4OO1G

Structure of an rrp6-rna exosome complex bound to poly(a) rna
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
234
structure length
226
Chain Sequence
STFIFPGDSFPVDPTTPVKLGPGIYCDPNTQEIRPVNTGVLHVSTAYIDYSSKRYIPSVNDFVIGVIIGTFSDSYKVSLQNFSSSVSLSYMAFPNASKKNRPTLQVGDLVYARVCTAEKELEAEIECFDSTTGRDAGFGILEDGMIIDVNLNFARQLLFNNDFPLLKVLAAHTKFEVAIGLNGKIWVKCEELSNTLACYRTIMECCQKNDTAAFKDIAKRQFKEIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exosome complex component RRP45
publication title Structure of an Rrp6-RNA exosome complex bound to poly(A) RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/rna
total genus 36
structure length 226
sequence length 234
ec nomenclature
pdb deposition date 2014-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF15985 KH_6 KH domain
G PF18311 Rrp40_N Exosome complex exonuclease Rrp40 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4oo1G01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4oo1G02
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 4oo1G03
2B3GA 2FXQA 4XIGS 4A4IA 4QGUA 4UP7A 3J81c 3A8IE 1V9PA 4AYBG 4YHHL 1CKOA 4B3SL 1HZBA 1D8LA 4DK3C 1HNZQ 4Y7NH 1VQOA 1JT8A 4LF4Q 3BU2A 4BBSH 1DD2A 1VQIA 4ALPA 3TZUA 4YWLA 3WWVA 2CQOA 4QIWE 1B8AA 1QUQA 2B8FA 2I5HA 3PO2H 3T1YL 2RCNA 4WANA 2E5LL 3IKJA 2R92G 4X62Q 2OQKA 4KHPL 1U0LA 4NB3A 4DV6L 1FL0A 4BY7G 3I4LA 3NE5B 2E8GA 1WYDA 4X66L 3NEMA 2YTXA 4IFDI 1PH5A 1HPCA 3U4ZA 1H9SA 3PF4A 3A74A 2Q2TA 2UUAQ 3PUZA 1PV4A 1TKWB 3JAMi 2NN6H 1GHJA 2A8VA 2D0PA 4IQZA 3CW2C 2B63G 1A8VA 5IYBG 2D5DA 2ATWA 2MFIA 4JI8Q 1N34Q 3HOYH 3A7LA 1JB7A 1Y8PB 1S40A 4JI0Q 1VQBA 1UE1A 3PV0A 3GTLH 4KKTA 3PUYA 2F4VQ 5JJLA 1LABA 1FYCA 3E9IA 1J4WA 3TQYA 3BZCA 1K8GA 1YHAA 3KOJA 3OTOL 1E7ZA 1WCMG 2JXMB 4BA1I 3KF8B 3GTJH 1XTDA 3SE0A 4A3JG 2IX0A 1IBKQ 2GVBA 3I4NG 3UDXA 4BY1G 3PGZA 5GAHC 4GZYC 1P8LA 4UP9A 5GROA 1WI5A 5J3BA 1Q86C 4L8JA 1EOVA 2UXCQ 2VW9A 2RF4A 4GS3A 3RLOA 4DV2L 2K5VA 1VQHA 2YU9H 3PUVA 2KENA 5KNDA 4K0KL 1J5KA 1A62A 1X3EA 3PCOB 2R7FA 1E1OA 4DR4Q 3HGBA 4OX9L 1IBLL 1XMOQ 5FLXc 1S72A 1CKNB 3U58A 4JI7L 2QNDA 4A3MH 5C0XG 2JJQA 4YCWA 3G71A 1TWGH 3U9SA 1UWVA 1HQMC 2VUMH 2AHOB 1HR0L 3M4YA 2IT1A 4KN4C 3VDYA 1E1TA 2R7DA 2YQRA 1V1QA 3AYHB 4XTCS 2KHJA 4RMFA 1GO3E 2JQOA 5EAYA 3VR6A 1AE2A 2A68C 1I6VC 3F8TA 4A3EH 4A3DG 3H0GH 4PG3A 1PA6A 3CMEA 3LWUA 1NMGA 2VNUD 1VQ4A 2EQSA 3E0EA 4LUOA 5ELNA 1IW7C 1K8AC 4R4TA 4DK0A 2D0OA 4DR1L 3PUXA 2ASBA 1N33Q 2A69C 3OPOA 4KHZA 3DLLA 5JEAH 3J81i 2BE5D 1X3GA 2PY9A 1XJVA 3A7AB 1OXUA 3OW2A 2IY5B 2ALYB 1YNXA 2Y0SG 1Q8KA 5C44G 1I3QH 3H15A 2D62A 2AMCB 1EYGA 4DNIA 2HQLA 2UXBQ 3F2BA 3HOVG 3CF5A 1CKNA 3TRZA 1CSPA 1VQCA 1PH9A 3RLNA 1L2FA 4A3FG 4A3LH 2HT1A 3CCJA 1QVCA 4DR3Q 4IFDG 3IRBA 3UDGA 2HIVA 4DV7L 1O7LA 1Q1BA 5ELOA 1SMYC 4NXMQ 4DAMA 2A6ED 2VY3A 2H5XA 2VS1A 4H13C 1GM5A 2ZJPA 1TWCH 1W2BA 3H3VH 4LW1A 3D4RA 1V43A 2Z6KC 1HNZL 2CWPA 3DM3A 1EFWA 4LF4L 4A3IH 1VQKA 1A63A 3L7ZC 5H1SE 4BXXG 4H0LC 1KD1C 1TWFH 4DPGA 4IFDJ 4HJ8A 5C3EG 4JI5Q 4G7HC 4MNOA 4R4OA 1IYUA 4X62L 4B3TQ 5IP9H 2K14A 4C2MH 2L15A 1L0WA 4R4IA 2V1CC 4R4CA 1VQAA 2GN5A 1XNQQ 1HZAA 3GDEA 3U50C 4HIKA 1QJOA 4X64Q 2R7ZG 4P71A 2CTFA 3RN5A 3VR5A 3M4PA 5IP7G 2I5LX 1EIFA 2UUAL 3STBD 2NVQH 5JJIA 4KMUC 2UXDQ 3PUWA 4IPHA 1JJCB 1VQ7A 4JVYA 1AE3A 4JI8L 4QL5A 1N34L 3K8AA 5A35A 4JI0L 2RHSB 3OOCA 2IHFA 2R92H 4APVA 1BBUA 3RZDH 3TS2A 1J5EQ 3CCEA 1ZZIA 4BY7H 3S14H 4NXNQ 3I73A 2DGRA 1YHQA 2V4DA 3TEHB 3KLWA 1FR3A 2Z6KA 1G291 3CCQA 3VKEA 1Z47A 2VL6A 1PFSA 4X65Q 2O5JC 2CTJA 3HOWG 1IBKL 4H44C 1Y1VG 1E3PA 2OTJA 5GQOA 3CPWA 1HZ9A 1Y8OB 1DTJA 5IYBH 2UXCL 2AXYA 3BZKA 3JC66 5C0XI 3PIPA 1VQLA 3HKZE 1GKHA 3J7A5 1LM0A 2ZM6Q 4HJ7A 3VR3A 4QMFB 1KRSA 1H9RA 5IY0A 1EWIA 2HH2A 4LUZA 1JMCA 3M4OH 3GTOH 4LFCL 1XMOL 4DV0Q 1VS0A 1KQSA 4A3JH 2MNAA 1BVSA 4JK1C 3I4NH 2NZOA 3I4MG 4JBJA 2BDOA 1MJCA 4GOPC 2R6GA 2R93G 4GOPB 3NENA 1TUAA 3A8JE 2KCTA 2QF7A 4WJ3M 2NVYH 4YCUA 4EQ5A 2K5HA 2OQ0A 4A3BG 5BR8Q 4UY8C 4C3IH 3HOXG 3I72A 4DR7L 2WAQE 1Q82C 2AWNA 4QJFA 3RLFA 1LYLA 1N33L 2OWOA 2JZXA 1ASYA 4DR5Q 2A6EC 1DGSA 1NY4A 3ND9A 5IYCG 4KKUA 1QZGA 4JBKA 1KHMA 2A6HD 1VF5C 3CPFA 2ID0A 4LFBQ 3S17H 1C7YA 2UXBL 1Z7TA 1YNJC 3WDNA 4A3DH 2WB1E 4YY3L 5M3MG 3F2CA 1N36Q 1I94Q 1OXTA 3L2PA 3SGIA 2PQAB 2Q8IB 4GNXC 4GNXB 3S16H 2PPBC 2NZHA 4A76A 4DR3L 4DR2Q 4AQYQ 4GOPA 2CTKA 1ZZKA 4NXML 2E74C 5C44H 4DV1Q 3GTPH 2JA9A 4WJ4A 3E9HA 3MXNB 1NMFA 4L5RC 2Q2HA 5FLMG 1EQRA 3CMAA 3Q8DA 3KLRA 3D31A 4JI2Q 1SLJA 3KYHC 2KA7A 4JV5Q 1KC8C 1X3FA 3CCVA 3GTKH 4TQUS 4YWKA 1N9WA 4A3FH 1KHIA 1KL9A 3AQQA 3KF6B 2EXDA 4ME3A 3K7AH 4A93G 4JI5L 4GLVB 2ES2A 4IFDH 4B3TL 4L5SA 1DT4A 2LXKA 4UP8A 4NPSA 1YBYA 1ZZJA 1XPRA 3G48A 3N6RA 2K50A 2GVAA 2ZTEA 1OXXK 2JVZA 4FDBA 1X54A 3M7NA 3F2DA 2JK8A 1ZKOA 4P74A 1XNQL 2B29A 2PQAA 5LMUL 5HY6A 5BN4A 4GNXA 1DCZA 4RG1A 1VQ8A 1GJXA 2XTIA 5M5YH 2CPQA 4BXXH 2UXDL 1OTCA 2JA7H 3DXJC 3TS0A 4BBSG 4LF6Q 4PMWA 1BBWA 1H95A 2NVXH 5C3EH 5LMNW 4B3RL 1WOCA 1J5EL 4OONA 4X6AH 2HH3A 4NXNL 1FGUA 4KKSA 4DV4Q 5C4JH 1QVFA 2C35B 1PH3A 1Y1WG 1H9KA 3EQLC 1HJPA 1Q90A 4X65L 2R7ZH 4IJLA 5C0XJ 3S1RH 3CXCA 1JJ2A 5IP7H 2N78A 3VA7A 4LFAQ 2LSSA 1X56A 4HJAA 5HGQA 4PZ8A 1Q7YC 3J81j 2NN6G 2F3IA 1UE6A 1TU2B 3CD6A 2PQUA 3I7FA 5C4XG 4A3CG 1NBWA 1EIYB 4KLKA 2ZM6L 3CAMA 4YCVA 4NBQA 3HOUH 3MEFA 2K7VA 2AKWB 1GUOA 4LK1C 1PH2A 4LF8Q 4DV0L 2ANRA 1X65A 3HOWH 1P16A 2HHHQ 3ERSX 1N32Q 2OCEA 4UPAA 4POGA 2A6HC 4HIMA 1WVNA 3KJOA 3MXUA 4LNQA 2UUBQ 1X55A 1Q1EA 4G7OC 3MFYA 1JE5A 1VQMA 1M1KC 2A19A 3F1ZA 1PYSB 2E76C 5BR8L 2K5NA 2QA4A 4OXPA 3NBHB 2D2CC 3S1MH 2K33A 2VQEQ 3IFTA 4JBMA 1XNRQ 1I50H 5IWAQ 1WE8A 2PMZE 3PO3G 4DR5L 2MJHA 1OXVA 3CCUA 1SROA 4OGQC 4A3MG 3I4MH 1SFOH 3AEVB 4DNTB 2I5MX 1GD7A 1SRUA 1QZHA 1X4NA 2R93H 1BDOA 4IOAA 2EJMA 4C3JH 4LFBL 4AYBE 2BL5A 4AIMA 1EC6A 1I94L 1H9JA 2K32A 1T9HA 4A3BH 1IL2A 4DV3Q 2Q2IA 2IX1A 2WFWA 3HOXH 1EQQA 4KI0A 4JYAQ 1KAWA 3GQBA 1YHBA 3CC4A 3ULJA 3L0OA 5K36G 2UU9Q 2AUJD 4AQYL 4JI7Q 3W3AA 1FVIA 3UDIA 2MO1A 1K8OA 1H9MA 2PI2E 4R1JA 4DV1L 4HR7B 2F4VL 3T56B 1GUNA 5IYDG 3OW7A 1GUSA 4JI3Q 3S24A 4LF9Q 5M3MH 1TWHH 1ONLA 3U1KA 4JI2L 1NJIC 3A8KE 2JA8G 1I6HH 4GLAC 2B8GA 2YYZA 1PH7A 2K75A 3P20A 3D0FA 4JI1Q 4JI4Q 1R9TH 5M5XH 1PH4A 3S1NH 3FKIG 4LF5Q 4LF7Q 3AEVA 4P72A 1E24A 3UE0A 2B63H 3I4OA 3KFUA 3K80C 1IYJB 4DR6Q 4DAYB 4DR1Q 4MZ9A 3AB9A 1HR0W 3K81C 1RL2A 3A5ZB 1VIHA 1Y69U 3FHWA 1CSQA 4DR4L 5FLMH 2I0QA 1WCMH 1SN8A 2ZJQA 2RHQB 1B70B 2BE5C 2QGQA 2A68D 3PF5A 2YTYA 1IBMQ 2JEAI 1YI2A 1G51A 4B8TA 4WALA 4BBRG 3VR2A 5IT9c 4BY1H 1VDZA 4LF6L 4DUZQ 4A3KG 4HIDA 1H9SB 3I56A 4GN3B 2VQFQ 1C0AA 1HNXQ 3CCSA 4QY7A 1YNNC 2F52A 4PZ6A 2A69D 1FJGQ 1WJJA 1SMXA 4DV4L 1UEBA 2NN6I 2ANNA 1YITA 3ICEA 5GAEC 4DUYQ 3T1HQ 3G4SA 5KNCA 3EIVA 4DK6C 1MJEA 2KCMA 3GTMH 5C0XH 3BJUA 3TREA 4LFAL 2Q2UA 1D7QA 2EVBA 1GUTA 2CTEA 1S3OA 4HJ9A 1L1OC 2JA5G 3T53B 4JI6Q 3RR5A 4JBWA 3W5OA 1L1OB 1K73C 3A0JA 4OO1G 3S15H 1VQJA 2DNCA 1N8RC 1E2ZA 1Q12A 4P73A 3BDOA 4GKJQ 2N3SA 1VQ9A 1J6QA 1Y1WH 3CCRA 1K3RA 3ZJYC 2EDGA 3T51B 4LF8L 4GKKQ 2K52A 5AJ3Q 1MIUA 3HKSA 5IE8A 4A3GG 1E2WA 2E2HH 2OTLA 2HHHL 2LMCB 2UUCQ 1N32L 2CTLA 3BG3A 2UUBL 3GO5A 5FJ8G 2MQHA 2PNRC 2Y0SE 1Y8NB 1VQNA 1T5EA 2DUDA 5C4XH 4A3CH 2O5IC 2BA1A 4EX5A 2JA6G 1VQFA 4GLXA 3HOVH 2BA0A 3HKZG 1PMRA 4MTNA 1NE3A 1GHKA 1LTLA 2VZAA 4I7ZC 4R4QA 3STBC 5JJKA 2VQEL 1XNRL 1PH6A 3UE1A 2CW0C 1X6OA 5IWAL 1YJ9A 1A0IA 3RN2A 1VQPA 3HOZG 1GVPA 3K0XA 5M3FG 4POFA 3VR4A 4AM3A 1VIGA 1L1OA 1KIXA 2CWAA 1Q81C 2KBNA 1RIPA 5M5WH 5BN5A 5GAGC 3RZOH 4YWMA 3HFZB 1PHJA 4B3MQ 1U5KA 4IJHA 3OYYA 1BKBA 5LMNQ 4IO9A 1HNWQ 3CQZH 3V69A 1QVGA 2K4KA 4DKAC 3EN2A 3FP9A 1O78A 4X64L 4TKOB 4DV3L 1UE7A 4JYAL 3CC2A 2LXJA 3LGJA 4IOCA 2WP8J 4C3HH 5DLQE 2WAQG 4LFCQ 3PO3H 4O0AA 2UU9L 1CI3M 1JJGA 4DV5Q 3I2ZA 3PO2G 1XMQQ 1YJWA 2JEBI 3LNNA 1GUGA 1WFQA 4JI3L 4RCNA 4DK1A 2CTMA 4LF9L 2CFMA 3UDFA 1VF7A 4YHHQ 3KF6A 5KNBA 1E2VA 3U4VA 3QJYA 2WB1G 3S2DH 4B3SQ 4JI1L 4JI4L 1DXMA 1Y14B 1I5FA 4HIOA 4LF5L 1CKMA 4LF7L 2OPUA 1YZ6A 4DR7Q 4Y52H 2E3UA 1CUKA 2PI2A 2DNEA 5K36H 4DR6L 1MKHA 3H3VI 2NVTH 1VQEA 1W3SA 1Q46A 3GD7A 3T1YQ 1TXYA 2ZJRA 3HOYG 3KJPA 3K7UC 2E5LQ 5GADC 2ZT9C 1YVCA 4OWWB 5IYDH 3FMCA 3J80c 4G7ZC 4KHPQ 2AWOA 4PV1C 4PZ7A 4KN7C 2EJGC 4DV6Q 2KCCA 3J7ZC 1CFMA 4OWXB 4P75A 1B7YB 4X66Q 2DN8A 2JA8H 4IPCA 1IBML 1ZTGA 4YY3Q 1Y1VH 3W1GA 1HCZA 4IPDA 3FKIH 1VQ6A 4DUZL 2BH8A 3AFPA 1K8MA 2VQFL 1HNXL 1HH2P 2EIFA 1YJNA 3H94A 1KRTA 1X4MA 3M85A 2CKZB 1FJGL 3CP0A 1PH8A 1IZ6A 1C9OA 3M9BA 4DUYL 1Z6HA 1YEZA 4JCVE 1LACA 3T1HL 4HJ5A 3W1BA 4OO1I 1VCIA 3GTGH 1ZYRC 2PNHA 1SE8A 3EBEA 3OTOQ 2ZTCA 2E75C 2PCFB 4J15A 4BBRH 3NELA 4JI6L 3A5UA 1K83H 4A3KH 4JOIC 3AFQA 3KDFB 2VUMG 2JA7G 2ZTDA 5E7NA 1HTPA 4GKJL 1A6XA 3RNUA 2FMRA 4O2DA 1N36L 3PSIA 2HIXA 4L5QA 4DV2Q 2IHEA 2N49A 5BN3A 3JAMc 4A3EG 3S2HH 1KXLA 4DNRB 3ULLA 3H0GG 4GN4B 1HZCA 4GKKL 4A75A 2DGYA 5AJ3L 4JG2A 3QG1A 3FPPA 4K0KQ 5LMUQ 3B6YA 2JE6I 3G6EA 1K0RA 2UUCL 1ASZA 4OX9Q 3ULPA 1IBLQ 1OXSC 4DR2L 1UE5A 1E22A 2Z0SA 4OWTB 2EJFC 1NTGA 5IYCH 1Z9FA 3SDZA 2JA5H 5JEAG 3ER0A 1HR0Q 2KHIA 4OO1H 1IXRA 1B9MA 1X9NA 3M3YH 2E2JH 3I55A 4LIJA 4JVHA 1VQDA 1SR3A 1EWHA 3M4QA 4B3RQ 1PYBA 4JV5L 2A1AA 2P2RA 1XPOA 3HOUG 2N8NA 4AH6A 2L5TA 4JC0A 4LJZC 1XPUA 4A3GH 3CCMA 1AH9A 1VQ5A 3KDFA 4JOIA 3CRKC 5JEAJ 4A3LG 1O7IA 1EUJA 1PVOA 1M90C 4GN5A 4B3ML 3ND8A 1TWAH 5FJ8H 4IPGA 4TVAB 1K9MC 5LMNL 3S1QH 2F1MA 2CCZA 1HNWL 1YIJA 1QUQB 4LUVA 3QIAA 2JA6H 1VQGA 2QEXA 1LUZA 2YTVA 4BA2I 1V8QA 4L5TA 1B9NA 2XGTA 1PH1A 2BH2A 1K1GA 1G6PA 4LWCA 3GTQH 2MO0A 3HOZH 4A3IG 4QQBX 2OPVA 3PIOA 5M3FH 3CC7A 3J80i 2AUKA 4H02A 4A93H 4DV5L 1XMQL 1IW7D 2YV5A 1IYVA 1CTMA 3CCLA 2E2IH 5IP9G 4DV7Q 3CRLC
chains in the Genus database with same CATH superfamily
2B3GA 2FXQA 4XIGS 4A4IA 3J81L 3PIO3 1JQYD 4QGUA 4UP7A 4C3JG 2L55A 3J81c 3A8IE 1V9PA 4AYBG 4YHHL 1AN7A 1NR4A 1RCVD 2RSOA 1PTOF 5COYA 1CKOA 4B3SL 4JI4H 3HOWB 1HZBA 1D8LA 4CDDC 4DK3C 4LF5H 1HNZQ 4LF7H 4Y7NH 5D3IB 4QUCA 1VQOA 1WD0A 1SEBD 1JT8A 4LF4Q 3BU2A 4BBSH 1DD2A 1VQIA 2LY7A 4ALPA 3TZUA 4YWLA 3WWVA 2CQOA 4DR6H 4QIWE 4DR1H 5ISRA 3C3LA 1AP0A 1AZQA 1B8AA 1QUQA 3HP3A 2B8FA 2I5HA 3PO2H 3T1YL 2LFNA 1T5XD 2RCNA 4WANA 5C6AA 4UAIA 3J80E 4HSPA 2E5LL 3IKJA 4HCEA 2R92G 3KUPA 4X62Q 2F0MA 2OQKA 1EY4A 4KHPL 2CWHA 2NTSA 1U0LA 4G57A 4NB3A 4DV6L 1WTWA 1FL0A 4NP5A 4A3IB 4BY7G 4KY7A 3I4LA 3NE5B 2E8GA 1WYDA 1QILA 2EYJA 4X66L 1XRHA 3NEMA 3UOEA 2YTXA 4IFDI 4RGOS 1PH5A 2PMZB 1HPCA 3U4ZA 1H9SA 1TWFB 1PLFA 2X6GA 3PF4A 3A74A 2QCPX 1ENFA 5EPKA 1EYCA 3KDKA 1EL0A 2F4IA 3D4DA 2Q2TA 4U68A 2UUAQ 2Q8RE 2FFKB 3PUZA 1PV4A 4F7XA 1PFMA 1TKWB 3JAMi 4LAAA 2M8WA 2NN6H 1GHJA 4K8IA 3G6JB 2A8VA 2D0PA 2PZWA 4IQZA 3CW2C 3LWEA 2XWBB 2IL8A 3TP5A 2B63G 4ZRZA 2R93B 1CQFA 1A8VA 1XWEA 3BVGA 5IYBG 2D5DA 2RVLA 5A2QL 2D9IA 2ATWA 2MFIA 4JI8Q 4C3JB 2QDLA 4RHRA 1N34Q 3HOYH 4DV7H 4AYBB 3A7LA 1JB7A 1Y8PB 1S40A 4JI0Q 4EQOA 4QUFA 1LTRD 1V1PB 1TY0A 1VQBA 1BQQT 4A3BB 1UE1A 1WTVA 4B8CD 3PV0A 3GTLH 4KKTA 3PUYA 2F4VQ 5KYIA 1STBA 1SNDA 4X3TA 5JJLA 1LABA 1FYCA 3E9IA 1J4WA 3TQYA 3BZCA 4EC5A 3D3RA 1K8GA 2MHVA 1YHAA 3KOJA 2JP1A 4KD3A 3OTOL 1E7ZA 3KK7A 1HNZH 1WCMG 2JXMB 4BA1I 3KF8B 3GTJH 1XTDA 4V190 1CHPD 2WIIB 3SE0A 4JI6H 3R3OA 3A54A 4A3JG 1S03G 1BR9A 2IX0A 1PZID 1IBKQ 5DT9A 2R92B 2GVBA 3I4NG 2Z4HA 3UDXA 1PTOC 3FDTA 1EYDA 4BY1G 4M1UB 3PGZA 5GAHC 4UP9A 1P8LA 4GZYC 1PTOB 1VMCA 2SNMA 5GROA 3Q22A 2ZXPA 1WI5A 5J3BA 1Q86C 4BY7B 4DAVA 3D6CA 4GKJH 1EOVA 4L8JA 2UXCQ 4FJUA 2VW9A 4X62H 2RF4A 3NK9A 4GS3A 3JAME 3RLOA 3FVQA 4DV2L 2M2LA 2K5VA 1TWHB 1VQHA 2YU9H 4QF4A 2KJXA 2RDGA 3PUVA 1STAA 4GKKH 3TP6A 1X3QA 2KENA 4L6TB 5KNDA 5C4ZA 4C3IG 4K0KL 1J5KA 1A62A 1ZEQX 1X3EA 3PCOB 5M5XB 2R7FA 3Q23A 3NPPA 1E1OA 5FLXL 2UUCH 4DR4Q 3HGBA 4OX9L 1IBLL 1EZ6A 4WORA 5FLXc 3AU7A 1XMOQ 2B63B 3EA6A 1S72A 1D5ZC 1CKNB 3U58A 2UUAH 1QE6A 4JI7L 2QNDA 4A3MH 1R4PB 5C0XG 2JJQA 4YCWA 3T4AC 3DM1A 3G71A 1SYBA 2RCFA 1TWGH 3U9SA 1UWVA 1HQMC 2VUMH 1WHRA 2AHOB 4XDXA 1QCBD 3C1FA 2AQ3B 1HR0L 3M4YA 2IT1A 4KN4C 3VDYA 3SB1A 1E1TA 2R7DA 2VB3X 4J8QA 1V1PA 2YQRA 1V1QA 1SYFA 3AYHB 4ZAIA 4XTCS 1N34H 3DEOA 3IAYA 1PYWD 2KHJA 1WTXA 1PRTD 4RMFA 1GO3E 1B4OA 3KBXA 4JI0H 4BWGB 3M4OB 2JQOA 3OSOA 5EAYA 3GTOB 3G7LA 2SDFA 3VR6A 1EZ8A 1AE2A 1STEA 4XYQA 2A68C 1WCMB 1I6VC 3F8TA 2HCIA 4K2KA 4A3EH 3EJIA 5IGDA 5IIFA 4A3DG 3H0GH 3H91A 4PG3A 4FF3A 2TSSA 1PA6A 3CMEA 1B3QA 1L0XB 4A3JB 3LWUA 1NMGA 2VNUD 3KF8A 1VQ4A 3I4NB 2EQSA 3E0EA 3IL8A 2FINB 2RDHA 4BY1B 4LUOA 3GKUA 3TZDA 4DXFA 2ZXOA 5ELNA 2G5DA 1IW7C 1S5ED 1TS3A 1K8AC 4R4TA 4DK0A 5IT9W 2F0UA 3J7AK 2D0OA 1IBKH 4C1NK 4DR1L 3PUXA 2ASBA 5JOBA 4ZK9B 1N33Q 3KDGA 2F0PA 2A69C 4ZKCB 1JWMD 3OPOA 2HD3A 4KHZA 3DLLA 5JEAH 3J81i 2BE5D 1CA5A 1X3GA 2B2YC 2PY9A 2O2LD 1JWUD 1HNWH 1XJVA 3A7AB 1F9PA 1OXUA 3OW2A 2IY5B 2UXCH 2ALYB 1F2MA 1YNXA 1UG8A 4B9WA 1HXYD 2Y0SG 3E0JA 1Q8KA 4C3IB 3KLSA 5C44G 1E0BA 1I3QH 2FMMA 3H15A 2D62A 2AMCB 1EQTA 1EYGA 2QDBA 4DNIA 2HQLA 2UXBQ 3F2BA 3HOVG 3CF5A 3FAUA 5I2YA 2F0WA 3GTMB 1YNND 2H4OA 2M6QA 1CKNA 3TRZA 4KK7A 1CSPA 1VQCA 1PH9A 4LFCH 2G8YA 3RLNA 1XMOH 2K01A 3MFGA 2Z1CA 2K03A 5C3WA 2JSOA 3MXGA 4X3SA 5I6YA 1KAAA 1L2FA 4HMJA 4A3FG 5IOCA 4A3LH 2HT1A 3CCJA 1QVCA 4DR3Q 2OXPA 3IRBA 3UDGA 3GP7A 4IFDG 2HIVA 4WRDA 4DV7L 3S17B 1HQRD 1QNUA 1O7LA 4A3DB 1Q1BA 5ELOA 1SMYC 4NXMQ 4DAMA 2A6ED 1NNXA 2MP1A 2VY3A 1JORA 2OEOA 2H5XA 2K28A 1LTBD 2VS1A 1RF2D 3J81E 1WVLA 4PNYA 3IFDA 4H13C 1GM5A 4K6LA 2ZJPA 1LT5D 1K3BC 2F0IA 2B2UC 1TWCH 1W2BA 2CPMA 4N9TA 3H3VH 4LW1A 3KLSX 3K5NA 3P7JA 2E2HB 5L37A 3D4RA 1XTCD 1SNOA 1V43A 2QILA 2Z6KC 1HNZL 2SEBD 2F0KA 3DUZA 4MIUA 2CWPA 3DM3A 1EFWA 1B50A 4LF4L 4A3IH 1SYGA 4DR7H 1VQKA 2CVRA 1A63A 4IUUA 3L7ZC 5H1SE 3BVZA 4BXXG 2M9VA 4H0LC 3NHHA 1Q8IA 1KD1C 1ILPA 1G91A 1N33H 1RD9D 1LTSD 1TWFH 2B2YA 1WD1A 5C44B 4DPGA 5C4XB 1J8IA 4IFDJ 4X3UA 4HJ8A 5C3EG 3L9AX 4G7HC 4MNOA 4JI5Q 4R4OA 1IYUA 4X62L 4B3TQ 5IP9H 1STGA 3HOVB 2K14A 4C2MH 2L15A 3TP8A 4DN4M 5ELFA 4KHPH 1L0WA 4FO2A 1JOOA 4R4IA 4OL7A 5A2QW 3BZDB 2KHSA 2V1CC 4R4CA 1VQAA 5G3LF 2GN5A 1BNZA 2FMCA 1XNQQ 1HZAA 3GDEA 1MI2A 2A74C 3U50C 2IWHA 4YY3H 4HIKA 4A3FB 1QJOA 4X64Q 2R7ZG 4P71A 2CTFA 1R4QB 3GR5A 3RN5A 1MGSA 3VR5A 5JPMC 3M4PA 1ZXTA 5IP7G 2I5LX 1EIFA 1CZGA 1SNCA 2UUAL 4J1MA 5M5WB 1PZJD 1LT6D 2QEJC 3I91A 3STBD 2NVQH 5JJIA 1VBIA 3RZOB 4KMUC 2B39A 2UXDQ 3PUWA 4E6IA 4IPHA 1JJCB 3CU7A 1VQ7A 4JW0A 1EY8A 2CW0D 2A5HA 5A2QE 4JVYA 4DR3H 1AE3A 4JI8L 4QL5A 1N34L 3CQZB 3K8AA 5E4XA 4O42A 4N8FA 3DMUA 5A35A 4JI0L 2RHSB 2XVSA 4NXMH 3OOCA 2IHFA 2R92H 1ET9A 4APVA 1BBUA 3RZDH 3TS2A 2F0EA 5JVH3 1DONA 4ULLA 1J5EQ 3CCEA 5J39A 1TQOA 1ZZIA 4OEMB 2B2UA 4BY7H 3R93A 3S14H 4NXNQ 3I73A 2DGRA 1YHQA 2V4DA 3TEHB 3KLWA 5M5YB 1FR3A 2Z6KA 4KHVA 1G291 2X69A 3HG9A 5KYLA 3CCQA 3OTOH 3VKEA 3BYYB 2EYMA 1AZPA 3E3XA 1Z47A 2VL6A 1PFSA 4X65Q 2PT7G 1S5DD 2O5JC 2CTJA 5EBCA 1SNQA 1JICA 3HOWG 1IBKL 1TS5A 4H44C 1O7ZA 1Y1VG 1E3PA 2OTJA 3HZXA 1S5BD 5GQOA 3CPWA 1HZ9A 1CK1A 5EPJA 1Y8OB 4CHTB 4QB4A 2N55A 4JI5H 1DTJA 5IYBH 2UXCL 2AXYA 3BZKA 4B3TH 3JC66 1LTID 1SDFA 5C0XI 3NP8A 3PIPA 1VQLA 3HKZE 1GKHA 1KDCA 3J7A5 3X3NA 2F0FA 1LM0A 2ZM6Q 2R7ZB 1EYAA 4HJ7A 2RDFA 3VR3A 4QMFB 3S1RB 4FNFA 4FVMA 1KRSA 1H9RA 3EVQA 1XNQH 3S2DB 1B2TA 5IY0A 1EWIA 3E6ZX 2HH2A 5LMUH 4LUZA 1JMCA 3M4OH 3RUZA 3GTOH 5FLXE 1UNSA 1AW7A 2C9OA 4LFCL 3OETA 1WTOA 1XMOL 2KQ3A 4DV0Q 1D2BA 3DWAA 1VS0A 1KQSA 1D1IA 4A3JH 4NDXA 4KJOA 2NVTB 1D6EC 2MNAA 2UXDH 3PIP3 2MGSA 1BVSA 4JK1C 3I4NH 5CYUA 2NZOA 3NSWA 4K6DA 5M9OA 4RCOA 4G08A 4RGNA 3I4MG 4JBJA 2BDOA 2K5WA 4XXEA 3OIPA 2VB2X 1MJCA 5CMDA 4GOPC 2R6GA 4N9PA 5E1FA 4F88A 5CBEE 2R93G 4GOPB 3NENA 3SEBA 4B3RH 1TUAA 3J80W 3A8JE 2KCTA 4CKBA 2QF7A 4C56C 2NVYH 4WJ3M 4YCUA 4EQ5A 2K5HA 4IUPA 4CJ1B 1WTHA 1C8CA 2IJ0A 4Z9CB 2OQ0A 4KJNA 4A3BG 3UI2A 5BR8Q 1Y1VB 4UY8C 4C3IH 3HOXG 3I72A 2LRRA 4DR7L 2Z6BA 3J7YW 4X65H 2WAQE 1AFPA 1Q82C 2X6LA 2AWNA 4QJFA 4FP5D 3RLFA 1RODA 1LYLA 4NMZA 1N33L 1BUVT 2OWOA 2JZXA 2Y3MA 2NYZD 1ASYA 4DR5Q 4DAPA 1C4QA 2A6EC 1DGSA 1NY4A 3ND9A 5IYCG 4H7BA 4KKUA 5KRUA 1QZGA 2WKCA 4JBKA 5D14A 3TMEA 1C48A 1KHMA 4IURA 3RD4A 2A6HD 2MUYA 1VF5C 1U4RA 3S1MB 4ME5A 1I50B 2HUGA 3CPFA 2ID0A 1S5FD 4LFBQ 3NQTA 5T1GA 1C7YA 3S17H 2UXBL 1D5XC 1Z7TA 1YNJC 2CH4W 1M8AA 4IUNA 3WDNA 2FHTA 2WB1E 4A3DH 4YY3L 5M3MG 3F2CA 1N36Q 1I94Q 1OXTA 1O80A 3L2PA 1OO9B 3SGIA 1EEFD 1PFBA 2PQAB 2RSNA 2Q8IB 4GNXC 3I4MB 4BBRB 1SE3A 1SFOB 1K83B 1DZ1A 1BCPF 4GNXB 3S16H 2PPBC 4DV0H 1NR2A 3K5OA 1A2TA 1X32A 5EKKA 1SJHD 2NZHA 5IGFA 4A76A 4DR3L 1EEID 1ZYRD 4DR2Q 3SVMA 4AQYQ 4GOPA 2CTKA 4TRDA 1ZZKA 2EXZA 4KY6A 4NXML 1UEAB 4I65A 4NKLA 4ZQ3A 3FPUB 2E74C 2LF0A 3L3OC 4MHEA 3S2HB 5C44H 4DV1Q 3GTPH 3HOXB 3S9WA 4IALA 2JA9A 4WJ4A 3E9HA 5JAVA 4RFBA 3MXNB 1S20A 3JAMW 1NMFA 2EYHA 4L63B 2Q2HA 4L5RC 5FLMG 1EQRA 3CMAA 5BR8H 3Q8DA 3KLRA 3D31A 4KY5A 3R8BA 2I46A 4DGZA 5I6WA 4LF4H 4JI2Q 1SLJA 3KYHC 5KIXA 2KA7A 4JV5Q 2XSCA 1KC8C 1X3FA 4K5WA 3CCVA 3DWPA 1A3UA 3GTKH 4HSVA 5HURA 4TQUS 1RTOA 4YWKA 1N9WA 4A3FH 1KHIA 1KL9A 3AQQA 3KF6B 3VA5A 5I9PA 4G4KA 1S4ZA 1PFNA 4NW2A 5FO8B 2EXDA 4HN7A 4ME3A 3BVMA 3K7AH 4A93G 4JI5L 2PW5A 3M3YB 1NSNS 4GLVB 2CHBD 1JOQA 1HUMA 2ES2A 4B3TL 4L5SA 1I4GA 4IFDH 1DT4A 2LXKA 4UP8A 4NPSA 2Z8LA 1YBYA 1ZZJA 1XPRA 3G48A 2B2VC 3N6RA 5M3MB 5HGTA 2K50A 2GVAA 2ZTEA 2CWFA 1EY6A 2L1BA 1OXXK 2JVZA 4FDBA 1I6HB 1LT3D 1X54A 3M7NA 3J7AV 3F2DA 2JK8A 1ZKOA 2H1EA 3K58A 4P74A 1XNQL 2B29A 2PQAA 1I4XA 1PXUA 5LMUL 1R9TB 3S1NB 1I94H 5HY6A 5BN4A 4GNXA 1DCZA 4K5XA 4RG1A 4CGYB 5FKAC 1VQ8A 1X3PA 1B44D 1DYQA 1GJXA 2XTIA 5EKIA 5M5YH 2CPQA 2MPMA 4BXXH 2UXDL 2SOBA 3HS0C 2EY6A 1OTCA 1TWAB 1EY7A 2JA7H 3DXJC 3TS0A 4BBSG 4LF6Q 5LL6b 1LO5D 3MVVA 4PMWA 4JI8H 1BBWA 1NAPA 3S1QB 1H95A 4AQYH 2NVXH 3P75A 5C3EH 1STNA 2JA6B 5CV9A 1BCPC 2F0GA 3A55A 1V8CA 2K5QA 3MXNA 4X3KA 3HKZB 5LMNW 4B3RL 1BCPB 1WOCA 1I4RA 1J5EL 2ZQEA 4DV1H 2F4VH 4OONA 1FNUA 1SJED 4X6AH 2HH3A 4NXNL 1FGUA 4KKSA 4DV4Q 3QOLA 5C4JH 4UDUC 3ITPA 1QVFA 2C35B 1PH3A 1BO0A 1Y1WG 1H9KA 1HHVA 3EQLC 1HJPA 1FNVA 1Q90A 4JI2H 3PQIA 4UHVA 4X65L 2R7ZH 4IJLA 1JB3A 5C0XJ 3S1RH 1IHZA 3CXCA 4A93B 1JJ2A 5IP7H 2N78A 1AN8A 3VA7A 1RJTA 1KDAA 4LFAQ 2LSSA 1X56A 1MD2D 4HJAA 1KABA 5EKLA 2F03A 5DM63 5HGQA 1F9QA 3TDQA 4PZ8A 3TBIB 1Q7YC 3C2PA 3J81j 2F3IA 2NN6G 1UE6A 1TU2B 4RKLA 3GV6A 1UAPA 3CD6A 2PQUA 3I7FA 5C4XG 4A3CG 5EPLA 3NQIA 1NBWA 2J0TD 1EIYB 1LTGD 4KLKA 3NTIA 2ZM6L 3CAMA 1KTKA 4YCVA 1F9RA 2ENBA 1GOZA 4NBQA 1TT2A 3U9OA 3HOUH 3MEFA 3OHXC 4EQPA 3J81W 5D65A 4FF1A 5EBDA 1EIGA 5CV8A 2BDNA 1V9NA 2K7VA 2AKWB 4DR4H 1GUOA 4LK1C 1WTQA 1PH2A 4BBSB 1MSHA 4IUVA 2LKVA 4LF8Q 2MJ8A 2EYPA 4DV0L 4QIWB 4H8AA 2ANRA 1X65A 2LTLA 3HOWH 2QW7A 1DOKA 1P16A 5CR3A 2HHHQ 3S15B 2ICEC 3ERSX 1N32Q 2OCEA 4O1NA 4Q0FA 4LF6H 1ICFB 4UPAA 2IX3A 4POGA 4XQQA 1ENCA 2A6HC 4HIMA 1KLUD 2F0QA 1A3VA 5LL6X 1WVNA 3KJOA 3MXUA 1J9OA 4LNQA 2K04A 2UUBQ 1X55A 2XWJB 1Q1EA 4KV6A 4G7OC 1Y1WB 4K5VA 3MFYA 2KCNA 5KGUA 2L4NA 1JE5A 1VQMA 4U673 1M1KC 2A19A 3F1ZA 5CGKA 1PYSB 1EIHA 1PRTF 4JVZA 1RHPA 2E76C 5BR8L 2K5NA 2KUMA 2B2WC 2QA4A 4OXPA 3NBHB 2K05A 2D2CC 3N52A 5DAUA 3S1MH 1XX8A 1ODHA 2K33A 1STYA 3IFTA 2VQEQ 1SBBB 3OMCA 4JBMA 1XNRQ 3GABA 1I50H 1XXGA 1F0XA 2F0SA 1TR5A 5IWAQ 1WE8A 2L11A 2PMZE 4C3HG 2ICIA 4LFAH 2B2TC 4ZUIA 3PO3G 4DR5L 2MJHA 3ZYYX 4MTKA 1A15A 1EFID 1OXVA 1SROA 3CCUA 2NBFA 4OGQC 4A3MG 1BOSA 3I4MH 3HOYB 4HCSA 1SFOH 3AEVB 4DNTB 2I5MX 2KVMA 2F0TA 2F0OA 3OIQA 1GD7A 2PYKA 3SK4A 4QCLA 1SRUA 1QZHA 1X4NA 3K6OA 2R93H 1BDOA 4IOAA 1I4HA 1HA6A 2EJMA 4C3JH 4LFBL 2UXBH 4AYBE 1HFGA 2BL5A 4AIMA 1EC6A 1I94L 1H9JA 2K32A 1HUNA 1T9HA 1NUCA 1QOHA 5FOBB 4A3BH 1IL2A 4DV3Q 2Q2IA 2IX1A 2WFWA 1G6ZA 3NTHA 3HOXH 3O13A 4XQNA 3BDCA 3GTJB 3K5MA 1EQQA 4KI0A 4JYAQ 1SE4A 4QMGA 5JJZA 1KAWA 3GQBA 2WV6D 1YHBA 3D8GA 1QWYA 3CC4A 2VXWA 3QR8A 3ULJA 1XYIA 2HHHH 2K6AA 2NTTA 1NCVA 3VYTA 3Q24A 1FD7D 4FYDA 3L0OA 5K36G 5EGTA 4C1NI 2UU9Q 2AUJD 1KLGD 4AQYL 4JI7Q 1CT1D 3W3AA 1FVIA 3UDIA 2MO1A 4NZTM 1K8OA 1H9MA 3RF2A 3TP7A 2PI2E 4R1JA 4PDBA 2YU9B 2FFMA 1PTOH 4HR7B 4DV1L 2F4VL 5FK9C 3T56B 1GUNA 4EQNA 1PTOD 5IYDG 3NBHA 3OW7A 3H09A 1CZWA 1GUSA 2G9DA 2B2WA 2M00A 4JI3Q 3S24A 3V2TA 4C3HB 4LF9Q 5M3MH 1TWHH 1ONLA 1CHQD 3U1KA 1F2YA 4J6HA 4JI2L 3PO3B 1NJIC 2A1SA 3A8KE 2VQEH 2JA8G 1I6HH 1JOKA 4A3MB 3OWFA 4GLAC 2B8GA 2YYZA 1PH7A 4S3SA 2J7ZA 2O4XA 2K75A 2B2TA 2HDMA 2Z4IA 3D0FA 3P20A 5FO7B 4JI1Q 4JI4Q 5FLXW 1LTTD 5M5XH 1R9TH 1PH4A 3R2IA 3FKIG 3S1NH 2VUMB 5DM73 3OMGA 1PRTC 1QG7A 4LF5Q 4LF7Q 3AEVA 3EROA 4P72A 1E24A 3UE0A 1Z2IA 2B63H 3I4OA 1PRTB 3KFUA 3K80C 5IGGA 5IGBA 3BYTB 1IYJB 4DR6Q 4DAYB 4DR1Q 4CKCA 4PQXA 4MZ9A 3AB9A 1HR0W 3K81C 1LTAD 1STHA 4ZKBB 4BS9A 3VYRA 1RL2A 3A5ZB 2IPKD 1VIHA 4A3EB 3NUCA 2R61A 1Y69U 1RKNA 2K5DA 3FHWA 1BBXC 1NXUA 1CSQA 4DR4L 5ELCA 2PO4A 5FLMH 2I0QA 4X64H 4OIKA 4FF2A 4DV3H 1CM9A 1WCMH 1PQXA 1SN8A 2ZJQA 3F2UA 3BDLA 2RHQB 1B70B 2F3WA 2BE5C 2QGQA 1X0AA 2A68D 3PF5A 2YTYA 1IBMQ 2JEAI 1YI2A 5IT9L 1G51A 4B8TA 1A2UA 4WALA 2A73B 5F2DA 2PZUA 4BBRG 3VR2A 5IT9c 4BY1H 1W6KA 4M8AA 1VDZA 5EQ0A 4LF6L 4DUZQ 5JVG3 1S5CD 4HIDA 4A3KG 2UU9H 3DEPA 1H9SB 1X9ZA 3I56A 4GN3B 1PZKD 4TSSA 2VQFQ 3LX0A 1C0AA 1HNXQ 2F0NA 3CCSA 2BOSA 1K28A 5I2XA 1J5EH 1EU4A 3E5SA 4QY7A 2I07B 1YNNC 2F52A 4PZ6A 2DJGC 2A69D 2EPBA 4NXNH 1FJGQ 2JA8B 1WJJA 1SMXA 4DV4L 1K0SA 1UEBA 3NWSA 3C1EA 2NN6I 4JI3H 1YITA 2ANNA 2F0VA 3ICEA 3EZJA 4R8IA 2OF1A 4OIJA 1ILQA 3FKIB 5GAEC 4DUYQ 4LF9H 3T1HQ 2F0HA 4RWSC 3G4SA 5KNCA 3D6WA 3EIVA 1VMPA 5E4WC 4DK6C 5I4DA 1EU3A 3I70A 1MJEA 2NWGA 1SAPA 1G2SA 2KCMA 4DF7A 3NTKA 3MEHA 1JR0D 3GTMH 5C0XH 1B53A 3BJUA 4JI1H 3TREA 5IODA 4LFAL 2F0JA 2F3VA 4CJ0B 4Q5VA 2Q2UA 1D7QA 3QWNA 2EVBA 4ILWA 5C5MA 1GUTA 2RA4A 2CTEA 4DAYA 1GXDC 1S3OA 4HJ9A 2XRSD 4CDCC 1L1OC 2JA5G 3T53B 4JI6Q 3RR5A 2PQEA 3CHBD 4JBWA 4OELB 3W5OA 1JWSD 1L1OB 1K73C 3MZ5A 5IGEA 3A0JA 4OO1G 4K8JA 3S15H 1ML0D 1TY2A 1VQJA 2DNCA 4R9WA 1N8RC 1JCKB 2ZM6H 3H3VC 1E2ZA 1Q12A 4P73A 4HMIA 3GTGB 1LT4D 3BDOA 1TWCB 5CV5A 5ELBA 1G2TA 4GKJQ 2N3SA 3M7GA 2E2DC 4DA2A 3P1HA 1VQ9A 1F77A 1J6QA 1SMYD 3CCRA 1Y1WH 1K3RA 3ZJYC 4ODGA 2EDGA 1QNKA 3T51B 4LF8L 4A3KB 4GKKQ 2K52A 3J7AF 5AJ3Q 1MIUA 3HKSA 4N8X1 5IE8A 4A3GG 1IBMH 1E2WA 2EY1A 3OWEB 2E2HH 4ZCKA 2FPHX 2OTLA 2HHHL 4IUTA 2DY7A 2LMCB 2TMPA 3MTSA 2UUCQ 5DEHA 1N32L 2CTLA 4CDEC 4DUZH 3NXWA 1O7YA 3BG3A 2K1BA 1BXTA 2VQFH 2UUBL 4C2MB 1HNXH 1MHWC 3GO5A 5FJ8G 4IUQA 2MQHA 2PNRC 2Y0SE 1Y8NB 2L12A 1T5EA 2DUDA 1VQNA 5C4XH 1IKLA 4A3CH 4LMQD 2O5IC 1I4QA 2BA1A 4EX5A 1F2LA 2XNAC 1FNWA 2JA6G 1FJGH 1VQFA 4CJ2C 4GLXA 3HOVH 2BA0A 2AQ2B 3HKZG 1PMRA 3SK5A 4MTNA 3H6MA 1NE3A 1GHKA 1SSOA 2BCOA 4DUYH 1LTLA 2VZAA 4I7ZC 4IZ8A 4R4QA 4V0BA 3STBC 3T1HH 1UUPA 5CV4A 5JJKA 2EY2A 2VQEL 4OHJA 1XNRL 1PH6A 3UE1A 2CW0C 1X6OA 5IWAL 2JA5B 1YJ9A 1A0IA 3W2DA 3RN2A 4JPBW 1VQPA 2NVQB 3HOZG 1GVPA 3K0XA 5LL6S 4NZRM 2JN4A 5M3FG 3BS1A 4POFA 3VR4A 4DR5H 4AM3A 4F87A 4ABNA 3DHQA 1VIGA 1L1OA 3K0YA 1TIID 1KIXA 2CWAA 2WACA 1Q81C 2KBNA 1RIPA 2E2JB 5KEEA 5BN5A 5M5WH 3D4WA 2JYOA 5GAGC 5TSSA 4DFAA 3RZOH 3I3CA 4YWMA 5CBAE 5J22A 1ESFA 3RZDB 4I7AA 2SNSA 3HFZB 1PHJA 4B3MQ 2O4CA 3SR1A 1U5KA 1RDPD 4R8NA 4IJHA 3MWYW 4FXDA 3MXPA 3OYYA 1BKBA 4ZYSA 2RQXA 5LMNQ 4IO9A 3S14B 4LFBH 1HNWQ 3CQZH 3V69A 1QVGA 4ZLTF 1TS4A 2K4KA 4DKAC 2EE1A 1N36H 5ELEA 2KEEA 3EN2A 3QB3A 4A3GB 3FP9A 1O78A 4X64L 4TKOB 4DV3L 1F2ZA 3FEWX 1UE7A 1DOLA 3CKIB 1WTRA 4JYAL 3CC2A 2J4XA 2LXJA 3LGJA 2F0LA 5CV7A 4XT3B 4IOCA 2WP8J 4C3HH 5DLQE 3GV3A 3I90A 4HTHA 2WAQG 1AEXA 4LFCQ 1LLRD 3PO3H 4RAUC 4O0AA 2UU9L 1SYCA 2PW7A 4DR2H 4YIJA 5LHY1 1CI3M 1JJGA 1DJRD 4B08A 4OCHA 1U9RA 4DV5Q 2NB0A 3I2ZA 1SNPA 3PO2G 1XMQQ 2D9UA 1YJWA 4E9JA 2JEBI 3QOJA 1M4VA 1KNAA 3LNNA 5ELDA 1HFNA 2NZ1D 1FKAH 1GUGA 1WFQA 3GTQB 3HRZC 4JI3L 4RCNA 1U4LA 3HOZB 4DK1A 3C46A 2L9HA 2CTMA 4LF9L 3I0PA 1F9SA 2CFMA 5M3FB 3UDFA 1D1KA 4JV5H 1I4PA 3NBIA 1VF7A 4YHHQ 3KF6A 5KNBA 1E2VA 3U4VA 3QJYA 2WB1G 3S2DH 1EQVA 3RMHA 4B3SQ 4JI1L 4JI4L 1DXMA 1Y14B 1I5FA 4HIOA 2WKDA 4FF4A 1FGBD 4CDFC 4LF5L 1CKMA 4LF7L 2ZXRA 3V96A 3NCVA 2OPUA 1YZ6A 4DR7Q 2E2IB 4Y52H 2E3UA 1CUKA 2PI2A 2DNEA 5FO9B 5K36H 4DR6L 2B2VA 1MKHA 3H3VI 2NVTH 2OT2A 4DXGA 1VQEA 3MA2B 5CORA 4B3MH 1W3SA 1Q46A 3GD7A 3T1YQ 1TXYA 3WOEA 5T1IA 2NVYB 2ZJRA 3HOYG 2X06A 5G3LD 3KJPA 3K7UC 5LMNH 1QB5D 5CV6A 3J80L 2E5LQ 5GADC 2ZT9C 1YVCA 4OWWB 3SK6A 5IYDH 3FMCA 3J80c 1SYDA 1A3TA 4G7ZC 4KHPQ 4EVOA 2AWOA 3Q6SA 4PV1C 4PZ7A 4Y7NB 1HTLD 4KN7C 2EJGC 4DV6Q 2KCCA 4PMCA 3J7ZC 2LS01 1II3A 3SK8A 1CFMA 1EOTA 2WAQB 4OWXB 4KD4A 4P75A 1B7YB 3TSSA 4X66Q 2DN8A 2C5CA 2EY5A 2JA8H 4IPCA 1IBML 1ZTGA 3QO2A 4YY3Q 5IT9E 1Y1VH 3W1GA 1HCZA 4IPDA 3PO2B 5K5PA 3FKIH 2RBMA 3ONAB 1SEIA 1VQ6A 4DUZL 2BH8A 4PMBA 2KOLA 3WOFA 2F0DA 3AFPA 1K8MA 1V1OA 2VQFL 1HNXL 1HH2P 4HEDA 4DV5H 4MN3A 2EIFA 3ERQA 2L0CA 1YJNA 3H94A 1XMQH 4KTAA 1CA6A 1KRTA 1X4MA 1G8ZD 1TVXA 2G9HD 3M85A 1EWCA 2CKZB 1FJGL 4DV4H 3CP0A 2WB1B 2PZTA 2Z9HA 2LTMA 5AFWA 1PH8A 1IZ6A 1C9OA 3M9BA 4XYOA 3K57A 4DUYL 1Z6HA 1YEZA 2WINB 2HCCA 4JCVE 1LACA 3T1HL 1W6JA 4HJ5A 3W1BA 4P2CB 3Q0AA 2EZVA 4OO1I 1VCIA 4YHHH 4RKBA 3S16B 3GTGH 4RGTA 4B3SH 1ZYRC 1D5MC 2PNHA 1SE8A 2R3ZA 3EBEA 5JPNC 3OTOQ 2ZTCA 3TN2A 4CKEA 2HDLA 3URYA 1DOMA 1YNJD 2E75C 4FJSA 1GUWA 2PCFB 4J15A 4BBRH 3NELA 3VYUA 4JI6L 3A5UA 1K83H 2EYOA 4A3KH 3K5LA 5I9OA 4JOIC 3AFQA 1SXTA 3KDFB 2NUCA 1HA5A 2VUMG 1Q3LA 3FRPB 1WTPA 5E3FA 2JA7G 2Y0SB 1PDQA 3GTLB 3GTPB 1SE2A 3T1YH 3T13A 4EGVA 2ZTDA 3MAQA 5C4HA 5E7NA 1HTPA 2E5LH 2EYFA 4GKJL 3RNUA 1A6XA 2FMRA 4O2DA 1ICWA 1N36L 3PSIA 4HAEA 2HIXA 3I8ZA 3JAML 2XIWA 4L5QA 2RKSA 4DV2Q 2IHEA 2N49A 5BN3A 3JAMc 4A3EG 4DV6H 3S2HH 1KXLA 1B3AA 2GA4B 3ULLA 3H0GG 4DNRB 4XQJA 3R2TA 4GN4B 1HZCA 4K14A 4LF8H 4GKKL 4A75A 1HRJA 2DGYA 4X66H 5AJ3L 4JG2A 2EYLA 3QG1A 3GTKB 3OSSD 3FPPA 4K0KQ 5LMUQ 2EOTA 3B6YA 2JE6I 3G6EA 4IN3A 1U4PA 1N32H 1K0RA 2UUCL 1ASZA 4OX9Q 3ULPA 1IBLQ 2P5ZX 1EY0A 1OXSC 3K7AB 4DR2L 1UE5A 1E22A 2Z0SA 1WTJA 4OWTB 3EFXD 5NUCA 2EJFC 1NTGA 1TS2A 4RH6A 5IYCH 1Z9FA 3SDZA 2JA5H 2UUBH 1CQVA 4ZUJA 5JEAG 3ER0A 2DJFC 1BF4A 2FJ2A 4FXKC 1HR0Q 5EJWA 2KHIA 4OO1H 1IXRA 1B9MA 5CC4A 1X9NA 3M3YH 3AMUA 2E2JH 4XT1B 3I55A 4FXGC 1MSGA 3PMFA 4WFN3 4LIJA 1U4MA 4JVHA 1VQDA 1SR3A 1EWHA 3M4QA 5D3DA 4B3RQ 1PYBA 1SNMA 4F8MA 1ESRA 4JV5L 4OD6A 1IKMA 2A1AA 1XNRH 2P2RA 3KBGA 2XN9C 3T16A 1XPOA 2K1HA 5IWAH 1LV9A 3HOUG 2N8NA 4AH6A 1ET6A 2L5TA 4JC0A 3MHBA 2KEDA 1TWGB 4LJZC 1XPUA 1MSZA 3SHLA 1B1ZA 4A3GH 3CCMA 2JA7B 1AH9A 1VQ5A 3KDFA 1JE4A 3V05A 2CH4A 4JOIA 2NVXB 1EY5A 3CRKC 1L0YB 5C3EB 5JEAJ 5IGCA 1O7IA 1EUJA 4DU9A 4A3LG 1PVOA 4RHSA 1M90C 4GN5A 4B3ML 3ND8A 3K59A 1TWAH 5FJ8H 4IPGA 4TVAB 1K9MC 1ENAA 5LMNL 1JC7A 2AQ1B 2F1MA 3H0GB 2CCZA 3S1QH 1IL8A 1HNWL 2XRQD 1YIJA 1QUQB 3VYSA 1I6UA 4LUVA 4RGMA 3QIAA 5C4JB 2JA6H 1VQGA 4CBVA 2QEXA 5J1ZA 1LUZA 2N88A 2YTVA 4BA2I 1V8QA 4DV2H 1SYEA 4L5TA 1B9NA 3HEJA 2XGTA 3MC0B 1PH1A 2DY8A 2BH2A 1BCPD 4JYAH 4K2LA 1K1GA 1KDBA 4B9XA 1MBYA 3SXHA 4K0KH 4ID6A 4LWCA 1EY9A 3X3MA 1G6PA 2Q8TA 3GTQH 2VKCA 2MO0A 3HOZH 5C3XA 1DM0B 4A3IG 4QQBX 2OPVA 1KNEA 4OX9H 3PIOA 5M3FH 3QD7X 1IBLH 3CC7A 1RTNA 3J80i 3A56A 2AUKA 4JI7H 4H02A 4A93H 2IW3A 3DWQA 4DV5L 5DNFA 1I3QB 1XMQL 1IW7D 2YV5A 5C5LA 1IYVA 1CTMA 4WJWA 4RA8A 1HR0H 2CQAA 2KECA 3CCLA 2E2IH 2HQEA 5IP9G 4DV7Q 3CRLC 2QKIC 3HOUB 3NWTA
chains in the Genus database with same CATH topology
2B3GA 2FXQA 4XIGS 4A4IA 3J81L 3PIO3 1JQYD 4QGUA 4UP7A 4C3JG 2L55A 3J81c 3A8IE 1V9PA 4AYBG 4YHHL 1NR4A 1RCVD 2RSOA 1PTOF 5COYA 1CKOA 4B3SL 3HOWB 1HZBA 1D8LA 4DK3C 1HNZQ 4Y7NH 5D3IB 4QUCA 1VQOA 1WD0A 1SEBD 1JT8A 4LF4Q 3BU2A 4BBSH 1DD2A 1VQIA 2LY7A 4ALPA 3TZUA 4YWLA 3WWVA 2CQOA 4QIWE 5ISRA 3C3LA 1AP0A 1AZQA 1B8AA 1QUQA 3HP3A 2B8FA 2I5HA 3PO2H 3T1YL 2LFNA 1T5XD 2RCNA 4WANA 5C6AA 4UAIA 3J80E 4HSPA 2E5LL 3IKJA 4HCEA 2R92G 3KUPA 4X62Q 2F0MA 2OQKA 1EY4A 4KHPL 2NTSA 1U0LA 4G57A 4NB3A 4DV6L 1WTWA 1FL0A 4NP5A 4A3IB 4BY7G 4KY7A 3I4LA 3NE5B 2E8GA 1WYDA 1QILA 2EYJA 4X66L 3NEMA 2YTXA 4IFDI 4RGOS 1PH5A 2PMZB 1HPCA 3U4ZA 1H9SA 1TWFB 1PLFA 2X6GA 3PF4A 3A74A 2QCPX 1ENFA 5EPKA 1EYCA 1EL0A 2F4IA 3D4DA 2Q2TA 4U68A 2UUAQ 2Q8RE 2FFKB 3PUZA 1PV4A 4F7XA 1PFMA 1TKWB 3JAMi 4LAAA 2NN6H 1GHJA 4K8IA 3G6JB 2A8VA 2D0PA 2PZWA 4IQZA 3CW2C 3LWEA 2XWBB 2IL8A 3TP5A 2B63G 4ZRZA 2R93B 1CQFA 1A8VA 1XWEA 3BVGA 5IYBG 2D5DA 2RVLA 5A2QL 2ATWA 2MFIA 4JI8Q 4C3JB 4RHRA 1N34Q 3HOYH 4AYBB 3A7LA 1JB7A 1Y8PB 1S40A 4JI0Q 4EQOA 4QUFA 1LTRD 1V1PB 1TY0A 1VQBA 1BQQT 4A3BB 1UE1A 1WTVA 3PV0A 3GTLH 4KKTA 3PUYA 2F4VQ 5KYIA 1STBA 1SNDA 4X3TA 5JJLA 1LABA 1FYCA 3E9IA 1J4WA 3TQYA 3BZCA 3D3RA 1K8GA 2MHVA 4KD3A 1YHAA 2JP1A 3KOJA 3OTOL 1E7ZA 3KK7A 1WCMG 2JXMB 4BA1I 3KF8B 3GTJH 1XTDA 4V190 1CHPD 2WIIB 3SE0A 3R3OA 3A54A 4A3JG 1BR9A 2IX0A 1PZID 1IBKQ 2R92B 2GVBA 3I4NG 2Z4HA 3UDXA 1PTOC 3FDTA 1EYDA 4BY1G 4M1UB 3PGZA 5GAHC 4GZYC 1P8LA 4UP9A 1PTOB 1VMCA 2SNMA 5GROA 3Q22A 2ZXPA 1WI5A 4BY7B 5J3BA 1Q86C 4DAVA 3D6CA 4L8JA 1EOVA 2UXCQ 2VW9A 2RF4A 3NK9A 3JAME 4GS3A 3RLOA 3FVQA 4DV2L 2M2LA 2K5VA 1TWHB 1VQHA 2YU9H 4QF4A 2KJXA 2RDGA 3PUVA 1STAA 3TP6A 1X3QA 2KENA 4L6TB 5KNDA 5C4ZA 4C3IG 4K0KL 1J5KA 1A62A 1ZEQX 1X3EA 5M5XB 3PCOB 2R7FA 3Q23A 3NPPA 1E1OA 5FLXL 4DR4Q 3HGBA 4OX9L 1IBLL 1EZ6A 4WORA 5FLXc 3AU7A 2B63B 1XMOQ 3EA6A 1S72A 1D5ZC 1CKNB 3U58A 1QE6A 4JI7L 2QNDA 4A3MH 1R4PB 5C0XG 2JJQA 4YCWA 3T4AC 3DM1A 3G71A 1SYBA 1TWGH 3U9SA 1UWVA 1HQMC 2VUMH 2AHOB 4XDXA 1QCBD 3C1FA 2AQ3B 1HR0L 3M4YA 2IT1A 4KN4C 3VDYA 1E1TA 2R7DA 2VB3X 4J8QA 1V1PA 2YQRA 1V1QA 1SYFA 4ZAIA 3AYHB 4XTCS 3DEOA 3IAYA 1PYWD 1WTXA 2KHJA 1PRTD 4RMFA 1GO3E 1B4OA 3KBXA 4BWGB 3M4OB 3GTOB 3OSOA 2JQOA 5EAYA 3G7LA 2SDFA 3VR6A 1EZ8A 1AE2A 1STEA 4XYQA 2A68C 1WCMB 1I6VC 3F8TA 2HCIA 4K2KA 4A3EH 3EJIA 5IGDA 5IIFA 4A3DG 3H91A 3H0GH 4PG3A 4FF3A 2TSSA 1PA6A 3CMEA 1L0XB 4A3JB 3LWUA 1NMGA 2VNUD 3KF8A 1VQ4A 3I4NB 2EQSA 3E0EA 3IL8A 2FINB 2RDHA 4BY1B 4LUOA 3TZDA 4DXFA 2ZXOA 5ELNA 1IW7C 1S5ED 1TS3A 1K8AC 4R4TA 4DK0A 2F0UA 2D0OA 4C1NK 4DR1L 3PUXA 2ASBA 5JOBA 4ZK9B 1N33Q 2F0PA 2A69C 4ZKCB 1JWMD 3OPOA 4KHZA 3DLLA 5JEAH 3J81i 2BE5D 1CA5A 1X3GA 2B2YC 2PY9A 2O2LD 1JWUD 1XJVA 3A7AB 1F9PA 1OXUA 3OW2A 2IY5B 2ALYB 1F2MA 1YNXA 4B9WA 1HXYD 2Y0SG 3E0JA 1Q8KA 4C3IB 3KLSA 5C44G 1E0BA 2FMMA 1I3QH 3H15A 2D62A 2AMCB 1EQTA 1EYGA 2QDBA 4DNIA 2HQLA 2UXBQ 3F2BA 3HOVG 3CF5A 5I2YA 2F0WA 3GTMB 1YNND 2H4OA 1CKNA 3TRZA 4KK7A 1CSPA 1VQCA 1PH9A 3RLNA 2K01A 3MFGA 2Z1CA 2K03A 5C3WA 2JSOA 3MXGA 4X3SA 5I6YA 1KAAA 1L2FA 4HMJA 4A3FG 5IOCA 4A3LH 2HT1A 3CCJA 1QVCA 4DR3Q 2OXPA 4IFDG 3IRBA 3GP7A 3UDGA 2HIVA 4WRDA 3S17B 4DV7L 1HQRD 1QNUA 1O7LA 4A3DB 1Q1BA 5ELOA 1SMYC 4NXMQ 4DAMA 2A6ED 2MP1A 2VY3A 1JORA 2OEOA 2K28A 2H5XA 1LTBD 3J81E 1RF2D 1WVLA 2VS1A 4PNYA 3IFDA 4H13C 1GM5A 4K6LA 2ZJPA 1LT5D 2F0IA 2B2UC 1TWCH 1W2BA 4N9TA 3H3VH 4LW1A 3KLSX 3K5NA 3P7JA 2E2HB 3D4RA 1XTCD 1SNOA 1V43A 2QILA 2Z6KC 1HNZL 2SEBD 2F0KA 3DUZA 4MIUA 2CWPA 3DM3A 1EFWA 1B50A 4LF4L 4A3IH 1SYGA 1VQKA 2CVRA 1A63A 4IUUA 3L7ZC 5H1SE 3BVZA 4BXXG 2M9VA 4H0LC 3NHHA 1Q8IA 1ILPA 1G91A 1KD1C 1RD9D 1LTSD 1TWFH 2B2YA 1WD1A 5C44B 5C4XB 4DPGA 1J8IA 4IFDJ 4X3UA 4HJ8A 5C3EG 3L9AX 4G7HC 4MNOA 4JI5Q 4R4OA 1IYUA 4X62L 4B3TQ 5IP9H 1STGA 3HOVB 2K14A 4C2MH 3TP8A 2L15A 4DN4M 5ELFA 1L0WA 4FO2A 1JOOA 4R4IA 4OL7A 3BZDB 2KHSA 2V1CC 4R4CA 1VQAA 5G3LF 2GN5A 1BNZA 2FMCA 1XNQQ 1HZAA 3GDEA 1MI2A 2A74C 3U50C 2IWHA 4HIKA 4A3FB 1QJOA 4X64Q 2R7ZG 4P71A 2CTFA 1R4QB 3RN5A 1MGSA 3VR5A 5JPMC 3M4PA 1ZXTA 5IP7G 2I5LX 1EIFA 1CZGA 1SNCA 2UUAL 4J1MA 5M5WB 1PZJD 1LT6D 2QEJC 3I91A 3STBD 2NVQH 5JJIA 3RZOB 4KMUC 2B39A 2UXDQ 3PUWA 4E6IA 4IPHA 1JJCB 3CU7A 1VQ7A 1EY8A 2CW0D 2A5HA 5A2QE 4JVYA 1AE3A 4JI8L 4QL5A 1N34L 3CQZB 5E4XA 3K8AA 4O42A 3DMUA 5A35A 4JI0L 2XVSA 2RHSB 3OOCA 2IHFA 2R92H 1ET9A 4APVA 1BBUA 3RZDH 3TS2A 2F0EA 5JVH3 1DONA 4ULLA 1J5EQ 3CCEA 5J39A 1TQOA 1ZZIA 2B2UA 4BY7H 3R93A 3S14H 4NXNQ 3I73A 2DGRA 1YHQA 2V4DA 3TEHB 3KLWA 5M5YB 1FR3A 2Z6KA 4KHVA 1G291 2X69A 3HG9A 5KYLA 3CCQA 3VKEA 3BYYB 2EYMA 1AZPA 1Z47A 2VL6A 1PFSA 4X65Q 1S5DD 2O5JC 2CTJA 5EBCA 1SNQA 1JICA 3HOWG 1IBKL 1TS5A 4H44C 1O7ZA 1Y1VG 1E3PA 2OTJA 3HZXA 1S5BD 5GQOA 3CPWA 1HZ9A 1CK1A 5EPJA 1Y8OB 4CHTB 4QB4A 2N55A 1DTJA 5IYBH 2UXCL 2AXYA 3BZKA 3JC66 1LTID 1SDFA 5C0XI 3NP8A 3PIPA 1VQLA 3HKZE 1GKHA 1KDCA 3J7A5 3X3NA 2F0FA 1LM0A 2ZM6Q 2R7ZB 1EYAA 4HJ7A 2RDFA 3VR3A 4QMFB 3S1RB 4FNFA 4FVMA 1KRSA 1H9RA 3EVQA 3S2DB 1B2TA 5IY0A 1EWIA 3E6ZX 2HH2A 4LUZA 1JMCA 3M4OH 3RUZA 3GTOH 5FLXE 1UNSA 1AW7A 2C9OA 4LFCL 1WTOA 1XMOL 2KQ3A 4DV0Q 1D2BA 3DWAA 1VS0A 1KQSA 1D1IA 4A3JH 4NDXA 4KJOA 2NVTB 1D6EC 2MNAA 3PIP3 2MGSA 1BVSA 4JK1C 3I4NH 5CYUA 2NZOA 3NSWA 4K6DA 5M9OA 4RCOA 4RGNA 3I4MG 4JBJA 2BDOA 2K5WA 4XXEA 3OIPA 2VB2X 1MJCA 5CMDA 4GOPC 2R6GA 4N9PA 5E1FA 4F88A 5CBEE 2R93G 4GOPB 3NENA 3SEBA 1TUAA 3A8JE 2KCTA 4CKBA 2QF7A 4C56C 2NVYH 4WJ3M 4YCUA 4EQ5A 4IUPA 2K5HA 4CJ1B 1C8CA 2IJ0A 4Z9CB 2OQ0A 4KJNA 4A3BG 3UI2A 5BR8Q 1Y1VB 4UY8C 4C3IH 3HOXG 3I72A 4DR7L 3J7YW 2WAQE 1AFPA 1Q82C 2X6LA 2AWNA 4QJFA 4FP5D 3RLFA 1RODA 4NMZA 1LYLA 1N33L 1BUVT 2OWOA 2JZXA 2NYZD 1ASYA 4DR5Q 4DAPA 1C4QA 2A6EC 1DGSA 1NY4A 3ND9A 5IYCG 4H7BA 4KKUA 5KRUA 1QZGA 2WKCA 4JBKA 5D14A 3TMEA 1C48A 1KHMA 4IURA 3RD4A 2A6HD 2MUYA 1VF5C 1U4RA 3S1MB 4ME5A 1I50B 2HUGA 3CPFA 2ID0A 1S5FD 4LFBQ 3NQTA 5T1GA 1C7YA 3S17H 2UXBL 1D5XC 1Z7TA 1YNJC 1M8AA 4IUNA 3WDNA 2FHTA 2WB1E 4A3DH 4YY3L 5M3MG 3F2CA 1N36Q 1I94Q 1OXTA 1O80A 3L2PA 1OO9B 3SGIA 1EEFD 1PFBA 2PQAB 2RSNA 2Q8IB 4GNXC 3I4MB 4BBRB 1SE3A 1SFOB 1K83B 1DZ1A 1BCPF 4GNXB 3S16H 2PPBC 1NR2A 3K5OA 1A2TA 1X32A 5EKKA 1SJHD 2NZHA 5IGFA 4A76A 4DR3L 1EEID 1ZYRD 4DR2Q 3SVMA 4AQYQ 4GOPA 2CTKA 4TRDA 1ZZKA 2EXZA 4KY6A 4NXML 1UEAB 4I65A 4NKLA 4ZQ3A 3FPUB 2E74C 3L3OC 4MHEA 3S2HB 5C44H 4DV1Q 3GTPH 3HOXB 3S9WA 4IALA 2JA9A 4WJ4A 3E9HA 5JAVA 4RFBA 3MXNB 1NMFA 2EYHA 4L63B 2Q2HA 4L5RC 5FLMG 1EQRA 3CMAA 3Q8DA 3KLRA 3D31A 4KY5A 3R8BA 2I46A 4DGZA 5I6WA 4JI2Q 1SLJA 3KYHC 5KIXA 2KA7A 4JV5Q 2XSCA 1KC8C 1X3FA 4K5WA 3CCVA 3DWPA 1A3UA 3GTKH 4HSVA 5HURA 4TQUS 1RTOA 4YWKA 1N9WA 4A3FH 1KHIA 1KL9A 3VA5A 3AQQA 3KF6B 5I9PA 4G4KA 1S4ZA 1PFNA 4NW2A 5FO8B 2EXDA 4HN7A 4ME3A 3BVMA 3K7AH 4A93G 4JI5L 2PW5A 3M3YB 1NSNS 4GLVB 2CHBD 1JOQA 1HUMA 2ES2A 4IFDH 4B3TL 1I4GA 4L5SA 1DT4A 2LXKA 4UP8A 4NPSA 2Z8LA 1YBYA 1ZZJA 1XPRA 3G48A 2B2VC 3N6RA 5M3MB 5HGTA 2K50A 2GVAA 2ZTEA 1EY6A 2L1BA 1OXXK 2JVZA 4FDBA 1I6HB 1LT3D 1X54A 3M7NA 3J7AV 3F2DA 2JK8A 1ZKOA 2H1EA 3K58A 4P74A 1XNQL 2B29A 2PQAA 1I4XA 1PXUA 1R9TB 5LMUL 3S1NB 5HY6A 5BN4A 4GNXA 1DCZA 4K5XA 4CGYB 4RG1A 5FKAC 1VQ8A 1X3PA 1B44D 1DYQA 1GJXA 2XTIA 5EKIA 5M5YH 2CPQA 2MPMA 4BXXH 2UXDL 2SOBA 3HS0C 2EY6A 1OTCA 1TWAB 1EY7A 2JA7H 3DXJC 3TS0A 4BBSG 4LF6Q 1LO5D 3MVVA 4PMWA 1BBWA 1NAPA 3S1QB 1H95A 2NVXH 3P75A 5C3EH 1STNA 2JA6B 5CV9A 1BCPC 2F0GA 3A55A 2K5QA 3MXNA 4X3KA 3HKZB 5LMNW 4B3RL 1BCPB 1WOCA 1I4RA 1J5EL 4OONA 1FNUA 1SJED 4X6AH 2HH3A 4NXNL 1FGUA 4KKSA 4DV4Q 3QOLA 5C4JH 4UDUC 3ITPA 1QVFA 2C35B 1PH3A 1BO0A 1HHVA 1H9KA 1Y1WG 3EQLC 1HJPA 1FNVA 1Q90A 4X65L 2R7ZH 4IJLA 1JB3A 5C0XJ 3S1RH 1IHZA 3CXCA 4A93B 1JJ2A 5IP7H 2N78A 1AN8A 3VA7A 1RJTA 1KDAA 4LFAQ 2LSSA 1X56A 1MD2D 4HJAA 1KABA 5EKLA 2F03A 5DM63 5HGQA 1F9QA 3TDQA 4PZ8A 3TBIB 3C2PA 1Q7YC 3J81j 2NN6G 2F3IA 1UE6A 1TU2B 4RKLA 3GV6A 1UAPA 3CD6A 2PQUA 3I7FA 5C4XG 4A3CG 5EPLA 3NQIA 1NBWA 2J0TD 1EIYB 1LTGD 4KLKA 3NTIA 2ZM6L 3CAMA 1KTKA 4YCVA 1F9RA 2ENBA 1GOZA 4NBQA 1TT2A 3U9OA 3HOUH 3OHXC 3MEFA 4EQPA 5D65A 4FF1A 5EBDA 1EIGA 5CV8A 2BDNA 2K7VA 2AKWB 1GUOA 4LK1C 1WTQA 1PH2A 4BBSB 1MSHA 4IUVA 2LKVA 4LF8Q 2MJ8A 2EYPA 4DV0L 4QIWB 2ANRA 1X65A 3HOWH 1DOKA 1P16A 5CR3A 2HHHQ 3S15B 2ICEC 3ERSX 1N32Q 2OCEA 4O1NA 4Q0FA 4UPAA 2IX3A 4POGA 4XQQA 1ENCA 2A6HC 4HIMA 1KLUD 2F0QA 1A3VA 5LL6X 1WVNA 3KJOA 3MXUA 1J9OA 4LNQA 2K04A 2UUBQ 1X55A 2XWJB 1Q1EA 4KV6A 4G7OC 1Y1WB 4K5VA 3MFYA 2KCNA 5KGUA 2L4NA 1JE5A 1VQMA 4U673 1M1KC 2A19A 3F1ZA 5CGKA 1PYSB 1EIHA 1PRTF 1RHPA 2E76C 5BR8L 2K5NA 2KUMA 2B2WC 2QA4A 4OXPA 3NBHB 2K05A 2D2CC 3N52A 5DAUA 3S1MH 1XX8A 2K33A 1STYA 3IFTA 2VQEQ 1SBBB 3OMCA 4JBMA 1XNRQ 1I50H 1XXGA 2F0SA 1TR5A 5IWAQ 1WE8A 2L11A 2PMZE 4C3HG 2ICIA 2B2TC 4ZUIA 3PO3G 4DR5L 2MJHA 3ZYYX 1A15A 1EFID 1OXVA 1SROA 3CCUA 2NBFA 4OGQC 4A3MG 1BOSA 3I4MH 3HOYB 4HCSA 1SFOH 3AEVB 4DNTB 2I5MX 2KVMA 2F0TA 2F0OA 3OIQA 1GD7A 2PYKA 3SK4A 4QCLA 1SRUA 1QZHA 1X4NA 3K6OA 2R93H 1BDOA 4IOAA 1I4HA 1HA6A 2EJMA 4C3JH 4LFBL 4AYBE 1HFGA 2BL5A 4AIMA 1EC6A 1I94L 1H9JA 2K32A 1HUNA 1T9HA 1NUCA 1QOHA 5FOBB 4A3BH 1IL2A 2IX1A 2Q2IA 4DV3Q 2WFWA 1G6ZA 3NTHA 3HOXH 3O13A 4XQNA 3BDCA 3GTJB 3K5MA 1EQQA 4KI0A 4JYAQ 1SE4A 4QMGA 5JJZA 1KAWA 3GQBA 2WV6D 1YHBA 3D8GA 1QWYA 3CC4A 2VXWA 1XYIA 3ULJA 2K6AA 2NTTA 1NCVA 3VYTA 3Q24A 1FD7D 4FYDA 3L0OA 5K36G 5EGTA 4C1NI 2UU9Q 2AUJD 1KLGD 4AQYL 4JI7Q 1CT1D 3W3AA 1FVIA 3UDIA 2MO1A 1K8OA 1H9MA 3TP7A 2PI2E 4R1JA 2YU9B 1PTOH 4HR7B 4DV1L 2F4VL 5FK9C 3T56B 1GUNA 4EQNA 1PTOD 5IYDG 3NBHA 3OW7A 3H09A 1CZWA 1GUSA 2G9DA 2B2WA 2M00A 4JI3Q 3V2TA 4C3HB 3S24A 4LF9Q 5M3MH 1TWHH 1ONLA 1CHQD 3U1KA 1F2YA 4J6HA 3PO3B 4JI2L 1NJIC 3A8KE 2JA8G 1I6HH 1JOKA 4A3MB 3OWFA 4GLAC 2B8GA 2YYZA 1PH7A 4S3SA 2J7ZA 2O4XA 2K75A 2B2TA 2HDMA 2Z4IA 3P20A 5FO7B 3D0FA 4JI1Q 4JI4Q 1LTTD 5M5XH 1R9TH 1PH4A 3R2IA 3FKIG 3S1NH 2VUMB 5DM73 3OMGA 1PRTC 1QG7A 4LF5Q 4LF7Q 3AEVA 3EROA 4P72A 1E24A 3UE0A 2B63H 1PRTB 3I4OA 3KFUA 3K80C 5IGGA 5IGBA 3BYTB 1IYJB 4DR6Q 4DAYB 4DR1Q 4CKCA 4PQXA 4MZ9A 3AB9A 1HR0W 3K81C 1STHA 1LTAD 4ZKBB 4BS9A 3VYRA 1RL2A 3A5ZB 2IPKD 1VIHA 4A3EB 3NUCA 2R61A 1Y69U 1RKNA 2K5DA 1BBXC 3FHWA 1CSQA 4DR4L 5ELCA 2PO4A 5FLMH 2I0QA 4OIKA 4FF2A 1CM9A 1WCMH 1SN8A 2ZJQA 3F2UA 3BDLA 2RHQB 1B70B 2F3WA 2BE5C 2QGQA 2A68D 3PF5A 2YTYA 1IBMQ 2JEAI 1YI2A 5IT9L 1G51A 4B8TA 1A2UA 4WALA 2A73B 5F2DA 2PZUA 4BBRG 3VR2A 5IT9c 4BY1H 1W6KA 4M8AA 1VDZA 5EQ0A 4LF6L 4DUZQ 5JVG3 1S5CD 4HIDA 4A3KG 3DEPA 1H9SB 3I56A 4GN3B 1PZKD 4TSSA 2VQFQ 3LX0A 1C0AA 1HNXQ 2F0NA 3CCSA 2BOSA 5I2XA 1EU4A 3E5SA 4QY7A 2I07B 1YNNC 2F52A 4PZ6A 2A69D 2EPBA 1FJGQ 2JA8B 1WJJA 1SMXA 4DV4L 1UEBA 3NWSA 3C1EA 2NN6I 2ANNA 1YITA 2F0VA 3ICEA 4R8IA 2OF1A 4OIJA 1ILQA 3FKIB 5GAEC 4DUYQ 3T1HQ 2F0HA 4RWSC 3G4SA 5KNCA 3D6WA 3EIVA 1VMPA 5E4WC 4DK6C 5I4DA 1EU3A 3I70A 1MJEA 2NWGA 1SAPA 1G2SA 4DF7A 2KCMA 3NTKA 3MEHA 1JR0D 3GTMH 5C0XH 1B53A 3BJUA 5IODA 3TREA 4LFAL 2F0JA 2F3VA 4CJ0B 4Q5VA 2Q2UA 1D7QA 3QWNA 2EVBA 4ILWA 5C5MA 1GUTA 2RA4A 2CTEA 4DAYA 1GXDC 1S3OA 4HJ9A 2XRSD 1L1OC 2JA5G 3T53B 4JI6Q 3RR5A 2PQEA 3CHBD 4JBWA 3W5OA 1JWSD 1L1OB 1K73C 3MZ5A 5IGEA 3A0JA 4OO1G 4K8JA 3S15H 1ML0D 1TY2A 4R9WA 2DNCA 1VQJA 1N8RC 1JCKB 3H3VC 1E2ZA 1Q12A 4P73A 4HMIA 3GTGB 1LT4D 3BDOA 1TWCB 5CV5A 5ELBA 1G2TA 4GKJQ 2N3SA 3M7GA 2E2DC 4DA2A 3P1HA 1VQ9A 1F77A 1J6QA 1SMYD 3CCRA 1Y1WH 1K3RA 3ZJYC 4ODGA 2EDGA 1QNKA 3T51B 4LF8L 4A3KB 4GKKQ 2K52A 3J7AF 5AJ3Q 1MIUA 3HKSA 5IE8A 4A3GG 1E2WA 2EY1A 3OWEB 2E2HH 2OTLA 2HHHL 4IUTA 2DY7A 2LMCB 2TMPA 3MTSA 2UUCQ 5DEHA 1N32L 2CTLA 3NXWA 1O7YA 3BG3A 2K1BA 1BXTA 2UUBL 4C2MB 3GO5A 5FJ8G 4IUQA 2MQHA 2PNRC 2Y0SE 1Y8NB 2L12A 1T5EA 2DUDA 1VQNA 5C4XH 1IKLA 4A3CH 4LMQD 2O5IC 1I4QA 2BA1A 4EX5A 1F2LA 2XNAC 1FNWA 2JA6G 1VQFA 4CJ2C 4GLXA 3HOVH 2BA0A 2AQ2B 3SK5A 1PMRA 3HKZG 4MTNA 3H6MA 1NE3A 1GHKA 1SSOA 2BCOA 1LTLA 2VZAA 4I7ZC 4IZ8A 4R4QA 4V0BA 3STBC 1UUPA 5CV4A 5JJKA 2EY2A 2VQEL 4OHJA 1XNRL 1PH6A 3UE1A 2CW0C 1X6OA 2JA5B 5IWAL 1YJ9A 1A0IA 3W2DA 3RN2A 1VQPA 2NVQB 3HOZG 5LL6S 1GVPA 3K0XA 5M3FG 3BS1A 4POFA 3VR4A 4AM3A 4F87A 4ABNA 3DHQA 1VIGA 1L1OA 3K0YA 1TIID 1KIXA 2CWAA 2WACA 1Q81C 2KBNA 1RIPA 2E2JB 5KEEA 5BN5A 5M5WH 3D4WA 2JYOA 5GAGC 5TSSA 4DFAA 3RZOH 3I3CA 5CBAE 5J22A 4YWMA 1ESFA 3RZDB 2SNSA 3HFZB 1PHJA 4B3MQ 3SR1A 4R8NA 1RDPD 1U5KA 4IJHA 3MWYW 4FXDA 3MXPA 3OYYA 1BKBA 4ZYSA 2RQXA 5LMNQ 4IO9A 3S14B 1HNWQ 3CQZH 3V69A 1QVGA 4ZLTF 1TS4A 2K4KA 4DKAC 2EE1A 5ELEA 2KEEA 3EN2A 3QB3A 4A3GB 3FP9A 1O78A 4X64L 4TKOB 4DV3L 1F2ZA 3FEWX 1UE7A 1DOLA 3CKIB 1WTRA 4JYAL 3CC2A 2J4XA 2LXJA 3LGJA 2F0LA 5CV7A 4XT3B 4IOCA 2WP8J 4C3HH 5DLQE 3GV3A 3I90A 4HTHA 2WAQG 1AEXA 4LFCQ 1LLRD 3PO3H 4RAUC 4O0AA 2UU9L 1SYCA 2PW7A 4YIJA 5LHY1 1CI3M 1JJGA 1DJRD 4B08A 1U9RA 4DV5Q 2NB0A 3I2ZA 1SNPA 3PO2G 1XMQQ 2D9UA 1YJWA 2JEBI 3QOJA 1M4VA 1KNAA 3LNNA 5ELDA 1HFNA 2NZ1D 1GUGA 1WFQA 3GTQB 3HRZC 4JI3L 4RCNA 1U4LA 3HOZB 4DK1A 3C46A 2L9HA 2CTMA 4LF9L 1F9SA 2CFMA 5M3FB 3UDFA 1D1KA 1I4PA 3NBIA 1VF7A 4YHHQ 3KF6A 5KNBA 1E2VA 3U4VA 3QJYA 2WB1G 3S2DH 1EQVA 3RMHA 4B3SQ 4JI1L 4JI4L 1DXMA 1Y14B 1I5FA 4FF4A 2WKDA 4HIOA 1FGBD 4LF5L 1CKMA 4LF7L 2ZXRA 3V96A 2OPUA 1YZ6A 4DR7Q 2E2IB 4Y52H 2E3UA 1CUKA 2PI2A 2DNEA 5FO9B 5K36H 4DR6L 2B2VA 1MKHA 3H3VI 2NVTH 2OT2A 4DXGA 5CORA 3MA2B 1VQEA 1W3SA 1Q46A 3GD7A 3T1YQ 3WOEA 1TXYA 5T1IA 2NVYB 2ZJRA 3HOYG 5G3LD 3KJPA 3K7UC 1QB5D 5CV6A 3J80L 2E5LQ 5GADC 2ZT9C 1YVCA 4OWWB 3SK6A 5IYDH 3FMCA 3J80c 1SYDA 1A3TA 4G7ZC 4KHPQ 4EVOA 2AWOA 3Q6SA 4PV1C 4PZ7A 4Y7NB 1HTLD 4KN7C 2EJGC 4DV6Q 2KCCA 4PMCA 3J7ZC 2LS01 1II3A 3SK8A 1CFMA 1EOTA 2WAQB 4OWXB 4KD4A 4P75A 1B7YB 3TSSA 4X66Q 2DN8A 2C5CA 2EY5A 2JA8H 4IPCA 1IBML 1ZTGA 3QO2A 5IT9E 4YY3Q 1Y1VH 3W1GA 1HCZA 4IPDA 3PO2B 5K5PA 3FKIH 2RBMA 3ONAB 1VQ6A 4DUZL 2BH8A 4PMBA 2KOLA 3WOFA 2F0DA 3AFPA 1K8MA 1V1OA 2VQFL 1HNXL 4HEDA 1HH2P 4MN3A 3ERQA 2EIFA 2L0CA 1YJNA 3H94A 4KTAA 1CA6A 1KRTA 1X4MA 1G8ZD 1TVXA 2G9HD 3M85A 1EWCA 2CKZB 1FJGL 3CP0A 2WB1B 2PZTA 5AFWA 1PH8A 1IZ6A 4XYOA 3K57A 1C9OA 3M9BA 4DUYL 1Z6HA 1YEZA 2WINB 2HCCA 4JCVE 1LACA 3T1HL 1W6JA 4HJ5A 3W1BA 4P2CB 3Q0AA 2EZVA 4OO1I 1VCIA 4RKBA 3S16B 3GTGH 4RGTA 1ZYRC 1D5MC 2PNHA 2R3ZA 1SE8A 5JPNC 3EBEA 3OTOQ 3TN2A 2ZTCA 4CKEA 2HDLA 3URYA 1DOMA 1YNJD 2E75C 1GUWA 2PCFB 4J15A 4BBRH 3VYUA 3NELA 4JI6L 3A5UA 1K83H 2EYOA 4A3KH 3K5LA 5I9OA 4JOIC 3AFQA 1SXTA 3KDFB 2NUCA 1HA5A 2VUMG