4OO1G

Structure of an rrp6-rna exosome complex bound to poly(a) rna
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
234
structure length
226
Chain Sequence
STFIFPGDSFPVDPTTPVKLGPGIYCDPNTQEIRPVNTGVLHVSTAYIDYSSKRYIPSVNDFVIGVIIGTFSDSYKVSLQNFSSSVSLSYMAFPNASKKNRPTLQVGDLVYARVCTAEKELEAEIECFDSTTGRDAGFGILEDGMIIDVNLNFARQLLFNNDFPLLKVLAAHTKFEVAIGLNGKIWVKCEELSNTLACYRTIMECCQKNDTAAFKDIAKRQFKEIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of an Rrp6-RNA exosome complex bound to poly(A) RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/rna
molecule keywords Exosome complex component RRP45
total genus 36
structure length 226
sequence length 234
ec nomenclature
pdb deposition date 2014-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF15985 KH_6 KH domain
G PF18311 Rrp40_N Exosome complex exonuclease Rrp40 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4oo1G01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4oo1G02
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 4oo1G03
4KKUA 1A63A 3K7AH 4JBJA 1XNRQ 4A3EH 1PVOA 2BH2A 4JI1L 1PHJA 1BBWA 2VQFQ 1J5EQ 1EIFA 2JA7H 2CKZB 4IPGA 3HOVG 2KA7A 1PH3A 4IPCA 1E3PA 4P71A 1TU2B 2BDOA 3N6RA 4LUZA 4QL5A 1CKNA 3CCUA 4DUYQ 4LK1C 4HJAA 4ALPA 4JOIC 3T1HQ 3GQBA 1YJ9A 1HNZQ 2A6HD 1WFQA 1I6VC 2A69D 2VS1A 2JK8A 4HJ5A 2JA6H 1KL9A 1LM0A 1Y1VH 5GAHC 1XPRA 3AEVA 1CTMA 3RLNA 2K32A 3U4ZA 2XTIA 4DV2Q 3GTMH 5IY0A 4JI7Q 1J5EL 4DK3C 4A3IH 4UY8C 1HZCA 1H9KA 1VQ4A 3A0JA 3GDEA 4POFA 1A6XA 3ER0A 3AB9A 3PV0A 3OTOL 3CF5A 4DUYL 3T1HL 3VR2A 1K0RA 5IE8A 3GTKH 1B70B 2NN6I 3GTOH 4KHPQ 2F1MA 1OXTA 3F2BA 2YV5A 1X54A 5JJKA 4A3GG 3UDFA 4JI5Q 1IBKL 1J6QA 4JI7L 1PH1A 3L0OA 1NTGA 4I7ZC 3S14H 4PZ7A 3PO2H 2IHEA 5BN3A 1E2VA 1VQ5A 1SMYC 2CTJA 3CCLA 1E22A 2VY3A 4DV0L 1UE5A 5M5XH 2E3UA 2Q2TA 3CCJA 4A3KH 2CTLA 1WJJA 2A19A 4A3BH 1K8GA 1TWCH 4P74A 4R4TA 2F52A 4IJLA 4JI2Q 1HNXL 1OXVA 1EFWA 2UUCL 3S1QH 2D62A 4DV1Q 3RZDH 1YNJC 4NB3A 1Y1WH 2Z6KC 1M90C 1VCIA 2GVAA 2Q2UA 4BY7G 4GLXA 1ZZKA 3EBEA 1Q86C 1TWGH 2CQOA 1P8LA 5M3FH 4BBSG 4A3FH 4O0AA 2E74C 4LFCL 5BR8L 1YIJA 1QUQA 1VQGA 3TS0A 4JI2L 2NVTH 1H9JA 3HOUH 3VA7A 1NE3A 4OO1I 4YHHQ 4ME3A 5C4XH 3HOUG 2UXBL 1B8AA 4GLAC 1DT4A 3CCRA 1ZYRC 2PNHA 2KENA 1YVCA 3A5UA 1R9TH 1UE6A 5C0XH 1E1OA 3ERSX 3BG3A 2BE5C 3M9BA 3H15A 1IBMQ 1XNQQ 1LTLA 1LUZA 5JJIA 1VF5C 4JI4Q 2D2CC 3B6YA 4DPGA 4FDBA 3KJPA 4GOPA 4AQYQ 3H94A 3VKEA 2NZOA 3TQYA 4NPSA 1JMCA 2R92H 1L1OA 1Z47A 2RF4A 5E7NA 1HNWL 4KMUC 2A69C 3F2DA 1YJNA 5JEAJ 1O7IA 2HT1A 1Q1BA 4K0KL 2I5HA 1QZGA 4G7HC 2E5LL 4JI4L 4MTNA 3S24A 3K0XA 4IPHA 5IYBH 1X3GA 4DK0A 3PIOA 4BY1H 3SE0A 4APVA 1X4MA 3JC66 1V8QA 4DK1A 4X64L 2CTEA 4NXNQ 2I0QA 1YBYA 2Q2IA 3HOXH 4BXXG 3OOCA 1VQJA 3A74A 2YU9H 4GN4B 1OTCA 1XPUA 3HOZH 1ZZJA 2LMCB 4WJ3M 4H13C 1X4NA 1H9SA 1VQIA 3I4OA 4L5QA 4KN7C 3CPFA 2OTLA 1XNRL 4X64Q 2MO0A 4GZYC 2PNRC 1K83H 2H5XA 1U0LA 2JJQA 2NVYH 3RLOA 1Q81C 5BN5A 4L5RC 2MJHA 5IP9G 2K52A 1IXRA 2CTKA 1IYVA 4JC0A 1B7YB 3QG1A 2JA6G 2O5JC 4GN3B 1NY4A 3W5OA 4GNXA 1GD7A 1N34Q 1TWFH 4AH6A 2QA4A 3HOXG 3D0FA 3G4SA 1XMOQ 1HNZL 4LNQA 4A3DG 1T5EA 4UP8A 5C0XI 4MZ9A 4HIDA 2PCFB 4DR2Q 3RN2A 1I50H 1VQ8A 5KNDA 2JA7G 4JI0Q 1V9PA 1VIHA 2AWNA 1K8MA 4A3EG 1Z9FA 2UXDL 2K50A 3JAMc 2UUBQ 1PH4A 4L8JA 3OTOQ 1Z7TA 3CC2A 1AH9A 3KF8B 4J15A 2DUDA 4GKKQ 1CFMA 3E0EA 3S15H 2K4KA 1QVGA 1ASZA 1X56A 5ELNA 1IYUA 5DLQE 1GUTA 4DR2L 2OTJA 1KRSA 1VQ7A 4P72A 5IT9c 4JI5L 1KQSA 3FPPA 1CI3M 1JJCB 4BBRH 2NZHA 5FLMH 1UE7A 1N36Q 1PFSA 2RHQB 1NMFA 1MKHA 2JA9A 2R7FA 2EXDA 3GO5A 4GOPC 5M3MG 4LF4Q 1TXYA 2JA8H 4UPAA 1PH9A 1M1KC 1L1OC 4QGUA 2AWOA 4DV0Q 4A76A 3F8TA 5LMNL 4DR3Q 3HOWH 4KKSA 5FLXc 3DLLA 1GM5A 1O7LA 3PF5A 4A3CG 1PA6A 3TEHB 2OQKA 3MXUA 4DR1L 1OXSC 2NN6G 3K8AA 4RG1A 2UUCQ 2OWOA 1IL2A 3A8JE 1W2BA 4LF4L 3M4YA 5JJLA 2NN6H 1YZ6A 1HJPA 1S3OA 2ZTCA 5KNCA 4AYBG 3IKJA 2YTVA 1VQAA 2A6ED 4OO1H 2WB1E 5M5WH 3RNUA 1HTPA 2LXJA 3TZUA 4X66L 3JAMi 1TKWB 3MFYA 3G6EA 2ATWA 4DR5Q 2ANRA 2BH8A 4A3JH 1IBKQ 1EC6A 1B9NA 1XJVA 1IBLL 4DR7L 2JA5H 3UE1A 3TRZA 2A6EC 4JOIA 2IX0A 2CTMA 2ES2A 3GTLH 1EQRA 4OO1G 4YWKA 2CWAA 4X66Q 1YI2A 1SFOH 3KJOA 1HR0L 2LXKA 4OXPA 2R7ZH 5ELOA 2O5IC 2NVXH 2JZXA 4DV7L 5IYDH 2WAQE 4HR7B 2YTYA 4GS3A 1IBLQ 3UDXA 1WCMH 3PO2G 1I94Q 2RCNA 2ZTDA 5K36H 1HZBA 3A7LA 3CC4A 2VW9A 4LFAL 1J5KA 1ZTGA 1PMRA 5JEAG 2ID0A 2OPUA 4IO9A 3CMAA 1BKBA 4L5SA 4A3GH 1TWHH 1WYDA 4GKJQ 2MNAA 1HNWQ 4A3LG 1KRTA 4PZ6A 2MFIA 2R93H 1O78A 2DGYA 4LJZC 3A5ZB 4BBRG 5FLMG 2OCEA 3HOYH 4R4CA 1PYSB 4TQUS 4EX5A 3PUXA 1BVSA 2R6GA 3I4LA 1EIYB 2UXBQ 4JI3Q 1K1GA 3MXNB 4KI0A 1KHMA 3PUYA 4GN5A 1L0WA 1OXXK 4LF9Q 4JCVE 5IYCH 3EIVA 5HY6A 1SRUA 3KFUA 4R4OA 3UE0A 4LF8L 3S1NH 3L2PA 3LNNA 4DR4Q 4A3LH 1PH5A 3DM3A 4YCWA 1HQMC 3CW2C 4DV3Q 1JB7A 4DV5Q 4AQYL 3AEVB 3TS2A 2E2IH 3HOZG 4A75A 3GTJH 4GOPB 1YHAA 1X3FA 2F4VQ 3I55A 3CD6A 2YQRA 2IT1A 4HJ9A 5A35A 4R4QA 1Q1EA 4DKAC 4WALA 3CAMA 2PQAA 4GNXB 5IYCG 4DAMA 4DNRB 1SN8A 2UU9Q 2B29A 1NJIC 5FJ8H 1N34L 4B3RQ 3VR6A 3F2CA 1GUSA 1BBUA 4YCVA 4PMWA 2PI2A 1VQLA 1G291 4A3MH 2R92G 1V1QA 2RHSB 2JVZA 3DXJC 1VF7A 1GUGA 3A7AB 3S16H 2R93G 1WVNA 1VQOA 3W3AA 3M7NA 1K3RA 4KLKA 4LUOA 4DV4L 3RZOH 1HPCA 4C3JH 2N49A 2K5HA 4HJ7A 3H3VH 4MNOA 3STBC 3S2DH 2AXYA 2L5TA 3M4PA 3PUZA 4O2DA 2JEAI 1YEZA 2E2HH 1P16A 2Z0SA 2A6HC 4OWXB 1DTJA 3WDNA 4P73A 5GQOA 1H9SB 3J7A5 4Y52H 3CQZH 3UDGA 5IYDG 1SROA 2A8VA 2HQLA 1I6HH 4R1JA 2QEXA 4H02A 1LYLA 1T9HA 2I5LX 4JYAQ 2UXCQ 2HHHL 4IFDH 1A62A 3PO3H 3RN5A 2B63H 4KHPL 4A4IA 5IP7H 2UUAQ 2JA5G 1Y69U 3T53B 1UEBA 4Y7NH 3QIAA 1L1OB 1DXMA 2R7DA 4JI0L 4JI1Q 1XMQQ 4DR7Q 3E9IA 3PUWA 5IWAQ 4KN4C 4X62Q 4BA2I 2VQFL 2HH2A 4LWCA 3U50C 1PYBA 2UXCL 4C3IH 3J7ZC 4LFBQ 2NVQH 4IFDG 4OGQC 1HR0W 3HGBA 1KIXA 1VS0A 2UUAL 4RCNA 2VUMG 1CKMA 2QF7A 2B63G 2ZJPA 3PO3G 4OWTB 2A68D 4JI8L 3S2HH 4LW1A 5IWAL 4X62L 1ONLA 4L5TA 2VQEQ 3AFPA 3CCSA 2B8FA 1HNXQ 4X65L 4IOCA 4WANA 1SMXA 1Y8OB 5GAGC 1X65A 2JEBI 2B3GA 3FMCA 2ASBA 2EJFC 2WP8J 1GJXA 1MJEA 5LMUL 2PY9A 1HR0Q 1DCZA 4QIWE 5C44G 4JI8Q 2ZJQA 4BY7H 1N32Q 1YHBA 3KDFA 2GVBA 4DAYB 4JI6Q 3HKZG 3A8IE 3VR5A 4X65Q 1Q90A 3OW2A 4A3IG 4LFAQ 1PV4A 1VIGA 4JVHA 4KKTA 1N8RC 4QJFA 1CKNB 3J80i 2HH3A 3ND8A 5FJ8G 5GROA 4GLVB 3D31A 1K73C 1GHKA 3S1RH 1EQQA 4TKOB 1I3QH 4JV5L 3BZKA 3I4MG 1GUNA 1IW7C 2CW0C 1C9OA 1Q82C 2IHFA 1Q46A 1Y8PB 1GUOA 4DV6Q 2KBNA 4JK1C 4G7ZC 4PZ8A 4IPDA 3E9HA 3AFQA 4LF9L 1YHQA 3ICEA 4YWMA 2Y0SG 1QJOA 1OXUA 1AE3A 1FR3A 3CP0A 3LGJA 5BR8Q 3CMEA 3M3YH 3ULLA 3T51B 3Q8DA 4DV7Q 4JV5Q 1Y14B 1SLJA 2E5LQ 3D4RA 1I94L 3PIPA 3S1MH 1FJGQ 2A68C 4JI6L 2AHOB 3HOYG 1HZ9A 1IYJB 1HCZA 1VQPA 1TUAA 1UE1A 3IRBA 3T56B 2K75A 2Y0SE 4LF6L 4GKJL 2BA0A 1FVIA 3K7UC 1JE5A 2E76C 2PQAB 3M4QA 3W1BA 3L7ZC 3KOJA 5GAEC 5C44H 1SR3A 1CKOA 2E8GA 3U4VA 3OW7A 1GKHA 2HIXA 1H9RA 4GNXC 1IBML 3A8KE 4YWLA 1XNQL 1TWAH 4AM3A 4UP9A 1ZKOA 1ASYA 3CRKC 3VR4A 2N3SA 3HFZB 4JI3L 4PV1C 1E24A 2LSSA 4RMFA 4JBMA 4LF5L 3S17H 2IY5B 5K36G 2K5NA 2L15A 4IJHA 3GD7A 1GVPA 2N8NA 2ZTEA 1X9NA 1E1TA 1X3EA 2VUMH 1K8AC 3PF4A 2B8GA 4POGA 1MJCA 4B3TQ 1CSQA 1B9MA 3CRLC 4HIMA 2R7ZG 2PI2E 3PGZA 1YITA 1KXLA 3UDIA 5AJ3L 4DK6C 1V43A 3HKZE 4LF5Q 3ND9A 4XTCS 5C3EG 4HJ8A 2EQSA 4LF7L 1Y8NB 4YCUA 3I56A 3F1ZA 2DN8A 5C3EH 2EIFA 4NXNL 2V1CC 5C0XG 1PH8A 4B3TL 2HHHQ 1I5FA 1DD2A 2JQOA 1VQ9A 3P20A 4B3MQ 4GKKL 2PQUA 1BDOA 5H1SE 1K8OA 1RIPA 4QY7A 2Q8IB 1W3SA 1FL0A 2EDGA 4LF7Q 4WJ4A 3T1YQ 4XIGS 3KF6B 1MIUA 2ZJRA 4A3CH 4YY3L 1JJ2A 1H9MA 3NE5B 4IFDJ 2ZM6L 4NXML 4DR6L 2KHIA 1EUJA 1GO3E 4DV4Q 4A3FG 3OPOA 3TREA 3KDFB 2E75C 1YJWA 3I73A 2Q2HA 3RR5A 4A93H 2XGTA 4DUZQ 4LFBL 1ZZIA 2EJGC 4H0LC 2KCMA 2N78A 4AIMA 3CPWA 3QJYA 1XMOL 3GTPH 3J81i 1JJGA 1VDZA 3CCEA 4A3MG 4OWWB 4EQ5A 1CSPA 1YNXA 5KNBA 2A1AA 3RLFA 5M3MH 4YY3Q 1KD1C 4A3BG 1H95A 4DR1Q 2YYZA 2ZM6Q 4NXMQ 3M4OH 3I72A 3J81j 1VQCA 3H0GG 2KCCA 1Z6HA 4G7OC 3ZJYC 3CCVA 1VQMA 2HIVA 1WE8A 5GADC 3I4NG 2E2JH 2AUKA 2K7VA 3H3VI 4UP7A 3BZCA 1GHJA 1Q8KA 1EWHA 1S40A 1YNNC 1E2ZA 2JE6I 1FYCA 2CFMA 4C2MH 4DR5L 4DV2L 1XMQL 2FMRA 1D8LA 5C0XJ 4QQBX 1LABA 1SE8A 3CCMA 1N36L 1N33L 3PUVA 3KLWA 4DV1L 2D5DA 2PPBC 3NENA 1G6PA 2WFWA 2CPQA 1KHIA 4JG2A 4IQZA 3I4MH 3G48A 2BA1A 2KCTA 4A3DH 1A8VA 3VDYA 2VNUD 5LMNQ 4DR3L 3FKIH 4OX9L 2D0PA 2JA8G 1K9MC 1QVCA 3I4NH 1CUKA 2OPVA 1RL2A 3I7FA 2CWPA 3K80C 2QNDA 4JVYA 5IP9H 4OONA 4AYBE 3BJUA 1Y1VG 3STBD 2VQEL 1VQDA 3KLRA 1VQKA 1N33Q 2Z6KA 5EAYA 1G51A 2EVBA 1HZAA 1X55A 1LACA 1Q12A 1E7ZA 2F3IA 1AE2A 3FKIG 5HGQA 1L2FA 4DV6L 5BN4A 2DNCA 1A0IA 1PH7A 4BXXH 3U9SA 2IX1A 1PH6A 2MQHA 3G71A 1X6OA 5LMUQ 4IOAA 4JBWA 4OX9Q 3HOVH 1N32L 1JT8A 3EQLC 2CTFA 3GTQH 4P75A 4A93G 1IW7D 5LMNW 2KHJA 1S72A 4DNIA 1Q7YC 3NBHB 2DGRA 2EJMA 1NMGA 5JEAH 3LWUA 2JXMB 3EN2A 2K33A 2C35B 2FXQA 2D0OA 1FJGL 5IYBG 1WCMG 1WOCA 2I5MX 1VQHA 2K5VA 2OQ0A 2V4DA 2AUJD 4PG3A 5J3BA 4C3HH 1HH2P 3NEMA 4LF6Q 2WAQG 4LFCQ 2ANNA 3VR3A 1D7QA 2DNEA 1EOVA 3H0GH 5C4JH 4LF8Q 3GTGH 4DR4L 2WB1G 3AQQA 4YHHL 1XTDA 1KC8C 1C0AA 4DV3L 3OYYA 1J4WA 3W1GA 4TVAB 4B3SQ 4LUVA 2F4VL 4A3JG 3PSIA 1KAWA 1E2WA 2QGQA 4QMFB 3CCQA 1VQNA 5IP7G 1UWVA 2ALYB 2UU9L 1XPOA 1VQEA 2ZT9C 3FHWA 5AJ3Q 3ULPA 4B3RL 4BA1I 3K81C 4IFDI 5C4XG 4LIJA 2YTXA 1VQ6A 1WI5A 4B3SL 3HOWG 1FGUA 3PCOB 3AYHB 2VL6A 1IZ6A 4K0KQ 2GN5A 4BBSH 2VZAA 3V69A 3BU2A 3M85A 3J81c 1EWIA 2AKWB 2BL5A 4DR6Q 3SDZA 3HKSA 4B3ML 1NBWA 1VQBA 1Y1WG 5M3FG 5M5YH 1QZHA 3BDOA 1EYGA 2CCZA 4H44C 2K14A 3SGIA 4DV5L 3KF6A 4HIOA 3NELA 1U5KA 3FP9A 1DGSA 3KYHC 2AMCB 2MO1A 3ULJA 2BE5D 3T1YL 3U58A 4JBKA 3U1KA 2PMZE 4DNTB 1C7YA 3MEFA 2UXDQ 3CC7A 4X6AH 3CXCA 4B8TA 2UUBL 1N9WA 3IFTA 4JYAL 2P2RA 1QUQB 3J80c 4A3KG 3WWVA 4BY1G 3I2ZA 1QVFA 4DUZL 1VQFA 4HIKA 4KHZA 1PH2A 4NBQA 4R4IA
chains in the Genus database with same CATH superfamily
4KKUA 1A63A 2H1EA 1A2UA 4JI1L 1J5EQ 2JA7H 4X64H 2KA7A 1TU2B 3N6RA 1XYIA 1WHRA 1U4MA 3GQBA 1HNZQ 5CGKA 2A69D 5CV4A 3Q23A 3U4ZA 4DV2Q 5HURA 1J5EL 1J9OA 4UY8C 1HZCA 4POFA 4GKKL 3PV0A 2B2VC 5IE8A 1K0RA 3GTOH 4BS9A 5IGEA 3D4DA 4DAVA 2NUCA 1OXTA 1EEFD 4K5XA 3F2BA 2JYOA 4A3GG 2NZ1D 3VA5A 1EY5A 3S14H 2PZTA 4HCEA 5BN3A 1LTID 4XDXA 1BF4A 2F0EA 2E3UA 3CCJA 2CTLA 3R8BA 1WJJA 2A19A 4A3BH 1BO0A 1X3PA 2UUCL 2D62A 2B2UA 3Q6SA 1B3AA 4BY7G 2GVAA 2F4VH 1DOMA 3EBEA 1PLFA 1Q86C 2ZM6H 4NXMH 3JAMW 1QUQA 1H9JA 1TVXA 3HOUH 1B50A 2NVTB 4EC5A 4OO1I 4DUZH 5JJZA 1BR9A 2B2TC 3DWPA 2M00A 1PTOH 1I4PA 2UXBH 1E1OA 3O13A 4I7AA 4PNYA 2BE5C 3M9BA 3H15A 3GTPB 1LUZA 5JJIA 1VF5C 2F0DA 5FLXW 2R92H 1A3TA 2D9UA 1HNWL 2ZQEA 1HXYD 1YJNA 5JEAJ 1CM9A 2HT1A 1Q1BA 1QZGA 3S24A 1TY2A 4IPHA 3SE0A 4APVA 2MJ8A 2CTEA 1VQJA 3OOCA 1M8AA 5C4ZA 1OTCA 1AN7A 2I46A 1ZZJA 4WJ3M 1TWCB 5EKLA 3K59A 3C46A 4JYAH 1XNRL 1CHPD 4XT1B 4NW2A 4GZYC 2PNRC 2H5XA 1Q81C 2X6GA 5EKIA 2K52A 1IXRA 1F9PA 4GN3B 4GNXA 1GD7A 1TWFH 1PRTB 4A3DG 4RHSA 2L11A 1LTGD 4HIDA 1I50H 3TP8A 1VIHA 4JI0Q 1V9PA 1XXGA 2RQXA 3Q22A 3JAMc 1S03G 1Z7TA 3U9OA 4YY3H 2DUDA 2RBMA 5ELCA 1DOKA 5KEEA 4JI4H 2B2YA 1EY6A 5DLQE 1SE3A 5I2XA 1KRSA 1VQ7A 5FLMH 4DR6Q 1UE7A 1N36Q 1PFSA 1NMFA 1A2TA 2JA9A 5M3MG 4LF7H 1B3QA 1L1OC 4YHHH 3W2DA 2AWOA 3F8TA 5LMNL 5FLXc 4JI8H 4DR4H 3PF5A 4MTKA 1PA6A 2OQKA 4DR1L 2OWOA 1EOTA 1HJPA 1MSZA 1LT6D 4B3SH 2A6ED 4OO1H 1YNND 4OELB 3RD4A 2LXJA 1PTOB 4N9TA 1U4LA 3TZUA 2LFNA 1KNEA 4BY7B 2BH8A 4A3JH 5M5YB 1IBLL 1EIHA 4NKLA 5G3LD 2JA5H 4GKJH 1G8ZD 2A6EC 4JOIA 3ERQA 4G08A 3GTLH 2CWAA 1B1ZA 1YI2A 2EY6A 2LXKA 2GA4B 4C3JB 2O5IC 5IYDH 4HR7B 1IBLQ 3BYYB 1WCMH 1TT2A 3K7AB 2RCNA 2ZTDA 1HZBA 2PO4A 1STAA 3PIP3 5JEAG 4A3GH 1TWHH 4XXEA 4X3UA 1V9NA 1IBKH 1RF2D 3E3XA 4PZ6A 2MFIA 1MGSA 1O78A 1KNAA 2AQ1B 4R4CA 5EPJA 4GN5A 1OXXK 4LF8L 1EYAA 2R7ZB 4HTHA 4AQYH 5ELEA 4YCWA 4JV5H 4DV5Q 2E2IH 4A75A 1YHAA 3CD6A 1Q1EA 1UNSA 3CAMA 4GNXB 2BOSA 2UU9Q 1NJIC 4B3RQ 5A2QW 3F2CA 1GUSA 1VQLA 3DUZA 3FVQA 2UUBH 2N88A 3A7AB 1GUGA 3M7NA 2NTTA 1N36H 1JOOA 5JOBA 4HJ7A 3STBC 2AXYA 4C56C 5I9PA 3MHBA 4O2DA 5A2QL 1YEZA 1P16A 1DTJA 3WDNA 3J7A5 1H9SB 3UDGA 5IYDG 1W6JA 1I6HH 2I07B 2A73B 4G4KA 2B63H 1QILA 4KHPL 4LF5H 5I6WA 1BCPC 5EBCA 4ZQ3A 1ILQA 4Y7NH 3J7AK 2OXPA 3PUWA 4C3IB 4X62Q 2VQFL 3HKZB 3J7ZC 4WFN3 1BQQT 2NVQH 2EYOA 1KIXA 2G8YA 1CKMA 2HCCA 4OWTB 4ZAIA 4JI8L 3GP7A 1ML0D 4X62L 3NSWA 1ONLA 1SEBD 4KHVA 5CORA 2B8FA 3SK4A 4IOCA 2F0NA 3I4MB 5FO7B 4C3JG 2ASBA 1WTWA 1GJXA 1HR0Q 1DCZA 4QIWE 4BY7H 1V1PA 4JI8Q 1UEAB 3KDFA 1IBMH 3R3OA 4DAYB 3HRZC 3TMEA 3HKZG 1Q90A 4A3IG 4LFAQ 1PV4A 3DM1A 2FJ2A 4KKTA 1N8RC 3J80i 1S5DD 1EU4A 5GROA 3V96A 3K57A 1I3QH 1STHA 3TN2A 2B2WA 2QDLA 3D6CA 1IW7C 1Q82C 1I3QB 3H09A 1Q46A 2X69A 2KBNA 2RA4A 1F2LA 4EQOA 1D5XC 1JQYD 2PQUA 4LFAH 1OXUA 3CP0A 3MZ5A 3M3YH 1D2BA 4BY1B 1VBIA 3DHQA 1N34H 1Y14B 3D4RA 1FJGQ 4JI6L 1IYJB 1PTOF 3GTMB 4GKJL 2Y0SE 3K7UC 2E76C 3W1BA 5J39A 3KOJA 3S16B 2E8GA 4K5WA 3JAME 1XNQL 1SJED 4GNXC 4YWLA 1TWFB 1XMOH 3KDKA 4JI6Q 2N3SA 3PMFA 3VR4A 4LF5L 3BDLA 4RMFA 1E24A 2IY5B 2B2TA 4LF8H 2K5NA 4IJHA 5K36G 1AW7A 3PF4A 4V190 1X3EA 1K8AC 3H3VC 4OCHA 4B3TQ 1IBLH 1R9TB 3UDIA 3WOEA 4LF5Q 4XTCS 5EKKA 3I56A 4FF2A 3BZDB 1PH8A 1AZPA 4B3TL 4JPBW 2ZXOA 1BDOA 3KDGA 5H1SE 1KDCA 4CDEC 3GTOB 4QY7A 3T1YQ 4XIGS 4FNFA 2IL8A 2L0CA 4YY3L 3TREA 4A93B 2E75C 2RKSA 1XRHA 2KCMA 3GTPH 3QJYA 4E9JA 4Y7NB 4OWWB 4A3MG 4YY3Q 2SOBA 4A3BG 4DV0H 3J81j 1VQCA 3H0GG 1Z6HA 1WE8A 1HFGA 2XWBB 1VQMA 5KIXA 5GADC 1XWEA 2RSNA 4UAIA 1ENFA 4UP7A 2WINB 1Q8KA 1EWHA 3OWFA 1YNNC 2JE6I 4KJOA 2FMRA 4DV2L 3S2HB 1QG7A 1LABA 4QQBX 3CCMA 3PUVA 3KLSX 5IT9W 2CPQA 1NUCA 1I4GA 4K0KH 3G48A 2BA1A 1F2ZA 4FXDA 1XX8A 4OX9L 3NWSA 2KUMA 4JVYA 5IP9H 4OONA 4RH6A 4IURA 3OMGA 3KLRA 3P1HA 5EAYA 4XYOA 2EVBA 1LACA 2JA8H 1AE2A 2SNSA 1L2FA 3U9SA 1PH6A 3G71A 5LMUQ 2AQ3B 4OX9Q 1ICFB 4OEMB 2WACA 2EJMA 1WTVA 4R8NA 3K6OA 2KJXA 2C35B 2FINB 5D65A 3PO3B 2EXZA 1V1PB 1BCPF 5IYBG 3SB1A 2I5MX 2OQ0A 1VQHA 2K5VA 1HH2P 3NEMA 1PYWD 2WAQG 5IWAH 2DNEA 2CVRA 2Z9HA 1E0BA 2JA6B 4DR4L 3DEPA 2CQAA 1KC8C 1EYDA 4DV3L 2A74C 2RSOA 3RZOB 1LTAD 2WIIB 2QGQA 3I91A 2EY2A 1UWVA 2ALYB 1XPOA 2ZT9C 1SSOA 3K81C 1OO9B 2YTXA 1KDAA 1TWAB 1WI5A 2CH4W 5AFWA 2VL6A 1ZEQX 1PZJD 3NWTA 4FF3A 4BBSH 3SDZA 4DU9A 2UUCH 5M5YH 4A3JB 3BDOA 1QZHA 4HIOA 1JR0D 5C3EB 2ZXPA 2AMCB 2F0LA 2MO1A 3ULJA 3U1KA 3A54A 2PMZE 4DNTB 4B8TA 3BS1A 5IGGA 4E6IA 2UXDQ 2UUBL 5FO9B 3AU7A 3WWVA 4Z9CB 3I2ZA 3NUCA 4DUZL 4KHZA 1I50B 4R4IA 4WRDA 3K7AH 4JBJA 3MXGA 1XNRQ 4A3EH 1PVOA 5I9OA 1O7YA 3PO2B 2M6QA 2BDOA 4JI1H 2BH2A 2F0SA 1CKNA 3CCUA 4JOIC 2JN4A 1WFQA 1I6VC 5GAHC 1Y1VH 3AMUA 2F3VA 4NMZA 4WJWA 2K32A 5IY0A 4JI7Q 1H9KA 4F87A 4ID6A 3HG9A 3A0JA 1SDFA 5CC4A 3ER0A 3LX0A 3CF5A 1A6XA 2K1HA 4OL7A 4QB4A 1N33H 2NN6I 2F1MA 2OEOA 3GTQB 1X54A 3UDFA 1J6QA 4JI7L 1PH1A 3L0OA 3PO2H 1ICWA 1SMYC 5E4XA 1UE5A 1TWCH 4P74A 5JAVA 4IJLA 3S1QH 1OXVA 1EFWA 3OMCA 4K8IA 1RTOA 1YNJC 1V1OA 1RDPD 2BDNA 4B9WA 2Q2UA 2KEEA 4GLXA 1KABA 3BDCA 1TWGH 1I4XA 1P8LA 4A3FH 4O0AA 4B3RH 4RWSC 2NVTH 3HOUG 4ME3A 1DT4A 1B8AA 4GLAC 1ZYRC 2PNHA 2F0HA 2KENA 5JVH3 3QOLA 5C0XH 4DR1H 1A3VA 4KD3A 5M3MB 3K58A 3BG3A 1KLUD 2B2UC 2D2CC 1K3BC 4DPGA 2C5CA 3KJPA 4GOPA 3H94A 1HRJA 1NNXA 1JMCA 4NPSA 1C48A 2EY1A 2RF4A 3NPPA 1K83B 1WTOA 4QCLA 1F0XA 2IX3A 5KGUA 1PFBA 4G7HC 2E5LL 2KHSA 2C9OA 2EYJA 4DFAA 4OD6A 3K0XA 4DK1A 4X64L 3MAQA 4CGYB 2AQ2B 5M5WB 2I0QA 1MSGA 3FRPB 2YU9H 3HOZH 4GN4B 2VQEH 2LMCB 1HHVA 4H13C 2Q8TA 4L5QA 1VQIA 1X4NA 4NZRM 4X64Q 2MO0A 4K0KL 1K83H 2NVYH 1U0LA 3SEBA 2MJHA 4JC0A 3QG1A 4FVMA 3TSSA 3W5OA 2Y3MA 3G4SA 1T5EA 4DR2Q 1TS3A 4H7BA 2RDFA 3RN2A 5CBAE 1SNCA 3HOUB 1T5XD 5IT9L 1Z9FA 4A3EG 1LTBD 2YU9B 2EYLA 3KF8B 2J7ZA 1FNWA 2P5ZX 1CFMA 1YNJD 1ASZA 1X56A 5ELNA 4DR2L 4ZRZA 3G7LA 4P72A 5IT9c 5K5PA 1JJCB 2IWHA 3NQTA 4CDFC 1MKHA 2R7FA 3GO5A 5J1ZA 4J1MA 1TXYA 4UPAA 5ELBA 1PH9A 3Q0AA 3JAML 4PQXA 4DV0Q 4DN4M 2IJ0A 3HOWH 1GM5A 3TEHB 2NN6G 3K8AA 4RG1A 4LMQD 2ZTCA 3MVVA 3NBHA 1QE6A 2YTVA 3IKJA 5KNCA 4EQPA 5M5WH 5CYUA 1CA6A 4X66L 3I4NB 4A3IB 1IBKQ 4LFCH 1QCBD 3NTHA 1CK1A 2CTMA 1EQRA 4X66Q 1SFOH 1HR0L 2K01A 5ELOA 2JZXA 2XIWA 4DV7L 1WTPA 3FPUB 2WAQE 3UOEA 4GS3A 1TY0A 1I94Q 4LFAL 5K36H 4HSPA 2ID0A 1STNA 5E1FA 4F7XA 4LF6H 1JB3A 1TIID 2HCIA 4DXFA 2LKVA 4JI6H 4LJZC 3MFGA 2RCFA 3OHXC 5IT9E 2UXBQ 2R6GA 1K1GA 1KHMA 3MXNB 1L0WA 4X3TA 4IUVA 4JCVE 4DA2A 3EIVA 1SRUA 3KFUA 3VYTA 3DWAA 4ILWA 3L2PA 1HQMC 1NR2A 4AQYL 3TS2A 3GTJH 2IT1A 5IYCG 3J81W 1SN8A 1WTRA 5EPLA 1N34L 1BBUA 4YCVA 4HMIA 1G291 2RHSB 2JVZA 3DXJC 3E0JA 2R93G 3S16H 3HZXA 4LF9H 3W3AA 4ABNA 1K3RA 3RZOH 1F9QA 1HPCA 1B2TA 1LTSD 4MNOA 2JEAI 3UI2A 2XRQD 4FXKC 4HMJA 4IN3A 5FO8B 2QEXA 4MHEA 1U4PA 1T9HA 2K5DA 5J22A 1B44D 3PO3H 3RN5A 5IP7H 4JI0H 3X3NA 3PQIA 1PRTF 3DWQA 1UEBA 2Z6BA 2R7DA 4JI1Q 1XMQQ 3C1FA 2WB1B 3U50C 1IL8A 4ME5A 4C3IH 3ZYYX 4IFDG 2JA8B 3A56A 1VS0A 4RCNA 4EGVA 4ZKCB 4CDDC 1ZTGA 1HNXQ 4L5TA 1G2TA 1RKNA 4WANA 1SMXA 1TS5A 2JSOA 1X65A 2B3GA 3BVZA 2EJFC 2WP8J 2X6LA 2PW5A 1N32Q 4FO2A 5C44G 3FAUA 1XNQH 1KLGD 3A8IE 3VR5A 4CKBA 1RCVD 2IW3A 1MBYA 5DNFA 4DV6H 4JVHA 1KAAA 4QJFA 1CKNB 3ND8A 5FJ8G 4GLVB 3D31A 2PMZB 5IODA 4TKOB 4JV5L 3BZKA 1EZ6A 1GUNA 1EFID 1K28A 5FLXL 2WV6D 2PZWA 2M9VA 1GUOA 2K28A 4JK1C 2B63B 1UG8A 1CQVA 3AFQA 3ICEA 4N8FA 3CMEA 5EPKA 1AE3A 3LGJA 1FR3A 2R61A 3NK9A 3Q8DA 4JV5Q 3PIPA 1HCZA 1VQPA 4IUQA 1UE1A 4J8QA 2PQEA 3IRBA 3T56B 3QD7X 1JICA 1FVIA 1JE5A 3KK7A 1LV9A 3NBIA 5C4HA 3OW7A 1GKHA 4A3FB 3D8GA 2B2VA 4UP9A 3HFZB 1JWSD 4JI3L 5JPNC 2EOTA 3HP3A 4KY5A 1PRTC 4XQJA 2L15A 1BCPD 1GVPA 1X9NA 3WOFA 1E1TA 2B8GA 4POGA 2KOLA 1HQRD 4A3KB 1DYQA 1CSQA 2R7ZG 1YITA 2QILA 1WTQA 2M8WA 3HKZE 3ND9A 5C3EG 4LF7L 4FF4A 2DN8A 2EIFA 2V1CC 2KCNA 5TSSA 1VQ9A 2F4IA 3P20A 2Q8RE 1I6UA 1RIPA 1L0YB 2Q8IB 4LF7Q 3KF6B 1MIUA 4A3CH 1JJ2A 2NBFA 1GO3E 4DV4Q 1EQTA 1TWHB 3OPOA 4A3FG 3KDFB 3RR5A 2Q2HA 4B9XA 4LFBL 4DUZQ 1ZZIA 2EJGC 2N78A 4AIMA 3CPWA 4EQ5A 4RGNA 1YNXA 5M3MH 5KNBA 2B39A 4NDXA 5HGTA 3M4OH 3I72A 2F03A 1SNPA 4G7OC 5I6YA 5C44B 3DEOA 4F88A 2E2JH 2AUKA 5C3XA 2NVXB 2ZXRA 2MUYA 2VXWA 4OIJA 4C2MH 4DR5L 1N36L 1G6PA 2D5DA 3NENA 3OSSD 2F0QA 2HDLA 3PIO3 1IKLA 1PXUA 4JG2A 2KCTA 4LAAA 5LMNQ 3FKIH 4QUFA 3C2PA 4JVZA 3I4NH 1CUKA 3I7FA 2O4XA 4AYBE 1Y1VG 3STBD 2VQEL 1VQDA 3S17H 1G51A 1HZAA 2F3IA 1Q12A 4HIMA 1PH7A 2EY5A 4DV6L 2DNCA 3NCVA 2FFKB 2IX1A 2MQHA 1X6OA 3RMHA 3EQLC 4AYBB 1IW7D 2L9HA 2KHJA 1Q7YC 5JEAH 2JXMB 2FXQA 2K33A 4R9WA 4ZK9B 4HAEA 1DOLA 1WCMG 4PG3A 1WOCA 1JWUD 3BYTB 1HNWH 2AUJD 4C3HH 3IFDA 4RCOA 1X32A 1XNRH 1EOVA 5C4JH 4FXGC 3GTGH 2DY8A 4RGOS 3AQQA 2R93B 1J4WA 3W1GA 2R92B 4B3SQ 1BNZA 3KLSA 2F4VL 3PSIA 2MGSA 3URYA 3CCQA 1A3UA 3HOVB 1VQEA 5AJ3Q 2LTMA 3NXWA 3HOWB 4B3SL 1FGUA 2BCOA 3RF2A 1AEXA 3BU2A 3CHBD 2Z4IA 2BL5A 4CJ2C 3HKSA 4B3ML 1NBWA 2R3ZA 5M3FG 1EYGA 1WD0A 1HUNA 3SGIA 4DV5L 3KF6A 2VKCA 3L9AX 1U5KA 3KYHC 4CKCA 1EZ8A 3HOYB 4X3SA 1C7YA 4X6AH 3CC7A 3CXCA 4IUNA 4JYAL 1ZYRD 2NTSA 1VQFA 4HIKA 1S5CD 4JI2H 1N32H 1BUVT 1ZXTA 2CKZB 3HOVG 1SNDA 1E3PA 2TSSA 5T1IA 4DUYQ 1S5BD 4ALPA 4HSVA 1YJ9A 1X9ZA 3TP6A 2A6HD 2JA6H 4HJ5A 3J80W 2JK8A 1KL9A 1LM0A 4A3IH 2NWGA 3GTLB 4DUYL 3AB9A 3GTKH 2MP1A 4KHPQ 1B70B 2K1BA 2JP1A 2YV5A 5F2DA 1HNZH 1NTGA 4I7ZC 4EQNA 3T1HH 3FEWX 1E2VA 1VQ5A 2CTJA 1E22A 2VY3A 4DXGA 1SAPA 4DV0L 5CV9A 5M5XH 2XSCA 4DV7H 1K8GA 4K8JA 4RKBA 4JI2Q 2F52A 1PZKD 5C5LA 1R4QB 4O42A 3OETA 4DV1Q 3RZDH 1Y1WH 2Z6KC 2L55A 5M3FH 4BBSG 2EYMA 4RFBA 4ZLTF 1YIJA 5BR8L 4FYDA 1J8IA 5DEHA 1VQGA 4JI2L 4YHHQ 5C4XH 1G91A 2CPMA 1II3A 1SNOA 3I0PA 1YVCA 3A5UA 4UHVA 1R9TH 3NP8A 1X0AA 5EGTA 5ELFA 1TQOA 1IBMQ 1LTLA 1CHQD 4JI4Q 2Z8LA 3B6YA 1ESRA 1SYEA 3VKEA 1CA5A 2NZOA 1L1OA 1FD7D 3S17B 4KMUC 2A69C 4KY7A 3F2DA 3P75A 3GV3A 4CJ1B 2I5HA 4JI4L 4OX9H 2Z1CA 1X4MA 3PIOA 1K0SA 3CQZB 4NXNQ 3J80E 1SMYD 2Q2IA 3HOXH 4BXXG 4DV2H 4J6HA 3M3YB 3A74A 1XPUA 4DR5H 2DJGC 3I4OA 2XNAC 4KN7C 3CPFA 3TDQA 3ONAB 2JJQA 3RLOA 5G3LF 5BN5A 1IYVA 2JA6G 2O5JC 1N34Q 4AH6A 1XMQH 2QA4A 3HOXG 3D0FA 1XMOQ 4LNQA 4A3LH 4UP8A 4MZ9A 5DAUA 2JA7G 1G2SA 5KNDA 2K03A 5E3FA 2K6AA 1K8MA 1RTNA 3S15B 1AH9A 4L8JA 3OTOQ 2XWJB 1HA6A 1I4RA 5D3IB 3S15H 4DR7H 1ESFA 1GUTA 4KK7A 4JI5L 3S1QB 1CI3M 4BBRH 2NZHA 2RHQB 4LF4Q 4GOPC 2OT2A 4DV1H 1M1KC 5ELDA 4QGUA 3S2DB 2FFMA 1IHZA 4DR3Q 2F0FA 4KKSA 1O7LA 2OTJA 3MXUA 4DR7Q 4RAUC 1W2BA 4LF4L 3M4YA 1YZ6A 1S3OA 5C3WA 4AYBG 3SK6A 2EE1A 1SYFA 5KYLA 1HTPA 4CJ0B 3IAYA 1TKWB 3MFYA 2ANRA 1EC6A 3EJIA 3TRZA 3GTKB 2ES2A 4OO1G 3KJOA 2R7ZH 2L12A 1STGA 3N52A 5EQ0A 4K2LA 2YTYA 4C3HG 4A3EB 3A7LA 3CC4A 2VW9A 1EYCA 3MA2B 2OPUA 3K0YA 4K5VA 5JVG3 4L5SA 4GKJQ 2MNAA 4TRDA 4A3LG 3OIQA 2DGYA 4BBRG 3A5ZB 5FLMG 2KVMA 1PYSB 4TQUS 3PUXA 1BVSA 3I4LA 1EIYB 3J7YW 3OSOA 1MSHA 5HY6A 1AP0A 5M3FB 5EJWA 1LTTD 1J5EH 3UE0A 5I2YA 4DR4Q 3DM3A 3CW2C 4DV3Q 1JB7A 3AEVB 4QF4A 4GOPB 1PFNA 3I55A 4KV6A 5A35A 4R4QA 5JPMC 3L3OC 4DKAC 3E5SA 4DAMA 1GXDC 5FJ8H 3QR8A 2SDFA 2PI2A 2R92G 3DMUA 2SNMA 4A3MH 1V1QA 1VF7A 3E6ZX 4KLKA 4LUOA 2ICIA 4C3JH 2XRSD 1EEID 2K5HA 3S2DH 1FNVA 1PRTD 2L5TA 2F0UA 2E2HH 2A6HC 4OWXB 1RODA 4P73A 4Y52H 3GTJB 4LFBH 2XN9C 1WD1A 1SROA 4R1JA 4C3HB 2CWFA 2UXCQ 1A62A 1EU3A 4JI3H 4A4IA 1F2YA 1LO5D 4QMGA 1SBBB 4OHJA 2JA5G 2F0MA 1Y69U 3QIAA 1L1OB 1JWMD 1DXMA 5ISRA 4JI0L 3K5NA 3E9IA 5IWAQ 2HH2A 4BA2I 4LWCA 2HHHH 1PYBA 2UXCL 4LFBQ 4OGQC 1HR0W 2WAQB 3HGBA 2VUMG 1QNKA 1AFPA 2F0TA 2QF7A 3PO3G 1X3QA 1FKAH 3S2HH 5IWAL 5CV7A 2PZUA 3AFPA 2H4OA 1CZWA 3CKIB 2VB3X 3LWEA 1HA5A 5GAGC 4ZYSA 3FMCA 1HTLD 3GR5A 2PY9A 5LMUL 1BOSA 1YHBA 1PFMA 2GVBA 3I70A 1Y1VB 4XT3B 3OW2A 1GUWA 1VIGA 3X3MA 3SR1A 4MN3A 5FOBB 2F0GA 2D9IA 2HH3A 1LTRD 3A55A 3FDTA 1EQQA 2K04A 1DONA 3I4MG 1JCKB 1Y8PB 4DV6Q 4G7ZC 4PZ8A 4IPDA 3IL8A 1EY8A 1YHQA 4LF9L 4FF1A 2CH4A 4A3DB 2Y0SG 4EVOA 3ULLA 3T51B 3S1MB 3D3RA 1ILPA 3S1MH 4K6DA 2A68C 2AHOB 1HZ9A 1BBXC 1B4OA 2K75A 5E4WC 2BA0A 5C44H 1H9RA 2CHBD 1TWAH 4AM3A 4KJNA 4O1NA 1ZKOA 1ASYA 3CRKC 5LMUH 1EWCA 4JBMA 3GD7A 2VUMH 4IALA 3K5LA 2PI2E 5KYIA 1KXLA 5AJ3L 2F0WA 4NP5A 1C4QA 2EQSA 1Y8NB 4YCUA 3F1ZA 1SE4A 5C3EH 3HS0C 4YIJA 2HHHQ 2JQOA 3R2IA 4B3MQ 1DD2A 2EDGA 3P7JA 3SVMA 5BR8H 2EZVA 3G6JB 2B2WC 1VMPA 3NE5B 2ZM6L 4NXML 4DR6L 5FK9C 1EUJA 2ENBA 2TMPA 2O2LD 1YJWA 2XGTA 5M5XB 4H0LC 1JJGA 2EYHA 3J81i 3CCEA 1CSPA 1SYCA 3EVQA 1KD1C 1H95A 2FHTA 2YYZA 2ZM6Q 4DR1Q 3ITPA 4NXMQ 2L1BA 1SFOB 2NVYB 2KCCA 1F9RA 3I4NG 5CV6A 3H3VI 1GHJA 1E2ZA 3MXNA 2CFMA 2J4XA 5C0XJ 1SE8A 4XQQA 1N33L 3KLWA 2PPBC 2L4NA 3C3LA 3SHLA 2VNUD 1A8VA 3VDYA 1S4ZA 2HD3A 1QVCA 5I4DA 2CWPA 4JW0A 2QNDA 1VQKA 3BJUA 1N33Q 4OIKA 1E7ZA 3FKIG 1QNUA 4BXXH 1A0IA 4CDCC 5BN4A 3Q24A 5KRUA 3HOVH 1JT8A 1CQFA 3NTKA 4A93G 2CW0D 5NUCA 2DGRA 3NBHB 1NMGA 3TP7A 3EN2A 1SYDA 3J7AF 2E2HB 1TR5A 4HN7A 2V4DA 4LF6Q 1D7QA 4X62H 4LF8Q 3H0GB 2A5HA 2WB1G 3EROA 4C3IG 4YHHL 1XTDA 1C0AA 4TVAB 3KUPA 4LUVA 3SXHA 1KAWA 1PQXA 1EY4A 4Q0FA 5IP7G 2UU9L 5C4XG 3FHWA 4B3RL 4RKLA 4BA1I 4LIJA 4IFDI 2E2IB 4NZTM 1NCVA 3BVMA 5L37A 3PCOB 3AYHB 4K0KQ 2GN5A 2VZAA 3M85A 3J81c 3NQIA 5LL6S 1Y1WG 2CCZA 1PZID 4H44C 2Z4HA 3NELA 4JBKA 1DGSA 3U58A 2BE5D 2PW7A 4DV4H 1NSNS 1MHWC 1N9WA 3IFTA 1QUQB 3J80c 4A3KG 4BY1G 1QVFA 1EIGA 4DR2H 1PH2A 2IPKD 5IGFA 2XVSA 1PHJA 1BBWA 2VQFQ 1EIFA 1WTJA 4IPGA 1PH3A 4IPCA 4P71A 4LUZA 4QL5A 3T1HQ 4LK1C 4HJAA 4JI5H 2OF1A 4RHRA 3GTGB 2VS1A 4FJSA 5C4JB 5FLXE 3AEVA 1XPRA 1LT5D 1CTMA 3RLNA 3I90A 2XTIA 3GTMH 1D6EC 4DK3C 4F8MA 1VQ4A 2EYPA 3GDEA 3OTOL 3T13A 1O80A 4HCSA 3T1HL 3VR2A 3J81L 3J7AV 2E2JB 3QWNA 1SXTA 3R93A 2F0PA 5JJKA 1LLRD 4JI5Q 1IBKL 2FMCA 4PZ7A 2IHEA 1WVLA 3MTSA 3CCLA 2LY7A 1PTOD 2WKDA 2Q2TA 4U68A 4A3KH 4R4TA 1HNXL 1KDBA 4NB3A 1M90C 1VCIA 1NAPA 3KBXA 3KBGA 2DJFC 2HDMA 2HUGA 1ZZKA 2CQOA 4LFCL 1F77A 2E74C 3TS0A 3VYUA 2QW7A 3VA7A 1NE3A 3QO2A 2LS01 2F0IA 2UXBL 3CCRA 4V0BA 4RA8A 1UE6A 1JORA 4K6LA 2HQEA 2MHVA 4DV3H 3ERSX 1DJRD 1XNQQ 4M8AA 4A3BB 1QB5D 2RDGA 3GKUA 4FDBA 4AQYQ 3R2TA 4PMBA 3TQYA 5D3DA 1Z47A 4DGZA 5E7NA 2LRRA 3S1RB 1O7IA 1WTHA 4MIUA 4MTNA 2J0TD 1PDQA 5IYBH 1X3GA 4DK0A 3M7GA 4FP5D 3JC66 1JC7A 1V8QA 5D14A 3EA6A 2KQ3A 1YBYA 1SJHD 1HFNA 1SYBA 2RVLA 2EYFA 4M1UB 1H9SA 3CU7A 2B2YC 1FNUA 2OTLA 4H8AA 3H3VH 4L5RC 1UUPA 4DUYH 5IP9G 1GOZA 2CTKA 3S9WA 1B7YB 1NY4A 3HOZG 2YQRA 1HNZL 5C0XI 1WCMB 4S3SA 2PCFB 1AZQA 1EY0A 1PTOC 2AWNA 2UXDL 2K50A 1SYGA 4DAYA 2UUBQ 1PH4A 4CKEA 3CC2A 1KTKA 4J15A 4GKKQ 2N55A 3E0EA 2CWHA 2K4KA 1QVGA 2UU9H 3I3CA 1IYUA 1KQSA 3FPPA 3MEHA 5IOCA 2EXDA 4PMCA 4FJUA 4A76A 5C5MA 3DLLA 4A3CG 3S14B 4B3MH 1QOHA 2PT7G 1OXSC 2UUCQ 1IL2A 5JJLA 3A8JE 3D6WA 3MXPA 2NN6H 1VQAA 2A1SA 2WB1E 3RNUA 3JAMi 2DY7A 3T16A 3FKIB 3G6EA 2ATWA 4DR5Q 1B9NA 1I4HA 1XJVA 3HEJA 4ODGA 4QUCA 3VYRA 2IX0A 2EPBA 4YWKA 1TWGB 4OXPA 1HNXH 1STYA 2NVXH 3S1NB 4Q5VA 3UDXA 1HUMA 3PO2G 1J5KA 4B3TH 1PMRA 4IO9A 4NXNH 3CMAA 1BKBA 1WYDA 1FJGH 1HNWQ 1RD9D 4JI7H 1KRTA 1EQVA 2R93H 4X3KA 2OCEA 3HOYH 4EX5A 3K5MA 1FGBD 4JI3Q 4KI0A 3PUYA 1BXTA 4LF9Q 2LF0A 5IYCH 4R4OA 3S1NH 4PDBA 3MC0B 5FKAC 3LNNA 1D1IA 1PH5A 4C1NK 4DR3H 1I6HB 5C6AA 1ENCA 1BCPB 1X3FA 2F4VQ 4DR6H 4HJ9A 4WALA 2PQAA 5IGCA 4DNRB 2B29A 1U9RA 3VR6A 2WKCA 4PMWA 1QWYA 2NVQB 2NB0A 2NYZD 1WVNA 1STEA 1VQOA 5A2QE 5LL6X 4DV4L 3T1YH 3F2UA 2PYKA 3TP5A 2N49A 4B08A 4DV5H 1EY7A 2MPMA 2Y0SB 3M4PA 3PUZA 2SEBD 4HEDA 2Z0SA 1NR4A 5GQOA 3H91A 3CQZH 5DT9A 2A8VA 2HQLA 1EL0A 4H02A 1D1KA 1LYLA 2I5LX 2QKIC 4KY6A 4ZKBB 5CMDA 2HHHL 1SNMA 4JYAQ 4IFDH 4DF7A 2FPHX 4BBSB 2UUAQ 2F0KA 1UAPA 3T53B 2K5WA 2K5QA 4X66H 4KN4C 3TBIB 3V05A 2F0OA 1M4VA 2UUAL 1I94H 2B63G 2ZJPA 2A68D 3D4WA 4B8CD 4LW1A 3CCSA 2VQEQ 3I8ZA 4X65L 3MWYW 1R4PB 1VMCA 1Y8OB 1NXUA 2JEBI 2VQFH 1MJEA 2QEJC 4L6TB 3QB3A 2KEDA 2ZJQA 1W6KA 3SK5A 5IGDA 3BVGA 4X65Q 1L0XB 1SE2A 4G57A 4A3MB 4ZUJA 1WTXA 1K73C 1GHKA 3S1RH 4KTAA 1LT3D 3C1EA 2CW0C 1C9OA 2IHFA 3GV6A 4A3GB 1DZ1A 3E9HA 4X65H 1MI2A 1O7ZA 4YWMA 1D5MC 1QJOA 3HOZB 5BR8Q 4R8IA 4DV7Q 4DAPA 4IUTA 2KECA 5M9OA 1SLJA 2E5LQ 4CHTB 1I94L 1ENAA 3HOYG 1TUAA 2F0VA 2JA5B 2O4CA 5DM73 1SNQA 4LF6L 2PQAB 5GAEC 3M4QA 3L7ZC 1S20A 1SR3A 1CKOA 3U4VA 1STBA 2HIXA 1IBML 2ICEC 3A8KE 5LL6b 2JA7B 4WORA 4RGTA 2LSSA 4PV1C 4KHPH 1HR0H 4ZUIA 1F9SA 2F3WA 2N8NA 2ZTEA 2FMMA 5EBDA 1G6ZA 4I65A 1MJCA 3KF8A 1B9MA 1F2MA 3CRLC 3PGZA 4DK6C 1V43A 5LMNH 2F0JA 5CBEE 5T1GA 2UUAH 4RGMA 4HJ8A 2K05A 2UXCH 4NXNL 5CV8A 5C0XG 3J81E 1Q8IA 1I5FA 1LT4D 1K8OA 2QCPX 1Z2IA 1W3SA 1ET9A 1FL0A 4WJ4A 4K2KA 2ZJRA 2G9DA 5DM63 2VB2X 1H9MA 4IFDJ 1RJTA 4IZ8A 2KHIA 1A15A 5CR3A 4XQNA 3I73A 1U4RA 4A93H 4CBVA 1D5ZC 1AN8A 1TS4A 1CT1D 1XMOL 2QDBA 4U673 1VDZA 2A1AA 3RLFA 2X06A 4TSSA 1SEIA 4BBRB 3CCVA 4N9PA 3ZJYC 3VYSA 2UXDH 2HIVA 4IUPA 4LF4H 5LHY1 1MD2D 2K7VA 3BZCA 3T4AC 1S40A 1FYCA 1XMQL 4C2MB 1D8LA 4DV1L 1S5ED 2WFWA 3OTOH 1KHIA 5IGBA 4IQZA 5IIFA 3I4MH 1TS2A 4A3DH 3NHHA 2VUMB 3V2TA 4DR3L 2M2LA 4ZCKA 2D0PA 2JA8G 1K9MC 2OPVA 1Q3LA 1RL2A 3K80C 4DR7L 2Z6KA 3H6MA 1X55A 4IUUA 1VQ8A 5HGQA 2G5DA 1IKMA 4N8X1 4KD4A 4IOAA 4JBWA 2CTFA 1N32L 3GTQH 4P75A 5LMNW 1S72A 4DNIA 3LWUA 1JOQA 1JE4A 1FJGL 2D0OA 1XTCD 2E2DC 4BWGB 4BY1H 5J3BA 1JOKA 2ANNA 5CV5A 3TZDA 4ULLA 4LFCQ 3VR3A 5COYA 3H0GH 2RDHA 2LTLA 4L63B 3M4OB 3OYYA 3GABA 3OIPA 1RHPA 3NTIA 4A3JG 3RZDB 4K14A 1E2WA 4QMFB 4XYQA 1VQNA 1DM0B 2E5LH 3EFXD 3RUZA 3ULPA 1B53A 1VQ6A 3HOWG 3HOXB 1IZ6A 1ODHA 4QIWB 3SK8A 5C4XB 3V69A 1C8CA 1EWIA 2AKWB 1EY9A 3OWEB 4P2CB 1VQBA 3J80L 1I4QA 2G9HD 2K14A 3FP9A 4C1NI 1V8CA 3T1YL 3K5OA 4GKKH 1ET6A 3QOJA 1Y1WB 3MEFA 1CZGA 2P2RA 4UDUC 4NBQA 3EZJA 3UE1A 1S5FD
chains in the Genus database with same CATH topology
4KKUA 1A63A 2H1EA 1A2UA 4JI1L 1J5EQ 2JA7H 2KA7A 1TU2B 3N6RA 1XYIA 1U4MA 3GQBA 1HNZQ 5CGKA 2A69D 5CV4A 3Q23A 3U4ZA 4DV2Q 5HURA 1J5EL 1J9OA 4UY8C 1HZCA 4POFA 4GKKL 3PV0A 2B2VC 5IE8A 1K0RA 3GTOH 4BS9A 5IGEA 3D4DA 4DAVA 2NUCA 1OXTA 1EEFD 4K5XA 3F2BA 2JYOA 4A3GG 2NZ1D 3VA5A 1EY5A 3S14H 2PZTA 4HCEA 5BN3A 1LTID 4XDXA 1BF4A 2F0EA 2E3UA 3CCJA 2CTLA 3R8BA 1WJJA 2A19A 4A3BH 1BO0A 1X3PA 2UUCL 2D62A 2B2UA 3Q6SA 1B3AA 4BY7G 2GVAA 1DOMA 3EBEA 1PLFA 1Q86C 1QUQA 1H9JA 1TVXA 1B50A 3HOUH 2NVTB 4OO1I 5JJZA 1BR9A 2B2TC 3DWPA 2M00A 1PTOH 1I4PA 1E1OA 3O13A 4PNYA 2BE5C 3M9BA 3H15A 3GTPB 1LUZA 5JJIA 1VF5C 2F0DA 2R92H 1A3TA 2D9UA 1HNWL 1HXYD 1YJNA 5JEAJ 1CM9A 2HT1A 1Q1BA 1QZGA 3S24A 1TY2A 4IPHA 3SE0A 4APVA 2MJ8A 2CTEA 3OOCA 5C4ZA 1M8AA 1VQJA 1OTCA 1ZZJA 2I46A 4WJ3M 1TWCB 5EKLA 3K59A 3C46A 1XNRL 1CHPD 4XT1B 4NW2A 4GZYC 2PNRC 2H5XA 1Q81C 2X6GA 5EKIA 2K52A 1IXRA 1F9PA 4GN3B 4GNXA 1GD7A 1TWFH 1PRTB 4A3DG 4RHSA 2L11A 1LTGD 4HIDA 1I50H 3TP8A 1VIHA 4JI0Q 1XXGA 2RQXA 1V9PA 3Q22A 3JAMc 1Z7TA 3U9OA 2RBMA 5ELCA 2DUDA 1DOKA 5KEEA 2B2YA 1EY6A 5DLQE 1SE3A 5I2XA 1KRSA 1VQ7A 5FLMH 4DR6Q 1UE7A 1N36Q 1PFSA 1NMFA 1A2TA 2JA9A 5M3MG 1L1OC 3W2DA 2AWOA 3F8TA 5LMNL 5FLXc 3PF5A 1PA6A 2OQKA 4DR1L 2OWOA 1EOTA 1HJPA 1LT6D 2A6ED 4OO1H 1YNND 3RD4A 2LXJA 1PTOB 4N9TA 1U4LA 3TZUA 2LFNA 1KNEA 4BY7B 2BH8A 5M5YB 4A3JH 1IBLL 1EIHA 4NKLA 5G3LD 2JA5H 1G8ZD 2A6EC 4JOIA 3ERQA 3GTLH 2CWAA 1B1ZA 1YI2A 2EY6A 2LXKA 2GA4B 4C3JB 2O5IC 5IYDH 4HR7B 1IBLQ 3BYYB 1WCMH 1TT2A 3K7AB 2RCNA 2ZTDA 1HZBA 2PO4A 1STAA 3PIP3 5JEAG 4A3GH 1TWHH 4XXEA 4X3UA 1RF2D 4PZ6A 2MFIA 1MGSA 1O78A 1KNAA 2AQ1B 4R4CA 5EPJA 4GN5A 1OXXK 4LF8L 1EYAA 2R7ZB 4HTHA 5ELEA 4YCWA 4DV5Q 2E2IH 4A75A 1YHAA 3CD6A 1Q1EA 1UNSA 3CAMA 4GNXB 2BOSA 2UU9Q 1NJIC 4B3RQ 3F2CA 1GUSA 1VQLA 3DUZA 3FVQA 2N88A 3A7AB 1GUGA 3M7NA 2NTTA 1JOOA 5JOBA 4HJ7A 3STBC 2AXYA 4C56C 5I9PA 3MHBA 4O2DA 5A2QL 1YEZA 1P16A 1DTJA 3WDNA 3J7A5 1H9SB 3UDGA 5IYDG 1W6JA 1I6HH 2I07B 2A73B 4G4KA 2B63H 1QILA 4KHPL 5I6WA 1BCPC 5EBCA 4ZQ3A 1ILQA 4Y7NH 2OXPA 3PUWA 4C3IB 4X62Q 2VQFL 3HKZB 3J7ZC 4WFN3 1BQQT 2NVQH 2EYOA 1KIXA 1CKMA 2HCCA 4OWTB 4ZAIA 4JI8L 3GP7A 1ML0D 4X62L 3NSWA 1ONLA 1SEBD 4KHVA 5CORA 2B8FA 3SK4A 4IOCA 2F0NA 3I4MB 5FO7B 4C3JG 2ASBA 1WTWA 1GJXA 1HR0Q 1DCZA 4QIWE 4BY7H 1V1PA 4JI8Q 1UEAB 3KDFA 3R3OA 4DAYB 3HRZC 3TMEA 3HKZG 1Q90A 4A3IG 4LFAQ 1PV4A 3DM1A 2FJ2A 4KKTA 1N8RC 3J80i 1S5DD 1EU4A 5GROA 3V96A 3K57A 1I3QH 1STHA 3TN2A 2B2WA 3D6CA 1IW7C 1Q82C 1I3QB 3H09A 1Q46A 2X69A 2KBNA 2RA4A 1F2LA 4EQOA 1D5XC 1JQYD 2PQUA 1OXUA 3MZ5A 1D2BA 3CP0A 3M3YH 4BY1B 3DHQA 1Y14B 3D4RA 1FJGQ 4JI6L 1IYJB 1PTOF 3GTMB 4GKJL 2Y0SE 3K7UC 2E76C 5J39A 3W1BA 3S16B 3KOJA 4K5WA 3JAME 2E8GA 1XNQL 1SJED 4GNXC 4YWLA 1TWFB 4JI6Q 3PMFA 3VR4A 2N3SA 4LF5L 3BDLA 4RMFA 1E24A 2IY5B 2B2TA 5K36G 2K5NA 4IJHA 1AW7A 3PF4A 4V190 1X3EA 1K8AC 3H3VC 4B3TQ 1R9TB 3UDIA 3WOEA 4LF5Q 4XTCS 5EKKA 3I56A 4FF2A 3BZDB 1AZPA 1PH8A 4B3TL 2ZXOA 1BDOA 5H1SE 1KDCA 3GTOB 4QY7A 3T1YQ 4XIGS 4FNFA 2IL8A 2L0CA 4YY3L 3TREA 4A93B 2E75C 2RKSA 2KCMA 3GTPH 3QJYA 4Y7NB 4OWWB 4A3MG 4YY3Q 2SOBA 4A3BG 3J81j 1VQCA 3H0GG 1Z6HA 1WE8A 1HFGA 2XWBB 1VQMA 5KIXA 5GADC 1XWEA 2RSNA 4UAIA 1ENFA 4UP7A 2WINB 1Q8KA 1EWHA 3OWFA 1YNNC 2JE6I 4KJOA 2FMRA 4DV2L 3S2HB 1QG7A 1LABA 4QQBX 3CCMA 3PUVA 3KLSX 2CPQA 1NUCA 1I4GA 3G48A 2BA1A 1F2ZA 4FXDA 1XX8A 4OX9L 3NWSA 2KUMA 4JVYA 5IP9H 4OONA 4RH6A 4IURA 3OMGA 3KLRA 3P1HA 5EAYA 4XYOA 2EVBA 1LACA 2JA8H 1AE2A 2SNSA 1L2FA 3U9SA 1PH6A 3G71A 5LMUQ 2AQ3B 4OX9Q 2WACA 2EJMA 1WTVA 4R8NA 3K6OA 2FINB 5D65A 2KJXA 2C35B 3PO3B 2EXZA 1V1PB 1BCPF 5IYBG 2I5MX 2OQ0A 1VQHA 2K5VA 1HH2P 3NEMA 1PYWD 2WAQG 2DNEA 2CVRA 1E0BA 2JA6B 4DR4L 3DEPA 2CQAA 1KC8C 1EYDA 4DV3L 2A74C 2RSOA 3RZOB 1LTAD 2WIIB 2QGQA 3I91A 2EY2A 1UWVA 2ALYB 1XPOA 2ZT9C 1SSOA 3K81C 1OO9B 2YTXA 1KDAA 1TWAB 1WI5A 5AFWA 2VL6A 1ZEQX 1PZJD 3NWTA 4FF3A 4BBSH 3SDZA 4DU9A 4A3JB 5M5YH 3BDOA 1QZHA 4HIOA 1JR0D 5C3EB 2ZXPA 2AMCB 2F0LA 2MO1A 3ULJA 3U1KA 3A54A 2PMZE 4DNTB 4B8TA 3BS1A 5IGGA 4E6IA 2UXDQ 2UUBL 5FO9B 3AU7A 3WWVA 4Z9CB 3NUCA 3I2ZA 4DUZL 4KHZA 1I50B 4R4IA 4WRDA 3K7AH 4JBJA 3MXGA 1XNRQ 4A3EH 1PVOA 5I9OA 1O7YA 3PO2B 2BDOA 2BH2A 2F0SA 1CKNA 3CCUA 4JOIC 1WFQA 1I6VC 5GAHC 1Y1VH 3AMUA 2F3VA 4NMZA 4WJWA 2K32A 5IY0A 4JI7Q 1H9KA 4F87A 4ID6A 3HG9A 3A0JA 1SDFA 5CC4A 1A6XA 3LX0A 3ER0A 3CF5A 4OL7A 4QB4A 2NN6I 2F1MA 2OEOA 3GTQB 1X54A 3UDFA 1J6QA 4JI7L 1PH1A 3L0OA 3PO2H 1ICWA 1SMYC 5E4XA 1UE5A 5JAVA 1TWCH 4P74A 4IJLA 3S1QH 1OXVA 1EFWA 3OMCA 4K8IA 1RTOA 1YNJC 1V1OA 1RDPD 2BDNA 4B9WA 2Q2UA 2KEEA 4GLXA 1KABA 3BDCA 1TWGH 1I4XA 1P8LA 4A3FH 4O0AA 4RWSC 2NVTH 3HOUG 4ME3A 1DT4A 1B8AA 4GLAC 1ZYRC 2PNHA 2F0HA 5JVH3 2KENA 3QOLA 5C0XH 1A3VA 4KD3A 5M3MB 3K58A 3BG3A 1KLUD 2B2UC 2D2CC 4DPGA 2C5CA 3KJPA 4GOPA 3H94A 1HRJA 1JMCA 4NPSA 1C48A 2EY1A 2RF4A 3NPPA 1K83B 1WTOA 4QCLA 2IX3A 5KGUA 1PFBA 4G7HC 2E5LL 2KHSA 2C9OA 2EYJA 4DFAA 3K0XA 4DK1A 4X64L 3MAQA 4CGYB 2AQ2B 5M5WB 2I0QA 1MSGA 3FRPB 2YU9H 3HOZH 4GN4B 2LMCB 1HHVA 4H13C 2Q8TA 4L5QA 1VQIA 1X4NA 4X64Q 2MO0A 4K0KL 1K83H 2NVYH 1U0LA 3SEBA 2MJHA 4JC0A 3QG1A 4FVMA 3TSSA 3W5OA 3G4SA 1T5EA 4DR2Q 1TS3A 4H7BA 2RDFA 3RN2A 5CBAE 1SNCA 3HOUB 1T5XD 5IT9L 1Z9FA 4A3EG 1LTBD 2YU9B 2EYLA 3KF8B 2J7ZA 1FNWA 1CFMA 1YNJD 1ASZA 1X56A 5ELNA 4DR2L 4ZRZA 3G7LA 4P72A 5IT9c 5K5PA 1JJCB 2IWHA 3NQTA 1MKHA 5J1ZA 3GO5A 2R7FA 4J1MA 1TXYA 4UPAA 5ELBA 1PH9A 3Q0AA 3JAML 4PQXA 4DV0Q 4DN4M 2IJ0A 3HOWH 1GM5A 3TEHB 2NN6G 3K8AA 4RG1A 4LMQD 2ZTCA 3MVVA 3NBHA 1QE6A 3IKJA 5KNCA 2YTVA 4EQPA 5M5WH 5CYUA 1CA6A 4X66L 3I4NB 4A3IB 1IBKQ 1QCBD 3NTHA 1CK1A 2CTMA 1EQRA 4X66Q 1SFOH 1HR0L 2K01A 5ELOA 2JZXA 2XIWA 4DV7L 1WTPA 3FPUB 2WAQE 4GS3A 1TY0A 1I94Q 4LFAL 5K36H 4HSPA 2ID0A 1STNA 5E1FA 4F7XA 1JB3A 1TIID 2HCIA 4DXFA 2LKVA 4LJZC 3MFGA 3OHXC 5IT9E 2UXBQ 2R6GA 1K1GA 1KHMA 3MXNB 1L0WA 4X3TA 4IUVA 4JCVE 4DA2A 3EIVA 1SRUA 3KFUA 3VYTA 3DWAA 4ILWA 3L2PA 1HQMC 1NR2A 4AQYL 3TS2A 3GTJH 2IT1A 5IYCG 1SN8A 1WTRA 5EPLA 1N34L 1BBUA 4YCVA 4HMIA 1G291 2RHSB 2JVZA 3DXJC 3E0JA 2R93G 3S16H 3HZXA 3W3AA 4ABNA 1K3RA 3RZOH 1F9QA 1HPCA 1B2TA 1LTSD 4MNOA 2JEAI 3UI2A 2XRQD 4FXKC 4HMJA 4IN3A 5FO8B 2QEXA 4MHEA 1U4PA 1T9HA 2K5DA 5J22A 1B44D 3PO3H 3RN5A 5IP7H 3X3NA 1PRTF 3DWQA 1UEBA 2R7DA 4JI1Q 1XMQQ 3C1FA 2WB1B 3U50C 1IL8A 4ME5A 4C3IH 3ZYYX 4IFDG 2JA8B 3A56A 1VS0A 4RCNA 4EGVA 4ZKCB 1ZTGA 1G2TA 4L5TA 1HNXQ 1RKNA 4WANA 1SMXA 1TS5A 2JSOA 1X65A 2B3GA 3BVZA 2EJFC 2WP8J 2X6LA 2PW5A 1N32Q 4FO2A 5C44G 1KLGD 3A8IE 3VR5A 4CKBA 1RCVD 2IW3A 1MBYA 5DNFA 4JVHA 1KAAA 4QJFA 1CKNB 3ND8A 5FJ8G 4GLVB 3D31A 2PMZB 5IODA 4TKOB 4JV5L 3BZKA 1EZ6A 1GUNA 1EFID 5FLXL 2WV6D 2PZWA 2M9VA 1GUOA 2K28A 4JK1C 2B63B 1CQVA 3AFQA 3ICEA 3CMEA 5EPKA 1AE3A 3LGJA 1FR3A 2R61A 3NK9A 3Q8DA 4JV5Q 3PIPA 1HCZA 1VQPA 4IUQA 4J8QA 1UE1A 2PQEA 3T56B 3IRBA 1JICA 1FVIA 1JE5A 3KK7A 1LV9A 3NBIA 5C4HA 3OW7A 4A3FB 1GKHA 3D8GA 2B2VA 4UP9A 3HFZB 1JWSD 4JI3L 5JPNC 4XQJA 2EOTA 3HP3A 1PRTC 4KY5A 2L15A 1BCPD 1GVPA 1X9NA 3WOFA 1E1TA 2B8GA 4POGA 2KOLA 1HQRD 4A3KB 1DYQA 1CSQA 2R7ZG 1YITA 2QILA 1WTQA 3HKZE 3ND9A 5C3EG 4LF7L 4FF4A 2DN8A 2EIFA 2V1CC 2KCNA 5TSSA 1VQ9A 2F4IA 3P20A 2Q8RE 1RIPA 1L0YB 2Q8IB 4LF7Q 3KF6B 1MIUA 4A3CH 1JJ2A 2NBFA 1GO3E 4DV4Q 1EQTA 1TWHB 3OPOA 4A3FG 3KDFB 4B9XA 2Q2HA 3RR5A 4LFBL 4DUZQ 1ZZIA 2EJGC 2N78A 4AIMA 3CPWA 4EQ5A 4RGNA 1YNXA 5M3MH 5KNBA 2B39A 4NDXA 5HGTA 3M4OH 3I72A 2F03A 1SNPA 4G7OC 5I6YA 5C44B 3DEOA 4F88A 2E2JH 2AUKA 5C3XA 2NVXB 2ZXRA 2MUYA 2VXWA 4OIJA 4C2MH 4DR5L 1N36L 1G6PA 2D5DA 3NENA 2F0QA 2HDLA 3PIO3 1IKLA 1PXUA 4JG2A 2KCTA 4LAAA 5LMNQ 3FKIH 4QUFA 3C2PA 3I4NH 1CUKA 3I7FA 2O4XA 4AYBE 1Y1VG 3STBD 2VQEL 1VQDA 3S17H 1G51A 1HZAA 2F3IA 1Q12A 4HIMA 1PH7A 2EY5A 4DV6L 2DNCA 2FFKB 2IX1A 2MQHA 1X6OA 3RMHA 3EQLC 4AYBB 1IW7D 2L9HA 2KHJA 1Q7YC 5JEAH 2JXMB 4ZK9B 2K33A 4R9WA 2FXQA 1DOLA 4HAEA 1WCMG 1WOCA 1JWUD 4PG3A 3BYTB 2AUJD 4C3HH 3IFDA 4RCOA 1X32A 1EOVA 5C4JH 4FXGC 3GTGH 2DY8A 4RGOS 3AQQA 2R93B 1J4WA 2R92B 3W1GA 4B3SQ 1BNZA 3KLSA 2F4VL 3PSIA 2MGSA 3URYA 3CCQA 1A3UA 3HOVB 1VQEA 5AJ3Q 3NXWA 3HOWB 4B3SL 1FGUA 2BCOA 1AEXA 3CHBD 3BU2A 2Z4IA 2BL5A 4CJ2C 3HKSA 4B3ML 1NBWA 2R3ZA 5M3FG 1EYGA 1WD0A 1HUNA 3SGIA 4DV5L 3KF6A 3L9AX 1U5KA 3KYHC 4CKCA 3HOYB 1EZ8A 4X3SA 1C7YA 4X6AH 3CC7A 3CXCA 4IUNA 4JYAL 1ZYRD 2NTSA 1VQFA 4HIKA 1S5CD 1BUVT 1ZXTA 2CKZB 3HOVG 1SNDA 2TSSA 5T1IA 1E3PA 4DUYQ 1S5BD 4ALPA 4HSVA 1YJ9A 3TP6A 2A6HD 2JA6H 4HJ5A 2JK8A 1KL9A 1LM0A 4A3IH 2NWGA 3GTLB 4DUYL 3AB9A 3GTKH 2MP1A 4KHPQ 1B70B 2K1BA 2JP1A 5F2DA 2YV5A 1NTGA 4I7ZC 4EQNA 3FEWX 1E2VA 1VQ5A 2CTJA 1E22A 2VY3A 4DXGA 1SAPA 4DV0L 5CV9A 5M5XH 2XSCA 1K8GA 4K8JA 4RKBA 4JI2Q 2F52A 1PZKD 5C5LA 1R4QB 4O42A 4DV1Q 3RZDH 1Y1WH 2Z6KC 2L55A 5M3FH 4BBSG 2EYMA 4RFBA 4ZLTF 4FYDA 5BR8L 1J8IA 1YIJA 5DEHA 1VQGA 4JI2L 4YHHQ 5C4XH 1G91A 1II3A 1SNOA 1YVCA 3A5UA 1R9TH 3NP8A 5EGTA 5ELFA 1TQOA 1IBMQ 1LTLA 1CHQD 4JI4Q 2Z8LA 3B6YA 1ESRA 1SYEA 3VKEA 1CA5A 2NZOA 1L1OA 1FD7D 3S17B 4KMUC 2A69C 4KY7A 3F2DA 3P75A 3GV3A 4CJ1B 2I5HA 4JI4L 2Z1CA 1X4MA 3PIOA 3CQZB 4NXNQ 3J80E 1SMYD 2Q2IA 3HOXH 4BXXG 4J6HA 3M3YB 3A74A 1XPUA 3I4OA 2XNAC 4KN7C 3CPFA 3TDQA 3ONAB 2JJQA 3RLOA 5G3LF 5BN5A 1IYVA 2JA6G 2O5JC 1N34Q 4AH6A 2QA4A 3HOXG 3D0FA 1XMOQ 4LNQA 4A3LH 4UP8A 4MZ9A 5DAUA 2JA7G 1G2SA 5KNDA 2K03A 5E3FA 2K6AA 1K8MA 1RTNA 3S15B 1AH9A 4L8JA 3OTOQ 2XWJB 1HA6A 1I4RA 5D3IB 3S15H 1ESFA 1GUTA 4KK7A 4JI5L 3S1QB 1CI3M 4BBRH 2NZHA 2RHQB 4LF4Q 4GOPC 2OT2A 1M1KC 5ELDA 3S2DB 4QGUA 1IHZA 4DR3Q 2F0FA 4KKSA 1O7LA 2OTJA 3MXUA 4DR7Q 4RAUC 1W2BA 4LF4L 3M4YA 1YZ6A 5C3WA 1S3OA 4AYBG 3SK6A 2EE1A 1SYFA 5KYLA 1HTPA 4CJ0B 3IAYA 1TKWB 3MFYA 2ANRA 1EC6A 3EJIA 3TRZA 3GTKB 2ES2A 4OO1G 3KJOA 2R7ZH 2L12A 1STGA 3N52A 5EQ0A 4K2LA 4C3HG 2YTYA 4A3EB 3A7LA 3CC4A 2VW9A 1EYCA 3MA2B 2OPUA 3K0YA 4K5VA 5JVG3 4L5SA 4GKJQ 2MNAA 4TRDA 4A3LG 3OIQA 2DGYA 4BBRG 3A5ZB 5FLMG 2KVMA 1PYSB 4TQUS 3PUXA 1BVSA 3I4LA 1EIYB 3J7YW 3OSOA 1MSHA 5HY6A 1AP0A 5M3FB 5EJWA 1LTTD 3UE0A 5I2YA 4DR4Q 3DM3A 3CW2C 4DV3Q 1JB7A 3AEVB 4QF4A 4GOPB 1PFNA 3I55A 4KV6A 5A35A 5JPMC 4R4QA 3L3OC 4DKAC 3E5SA 4DAMA 1GXDC 5FJ8H 2SDFA 2PI2A 2R92G 3DMUA 2SNMA 4A3MH 1V1QA 1VF7A 3E6ZX 4KLKA 4LUOA 2ICIA 4C3JH 2XRSD 1EEID 2K5HA 3S2DH 1FNVA 1PRTD 2L5TA 2F0UA 2E2HH 2A6HC 4OWXB 1RODA 4P73A 4Y52H 3GTJB 2XN9C 1WD1A 1SROA 4R1JA 4C3HB 2UXCQ 1A62A 1EU3A 4A4IA 1F2YA 1LO5D 4QMGA 1SBBB 4OHJA 2JA5G 2F0MA 1Y69U 3QIAA 1L1OB 1JWMD 1DXMA 5ISRA 4JI0L 3K5NA 3E9IA 5IWAQ 2HH2A 4BA2I 4LWCA 1PYBA 2UXCL 4LFBQ 4OGQC 1HR0W 2WAQB 3HGBA 2VUMG 1QNKA 1AFPA 2F0TA 2QF7A 3PO3G 1X3QA 3S2HH 5IWAL 5CV7A 2PZUA 3AFPA 2H4OA 1CZWA 3CKIB 2VB3X 3LWEA 1HA5A 5GAGC 4ZYSA 3FMCA 1HTLD 2PY9A 5LMUL 1BOSA 1YHBA 1PFMA 2GVBA 3I70A 1Y1VB 4XT3B 3OW2A 1GUWA 1VIGA 3X3MA 3SR1A 4MN3A 5FOBB 2F0GA 2HH3A 1LTRD 3A55A 3FDTA 1EQQA 2K04A 1DONA 3I4MG 1JCKB 1Y8PB 4DV6Q 4G7ZC 4PZ8A 4IPDA 3IL8A 1EY8A 1YHQA 4FF1A 4LF9L 4A3DB 2Y0SG 4EVOA 3ULLA 3T51B 3S1MB 3D3RA 1ILPA 3S1MH 4K6DA 2A68C 2AHOB 1HZ9A 1BBXC 1B4OA 2K75A 5E4WC 2BA0A 5C44H 1H9RA 2CHBD 1TWAH 4AM3A 4KJNA 4O1NA 1ZKOA 1ASYA 3CRKC 1EWCA 4JBMA 3GD7A 2VUMH 4IALA 3K5LA 2PI2E 5KYIA 1KXLA 5AJ3L 2F0WA 4NP5A 1C4QA 2EQSA 1Y8NB 4YCUA 3F1ZA 1SE4A 5C3EH 3HS0C 4YIJA 2HHHQ 1DD2A 3R2IA 2JQOA 4B3MQ 2EDGA 3P7JA 3SVMA 2EZVA 3G6JB 2B2WC 1VMPA 3NE5B 2ZM6L 4NXML 4DR6L 5FK9C 1EUJA 2ENBA 2TMPA 2O2LD 1YJWA 5M5XB 2XGTA 4H0LC 1JJGA 2EYHA 3J81i 3CCEA 1SYCA 1CSPA 3EVQA 1KD1C 1H95A 2FHTA 2YYZA 2ZM6Q 4DR1Q 3ITPA 4NXMQ 2L1BA 1SFOB 2NVYB 2KCCA 1F9RA 3I4NG 5CV6A 3H3VI 1GHJA 1E2ZA 3MXNA 2J4XA 2CFMA 5C0XJ 4XQQA 1SE8A 1N33L 3KLWA 2PPBC 2L4NA 3C3LA 3SHLA 2VNUD 1A8VA 3VDYA 1S4ZA 5I4DA 1QVCA 2CWPA 2QNDA 1VQKA 3BJUA 1N33Q 4OIKA 1E7ZA 3FKIG 1QNUA 4BXXH 5BN4A 1A0IA 3Q24A 5KRUA 3HOVH 1JT8A 1CQFA 3NTKA 4A93G 2CW0D 5NUCA 2DGRA 3NBHB 1NMGA 3TP7A 3EN2A 1SYDA 3J7AF 2E2HB 1TR5A 4HN7A 2V4DA 4LF6Q 1D7QA 4LF8Q 3H0GB 2A5HA 2WB1G 3EROA 4C3IG 4YHHL 1XTDA 1C0AA 4TVAB 3KUPA 3SXHA 4LUVA 1KAWA 1EY4A 4Q0FA 5IP7G 2UU9L 5C4XG 3FHWA 4B3RL 4RKLA 4BA1I 4LIJA 4IFDI 2E2IB 1NCVA 3BVMA 3PCOB 3AYHB 4K0KQ 2GN5A 2VZAA 3M85A 3J81c 3NQIA 5LL6S 1Y1WG 2CCZA 1PZID 4H44C 2Z4HA 3NELA 4JBKA 1DGSA 3U58A 2BE5D 2PW7A 1NSNS 1N9WA 3IFTA 1QUQB 3J80c 4A3KG 4BY1G 1QVFA 1EIGA 1PH2A 2IPKD 5IGFA 2XVSA 1PHJA 1BBWA 2VQFQ 1EIFA 4IPGA 1PH3A 4IPCA 4P71A 4LUZA 4QL5A 3T1HQ 4LK1C 4HJAA 2OF1A 4RHRA 3GTGB 2VS1A 5C4JB 5FLXE 3AEVA 1XPRA 1LT5D 1CTMA 3RLNA 3I90A 2XTIA 3GTMH 1D6EC 4DK3C 4F8MA 1VQ4A 2EYPA 3GDEA 3OTOL 3T13A 1O80A 4HCSA 3T1HL 3VR2A 3J81L 3J7AV 2E2JB 3QWNA 1SXTA 3R93A 2F0PA 5JJKA 1LLRD 4JI5Q 1IBKL 2FMCA 4PZ7A 2IHEA 1WVLA 3MTSA 3CCLA 2LY7A 1PTOD 2WKDA 2Q2TA 4U68A 4A3KH 4R4TA 1HNXL 1KDBA 4NB3A 1M90C 1VCIA 1NAPA 3KBXA 3KBGA 2HDMA 2HUGA 1ZZKA 2CQOA 4LFCL 1F77A 2E74C 3TS0A 3VYUA 3VA7A 1NE3A 3QO2A 2LS01 2F0IA 2UXBL 3CCRA 4V0BA 4RA8A 1UE6A 1JORA 4K6LA 2HQEA 2MHVA 3ERSX 1DJRD 1XNQQ 4M8AA 4A3BB 1QB5D 2RDGA 4FDBA 4AQYQ 3R2TA 4PMBA 3TQYA 5D3DA 1Z47A 4DGZA 5E7NA 3S1RB 1O7IA 4MIUA 4MTNA 2J0TD 1PDQA 5IYBH 1X3GA 4DK0A 3M7GA 4FP5D 3JC66 1JC7A 1V8QA 5D14A 3EA6A 2KQ3A 1YBYA 1SJHD 1HFNA 1SYBA 2RVLA 2EYFA 4M1UB 1H9SA 3CU7A 2B2YC 1FNUA 2OTLA 3H3VH 4L5RC 1UUPA 5IP9G 1GOZA 2CTKA 3S9WA 1B7YB 1NY4A 3HOZG 2YQRA 1HNZL 5C0XI 1WCMB 4S3SA 2PCFB 1AZQA 1EY0A 1PTOC 2AWNA 2UXDL 2K50A 1SYGA 4DAYA 2UUBQ 1PH4A 4CKEA 3CC2A 1KTKA 4J15A 4GKKQ 2N55A 3E0EA 2K4KA 1QVGA 3I3CA 1IYUA 1KQSA 3FPPA 3MEHA 5IOCA 4PMCA 2EXDA 4A76A 5C5MA 3DLLA 4A3CG 3S14B 1QOHA 1OXSC 2UUCQ 1IL2A 5JJLA 3A8JE 3D6WA 3MXPA 2NN6H 1VQAA 2WB1E 3RNUA 3JAMi 2DY7A 3T16A 3FKIB 3G6EA 2ATWA 4DR5Q 1B9NA 1I4HA 1XJVA 3HEJA 4ODGA 4QUCA 3VYRA 2IX0A 2EPBA 4YWKA 1TWGB 4OXPA 1STYA 2NVXH 3S1NB 4Q5VA 3UDXA 1HUMA 3PO2G 1J5KA 1PMRA 4IO9A 3CMAA 1BKBA 1WYDA 1HNWQ 1RD9D 1KRTA 1EQVA 2R93H 4X3KA 2OCEA 3HOYH 4EX5A 3K5MA 1FGBD 4JI3Q 4KI0A 3PUYA 1BXTA 4LF9Q 5IYCH 4R4OA 3S1NH 3MC0B 5FKAC 3LNNA 1D1IA 1PH5A 4C1NK 1I6HB 5C6AA 1ENCA 1BCPB 1X3FA 2F4VQ 4HJ9A 4WALA 2PQAA 5IGCA 4DNRB 2B29A 1U9RA 3VR6A 2WKCA 4PMWA 1QWYA 2NVQB 2NB0A 2NYZD 1WVNA 1STEA 1VQOA 5A2QE 5LL6X 4DV4L 3F2UA 2PYKA 3TP5A 4B08A 2N49A 1EY7A 2MPMA 2Y0SB 3M4PA 3PUZA 2SEBD 4HEDA 2Z0SA 1NR4A 5GQOA 3H91A 3CQZH 2A8VA 2HQLA 1EL0A 4ZKBB 1D1KA 2QKIC 1LYLA 4KY6A 5CMDA 2I5LX 4H02A 2HHHL 1SNMA 4IFDH 4JYAQ 4DF7A 4BBSB 2UUAQ 2F0KA 1UAPA 3T53B 2K5WA 2K5QA 4KN4C 3TBIB 3V05A 2F0OA 1M4VA 2UUAL 2B63G 2ZJPA