3OA 2JA7G 1HUMA 4DR6L 4KHPL 1UUPA 4F7XA 1ASZA 4LW1A 1OXXK 1X3FA 4ZK9B 1C9OA 1KAAA 3FP9A 5E3FA 3I56A 4RHRA 1VQJA 3RR5A 1N34H 3NQTA 2B2UA 4JBMA 1F9RA 3HOYB 3NELA 2K4KA 4DXGA 1PFMA 3MEHA 2JA6B 3VR5A 1OO9B 1C7YA 3S2DB 1IYUA 5E7NA 4IOCA 5D65A 1VQGA 3SB1A 1PH7A 4L6TB 3RLFA 4A3JB 5IYCG 1YNNC 3Q22A 2JA8H 5KNBA 5C44G 3OTOH 2WB1E 4G7ZC 2HDMA 1S5CD 2A68C 3S1QH 1SE3A 1CUKA 4C3HH 2A6HC 3PF4A 1BCPC 2UUBL 1SDFA 1K83B 1V1PB 4DU9A 2WAQE 3SVMA 1SYDA 4X64Q 3PIP3 4DR3H 1BCPB 1EY5A 1Q46A 2Z4IA 4C1NK 2UUCH 3PMFA 2UUAH 1M8AA 3V05A 4RGNA 3M4YA 3DUZA 3S14B 1EC6A 1CFMA 2VL6A 4OWWB 2L4NA 2RHSB 2R7ZH 3S15H 1TXYA 3CF5A 4HR7B 1E24A 1G2SA 2NZ1D 2WAQG 5EBDA 4OX9H 1FD7D 3HKZG 2Z1CA 1LTRD 4LUOA 5T1IA 4K0KQ 2H4OA 1Q3LA 2ZJQA 4DR2L 4OO1H 5I2YA 5CV6A 1L1OA 3IAYA 3U9OA 3J81W 4HMJA 1J9OA 3FPUB 1PA6A 4JI2H 2RVLA 4JI3Q 4BBSB 1V8CA 1I4HA 3CRLC 4JBKA 3DM1A 1ICFB 1K8MA 4FDBA 2PY9A 1G291 1H9MA 1QOHA 4OELB 1HZBA 2B63G 1RHPA 4R4OA 1XPUA 5KIXA 2ANNA 4A3KG 4CJ2C 4DA2A 1H9SA 1XTCD 4EC5A 1F9SA 1B70B 1HCZA 4XQJA 5IGGA 1NJIC 4LFBQ 2B63H 1OXTA 3A5ZB 4BBRB 4K6DA 4DK3C 5C4JB 2RDFA 4P71A 1SNOA 4APVA 1F0XA 1WCMG 1KRSA 2JXMB 1JWSD 3AB9A 3I70A 3NP8A 1UEBA 3QG1A 4DUYQ 2AMCB 2JEAI 3FKIH 4ZAIA 2CPMA 2PT7G 4JI3H 1SYCA 2OQKA 3ND9A 4X3UA 3VYRA 4GN5A 2RCNA 3L7ZC 2F0VA 4HN7A 4I65A 4B3RL 2ZQEA 4A3DG 1BUVT 4B3RQ 2VB3X 2IX1A 2YTYA 3ZYYX 2KEDA 2B3GA 4YWMA 1TS4A 1X3GA 3J80i 1M1KC 3BG3A 3CCQA 1GUWA 4LF9L 5IWAL 4OX9Q 4KKTA 4A3JG 2K32A 1IKMA 3J7YW 1YEZA 2L12A 4XT3B 4A3CH 3H15A 4AIMA 2VY3A 5C0XI 2RA4A 1SE8A 5M5XH 2E2HB 1XMQH 1D1KA 3VKEA 4XYOA 3H6MA 3PCOB 4R4QA 1PRTC 3LGJA 2B8FA 2UUCQ 2O5IC 2K50A 3HZXA 1FJGL 2KOLA 1I6HH 1C4QA 2K7VA 3D6WA 1Y69U 3I4MH 1EY6A 2QILA 4A76A 4YY3H 1JE4A 2LFNA 2B2YC 1PXUA 1FGBD 2B2TA 3PV0A 1HR0W 3I2ZA 3S2DH 5A2QL 4RFBA 4BY7H 5C44H 3BZCA 1KD1C 2XNAC 1PTOC 4Y52H 5LL6b 3CAMA 4JI2L 1RDPD 4KD3A 1QNUA 2P2RA 5EPJA 2TMPA 1CKNB 4B08A 4JI5Q 1FVIA 1SN8A 1UAPA 1W6JA 1BCPD 2ASBA 2OPUA 5C0XH 1SROA 1KC8C 3R2IA 1TWHH 1ZYRC 1A6XA 1ZZJA 3RUZA 3G48A 1RTOA 2K5QA 4IQZA 1MJEA 4IPDA 2N49A 1HH2P 3GTKH 1A3VA 2HHHL 4JI7L 2PPBC 1DOLA 3MWYW 4DNIA 2K5WA 1HNXQ 1LT3D 1F77A 1PMRA 1HNWQ 3HKZB 1U4PA 2ZTCA 1GO3E 3GTOB 2D9IA 2EYMA 2A73B 1ONLA 3TN2A 2OT2A 1HQRD 1CKNA 2CW0D 5DNFA 2FINB 2JK8A 1IYJB 3KF8B 1Z6HA 4CGYB 4BBSH 1WCMB 1WFQA 2EYJA 4DV6H 3GTQB 1TQOA 2PQEA 5GROA 3J80L 4QGUA 1EZ8A 2KHJA 5H1SE 1YITA 4POGA 3MEFA 1SNDA 1ET6A 3A56A 2F0PA 4AYBE 2VS1A 4A3LG 3ERSX 3GTPB 2JSOA 3RN5A 1VMCA 1SNQA 5LHY1 1SFOH 5C3EG 1WTVA 1EEFD 2MUYA 2YTVA 4FF1A 4QB4A 1N36Q 3I73A 2FXQA 3TZDA 4FJSA 4DR2Q 1JB7A 4QF4A 1X6OA 1EY9A 3EA6A 1Q1EA 1XPOA 1ZZKA 1HTLD 3Q8DA 2K28A 4NDXA 3BU2A 1MI2A 1D1IA 1CA5A 3HOWH 1Q7YC 1Q8KA 2L15A 5LL6X 4JC0A 4DUYL 1EYCA 3CHBD 4P72A 5GADC 3C2PA 2C5CA 4JI7H 3TP5A 2F0IA 5D3IB 3VR6A 1XMOL 4V0BA 1WOCA 3CCJA 4A3DH 1IBLH 2M6QA 1D2BA 4QCLA 1H9SB 4H0LC 1E0BA 4DR6Q 1N36H 4JI0Q 3LX0A 4RG1A 2O2LD 3SK5A 1P8LA 5FKAC 4J15A 4KMUC 3BDLA 1WYDA 2IL8A 2JQOA 4A3EG 5IOCA 3X3NA 3BVZA 2YTXA 3BZDB 4BY7B 2E2DC 1X65A 4GKKL 1XNQQ 2V1CC 5IT9E 3I7FA 1HZCA 3JAML 1VQLA 2VW9A 5M5WB 2MO0A 3QJYA 4K6LA 4CDFC 4DNRB 1HTPA 3JAME 4BXXG 2QDBA 1WTXA 2VQFL 3K5MA 2Q8RE 5KYIA 4UP9A 1MSZA 4WALA 2E2IH 2PI2E 3BZKA 3KYHC 1FKAH 3E9HA 3KK7A 4GZYC 1X9ZA 4J8QA 1UWVA 1XMQL 1XRHA 3F8TA 1KDCA 4DR1Q 1BCPF 1DTJA 4CDEC 4DR1L 4DV0L 3GTKB 3UOEA 4A3CG 4CDCC 1B4OA 4QUFA 2MGSA 4IUNA 3M7GA 1KHIA 1L0XB 2JA7B 2XRSD 2C9OA 1FNVA 4GNXB 1JWUD 1N33L 3HEJA 1VIGA 3E3XA 1P16A 2F0SA 4GNXC 3MXNA 2K14A 3MXPA 4B3RH 4KTAA 4MHEA 4K5XA 1PZID 5KNDA 5EPKA 2PQUA 4PQXA 4M1UB 5IYDH 4IUUA 4DV5L 1HNXL 4LF9H 3FKIG 1CKMA 2GA4B 1N8RC 1HNWL 3E0JA 3S14H 3DWPA 2IX3A 2AQ3B 3NTIA 4LFBH 1CI3M 1LTLA 3X3MA 3S15B 3SK4A 1S5FD 2M8WA 1LLRD 1O7ZA 2WKDA 3CXCA 5GAEC 1E1OA 4A75A 3EFXD 5IGFA 3QR8A 2L11A 3WOFA 1VQ6A 3TDQA 4X6AH 3J81i 1QVFA 1YJ9A 1QUQB 3J80E 4C3IG 1JB3A 1EIHA 2UU9Q 2VQEH 1SYBA 1CSPA 1RKNA 4LFBL 4DR4H 3CW2C 3I72A 4LAAA 1EOVA 5C3EH 2K5HA 3D8GA 1G91A 1M90C 2PYKA 3BVMA 4JBWA 1O7YA 2EJFC 2KCTA 1GJXA 3KDKA 5ELNA 3J81E 3FEWX 3CPWA 1QZGA 3E5SA 3HOZB 2E75C 1YIJA 5HGTA 4PZ8A 2JA6G 3HGBA 1E1TA 4QMGA 4H44C 3T53B 2BA0A 4U68A 2DNEA 5CV8A 3D6CA 3STBC 5EGTA 4X64H 3DMUA 1O7IA 3NE5B 4H13C 4HTHA 4DK0A 4JYAL 1Y14B 4XIGS 4BBRG 1L1OB 4K8IA 3T16A 4KHZA 4HJ7A 3ULLA 1SNCA 2UUBH 1D7QA 3OMCA 1OXVA 4TRDA 5LMUH 1J8IA 5LMUL 5BR8L 1F2ZA 2FFKB 4YWKA 3I4OA 3I0PA 3V96A 2OPVA 4YCVA 4A93H 2IJ0A 1JE5A 1IXRA 4Y7NH 3DEOA 4HIKA 4FVMA 1KNAA 1Y1WB 1EQTA 4X62Q 5C0XG 5CV9A 3AEVA 4DR5Q 2V4DA 1QJOA 3P7JA 1YNJD 4GOPC 3K7UC 1WHRA 1L0WA 1CQVA 3NK9A 5DM73 2B29A 3T51B 5E1FA 2IT1A 3F2BA 2Y3MA 1I3QH 3HKSA 2D0PA 4HIMA 3OWFA 1PH6A 1AFPA 5FLMH 3Q23A 2E8GA 3UDGA 2AWNA 4DAYB 4PZ7A 1A15A 2QW7A 4PV1C 2H1EA 2VXWA 3A7LA 3T1HH 4UAIA 5JJZA 1SJHD 2WB1G 1ZXTA 2EE1A 5DLQE 3T4AC 3S17B 3K7AB 2F0NA 4ID6A 3UE0A 3G71A 1WJJA 4X66Q 4QIWB 2NWGA 4OONA 1IYVA 1A62A 2CTEA 1LV9A 1MGSA 1XJVA 2WINB 1PTOF 1SBBB 3K5OA 4DV5Q 3CCRA 1JJGA 2EDGA 3DXJC 3GTJB 3CCEA 2SDFA 1JCKB 1TS3A 1VQ4A 1VQ5A 5AJ3L 3SGIA 1DT4A 1SEBD 1EY7A 1MSHA 3AYHB 1ICWA 4DV3Q 3OMGA 3I90A 3G4SA 1PH2A 5TSSA 1QCBD 1GKHA 2EY1A 1YHQA 4LF6Q 1E2VA 4HCSA 4LFCH 2K5DA 4MZ9A 3KLSX 2PMZB 5FO7B 1VBIA 2R92G 1I50B 3J81j 3JAMc 2OTLA 2Y0SB 3OIQA 4F8MA 1QB5D 4IUPA 4X65Q 4OL7A 1QZHA 2E74C 3H3VH 4QUCA 4LF5L 4YHHL 1WVNA 2ENBA 2F0OA 2M00A 1OTCA 5IWAQ 4A3MG 4OX9L 4DR2H 2ZM6L 2AKWB 3A54A 4P75A 4B9XA 5IP7G 2Y0SE 4FO2A 3PO2B 4NZRM 1YJWA 2YU9H 1N32L 1O7LA 5M3MH 3F2DA 2DY8A 4WFN3 1T5EA 1FYCA 2IX0A 1PTOH 2D9UA 2AQ2B 4LF7Q 3M7NA 4XYQA 4OO1G 1R9TH 5C4ZA 5C4XB 2HCIA 4RKLA 3H09A 2C35B 5JPMC 3GTGH 4K14A 2ZXOA 5IY0A 2CWHA 3KF6B 4A3IH 2VQFH 1J5EH 2Z6KC 4I7ZC 4HJAA 4DV2Q 5LMNQ 4NZTM 1LTSD 3KDFA 4JK1C 3S1RB 1WTOA 1U4LA 1CK1A 1PZJD 4B3TQ 3H3VI 3S2HH 3A74A 5C4XG 1VS0A 3SHLA 3T1YQ 4K8JA 3HOVB 4HAEA 1VQKA 1IW7C 4A93B 1NE3A 4DXFA 4JI6L 2JZXA 4FF4A 1BOSA 1HR0H 1I94Q 1S03G 1VF5C 3CMEA 2VB2X 4OIKA 3A55A 1JMCA 4ILWA 1XXGA 4WORA 1QWYA 3OTOL 2EYLA 1VQ8A 5K36H 5KGUA 1ENAA 4JCVE 3E9IA 4G7OC 3FPPA 1LTTD 1SE4A 3S24A 3K0XA 1U4RA 1MJCA 4DV0Q 5KYLA 2Q2HA 3GTLB 4ZUIA 4QJFA 3S1QB 4KHPH 2LTMA 3PF5A 4C3HB 4X3TA 1I4QA 3A7AB 3G7LA 4PMBA 1EQVA 3HOXG 2F1MA 4DGZA 1I5FA 1ZKOA 1NTGA 2R61A 2KA7A 3L9AX 3MXUA 1F2LA 1VQNA 2NZOA 4RMFA 5IT9W 2KHIA 2F3WA 3H94A 3U58A 1SEIA 2WIIB 2Q8TA 2NTSA 1Q1BA 2CTMA 4B8CD 1ENFA 4GN3B 4A3BB 3CCMA 1K0RA 2EYFA 1YHAA 1STEA 2IPKD 2MQHA 1W3SA 3EQLC 4NXNH 4A3EB 1BNZA 1TT2A 1Y1VB 4DKAC 1NMGA 4QQBX 5M5YH 4JI4H 4R8NA 3K8AA 2QNDA 3OWEB 2Z9HA 1K9MC 1EU4A 5J22A 1Y1VG 3CCSA 5KNCA 4DK6C 4HCEA 2VNUD 1TWFH 4A3GH 3T56B 2VUMH 1UE7A 3RMHA 1K0SA 4OCHA 1XMOH 4XQQA 5C5LA 3RZDH 1I50H 1DXMA 2F4IA 3NUCA 4RGOS 1JWMD 1IBKL 1MSGA 2ZT9C 1D5ZC 1GM5A 1XYIA 1D8LA 1N36L 5HGQA 5E4XA 3M9BA 4K5VA 2ZTDA 1SAPA 2KCCA 1AZPA 1HNZL 2E5LQ 3FKIB 3J7A5 4J6HA 4KI0A 2OCEA 2XWBB 2Q8IB 4B3MQ 2YU9B 1V9NA 2Z6KA 5M3MB 5C3EB 1Q90A 2IHFA 1IBMH 3RZOB 2RCFA 3MAQA 4XQNA 2F0UA 4LFAH 4ZYSA 3CQZH 3TS0A 1AZQA 4LF8H 4MTKA 1L2FA 2F0KA 2L0CA 4WANA 3GTGB 4ZCKA 1SXTA 1PQXA 3HOZH 2UXDQ 3J7AV 3ERQA 2QF7A 2BA1A 1IHZA 5IODA 1VQBA 1CTMA 3K6OA 2F0JA 4YHHQ 1NXUA 1K73C 3S1NB 3KLSA 2DJFC 3AQQA 2CCZA 1KXLA 3T13A 2HIVA 2MPMA 1X3EA 3AFQA 4WJ3M 3TZUA 2PNRC 1LT5D 4NW2A 3DHQA 2ATWA 1N33Q 4C56C 1QILA 2BDOA 3VR4A 1LT6D 1U4MA 4A3FH 4RA8A 2ZJRA 4FF2A 4R8IA 4JI8Q 4EQNA 2GVBA 2KBNA 1V1PA 2ZXRA 3KLRA 2A6ED 1SSOA 4BY7G 4DAVA 4DR3L 2BDNA 3EZJA 4DR3Q 1T5XD 1V9PA 5ELFA 2FHTA 1ASYA 1X4NA 1IBML 1TWAB 4IZ8A 4MTNA 3HOYH 1HRJA 5ELEA 3OTOQ 2HUGA 5JOBA 5FLXE 4C3JG 5JVH3 4EQOA 3VA7A 1XNRH 2F0QA 1S5DD 3I8ZA 4A4IA 2PCFB 4DV1H 4DR7L 3S1MB 4B3SH 2DJGC 4UP8A 3GD7A 2FFMA 4A3JH 1O78A 4B3SL 4HIOA 2D62A 3ONAB 1JICA 1STBA 1XPRA 4X3KA 2CQOA 2ID0A 4PNYA 2RDGA 1Y8PB 2UU9L 2XRQD 5M3FG 4IPHA 2RDHA 2WP8J 1N34Q 5I9PA 4MN3A 1W6KA 2EY6A 1GHKA 2LF0A 3P75A 2Q2TA 1HA5A 1H9KA 1HJPA 2ZM6Q 1YNJC 3S17H 4DR7H 5M3FB 1OXSC 2A74C 1WCMH 2F4VL 4X3SA 2OTJA 1IL8A 3P20A 1CHPD 4JW0A 1WTHA 1NBWA 2R7ZB 5AJ3Q 3PQIA 2ZJPA 3MC0B 3G6JB 3CCLA 3CRKC 2QEXA 1RJTA 3NWSA 1VQCA 1QVCA 4KV6A 1Z9FA 2AUJD 3GTPH 1J4WA 4CHTB 1AE2A 4JOIC 4DN4M 1BR9A 2B2YA 4G4KA 4JBJA 2HH2A 2XVSA 3ULJA 4ME5A 5I9OA 2K6AA 4QL5A 1K28A 3JAMW 2RKSA 5J3BA 2PZWA 4LWCA 4CJ0B 3HOXH 4IN3A 5HY6A 3C3LA 1NR4A 3D4WA 1FJGQ 4JI5L 3T1HL 3MFGA 5EQ0A 2AWOA 4FXGC 4S3SA 4AQYL 5I6YA 1WE8A 4LF8L 2RHQB 2A19A 4IJLA 1U9RA 1LM0A 2R7DA 1X3QA 1I4GA 3PUYA 4BS9A 1D5XC 2B2WA 3K57A 1HNZQ 2B63B 2UXDH 3T1YL 1VIHA 5C4JH 3PGZA 4Q5VA 2PQAA 3SK6A 2Q2UA 3OOCA 2L1BA 3CKIB 1Q86C 3U1KA 1LYLA 2EOTA 3QOLA 2GN5A 2B2TC 5CORA 1PH3A 2BCOA 4BWGB 2LRRA 4LF4H 4B3MH 4LFAL 1EL0A 1TKWB 1C48A 3F2UA 3W1GA 1ESFA 3GV3A 2NTTA 1JJ2A 5G3LF 1BO0A 1GUTA 3BJUA 2JA8G 2M2LA 1HFGA 1E3PA 1B53A 3K81C 3STBD 4IFDG 5CYUA 4F88A 4NKLA 4ZQ3A 3H3VC 4A3FB 3BYYB 1VQMA 1KDBA 2O5JC 2NB0A 2CKZB 3H0GG 4L63B 3EJIA
chains in the Genus database with same CATH topology
5I2XA 1IL2A 1SMYD 1S4ZA 1EQQA 1X3PA 4KHVA 4OWTB 2UXCQ 1NSNS 2JA9A 1B8AA 3SR1A 2IHEA 2EY2A 1I6HB 4DV7L 2WV6D 5IP9H 3I4MB 3HOUH 3NENA 3BVGA 2JA5G 4A3MH 1B7YB 2KENA 1II3A 3MA2B 4G57A 2RF4A 3I4NH 4JVYA 4JI4Q 1TUAA 2N78A 3MHBA 3SE0A 2KQ3A 4NXNQ 2JA7H 2L55A 3GTLH 1VQFA 5LMNW 1EFWA 1VQIA 4B3ML 4EVOA 2KECA 1PV4A 3U4VA 1EYAA 4JI1Q 3GO5A 2LXJA 1EY4A 2AUKA 4OGQC 4HMIA 4OHJA 5FJ8G 1QVGA 1K1GA 2UXDL 5M3FH 2K33A 3TRZA 1DYQA 1V8QA 4PZ6A 3OPOA 5DEHA 3H0GB 1F2YA 4LF5Q 4A3BH 3SEBA 3NBHB 4KHPQ 2XTIA 2CTLA 1FNWA 3R8BA 1L1OC 2B8GA 2HT1A 3KBXA 4LK1C 1K3RA 1PRTD 1DZ1A 2J7ZA 2KCMA 1FR3A 2TSSA 1E2WA 2ICIA 4IUQA 3CCUA 2EIFA 3UE1A 2BH8A 3NTHA 1JR0D 4AYBG 3BYTB 4OWXB 1A3TA 4ZKBB 4BY1G 2JYOA 1GD7A 3C46A 3D31A 1FNUA 1GOZA 5JPNC 2MFIA 1EIGA 3VYTA 1HR0Q 4LMQD 3BDOA 2QGQA 5BN4A 1Q81C 1G8ZD 4A3GB 1BKBA 1VQHA 3ZJYC 4LJZC 1FL0A 1VDZA 1KLGD 2YV5A 3V69A 5NUCA 1BQQT 2NVTB 1DOMA 3EROA 3DLLA 2VZAA 4ALPA 1HXYD 1DGSA 4X64L 2QA4A 1X9NA 4RCOA 1TWGB 1F9PA 4P2CB 4BY1H 2MHVA 4M8AA 3NWTA 2I07B 5C3XA 4F87A 3ICEA 4UP7A 5T1GA 4DAMA 3HOZG 1HZAA 4IURA 3OHXC 1EU3A 3SK8A 1ZZIA 3M4QA 4IFDH 1IBLL 3W5OA 4HJ5A 5CMDA 1SNMA 1AP0A 5E4WC 4GLAC 4JI3L 1CZGA 1TU2B 4DUZQ 2NZHA 1G6PA 1Z47A 3S1NH 2IWHA 4Y7NB 1RL2A 4NXML 3L3OC 4DR7Q 2QKIC 1C8CA 2K05A 1Y1WH 4NXMQ 1PVOA 4IUVA 2JA6H 2F52A 3AU7A 1PHJA 2X69A 1X4MA 2F3IA 3MXNB 2F4VQ 2F3VA 1BF4A 2F0MA 2YQRA 1JJCB 3V2TA 4DPGA 2VUMG 1PH1A 4OO1I 1Q82C 1EIFA 2EJMA 4NP5A 3TBIB 1DD2A 3I4NG 2JA8B 2A69D 1I3QB 4JVHA 1EFID 4IPGA 4MIUA 3TREA 4B3SQ 2I5LX 3HKZE 2ICEC 1LUZA 4PG3A 3HOUG 1STHA 1K83H 2I0QA 3I55A 4DAYA 5IIFA 3WOEA 3NHHA 4PMCA 2MO1A 1HA6A 3HOVG 3D3RA 4IJHA 2SOBA 3K7AH 4DV7Q 4EGVA 5COYA 1TVXA 3CPFA 4C2MH 3S1MH 4FXKC 2PNHA 3LNNA 1HQMC 4KKSA 1IBKQ 1EYDA 1LTBD 3UI2A 2CFMA 1K8OA 4JI1L 3NEMA 4FXDA 3NTKA 2WAQB 1VF7A 1A2TA 1HFNA 1TIID 3QWNA 2RSNA 2UUCL 2PW7A 1PH8A 2A5HA 2Z4HA 3DWAA 3W1BA 1EWHA 4NB3A 4L5QA 4ME3A 2CQAA 2EXDA 4Q0FA 2K5VA 2CTKA 3FRPB 3CC7A 2NBFA 3P1HA 4DV4L 1BDOA 2F0WA 5IYBH 4DV4Q 1XNRL 3ITPA 3RLNA 3M3YB 2BH2A 2OWOA 5K36G 4R1JA 2N8NA 2Y0SG 2PZUA 5JJKA 3JC66 3LWEA 3L0OA 5IYBG 4YY3L 2NVYH 2R93H 4NBQA 3J80c 4EQPA 1WTRA 1AH9A 3URYA 4LF8Q 4C3JH 2N55A 4GS3A 5LL6S 3EBEA 3NBIA 1TWGH 1SNPA 2B2UC 2WFWA 4GKKQ 3M85A 1DJRD 3E6ZX 4QIWE 4BXXH 2EZVA 3VYUA 1SLJA 2DY7A 3PUVA 2NVQB 4V190 3F2CA 5J1ZA 3TS2A 4A3FG 2I46A 4IFDJ 1S3OA 1KAWA 2PQAB 3S16H 1CHQD 1TWCB 4R9WA 1Q12A 4C1NI 3L2PA 3D4RA 3CU7A 2B2VA 3I91A 4JI8L 4DV6L 2FMCA 1UNSA 5EKKA 1PDQA 1Z7TA 2KVMA 4KY7A 1D5MC 2N3SA 5GAGC 3CC2A 2E3UA 4NPSA 2NVXH 2JEBI 1ZTGA 5ISRA 4GKJQ 4IALA 5G3LD 2LKVA 2OQ0A 1GUSA 3MFYA 1E22A 4LF4L 2EQSA 5J39A 4KLKA 3N6RA 2XN9C 3VR2A 1XWEA 2Z8LA 3TP7A 1LTGD 3DWQA 1PYSB 4K5WA 5FLXc 1MBYA 1LABA 2XWJB 1IBMQ 1EWCA 3SXHA 3KUPA 2K5NA 4LF6L 4L5RC 1SRUA 4DF7A 2A6EC 1VQDA 2K52A 2NN6I 1U5KA 2EYOA 5BN3A 3PSIA 1TY2A 1RCVD 2HDLA 4X65L 2KHSA 1SR3A 4KD4A 4C2MB 1EUJA 1H9RA 1VMPA 2G9HD 3K0YA 4XXEA 1IW7D 4A3KB 2FJ2A 3IFDA 4A3LH 3I3CA 1UE5A 2LMCB 3TP6A 1AEXA 1T9HA 1J5KA 2A1AA 3J81L 3GTOH 1V1QA 1QNKA 1S5BD 1B50A 4ZLTF 5ELOA 2N88A 1H9JA 1QUQA 3U4ZA 1VQ7A 2O4XA 1Y1VH 1PFBA 4BA1I 2JE6I 1CZWA 2E2JB 1YVCA 1YJNA 3EIVA 1A8VA 2D0OA 5D14A 1I6VC 5JVG3 1BBXC 5EPLA 4R4IA 2NN6H 2CPQA 4CKBA 2K75A 2JP1A 2F0EA 2ZXPA 3M4OH 2ES2A 1YBYA 1N32Q 5HURA 4XT1B 5IT9L 2UUAL 4JYAQ 5CBEE 1B9MA 1RODA 1WTPA 1PYBA 3DEPA 1Y8OB 2A68D 1ZYRD 1PFSA 2R93B 1PH4A 3GQBA 5BR8Q 2EJGC 5K5PA 1I4XA 3OSOA 3NXWA 2JA5H 5C0XJ 2K01A 2PMZE 3MVVA 2F0DA 2RQXA 4JV5Q 1B9NA 2OXPA 5JEAJ 3VDYA 1M4VA 4WRDA 1PTOD 3GTMB 2F0TA 5C5MA 2D5DA 2BL5A 2IW3A 1CQFA 2NUCA 4KN4C 1ENCA 2DNCA 3KF8A 2FMRA 1D6EC 1TR5A 3FHWA 3EVQA 1X56A 3TP8A 4A3BG 1CT1D 1VQEA 1GUGA 4JI7Q 4BBRH 4DUZL 4XTCS 4POFA 3S16B 1PZKD 2HQEA 1N34L 1TWCH 3IFTA 5I4DA 3CMAA 4X62L 5FO8B 4XDXA 1SYGA 4O1NA 1WVLA 2WKCA 3W3AA 1B2TA 4KY6A 3HFZB 3FDTA 5CBAE 3A5UA 2IY5B 3Q0AA 4DV1L 4NMZA 2LS01 5KEEA 4JG2A 5C4XH 4RAUC 3I4LA 3U9SA 1L0YB 3NQIA 2FMMA 4A3IB 1J5EQ 1GXDC 1VQOA 1KLUD 2F0FA 3GP7A 1WD0A 2OF1A 4IUTA 4ABNA 2RSOA 2UXCL 3UDXA 3J7AF 4GKJL 3KOJA 3HP3A 3HOVH 3NSWA 2BE5C 2DGYA 1TWAH 3PUZA 1TY0A 2E2IB 1PYWD 1N9WA 1GUOA 3AMUA 3T1HQ 1NR2A 4ZUJA 4B9WA 4HJ9A 4DNTB 1QG7A 1NY4A 1EY8A 1KABA 1B44D 1EZ6A 1X55A 3A8JE 2Z0SA 2MP1A 3F1ZA 5IE8A 5FO9B 4A3KH 4KKUA 2F03A 1EYGA 2R6GA 4K2LA 1SMXA 3RLOA 3K80C 5IT9c 4LFCL 1BBUA 1TWHB 1Y1WG 4TQUS 1IKLA 2K03A 1JOOA 3QB3A 2NYZD 4DR5L 1F9QA 1LTID 4HEDA 3A8KE 3OW2A 2E5LL 1G2TA 3IRBA 4LUZA 4N9TA 3M4OB 1JT8A 4LF7L 1K8AC 3BDCA 1B3AA 3B6YA 2CHBD 4RWSC 4CJ1B 3QOJA 5ELDA 1OXUA 3TMEA 2R92B 3PIO3 4U673 1FGUA 4LNQA 5LMUQ 4R4CA 2G9DA 5LMNL 2ALYB 4IO9A 1NAPA 1PLFA 5M5YB 3W2DA 1XNRQ 2A6HD 2M9VA 4YCWA 1MD2D 4RHSA 5EKLA 4GNXA 1XNQL 4EX5A 2DGRA 3K58A 4YIJA 1RTNA 2ZTEA 2CTJA 2SNMA 1YI2A 2MJ8A 3D0FA 3UDIA 4CKEA 3R93A 4YY3Q 1S5ED 1QE6A 4JI6Q 4P73A 3QIAA 4C3HG 3GTMH 5A35A 1G51A 4K0KL 2VUMB 5I6WA 5FLXL 4IOAA 1MKHA 4WJ4A 3M4PA 2CWPA 4B3TL 3RZDB 3O13A 3PO3B 1ML0D 2NVYB 3K5NA 4LF4Q 2EXZA 3VR3A 5EBCA 3K59A 4HIDA 4C3JB 2NN6G 1SMYC 2JJQA 1X32A 3PUXA 1KL9A 4DV2L 3D4DA 2MNAA 2CVRA 2PO4A 4A93G 5GQOA 1A0IA 4DR4Q 4QY7A 3RNUA 4YCUA 3RZOH 3C1FA 2VQEQ 5D3DA 2EYHA 3E0EA 2VQEL 3CC4A 3CQZB 1UEAB 5CGKA 2LSSA 3C1EA 1I4PA 1DONA 1SYEA 5CV5A 1AW7A 5IGBA 1ET9A 3ULPA 5ELBA 4A3DB 2F0GA 4L5SA 4DV1Q 2QEJC 4H7BA 4Z9CB 4L8JA 4MNOA 4ULLA 1EY0A 5FOBB 2AHOB 1DM0B 1ILQA 2I5MX 3PO2G 1V43A 5JEAH 3HOUB 4O42A 1J6QA 3AFPA 4GLVB 4KJOA 5FLMG 1A3UA 1F2MA 2RBMA 1I4RA 3I4NB 4FYDA 2CWAA 4TKOB 1KQSA 4UPAA 4PMWA 2AQ1B 5M5WH 2HCCA 2H5XA 2HIXA 1TS2A 3KF6A 1BXTA 2SEBD 2A8VA 5KRUA 5GAHC 2WACA 3PUWA 1EIYB 1YNXA 1HPCA 3OIPA 4AQYQ 4BBSG 5IP9G 1XX8A 4KJNA 5EKIA 5C4HA 2X6LA 4C3IH 2EY5A 2R7FA 2UUAQ 2K1BA 2PW5A 4B8TA 1GVPA 4CKCA 4GOPA 2HHHQ 3RN2A 4GN4B 5CV7A 1LTAD 3RD4A 5IGEA 3H0GH 3G6EA 1I94L 3SDZA 1KDAA 2F0HA 2UUBQ 4KK7A 1K8GA 4JOIA 4UDUC 2EYPA 4FNFA 4TVAB 4LFAQ 4HJ8A 5C6AA 1JC7A 2Q2IA 4JV5L 4RGMA 3ER0A 1SJED 2B2WC 3TQYA 2E2JH 3JAMi 5A2QE 1A2UA 5EJWA 4JI0L 1J5EL 1HZ9A 1STGA 5JJIA 1EOTA 2B2VC 3K5LA 1VQ9A 1CKOA 2F0LA 1VQAA 5CR3A 1WI5A 3QO2A 3Q6SA 3FMCA 3IL8A 4FF3A 1EQRA 2R93G 4RKBA 5IGDA 3DM3A 3BS1A 3J81c 1Q8IA 4DFAA 4YWLA 1EEID 2QCPX 1KRTA 4GOPB 5C3WA 3GDEA 4E6IA 5M9OA 3PIPA 5CV4A 3PO3H 1JOKA 4DK1A 3VA5A 1LT4D 4H02A 4KY5A 2JA5B 1R4QB 2J0TD 3FVQA 3I4MG 3R2TA 5JJLA 3HOXB 1R4PB 5F2DA 2EVBA 4EQ5A 1GHJA 1S72A 3KJPA 1NCVA 2ANRA 1R9TB 4HSVA 4P74A 4LIJA 4ZRZA 4JI4L 4FP5D 1RF2D 2CW0C 4UY8C 4X66L 3CCVA 3S1RH 1O80A 3S2HB 2WB1B 1NMFA 5M3MG 5M5XB 2E2HH 3Q24A 5BN5A 4R4TA 3VYSA 5AFWA 1YNND 4N9PA 3HS0C 2KJXA 4LUVA 3H91A 4LF9Q 2X6GA 5IYDG 3OYYA 4WJWA 3HG9A 2XGTA 2LXKA 1CA6A 2K04A 4DR4L 1KHMA 3EN2A 2R3ZA 1XMOQ 5C44B 2UXBQ 4DV3L 2GVAA 1U0LA 2UXBL 2D2CC 1VCIA 4ZKCB 1JOQA 1WTQA 2JVZA 4RH6A 2A69C 2YYZA 2SNSA 1BBWA 3S9WA 3KLWA 1ZEQX 1TS5A 2HH3A 1G6ZA 1E2ZA 1YZ6A 1ESRA 1STNA 3WDNA 2OEOA 2HQLA 2PZTA 3KDFB 1EWIA 1H95A 3HOYG 3NBHA 4RGTA 1Y8NB 3LWUA 4C3IB 4A3MB 2PI2A 2B39A 4DAPA 1VQPA 3AEVB 1UE6A 4OXPA 1PH5A 5EAYA 5IGCA 2KEEA 4J1MA 5ELCA 1AN8A 2L9HA 2MJHA 1HR0L 3PO3G 2AXYA 4GLXA 1GUNA 1PFNA 4A3IG 2EPBA 2VQFQ 1KIXA 1JQYD 1CSQA 4K2KA 3CP0A 4HSPA 3HRZC 2R7ZG 1AE3A 3CD6A 1XTDA 3KFUA 1B1ZA 1BVSA 4DV6Q 2L5TA 4A3EH 2KUMA 1PH9A 1STYA 3UDFA 2E76C 5IP7H 1HUNA 3A0JA 3OW7A 1A63A 1UE1A 3N52A 1NUCA 2KCNA 3WWVA 1YHBA 3KJOA 1IBLQ 4KN7C 3GTQH 5JAVA 3MZ5A 1TWFB 3J7ZC 1XMQQ 2CTFA 4IPCA 1X54A 5IYCH 2R92H 3M3YH 1CM9A 3GTJH 1MIUA 4OIJA 3HOWG 1E7ZA 2LY7A 2I5HA 4O2DA 5DAUA 2J4XA 1SFOB 1S40A 2XIWA 3KBGA 4ODGA 4AH6A 1SE2A 1SYFA 3MTSA 4TSSA 1W2BA 2XSCA 1V1OA 1LACA 4L5TA 3GV6A 1WD1A 3TEHB 4QMFB 3A8IE 2BOSA 5DM63 3HOWB 1C0AA 2NVQH 1PRTF 1DCZA 2BE5D 3IKJA 1KTKA 1STAA 1JORA 2NVTH 3NPPA 3TSSA 2DUDA 1IZ6A 1DOKA 1KNEA 4O0AA 1PRTB 1ILPA 4CBVA 4A3GG 4G7HC 4IFDI 5FK9C 3ND8A 5FJ8H 3PIOA 5JEAG 3MXGA 4BY1B 1LO5D 3PO2H 4AYBB 4BA2I 5CC4A 1RD9D 1WTWA 1PTOB 1HHVA 4NXNL 2NVXB 4JI2Q 1RIPA 4AM3A 2DN8A 3U50C 4RCNA 4LFCQ 3R3OA 2JA7G 1HUMA 4DR6L 4KHPL 4F7XA 1UUPA 1ASZA 4LW1A 1OXXK 1X3FA 4ZK9B 1KAAA 1C9OA 3FP9A 5E3FA 3I56A 4RHRA 1VQJA 3RR5A 3NQTA 2B2UA 4JBMA 1F9RA 3HOYB 3NELA 2K4KA 4DXGA 1PFMA 3MEHA 2JA6B 3VR5A 1OO9B 3S2DB 1C7YA 1IYUA 5E7NA 4IOCA 5D65A 1VQGA 1PH7A 4L6TB 3RLFA 4A3JB 5IYCG 1YNNC 3Q22A 2JA8H 5KNBA 5C44G 2WB1E 4G7ZC 2HDMA 1S5CD 2A68C 3S1QH 1SE3A 1CUKA 4C3HH 2A6HC 3PF4A 1BCPC 2UUBL 1SDFA 1K83B 1V1PB 4DU9A 2WAQE 3SVMA 1SYDA 3PIP3 4X64Q 1BCPB 1EY5A 1Q46A 2Z4IA 4C1NK 3PMFA 1M8AA 3V05A 4RGNA 3M4YA 3DUZA 3S14B 1EC6A 1CFMA 2VL6A 4OWWB 2L4NA 2RHSB 2R7ZH 3S15H 1TXYA 3CF5A 1G2SA 4HR7B 1E24A 2NZ1D 2WAQG 5EBDA 1FD7D 3HKZG 2Z1CA 1LTRD 4LUOA 5T1IA 4K0KQ 2H4OA 1Q3LA 2ZJQA 4DR2L 4OO1H 5I2YA 5CV6A 3IAYA 1L1OA 3U9OA 4HMJA 1J9OA 3FPUB 1PA6A 2RVLA 4JI3Q 4BBSB 1I4HA 3CRLC 4JBKA 3DM1A 4FDBA 1K8MA 2PY9A 1G291 1H9MA 1QOHA 2B63G 1HZBA 1RHPA 4R4OA 1XPUA 5KIXA 2ANNA 4A3KG 4CJ2C 4DA2A 1H9SA 1XTCD 1F9SA 1B70B 1HCZA 4XQJA 5IGGA 1NJIC 4LFBQ 2B63H 1OXTA 3A5ZB 4BBRB 4K6DA 5C4JB 4DK3C 2RDFA 4P71A 1SNOA 4APVA 1WCMG 1KRSA 2JXMB 1JWSD 3AB9A 3I70A 3NP8A 1UEBA 3QG1A 4DUYQ 2JEAI 2AMCB 4ZAIA 3FKIH 1SYCA 2OQKA 3ND9A 4X3UA 3VYRA 4GN5A 2RCNA 3L7ZC 2F0VA 4HN7A 4I65A 4B3RL 4A3DG 1BUVT 4B3RQ 2VB3X 2IX1A 2YTYA 3ZYYX 2KEDA 2B3GA 4YWMA 1TS4A 1X3GA 3J80i 1M1KC 3BG3A 3CCQA 1GUWA 4LF9L 5IWAL 4OX9Q 4KKTA 4A3JG 2K32A 1IKMA 3J7YW 1YEZA 2L12A 4XT3B 4A3CH 3H15A 4AIMA 2VY3A 5C0XI 2RA4A 1SE8A 2E2HB 5M5XH 1D1KA 3VKEA 4XYOA 3H6MA 3PCOB 4R4QA 1PRTC 3LGJA 2B8FA 2O5IC 2UUCQ 2K50A 3HZXA 1FJGL 2KOLA 1I6HH 1C4QA 2K7VA 3D6WA 1Y69U 3I4MH 1EY6A 2QILA 4A76A 1JE4A 2LFNA 2B2YC 1PXUA 1FGBD 2B2TA 3PV0A 1HR0W 3I2ZA 3S2DH 5A2QL 4RFBA 4BY7H 5C44H 3BZCA 1KD1C 2XNAC 1PTOC 4Y52H 3CAMA 4JI2L 1RDPD 4KD3A 1QNUA 2P2RA 5EPJA 2TMPA 4B08A 1CKNB 4JI5Q 1UAPA 1FVIA 1SN8A 1W6JA 1BCPD 2ASBA 2OPUA 5C0XH 1SROA 1KC8C 3R2IA 1TWHH 1ZYRC 1A6XA 1ZZJA 3RUZA 3G48A 1RTOA 2K5QA 4IQZA 1MJEA 4IPDA 2N49A 1HH2P 3GTKH 1A3VA 2HHHL 4JI7L 2PPBC 1DOLA 3MWYW 4DNIA 2K5WA 1HNXQ 1LT3D 1F77A 1PMRA 1HNWQ 3HKZB 1U4PA 2ZTCA 1GO3E 3GTOB 2EYMA 2A73B 1ONLA 3TN2A 2OT2A 1HQRD 1CKNA 2CW0D 5DNFA 2FINB 2JK8A 1IYJB 3KF8B 1Z6HA 4CGYB 4BBSH 1WCMB 1WFQA 2EYJA 3GTQB 1TQOA 2PQEA 5GROA 3J80L 4QGUA 1EZ8A 2KHJA 5H1SE 1YITA 4POGA 3MEFA 1SNDA 1ET6A 3A56A 2F0PA 4AYBE 2VS1A 4A3LG 3ERSX 3GTPB 2JSOA 3RN5A 1VMCA 1SNQA 5LHY1 1SFOH 5C3EG 1WTVA 1EEFD 2MUYA 4FF1A 2YTVA 4QB4A 1N36Q 3I73A 2FXQA 3TZDA 4DR2Q 1JB7A 4QF4A 1X6OA 1EY9A 3EA6A 1Q1EA 1XPOA 1ZZKA 1HTLD 3Q8DA 2K28A 4NDXA 3BU2A 1MI2A 1D1IA 1CA5A 3HOWH 1Q7YC 1Q8KA 2L15A 5LL6X 4JC0A 4DUYL 1EYCA 3CHBD 4P72A 5GADC 3C2PA 2C5CA 3TP5A 2F0IA 5D3IB 3VR6A 1XMOL 4V0BA 1WOCA 3CCJA 4A3DH 1D2BA 4QCLA 1H9SB 4H0LC 1E0BA 4DR6Q 4JI0Q 3LX0A 4RG1A 2O2LD 3SK5A 5FKAC 1P8LA 4J15A 4KMUC 3BDLA 1WYDA 2IL8A 2JQOA 4A3EG 5IOCA 3X3NA 3BVZA 2YTXA 3BZDB 4BY7B 2E2DC 1X65A 4GKKL 1XNQQ 2V1CC 5IT9E 3I7FA 1HZCA 3JAML 1VQLA 2VW9A 5M5WB 2MO0A 3QJYA 4K6LA 4DNRB 1HTPA 3JAME 4BXXG 2QDBA 1WTXA 2VQFL 3K5MA 2Q8RE 5KYIA 4UP9A 4WALA 2E2IH 2PI2E 3BZKA 3KYHC 3E9HA 3KK7A 4GZYC 4J8QA 1UWVA 1XMQL 3F8TA 1KDCA 4DR1Q 1BCPF 1DTJA 4DR1L 3GTKB 4DV0L 4A3CG 1B4OA 4QUFA 2MGSA 4IUNA 3M7GA 1L0XB 1KHIA 2JA7B 2XRSD 2C9OA 1FNVA 4GNXB 1JWUD 1N33L 3HEJA 1VIGA 2F0SA 1P16A 4GNXC 3MXNA 3MXPA 2K14A 4KTAA 4MHEA 4K5XA 1PZID 5KNDA 5EPKA 2PQUA 4PQXA 4M1UB 5IYDH 4IUUA 4DV5L 1HNXL 3FKIG 1CKMA 2GA4B 1N8RC 1HNWL 3E0JA 3S14H 3DWPA 2IX3A 2AQ3B 3NTIA 1CI3M 1LTLA 3X3MA 3S15B 3SK4A 1S5FD 1LLRD 1O7ZA 2WKDA 3CXCA 5GAEC 1E1OA 4A75A 3EFXD 5IGFA 1VQ6A 2L11A 3WOFA 3TDQA 4X6AH 3J81i 1QVFA 1YJ9A 1QUQB 3J80E 4C3IG 1JB3A 1EIHA 2UU9Q 1SYBA 1CSPA 1RKNA 4LFBL 3CW2C 3I72A 4LAAA 1EOVA 5C3EH 2K5HA 3D8GA 1G91A 1M90C 2PYKA 3BVMA 4JBWA 1O7YA 2EJFC 1GJXA 2KCTA 5ELNA 3J81E 3FEWX 3CPWA 1QZGA 3E5SA 3HOZB 2E75C 1YIJA 5HGTA 4PZ8A 2JA6G 3HGBA 4QMGA 1E1TA 4H44C 3T53B 2BA0A 4U68A 2DNEA 5CV8A 3D6CA 3STBC 5EGTA 3DMUA 3NE5B 4H13C 1O7IA 4HTHA 4DK0A 4JYAL 4XIGS 1Y14B 4BBRG 1L1OB 4K8IA 3T16A 4KHZA 4HJ7A 3ULLA 1SNCA 1D7QA 3OMCA 1OXVA 4TRDA 1J8IA 5LMUL 5BR8L 1F2ZA 2FFKB 4YWKA 3I4OA 3V96A 2OPVA 4YCVA 4A93H 2IJ0A 1JE5A 1IXRA 4Y7NH 3DEOA 4HIKA 4FVMA 1KNAA 1Y1WB 1EQTA 4X62Q 5C0XG 5CV9A 3AEVA 4DR5Q 2V4DA 1QJOA 3P7JA 1YNJD 4GOPC 3K7UC 1L0WA 1CQVA 3NK9A 5DM73 2B29A 3T51B 5E1FA 2IT1A 3F2BA 1I3QH 3HKSA 2D0PA 4HIMA 3OWFA 1PH6A 1AFPA 3Q23A 5FLMH 2E8GA 3UDGA 2AWNA 4DAYB 4PZ7A 1A15A 4PV1C 2H1EA 2VXWA 3A7LA 4UAIA 5JJZA 1SJHD 2WB1G 1ZXTA 2EE1A 3T4AC 3S17B 5DLQE 3K7AB 2F0NA 4ID6A 3UE0A 3G71A 1WJJA 4X66Q 4QIWB 2NWGA 1IYVA 4OONA 1A62A 2CTEA 1LV9A 1MGSA 1XJVA 2WINB 1PTOF 1SBBB 3K5OA 4DV5Q 3CCRA 1JJGA 2EDGA 3DXJC 3GTJB 3CCEA 2SDFA 1JCKB 1TS3A 1VQ4A 1VQ5A 5AJ3L 3SGIA 1DT4A 1SEBD 1EY7A 1MSHA 3AYHB 1ICWA 4DV3Q 3OMGA 3I90A 3G4SA 1PH2A 5TSSA 1QCBD 1GKHA 2EY1A 1YHQA 4LF6Q 1E2VA 4HCSA 2K5DA 4MZ9A 3KLSX 2PMZB 5FO7B 2R92G 1I50B 3J81j 3JAMc 2OTLA 2Y0SB 3OIQA 4F8MA 1QB5D 4IUPA 4X65Q 4OL7A 1QZHA 2E74C 3H3VH 4QUCA 4LF5L 4YHHL 1WVNA 2ENBA 2F0OA 2M00A 1OTCA 5IWAQ 4A3MG 4OX9L 2ZM6L 2AKWB 3A54A 4P75A 4B9XA 5IP7G 2Y0SE 4FO2A 3PO2B 1YJWA 2YU9H 1N32L 1O7LA 5M3MH 3F2DA 2DY8A 4WFN3 1T5EA 1FYCA 2IX0A 1PTOH 2D9UA 2AQ2B 4OO1G 3M7NA 4XYQA 4LF7Q 1R9TH 5C4ZA 5C4XB 2HCIA 4RKLA 3H09A 2C35B 5JPMC 3GTGH 4K14A 2ZXOA 5IY0A 3KF6B 4A3IH 4I7ZC 2Z6KC 4HJAA 4DV2Q 5LMNQ 1LTSD 3KDFA 4JK1C 3S1RB 1WTOA 1U4LA 1CK1A 1PZJD 4B3TQ 3H3VI 3S2HH 3A74A 5C4XG 1VS0A 3SHLA 3T1YQ 4K8JA 3HOVB 4HAEA 1VQKA 1IW7C 4A93B 1NE3A 4DXFA 4JI6L 2JZXA 4FF4A 1BOSA 1I94Q 1VF5C 3CMEA 2VB2X 4OIKA 3A55A 1JMCA 4ILWA 1XXGA 4WORA 1QWYA 3OTOL 2EYLA 5K36H 1VQ8A 5KGUA 1ENAA 4JCVE 3E9IA 4G7OC 3FPPA 1LTTD 1SE4A 3S24A 3K0XA 1U4RA 1MJCA 4DV0Q 5KYLA 3GTLB 2Q2HA 4ZUIA 3S1QB 4QJFA 3PF5A 4C3HB 4X3TA 1I4QA 3A7AB 3G7LA 4PMBA 1EQVA 3HOXG 2F1MA 4DGZA 1I5FA 1ZKOA 2R61A 1NTGA 2KA7A 3L9AX 1F2LA 3MXUA 1VQNA 2NZOA 4RMFA 2KHIA 2F3WA 3H94A 3U58A 2WIIB 2Q8TA 2NTSA 1Q1BA 2CTMA 1ENFA 4A3BB 4GN3B 3CCMA 1K0RA 2EYFA 1YHAA 1STEA 2IPKD 2MQHA 3EQLC 1W3SA 4A3EB 1BNZA 1TT2A 1Y1VB 4DKAC 1NMGA 4QQBX 5M5YH 4R8NA 3K8AA 2QNDA 3OWEB 1K9MC 1EU4A 5J22A 1Y1VG 3CCSA 5KNCA 4DK6C 4HCEA 2VNUD 1TWFH 4A3GH 3T56B 2VUMH 1UE7A 3RMHA 4XQQA 5C5LA 3RZDH 1I50H 1DXMA 2F4IA 3NUCA 4RGOS 1JWMD 1IBKL 1MSGA 2ZT9C 1D5ZC 1GM5A 1XYIA 1D8LA 1N36L 5HGQA 5E4XA 3M9BA 4K5VA 2ZTDA 1SAPA 2KCCA 1AZPA 1HNZL 2E5LQ 3FKIB 3J7A5 4J6HA 4KI0A 2OCEA 2XWBB 2Q8IB 4B3MQ 2YU9B 2Z6KA 5M3MB 5C3EB 1Q90A 2IHFA