4OO1G

Structure of an rrp6-rna exosome complex bound to poly(a) rna
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
234
structure length
226
Chain Sequence
b'STFIFPGDSFPVDPTTPVKLGPGIYCDPNTQEIRPVNTGVLHVSTAYIDYSSKRYIPSVNDFVIGVIIGTFSDSYKVSLQNFSSSVSLSYMAFPNASKKNRPTLQVGDLVYARVCTAEKELEAEIECFDSTTGRDAGFGILEDGMIIDVNLNFARQLLFNNDFPLLKVLAAHTKFEVAIGLNGKIWVKCEELSNTLACYRTIMECCQKNDTAAFKDIAKRQFKEIL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exosome complex component RRP45
publication title Structure of an Rrp6-RNA exosome complex bound to poly(A) RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/rna
total genus 36
structure length 226
sequence length 234
ec nomenclature
pdb deposition date 2014-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF15985 KH_6 KH domain
G PF18311 Rrp40_N Exosome complex exonuclease Rrp40 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4oo1G01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4oo1G02
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 4oo1G03
1EIFA 1N33L 3L2PA 3GTKH 4LK1C 2LSSA 4OXPA 3CCVA 3STBD 4DR4L 4IOAA 2VY3A 4EX5A 3T51B 4ME3A 4DV5L 4GNXA 3JAMc 1WOCA 1PYSB 4UP9A 3CC2A 4JI2Q 3N6RA 4LF4L 5AJ3L 4XIGS 2R7FA 2GVAA 5J3BA 2JJQA 1Q90A 2KHJA 2E3UA 4DV7Q 4OO1H 2NVTH 2KA7A 1W3SA 2EJFC 4LFAQ 1KXLA 2JEAI 4IPDA 4JYAQ 1IXRA 5IP9H 3W1BA 3BG3A 2UU9Q 4HIKA 1GUNA 1NTGA 4A3LH 1KRTA 3PUYA 3SGIA 5M3FG 1B9NA 2WB1E 3S14H 2B3GA 4B3MQ 3I56A 1YI2A 4AH6A 3I2ZA 3UDFA 3D31A 5IP7G 4YY3Q 3HFZB 4B8TA 5IWAL 1Q81C 4DV6L 3BZCA 4DR1Q 4GN5A 1TWGH 1YNJC 4A3JG 4Y52H 2NVYH 3KDFB 1FGUA 3OPOA 4P74A 4JI0Q 1GO3E 4LNQA 4DAMA 2Q2IA 3M4YA 3KLWA 4A3KG 2B8GA 1PV4A 1N36L 4DV0Q 4GKJL 1SE8A 3I4MH 2BDOA 4H02A 2L15A 3RN5A 2EJGC 4DPGA 1VS0A 3PO2H 3SDZA 1GUOA 4DR7Q 3I4NG 1K73C 4BBRH 1HR0Q 1HTPA 2ZJPA 2VQEQ 4X6AH 4JVHA 1GUSA 5GAEC 3VA7A 4APVA 3ICEA 4C3JH 2K14A 1CI3M 3GTGH 2JA7G 4LJZC 4GNXC 2LMCB 2AKWB 4R4TA 2H5XA 3VKEA 2AWOA 4DK3C 2IT1A 1ASZA 3U58A 4BY1G 2E5LL 3ULPA 4RMFA 1E7ZA 3AQQA 4DUZQ 3GD7A 2D5DA 4LF5L 4YWKA 3HGBA 4A3DG 1EYGA 1XNRL 1K0RA 2KHIA 1H95A 4YCUA 4YCVA 2DNEA 3PO3G 5ELOA 1J4WA 3A7AB 1CSPA 4X65L 2CKZB 1OXVA 5IYCH 2UUBL 4IPGA 4DKAC 1UE5A 2PI2E 1RIPA 4YHHQ 4A3EH 2YQRA 2VNUD 1MJCA 3M3YH 5M3MG 2DUDA 3M7NA 4L8JA 2CFMA 1ONLA 2ATWA 4QJFA 1Q1BA 4JI5Q 3RZOH 1VQNA 4A4IA 1VQ6A 3HOXG 4JBMA 3FP9A 4DR6L 2I5LX 1KL9A 3AYHB 2R93G 3FHWA 1K9MC 5BN5A 1A62A 3OTOL 4A3MG 1VCIA 2BA1A 1S72A 3W1GA 1OXSC 3NBHB 3OW7A 2UXDQ 4OGQC 3FKIH 1QZGA 1YHBA 5IE8A 1A6XA 1Q46A 4LFBQ 1Q7YC 4IFDG 4POGA 1KHMA 4JI8Q 3M85A 4GLAC 4LFCL 4KHPL 5GQOA 3FMCA 2UUCL 3AB9A 3CF5A 4X62Q 4JI4L 2EDGA 3W5OA 1QZHA 1A0IA 4DV2L 5H1SE 3S2HH 4UP7A 3MEFA 3CC7A 1SMYC 1Y8PB 1UE7A 1XPOA 1XMQQ 1K3RA 2KENA 3GTOH 3P20A 4YCWA 1X4MA 4A3CG 4OO1I 3V69A 1HNXL 1N33Q 2K50A 1VQMA 1QUQB 2DGYA 4DR4Q 3PUXA 1VQFA 4DV5Q 1JB7A 5JEAG 2AMCB 5EAYA 3K7UC 1VQEA 4JV5L 4LF4Q 5AJ3Q 2QGQA 4KN7C 2VZAA 1SN8A 1C7YA 3A5UA 4JI6L 1X4NA 3VR4A 3VDYA 1O7LA 3GTJH 2QEXA 4IJHA 1XPUA 4DV3L 4PG3A 3DLLA 1CSQA 1XMOL 3U4ZA 2WFWA 1WVNA 1PH4A 3QG1A 2JK8A 3S17H 4A3BG 4OO1G 2V1CC 5LMNL 4KN4C 1YJNA 1VQ5A 1PFSA 1X56A 2ZTCA 1XJVA 1HZBA 2EIFA 2R7ZG 5IP9G 2ANNA 1YIJA 1VQ7A 5M5WH 3F2CA 3GDEA 3S1QH 3HOYH 1NMGA 5IWAQ 3CAMA 1WFQA 4DV6Q 4AQYL 3PUVA 4LF8L 2K33A 3LGJA 3J81j 2I5MX 1PH5A 3U1KA 2ZT9C 1IBML 2JA5H 1X55A 3LNNA 1DTJA 3T1HL 1FJGL 1GJXA 1T9HA 1N36Q 4GKJQ 1WI5A 4XTCS 1DT4A 4JBKA 1T5EA 3I72A 3KDFA 3CCEA 3KLRA 2NN6H 3HOZH 1ZKOA 3J7A5 3S16H 3I4MG 2A69C 1HZAA 2ZJQA 2AHOB 3DM3A 1IW7C 3IFTA 3PO2G 4IO9A 5FJ8H 2KBNA 2D62A 4BBRG 3I55A 4HJAA 4LF6L 1L0WA 2MNAA 4DUYL 4JVYA 1QJOA 4B3SL 2MQHA 5C0XI 2E2HH 3A8JE 4TVAB 1EOVA 4P71A 3CC4A 2F1MA 4PMWA 3JC66 1WE8A 1CKOA 1NE3A 4JG2A 4BA1I 2EQSA 2E5LQ 2OPVA 4LUZA 2JZXA 4BXXG 3S24A 2A69D 3CRKC 2Y0SE 1SRUA 3W3AA 4PV1C 2YTXA 4LF5Q 4KHZA 2O5JC 1IW7D 1UE1A 3D0FA 4QL5A 5FLMH 1XNRQ 2PQUA 1HNWL 1R9TH 5A35A 3NENA 1PYBA 3HOWH 4X65Q 5FLXc 5GROA 3T56B 1U0LA 2UUBQ 4LF9L 4PZ6A 1HNZL 1Q82C 4GOPB 4G7HC 4BBSH 4R4CA 1TWCH 2PQAB 3PGZA 3RN2A 4OX9L 2FMRA 5JJKA 1LABA 2D0PA 2VQFL 4HIOA 1AE2A 2OTJA 3J7ZC 4A3EG 2BA0A 3RZDH 1GM5A 3CPFA 4PZ8A 2HQLA 3BZKA 2Z0SA 4DR6Q 3VR6A 2YYZA 5C44G 3A5ZB 4DNRB 1YHAA 2YTVA 3OTOQ 5E7NA 1K83H 2HHHL 2CCZA 4G7ZC 2VUMH 1NMFA 3M9BA 3HOUH 2K5NA 1Y69U 1MJEA 1YBYA 4LFCQ 1VQKA 4KHPQ 1Z6HA 3FKIG 4NXML 2UUCQ 1BKBA 4DK6C 4JI4Q 1N34L 3WWVA 4DV2Q 1XTDA 3IRBA 2PY9A 3OW2A 3CXCA 3EQLC 2B29A 1YNXA 4NPSA 1WCMG 5M5XH 1JJGA 3TS2A 2IHEA 2PI2A 2WAQG 1KD1C 4RG1A 1E22A 1HNXQ 4P73A 1B9MA 1N8RC 1P16A 4G7OC 4IPHA 2HT1A 2B63H 4O0AA 2FXQA 3EN2A 1V43A 2BH8A 1PA6A 1LYLA 4JV5Q 1DGSA 1HQMC 3VR2A 1L1OB 1YITA 3QIAA 2ALYB 4JI6Q 1HZCA 1OTCA 1Z7TA 2K5VA 3J80i 5C3EH 4DV3Q 1B8AA 1XMOQ 2NVQH 2BH2A 4JI3L 3G4SA 3F2BA 4H13C 2HH3A 4X64L 4HJ8A 5LMNQ 1G51A 3DXJC 5K36H 1IYJB 2LXKA 1GUTA 1HR0W 2GVBA 5LMNW 2NN6I 2N8NA 1ZYRC 4DR3L 1EIYB 1JJCB 4UPAA 4AQYQ 1J5EL 2IY5B 4LF8Q 2E8GA 4NXNL 3MXUA 2KCMA 3HOYG 2YV5A 3E0EA 2NZHA 1IBMQ 1PH9A 3S1NH 3J80c 2RCNA 1WYDA 1Q86C 3T1HQ 1PH3A 2QF7A 1FJGQ 1VIGA 2R6GA 2JA5G 2BE5C 2A8VA 5BN3A 4J15A 3L7ZC 1FVIA 2KCTA 2YTYA 4KKTA 4JC0A 4IFDI 4A3GH 1FYCA 2C35B 3CCUA 1YJWA 2VS1A 1H9SB 2NN6G 1Y8NB 3WDNA 3TS0A 4DR2L 1M1KC 4LF6Q 3AFQA 4DUYQ 4B3SQ 3HKZG 4FDBA 1X3EA 1C0AA 1JMCA 2I5HA 4R4IA 4L5TA 5M5YH 2HIVA 4A3IH 4LW1A 2BE5D 4O2DA 3TEHB 3U4VA 2IX1A 2CWPA 2JA8H 3EIVA 4GNXB 1EQRA 3CD6A 1C9OA 3PUWA 2EXDA 1BDOA 2GN5A 2JVZA 3A7LA 4DV1L 2HIXA 3UE0A 1LACA 1HNWQ 2EJMA 3E9HA 1MIUA 4QQBX 2R7DA 3A0JA 4A93H 3S1MH 4LF9Q 2RF4A 4JBJA 4AIMA 3HOWG 1TWAH 1HNZQ 3CQZH 4QIWE 1TKWB 1CUKA 2XGTA 3AFPA 2DNCA 1BBWA 2CPQA 1KRSA 4OX9Q 1VQOA 3S1RH 5BN4A 4DV4L 2VQFQ 1IBKL 3BJUA 3A74A 1I94L 4R4QA 1J6QA 1E1OA 3ERSX 2K52A 5M3FH 3ER0A 4GOPA 5GAGC 1YJ9A 4DNTB 1K8MA 1X6OA 2CTLA 3RLNA 5DLQE 1PHJA 2HH2A 1B7YB 3ULJA 1YNNC 1G6PA 4AYBG 2VL6A 2F3IA 1X65A 5HGQA 2HHHQ 2P2RA 1XNQL 1E24A 1NBWA 1EUJA 4JI7L 1EC6A 4NXMQ 3GO5A 1LUZA 5JEAJ 2CTMA 3BU2A 2V4DA 1N34Q 4A76A 1Q8KA 3U50C 2N49A 1UWVA 3I4NH 1O7IA 1K8AC 2JA9A 2JEBI 2ZM6L 3GTLH 3PIOA 1V1QA 4TQUS 3E9IA 4LF7L 3G6EA 1VF5C 4POFA 1IBLL 4A3LG 2ZTDA 2A6EC 4DAYB 4KKSA 1XPRA 4GLVB 2B63G 2MFIA 3GTMH 2Q8IB 1EWHA 2A19A 1VQHA 1VQ4A 2A6HC 2F4VL 2PNRC 1G291 3SE0A 1Z47A 1SROA 3I4LA 3U9SA 1GHJA 1VF7A 3K0XA 4A3DH 1E2ZA 2WP8J 2D2CC 3NEMA 4L5QA 2K4KA 1L1OA 5C3EG 4JI3Q 4KLKA 4X64Q 2K5HA 3Q8DA 2A6ED 1TWHH 3CCJA 2E74C 2OTLA 2ZTEA 1IZ6A 4GOPC 4NBQA 2A6HD 4K0KL 2YU9H 5K36G 2WB1G 4IJLA 5M3MH 3TREA 2Z6KA 1EWIA 4DR3Q 1PVOA 1VQJA 1QVCA 5JJIA 2UXCL 2AUJD 4JOIA 4BY7H 1J5EQ 4NXNQ 3RLFA 3ZJYC 1OXTA 3CMAA 1KIXA 1VQBA 1GHKA 1LTLA 2L5TA 4BA2I 2CTKA 2R93H 1VQCA 4DNIA 4C3HH 3A8KE 4R1JA 1I6VC 5LMUL 1OXUA 3G71A 3S15H 3VR5A 4GZYC 5IYBH 1Y1WH 2PPBC 4B3RL 3PCOB 1VIHA 1IYUA 1GKHA 4DR2Q 1K1GA 2MO0A 5IYCG 5IYDH 4WANA 4ALPA 3K7AH 1H9SA 2OQKA 3CCQA 2EVBA 3PUZA 3UE1A 4DR5L 5C0XJ 4A3IG 4LIJA 4P72A 2ES2A 4DK0A 2XTIA 5JEAH 3A8IE 3NELA 2JA8G 4R4OA 3LWUA 4DV1Q 1PH8A 1L1OC 1PH1A 3F1ZA 1CKMA 3CW2C 4GKKL 1SLJA 1DCZA 2OQ0A 3T1YL 1D8LA 2UXBL 2VW9A 1CKNB 1E1TA 2Z6KC 3KOJA 4QY7A 1PH2A 4A93G 4A3BH 1SFOH 4OONA 1NJIC 3H0GH 5C4XH 4JOIC 1KC8C 3FPPA 4DV4Q 1IBKQ 1X54A 4Y7NH 5GADC 1I94Q 2B8FA 2A68C 1ZZKA 5ELNA 3M4OH 1HCZA 2R7ZH 1VQPA 2D0OA 3KJOA 4C2MH 1D7QA 4IPCA 4KMUC 3I7FA 3RR5A 1OXXK 1M90C 1QUQA 1CFMA 1K8OA 3OYYA 5BR8L 1FL0A 1NY4A 1XNQQ 2JE6I 1MKHA 4JI7Q 1K8GA 1IL2A 2A68D 2CTFA 1Z9FA 3KJPA 3RNUA 3HOVH 3F8TA 1Y8OB 1UEBA 3NE5B 4H44C 1VQDA 2ZM6Q 2R92H 2K75A 1BVSA 1VQ9A 3PF5A 1V8QA 1A8VA 4LF7Q 2N78A 3KF8B 1AH9A 1IBLQ 1VQ8A 1ZZIA 2OPUA 2AXYA 1H9MA 3ND9A 1S3OA 4HIMA 4NB3A 2UUAL 2F4VQ 3PV0A 4BXXH 1E3PA 2KCCA 3TQYA 2K7VA 3BDOA 4A3FH 2JA6H 1PH6A 2NVXH 4L5RC 2CW0C 4QMFB 3H94A 4TKOB 4X66L 1QVFA 4LUVA 4OWXB 4B3TL 4JI1L 1Y1VH 4WJ3M 2I0QA 1ZTGA 3J81i 1Q1EA 1H9KA 3RLOA 3HOZG 3AEVB 3I73A 4OWWB 2E2JH 4C3IH 2RHSB 3KF6B 5C0XH 1SR3A 4K0KQ 2ANRA 1EQQA 2A1AA 2PCFB 5FJ8G 4GN4B 1N32L 5JJLA 4EQ5A 1X3FA 2UXCQ 2Q2HA 4A75A 2E76C 2QNDA 3B6YA 2WAQE 4MTNA 1UE6A 3PSIA 3TZUA 2CTJA 3M4PA 4BY7G 5C44H 1PH7A 2RHQB 2JXMB 1VDZA 5LMUQ 1N9WA 3CMEA 4JI2L 1Q12A 1WJJA 3J81c 3H3VH 5GAHC 5FLMG 2O5IC 3GTQH 2Q2UA 2MJHA 4UP8A 1TXYA 4YWLA 4B3RQ 2OCEA 2IX0A 4GN3B 3ULLA 5IYBG 1KHIA 4DV7L 4KI0A 1Y1WG 4HIDA 2N3SA 4IFDJ 3L0OA 4WJ4A 1WCMH 4JCVE 2DN8A 4L5SA 4LFAL 3CCMA 4BBSG 1BBUA 1TUAA 4JYAL 5C4JH 5HY6A 1ZZJA 4HJ7A 4KKUA 3OOCA 2PQAA 3PIPA 4GLXA 2UU9L 1JJ2A 4DR5Q 5IYDG 5IP7H 1DD2A 1E2WA 1YVCA 3G48A 5KNDA 1QVGA 1KAWA 4AM3A 1I5FA 2Y0SG 1PMRA 4B3ML 4A3JH 4YY3L 1I6HH 1VQAA 1SMXA 1X3GA 4DR1L 3TRZA 1S40A 1YEZA 4GKKQ 4A3KH 3M4QA 3T1YQ 2UXBQ 1HZ9A 2VUMG 4JI0L 3K81C 3HOUG 2AUKA 1I50H 4UY8C 2CWAA 1B70B 3IKJA 4DV0L 1P8LA 2AWNA 4IQZA 1KQSA 1GVPA 3K8AA 1GD7A 1CTMA 4DR7L 1IYVA 2Q2TA 2PNHA 2ID0A 1CKNA 4PZ7A 1HR0L 1GUGA 1LM0A 4GS3A 2JA7H 3CCRA 2VQEL 3H0GG 3CCLA 2ZJRA 5C4XG 3UDGA 2DGRA 4HR7B 1FR3A 2F52A 3GQBA 3HKZE 4DK1A 4IOCA 1YHQA 4BY1H 2NZOA 4YWMA 5BR8Q 1TU2B 3I4OA 4HJ9A 3D4RA 2CTEA 2E2IH 2PMZE 3K80C 1AE3A 1HPCA 4DUZL 1H9RA 1RL2A 1JE5A 3PO3H 4OWTB 3MFYA 1L2FA 2CQOA 3F2DA 3GTPH 3CP0A 2LXJA 2ASBA 2IHFA 1VQGA 3HOVG 4QGUA 1E2VA 3PF4A 3CCSA 3CRLC 3HKSA 4RCNA 1JT8A 4JK1C 3CPWA 2R92G 2OWOA 1X9NA 5IY0A 1DXMA 1W2BA 4MNOA 4YHHL 1U5KA 3ND8A 1TWFH 3HOXH 2UUAQ 1HH2P 5KNCA 2BL5A 1Y14B 4JI5L 4P75A 2QA4A 4A3MH 1O78A 3MXNB 4LWCA 1EFWA 3EBEA 3UDIA 3KYHC 1I3QH 3KFUA 4A3FG 2MO1A 2JA6G 2E75C 4AYBE 4IFDH 3T53B 4X66Q 3JAMi 1V9PA 4I7ZC 4B3TQ 4JI1Q 3H15A 4HJ5A 3UDXA 2UXDL 4H0LC 3STBC 1VQIA 4LFBL 4MZ9A 4JI8L 1Y1VG 4LUOA 1H9JA 4A3GG 5IT9c 3VR3A 2JQOA 2K32A 4X62L 3H3VI 1J5KA 4JBWA 4WALA 1ASYA 5C0XG 4A3CH 1N32Q 3AEVA 1VQLA 3QJYA 1A63A 1YZ6A 1XMQL 1HJPA 3S2DH 3KF6A 5KNBA
chains in the Genus database with same CATH superfamily
1B3QA 1DOLA 2RSOA 3H6MA 4EQNA 1N33H 2K5DA 1EIFA 1N33L 1EWCA 3L2PA 3GTKH 4LK1C 4RGTA 2LSSA 4OXPA 3RZDB 4DR4H 3CCVA 3STBD 4DR4L 4IOAA 2VY3A 4CDCC 4EX5A 1JC7A 1XXGA 3T51B 4ME3A 1CT1D 4DV5L 4GNXA 3JAMc 1WTPA 1WOCA 5EKIA 1PYSB 5CBEE 4GKKH 4UP9A 3CC2A 3D4DA 4JI2Q 4WRDA 3N6RA 4LF4L 4K8JA 3D3RA 5AJ3L 1FNVA 1K83B 4JVZA 4RGNA 4XIGS 4DXGA 2R7FA 2GA4B 2VUMB 2GVAA 5J3BA 4B08A 2JJQA 1Q90A 1XYIA 3HOUB 1ODHA 2KHJA 2RKSA 3IL8A 3H09A 1C8CA 2F0UA 2E3UA 4DV7Q 4OO1H 1ILQA 5CV7A 2NVTH 4XT3B 4X3TA 2A73B 2KA7A 3IFDA 1W3SA 3UOEA 2EJFC 3J81W 4OIKA 4LFAQ 3NWTA 1NXUA 1KXLA 2JEAI 3F2UA 4IPDA 4JYAQ 5E3FA 3D8GA 1IXRA 5M5XB 1HQRD 1SFOB 5IP9H 3W1BA 3BG3A 2UU9Q 1EY0A 4HIKA 3PIP3 1GUNA 1NTGA 4A3LH 1KRTA 5JOBA 2FINB 1HA5A 2LS01 3PUYA 3SGIA 5M3FG 5C4ZA 3L3OC 1B9NA 2B63B 2ZXPA 2WB1E 3S14H 4ZUJA 2B3GA 4B3MQ 3I56A 1YI2A 4AH6A 2B2WA 3I2ZA 3C46A 3UDFA 3D31A 5IP7G 2H4OA 1O80A 4YY3Q 3EFXD 3HFZB 4B8TA 2J7ZA 4C2MB 5IWAH 5IWAL 1Q81C 4Q0FA 4DV6L 3BZCA 4DR1Q 1QE6A 4GN5A 5HURA 1TWGH 1STHA 5ISRA 1YNJC 4A3JG 4Y52H 2NVYH 3L9AX 4XQQA 2G9DA 3R93A 3A56A 1SJED 4V190 1JE4A 2A5HA 3KDFB 1FGUA 3OPOA 4P74A 1KNAA 4JI0Q 1S5BD 1DOMA 1GO3E 4LNQA 2XN9C 4DAMA 1I4XA 3BS1A 2Q2IA 3M4YA 1U4PA 3KLWA 4A3KG 2B8GA 5EBCA 2VXWA 1PV4A 3QR8A 5A2QE 4DV0Q 1N36L 4GKJL 2Q8TA 2NVQB 1SE8A 3I4MH 1SNPA 2LF0A 4OCHA 2XWJB 2BDOA 1II3A 4H02A 2L15A 3BDLA 3RN5A 2EJGC 1S03G 4DPGA 1VS0A 3PO2H 3SDZA 1GUOA 2RSNA 1TVXA 3HOVB 4ZK9B 4DR7Q 3I4NG 1K73C 3PIO3 4BBRH 1HR0Q 2F3WA 2ICEC 4UHVA 1HTPA 5I6YA 2J4XA 2ZJPA 2MPMA 3TSSA 2WB1B 3LWEA 2VQEQ 4X6AH 3DWPA 1GUSA 5GAEC 1ENCA 4JVHA 5T1IA 1YNJD 1TR5A 4DFAA 3VA7A 4APVA 4WFN3 4N9TA 3QB3A 4C3JH 3ICEA 1ENFA 2A1SA 2K14A 1CI3M 3GTGH 4ZQ3A 2Z1CA 2JA7G 1G8ZD 4LJZC 4GNXC 2UUAH 2DY7A 2LMCB 4XQNA 2AKWB 4R4TA 1D5MC 3MAQA 2H5XA 3URYA 1PTOC 5ELEA 1S5DD 2EYMA 3VKEA 2AWOA 4DK3C 5E4XA 2CH4W 2IT1A 1ASZA 4B8CD 3U58A 4BY1G 2F0HA 4DAYA 2E5LL 3ULPA 1RODA 4RMFA 1E7ZA 1QWYA 3RMHA 1ML0D 3AQQA 3P75A 4DUZQ 3GD7A 2D5DA 2L9HA 4LF5H 4LF5L 4YWKA 4B3TH 3HGBA 2NVXB 4A3DG 3EVQA 1XNRH 2FMMA 1EYGA 1XNRL 2KJXA 1K0RA 5C3WA 2KHIA 1H95A 3J80L 4YCUA 1B3AA 1CHQD 3OWFA 4YCVA 1SNQA 5CV6A 3D6WA 4FXGC 2DNEA 1M8AA 3PO3G 5ELOA 1J4WA 3A7AB 1CSPA 4A3GB 4X65L 1ET9A 1XRHA 1PTOD 5ELCA 2CKZB 2UUBH 1OXVA 5IYCH 2UUBL 1UAPA 4IPGA 1N32H 2IW3A 4DKAC 4CKEA 1UE5A 2CQAA 4N9PA 2PI2E 1RIPA 4YHHQ 4A3EH 2YQRA 2VNUD 4XXEA 1MJCA 3M3YH 5CC4A 3RF2A 5M3MG 1WTQA 4KY6A 3AMUA 1EYCA 1PLFA 4UDUC 2DUDA 3M7NA 4L8JA 5M5YB 2CFMA 4A3IB 1ONLA 2ATWA 4QJFA 1Q1BA 2QW7A 4CDEC 5D14A 4JI5Q 1STEA 3RZOH 4ZCKA 1VQNA 3Q0AA 2ZQEA 4A4IA 1VQ6A 2JA8B 3HOXG 4JBMA 3FP9A 1SYBA 1G2TA 2BOSA 4DR6H 4DR6L 2I5LX 3BYYB 1KL9A 2EY1A 3AYHB 2R93G 3R2TA 4JI2H 3FHWA 1K9MC 2Z4HA 5BN5A 5DT9A 1A62A 1LV9A 1NUCA 5FK9C 3OTOL 1VCIA 4A3MG 2BA1A 5C6AA 1S72A 4ZUIA 3W1GA 1OXSC 3NBHB 2KQ3A 3OW7A 2UXDQ 4OGQC 3FKIH 1QZGA 1YHBA 2XNAC 1CA5A 3MXNA 5IE8A 1Q46A 1A6XA 1BUVT 2F0GA 3GV3A 4LFBQ 2TMPA 1Q7YC 4POGA 4IFDG 1KHMA 4JI8Q 1F9RA 5I2YA 3M85A 4LFCH 1KAAA 4KHPH 4GLAC 4LFCL 4KHPL 3M7GA 4NP5A 4DV7H 2UUCH 5GQOA 3FMCA 2UUCL 3AB9A 1HUNA 3CF5A 4A93B 4X62Q 4JI4H 3P1HA 3S1MB 4JI4L 2EDGA 4CHTB 1TWAB 3W5OA 1QZHA 1A0IA 4DV2L 5H1SE 3GP7A 4K14A 3R3OA 3S2HH 4RHRA 4UP7A 4JYAH 3QOLA 1B1ZA 2B2VC 3MEFA 3CC7A 1SMYC 2L1BA 2B2UA 2UU9H 1Y8PB 1UE7A 1K28A 1XPOA 1O7ZA 1XMQQ 1ZXTA 3S1RB 1K3RA 1B53A 2KENA 5IIFA 3GTOH 3P20A 4YCWA 2K1HA 1X4MA 1HNXH 4A3CG 4OO1I 3V69A 1HNXL 5EKLA 1N33Q 2O4CA 2K50A 1VQMA 5FLXW 1QUQB 2DGYA 4DR4Q 5M3FB 2KHSA 5T1GA 5JPNC 4YY3H 2WINB 3PUXA 1VQFA 1D5XC 4DV5Q 1JB7A 4FF1A 2R3ZA 5JEAG 2AMCB 5EAYA 1F77A 1PFBA 4JV5H 3K7UC 1VQEA 3MFGA 4JV5L 4RA8A 4LF4Q 5AJ3Q 2QGQA 4KN7C 2F0MA 3OSSD 2VZAA 1MI2A 1I6HB 2ZXRA 5COYA 1F0XA 1SN8A 1C7YA 4JI6H 3A5UA 2ZXOA 4JI6L 4RGOS 1SMYD 1X4NA 3VR4A 3VDYA 1O7LA 3TZDA 3GTJH 2F4IA 2QEXA 1HRJA 4IJHA 1XPUA 2XWBB 1CZWA 4WORA 2CPMA 4QB4A 4DV3L 3JAMW 4PMBA 4PG3A 3DLLA 5K5PA 1JORA 1CSQA 1XMOL 1L0YB 4IUPA 3U4ZA 2WFWA 2B2YA 1WVNA 5CMDA 1LTRD 1PH4A 3QG1A 2JK8A 2EZVA 1HR0H 3S17H 3I4NB 4A3BG 4OO1G 5LMNH 1UNSA 2V1CC 3SXHA 5LMNL 3K57A 2EYFA 4KN4C 1RF2D 3GTLB 1YJNA 1FNUA 1VQ5A 1PFSA 1X56A 3D6CA 2ZTCA 1XJVA 2MJ8A 1HZBA 3TDQA 4FYDA 2EIFA 4RH6A 4RFBA 4J6HA 2JA7B 2R7ZG 5IP9G 1EY4A 2ANNA 1F9SA 1WHRA 4F8MA 1YIJA 1VQ7A 5M5WH 3F2CA 3GDEA 4PMCA 3K5LA 3S1QH 3HOYH 1NMGA 1VMCA 1LO5D 2FPHX 5IWAQ 1IKLA 3CAMA 4AQYH 1WFQA 4DV6Q 4IUTA 4AQYL 4NW2A 3PUVA 4LF8H 3GTMB 4LF8L 2K33A 3LGJA 2QILA 3J81j 2G8YA 2I5MX 1SBBB 1PH5A 2I46A 3U1KA 4EGVA 2FFKB 2ZT9C 5I6WA 1IBML 2JA5H 4DUZH 5EQ0A 4RCOA 1X55A 1A3TA 2X06A 2VB2X 4HCEA 3LNNA 1DTJA 1FJGH 3T1HL 5KGUA 1FJGL 1CZGA 3HRZC 1GJXA 1T9HA 1N36Q 4A3DB 5CV5A 4GKJQ 2WKDA 1RCVD 1WI5A 4XTCS 1DT4A 4JBKA 1T5EA 3I72A 3KDFA 4OELB 3CCEA 3KLRA 2NN6H 2DJFC 3HOZH 1PQXA 1ZKOA 3J7A5 1BOSA 3S16H 3I4MG 2A69C 1TWHB 1HZAA 2ZJQA 2AHOB 3DM3A 1IW7C 3IFTA 3PO2G 4IO9A 3OSOA 4G57A 4K5VA 3MHBA 5FJ8H 4HSPA 4IALA 2KBNA 4LF6H 2D62A 4BBRG 4DA2A 1TT2A 3I55A 4HJAA 1L0WA 4LF6L 2IL8A 2MNAA 4DUYL 1BNZA 2YU9B 4JVYA 1QJOA 4B3SH 3FDTA 4B3SL 2MQHA 5M3MB 5C0XI 2E2HH 1D2BA 3A8JE 4RAUC 1U9RA 2J0TD 4TVAB 5ELFA 4CGYB 1EOVA 4P71A 2HCIA 3CC4A 2F1MA 4PMWA 3JC66 1WE8A 3EJIA 1CKOA 1NE3A 4KV6A 1FGBD 1RTOA 4JG2A 1AZQA 4IUQA 3T4AC 4BA1I 1PRTC 5HGTA 2EQSA 4DXFA 5IT9E 2E5LQ 1AEXA 3WOFA 1AZPA 2OPVA 1O7YA 4LUZA 2JZXA 4BXXG 3S24A 3K5NA 4F7XA 2A69D 1PDQA 4QUFA 3CRKC 2R93B 1G91A 2Y0SE 1SRUA 3W3AA 4PV1C 2YTXA 3KBXA 4LF5Q 4KHZA 2O5JC 1IW7D 1UE1A 3D0FA 2B2YC 4QL5A 1HNWH 5FLMH 1XNRQ 2PQUA 3RD4A 1HNWL 2EYOA 4LFBH 2RDGA 1R9TH 3KLSA 2PW5A 3S15B 5A35A 3NENA 1PYBA 1JWUD 3HOWH 2HQEA 5I2XA 1X3PA 4PNYA 4Z9CB 3DEPA 2CHBD 3K6OA 4X65Q 5FLXc 2OF1A 4FP5D 5GROA 3J80W 4IN3A 3T56B 1U0LA 2UUBQ 4LF9L 3MC0B 1STAA 2C9OA 4PZ6A 1HNZL 3I0PA 3FAUA 1SJHD 1PRTD 1Q82C 3JAME 1SEBD 4GOPB 4G7HC 1ICFB 4BBSH 4R4CA 1TWCH 2PQAB 1XMQH 3PGZA 3CU7A 1DYQA 2KOLA 3RN2A 1TS2A 4OX9L 4ME5A 2FMRA 1WTOA 2QCPX 1F9QA 1LABA 5JJKA 2D0PA 2VQFH 2VQFL 3K7AB 4TSSA 4HIOA 1AE2A 2OTJA 3J7ZC 4A3EG 1V1OA 2BA0A 4X3KA 3RZDH 2Y0SB 1GM5A 1TS5A 4H8AA 1VBIA 3CPFA 2NTSA 2JSOA 4PZ8A 4DV5H 2HQLA 3BZKA 2EYLA 2Z0SA 5EGTA 4DR6Q 3VR6A 1KLUD 1ZEQX 5JAVA 2YYZA 5C44G 4LF4H 3A5ZB 4PQXA 4DNRB 1YHAA 2YTVA 3OTOQ 5E7NA 5KRUA 3D4WA 1K83H 3C1FA 2CCZA 2HHHL 2WV6D 4G7ZC 2VUMH 1NMFA 3M9BA 3HOUH 2K5NA 1LTGD 4C56C 1Y69U 3K5MA 1MJEA 1YBYA 4LFCQ 3HZXA 1VQKA 4KHPQ 4NXMH 1T5XD 1Z6HA 3FKIG 4NXML 2UUCQ 4EVOA 1BKBA 4DK6C 4JI4Q 3SK6A 5FO7B 1N34H 1N34L 3WWVA 4DV2Q 1XTDA 3IRBA 3K5OA 1NSNS 2PY9A 3OW2A 1PFMA 3CXCA 3EQLC 2B29A 4A3BB 2I07B 1G2SA 1YNXA 4NPSA 3MXPA 5EPKA 1WCMG 5M5XH 1JJGA 3H0GB 3ZYYX 3TS2A 5C4XB 1TQOA 2IHEA 2PI2A 2WAQG 5E4WC 1KD1C 4RG1A 1E22A 3MZ5A 4Y7NB 1HNXQ 4P73A 1WD0A 1G6ZA 1B9MA 4C1NI 1N8RC 5DEHA 1L0XB 1P16A 4DN4M 4G7OC 4IPHA 2F0IA 3M4OB 2HT1A 5KYIA 2R7ZB 2B63H 4WJWA 4O0AA 3VA5A 1TIID 1I4PA 2FXQA 3EN2A 4FXDA 1V43A 2BH8A 1A2TA 4DV6H 2IWHA 1AN7A 5TSSA 4B9XA 1PA6A 1CHPD 2EY2A 2QDBA 3S14B 1LYLA 1RHPA 4JV5Q 2RA4A 2A74C 1NR4A 2TSSA 1DGSA 3CKIB 3NTIA 5C5LA 1B50A 1X9ZA 3EZJA 4DAPA 1DZ1A 1L1OB 1HQMC 3VR2A 1WVLA 3QD7X 1YITA 3QIAA 2ALYB 4JI6Q 5EKKA 5IGEA 1JOQA 1HZCA 1TWGB 1OTCA 1Z7TA 2O4XA 1N36H 5C4HA 2K5VA 5JVH3 4GKJH 3J80i 5C3EH 1I4HA 4DV3Q 1B8AA 4ULLA 1XMOQ 2NVQH 3OIQA 5CGKA 4J1MA 5I9OA 3UI2A 5IGBA 1R4PB 2BH2A 4JI3L 3G4SA 3F2BA 4H13C 2HH3A 3I4MB 4X64L 4HJ8A 5LMNQ 1G51A 3DXJC 2JP1A 5K36H 4BS9A 4XYOA 2M9VA 4KD3A 5CORA 2R92B 2PZTA 1CA6A 3VYSA 1V1PB 1UUPA 1IYJB 2F0SA 2LXKA 1GUTA 2N88A 1HR0W 2GVBA 2M00A 4L6TB 5LMNW 2NN6I 1QNKA 1JWSD 1HUMA 2F0OA 2N8NA 4I7AA 4DR3H 1ZYRC 4DR3L 2L0CA 1EIYB 1DJRD 5IODA 1JJCB 1RD9D 3A54A 4UPAA 4AQYQ 1W6JA 1J5EH 1E0BA 1J5EL 2IY5B 4LF8Q 2E8GA 2E5LH 5KEEA 4NXNH 2PT7G 3E6ZX 4NXNL 1EZ6A 1WTXA 2PQEA 3MXUA 1EOTA 1QB5D 1J9OA 2KCMA 3HOYG 2YV5A 3E0EA 2NZHA 1IBMQ 1EL0A 1PH9A 5A2QL 2KCNA 3S1NH 3J80c 2VB3X 3TP7A 2RCNA 4A3FB 2JA6B 3I70A 1WYDA 2IX3A 2F0FA 2F0LA 3E0JA 1Q86C 1AN8A 3T1HQ 2QF7A 1PH3A 1FJGQ 2CH4A 1VIGA 2QEJC 2R6GA 4DGZA 2JA5G 1BXTA 1PZID 2BE5C 4QUCA 4DAVA 2X6GA 2A8VA 1C48A 2B2TA 2EPBA 4P2CB 4J15A 5BN3A 3L7ZC 4S3SA 1LLRD 3GR5A 2NTTA 1Y1VB 3J7AF 1FVIA 1U4MA 3K59A 3Q23A 1U4LA 2KCTA 2NB0A 4X65H 1ZYRD 2YTYA 4JC0A 4KKTA 2F0TA 4IFDI 4A3GH 1FYCA 2EYJA 4U673 2C35B 3CCUA 1YJWA 4ZKBB 4HN7A 2E2JB 2VS1A 1H9SB 2NN6G 4C3IB 1Y8NB 2DJGC 3WDNA 3TS0A 3KDKA 4DR2L 4DR2H 1EY6A 1BCPF 1QOHA 1DOKA 1M1KC 2B2WC 1HHVA 4LF6Q 2F0PA 1LT3D 3AFQA 1SNCA 4DUYQ 5JPMC 3J81E 4B3SQ 3HKZG 4FDBA 1KNEA 1X3EA 1C0AA 2I5HA 4R4IA 1JMCA 4L5TA 5M5YH 2HIVA 4A3IH 4LW1A 2BE5D 1V8CA 4O2DA 3TEHB 3U4VA 5I4DA 1SDFA 2IX1A 2CWPA 3TMEA 3VYTA 3NBIA 4IUUA 2JA8H 3EIVA 4GNXB 4F88A 4ODGA 3Q24A 1EQRA 5IGCA 3CD6A 1C9OA 3PUWA 1SE2A 2EXDA 3OTOH 1BDOA 1PTOB 2GN5A 2JVZA 3A7LA 5C44B 4DV1H 3BDCA 1B2TA 4DV1L 2HIXA 1UEAB 3GV6A 1EY8A 3UE0A 1LACA 4KY7A 3TP5A 4KTAA 1HNWQ 5LL6X 2EJMA 2KUMA 3BZDB 1JR0D 4V0BA 3OMCA 4DF7A 4NZTM 3E9HA 1MIUA 3GTQB 4QQBX 5DAUA 2R7DA 3A0JA 3NUCA 4A93H 4DV2H 3S1MH 4LF9Q 2RF4A 4JBJA 4AIMA 1SYDA 3SR1A 1TWAH 3HOWG 3N52A 1HNZQ 3BVMA 3CQZH 4JW0A 3J81L 4QIWE 1C4QA 1TKWB 2HCCA 1UG8A 1CUKA 2XGTA 3AFPA 5KYLA 1BBWA 2DNCA 2CPQA 4QF4A 1KRSA 1WCMB 1XX8A 1KDAA 1EIGA 1EQVA 4CKBA 4OX9Q 1FD7D 1VQOA 3U9OA 3S1RH 5BN4A 1BO0A 1SE4A 4DV4H 2OXPA 2RBMA 2WAQB 4DV4L 1IBKH 2VQFQ 1IBKL 1NCVA 3BJUA 3A74A 1I94L 4R4QA 4FVMA 2K04A 5C4JB 2FHTA 1J6QA 4XT1B 1E1OA 3ERSX 2KEEA 2K52A 5M3FH 2LKVA 3ER0A 2ENBA 4GOPA 1SAPA 5EBDA 5GAGC 5L37A 1YJ9A 4DNTB 4ZKCB 1K8MA 1X6OA 2CTLA 1SYCA 3RLNA 5DLQE 1EEFD 1PHJA 2X69A 4RWSC 2HH2A 4CDFC 1B7YB 3ULJA 1YNNC 4A3JB 1G6PA 4AYBG 2VL6A 2F3IA 3ONAB 3E5SA 3NTHA 3G7LA 1X65A 5HGQA 2HHHQ 3NQIA 2P2RA 5CYUA 3NXWA 5NUCA 1XNQL 2M6QA 4A3KB 4DV3H 2HD3A 1E24A 1NBWA 4CJ0B 1EUJA 4JI7H 4QIWB 4JI7L 1A3UA 1XMOH 1EC6A 2K5WA 4NXMQ 3GO5A 1A15A 1JQYD 1LUZA 5JEAJ 2CTMA 3TN2A 3BU2A 1F9PA 2V4DA 1I50B 1TY0A 3K58A 1EIHA 3KBGA 1N34Q 4A76A 2KEDA 1Q8KA 3MVVA 4U68A 1QG7A 3TP6A 1R4QB 3U50C 1I4GA 2N49A 3I91A 1UWVA 3I4NH 1O7IA 3NPPA 1K8AC 4NKLA 2JA9A 2JEBI 5G3LF 5KIXA 3EA6A 2ZM6H 3DUZA 2ZM6L 4FF2A 1YNND 3J7YW 5D65A 3NSWA 4G08A 3GTLH 3PIOA 1V1QA 3QWNA 1D6EC 1GXDC 4TQUS 3E9IA 2AQ3B 1ILPA 4LF7H 4LF7L 1MSGA 3G6EA 3T16A 1VF5C 1JWMD 1EFID 4POFA 1AFPA 1IBLH 1LTBD 1IBLL 3VYUA 4A3LG 1IKMA 2ZTDA 3C1EA 1JOOA 2B39A 2A6EC 4DAYB 4KKSA 2MUYA 1XPRA 4GLVB 2B63G 3V05A 2MFIA 4BY1B 3GTMH 1IBMH 1SYEA 2Q8IB 1EWHA 1BCPB 1CK1A 1VQHA 2A19A 3NHHA 3WOEA 4KJNA 2A6HC 1VQ4A 4FF4A 2F4VL 1WTWA 2PNRC 1EU3A 1G291 3MA2B 3V96A 2PW7A 3SE0A 3T1HH 2E2IB 1Z47A 1SROA 3I4LA 4C1NK 3OHXC 3U9SA 1GHJA 1NR2A 1VF7A 1BF4A 3K0XA 4A3DH 1E2ZA 2WP8J 2XRSD 2D2CC 3NEMA 4L5QA 2K4KA 5CV9A 3MTSA 1L1OA 2B2UC 3PO3B 4ZYSA 5C3EG 4JI3Q 3GTPB 3J7AK 4KLKA 4X64Q 2K5HA 3Q8DA 1TWHH 2A6ED 1EQTA 3CCJA 2RDFA 1W6KA 2E74C 4HEDA 2OTLA 2AQ1B 2ZTEA 2K05A 1IZ6A 3S9WA 4GOPC 4DUYH 4NBQA 4QMGA 1S4ZA 2A6HD 3V2TA 1RKNA 2SDFA 4K0KL 4ILWA 2YU9H 5K36G 4MN3A 2WB1G 3HKZB 4IJLA 5M3MH 3TREA 2EE1A 2Z6KA 4ZLTF 1X0AA 4C3JG 1EWIA 4DR3Q 1PVOA 1VQJA 3PQIA 4K6DA 1QNUA 2UXCH 1QVCA 5JJIA 2UXCL 2AUJD 4NZRM 1V1PA 4JOIA 1TWFB 4BY7H 1J5EQ 5I9PA 3HOXB 4NXNQ 3RLFA 3ZJYC 1OXTA 3CMAA 5FLXE 1KIXA 1A2UA 2Z8LA 1I4QA 1VQBA 4TRDA 1I4RA 1LTLA 1GHKA 2L5TA 4BA2I 2CTKA 2R93H 4A3MB 1MSZA 1VQCA 4DNIA 1WTJA 2Y3MA 4C3HH 3A8KE 4R1JA 3R2IA 1PZJD 4IURA 1I6VC 2LTMA 5CR3A 1I3QB 2F0VA 5LMUL 2PYKA 1OXUA 3G71A 2F0DA 1MD2D 2RDHA 3S15H 3VR5A 4GZYC 1BR9A 2OT2A 5IYBH 2F0JA 4LF9H 5EPJA 1Y1WH 1HNZH 2PPBC 4B3RL 1R9TB 3PCOB 1VIHA 1IYUA 1LT5D 1GKHA 3HOWB 2LRRA 4UAIA 4DR2Q 1K1GA 2MO0A 5IYCG 3SB1A 4OX9H 5ELBA 2HDMA 4IZ8A 3I90A 3VYRA 1Q8IA 4XDXA 4ALPA 5IYDH 1JB3A 4WANA 5IT9L 3K7AH 1H9SA 3FPUB 3CHBD 1Z2IA 2OQKA 3CCQA 1SE3A 4R8IA 3S2DB 2EVBA 1ENAA 4FO2A 2EY6A 3PUZA 4M8AA 3UE1A 4DR5H 3HG9A 4DR5L 3SEBA 5C0XJ 2C5CA 3GTKB 4A3IG 4LIJA 4P72A 2ES2A 4DK0A 2XTIA 5C5MA 2F03A 4G4KA 5JEAH 3A8IE 3NELA 2JA8G 4FXKC 1BBXC 4R4OA 3LWUA 4DV1Q 4AYBB 2HHHH 3KK7A 1PH8A 1PRTB 4X3SA 1S5ED 1F2LA 1ICWA 1L1OC 1PH1A 1STBA 3DWAA 3F1ZA 3NTKA 3I3CA 1CKMA 3CW2C 4GKKL 1SLJA 3TP8A 1DCZA 2OQ0A 2XSCA 3T1YH 2E2DC 4OD6A 2UXBH 3T1YL 1D8LA 2UXBL 3LX0A 2VW9A 3JAML 3ERQA 3NBHA 3KUPA 3W2DA 4HMJA 5LL6b 3TBIB 1CKNB 2PZWA 1A3VA 1E1TA 5IGDA 2Z6KC 3KOJA 2CWHA 1PTOF 4QY7A 1HFGA 1PH2A 2NVTB 4A93G 4A3BH 4CKCA 5DNFA 1SFOH 1PFNA 4OONA 3DWQA 4RKBA 1NJIC 3H0GH 5C4XH 4JOIC 2IPKD 1KC8C 4HCSA 4DU9A 3FPPA 4DV4Q 4FF3A 2L55A 1X54A 1IBKQ 2K01A 4Y7NH 5GADC 1I94Q 4FJSA 2B8FA 2F0EA 1F2MA 2A68C 1LT4D 1ZZKA 5ELNA 4KY5A 4O42A 2WACA 3M4OH 1HCZA 2R7ZH 1DONA 5CBAE 1VQPA 2D0OA 4E6IA 3KJOA 4C2MH 3GKUA 1D7QA 4IPCA 1B44D 4KMUC 1RTNA 2ICIA 1X32A 3I7FA 3RR5A 1OXXK 1M90C 4ABNA 4HTHA 1QUQA 4K5WA 1CFMA 2EYPA 5D3DA 2D9IA 2L11A 1K8OA 5BR8H 3OYYA 3OWEB 2EYHA 4N8FA 1FL0A 5BR8L 2F3VA 3K0YA 1TY2A 3A55A 1J8IA 1XTCD 1NY4A 1S5CD 3HP3A 1XNQQ 3SHLA 3ITPA 1GUWA 2NVYB 1SYFA 3C2PA 4J8QA 2PZUA 4EQPA 2JE6I 1MKHA 3H91A 3OMGA 1S5FD 4JI7Q 1IHZA 1K8GA 1Q3LA 1RJTA 1IL2A 1KTKA 2A68D 2CTFA 4JI3H 2LTLA 1Z9FA 5J22A 3KJPA 3P7JA 3RNUA 4NDXA 5C3EB 3HOVH 4X64H 3F8TA 1Y8OB 1UEBA 3NE5B 1M4VA 4H44C 5DM73 3FVQA 1VQDA 3PO2B 2ZM6Q 2O2LD 2JYOA 2R92H 1MHWC 2K75A 1BVSA 1VQ9A 4BBRB 3J80E 2PO4A 3PF5A 1V8QA 1A8VA 4LF7Q 2N78A 2L12A 4LAAA 2Q8RE 1D1IA 1EY9A 1LTSD 3KF8B 1AH9A 1IBLQ 1VQ8A 3BVZA 5CV8A 2KECA 1ZZIA 4M1UB 4C3JB 2OPUA 2AXYA 1H9MA 3GTGB 4QCLA 2DY8A 3ND9A 2XIWA 1U4RA 1S3OA 2RVLA 2HUGA 4HIMA 3NQTA 4NB3A 2BCOA 1HA6A 2B2VA 2UUAL 1JOKA 4X3UA 2EOTA 3NK9A 2F4VQ 2VKCA 3PV0A 5JVG3 1QCBD 4BXXH 1EY7A 2Z6BA 1E3PA 2KCCA 3TQYA 4JPBW 2K7VA 3BDOA 3HS0C 4A3FH 2JA6H 1PH6A 2LFNA 2D9UA 2NVXH 2K5QA 5D3IB 2XVSA 4L5RC 2CW0C 5IGGA 5LHY1 3S1NB 4KK7A 4QMFB 2EXZA 2HDLA 4OEMB 4X66H 3H94A 4TKOB 4X66L 3H3VC 3RUZA 1QVFA 1HTLD 1ESRA 4LUVA 4JI1H 2IJ0A 4OWXB 4B3TL 4JI1L 1Y1VH 4WJ3M 2I0QA 1ZTGA 5FO8B 3O13A 4IUVA 4NMZA 3J81i 5IOCA 5LL6S 5CV4A 3R8BA 1Q1EA 1EY5A 1H9KA 4CBVA 3RLOA 3HOZG 3AEVB 1XWEA 3I73A 3NWSA 4OWWB 2E2JH 4C3IH 2RHSB 3MWYW 3KF6B 5C0XH 3GABA 1EYAA 1SR3A 5EJWA 4K0KQ 2ANRA 4HMIA 1EQQA 4L63B 2A1AA 2PCFB 2RCFA 1SNOA 5FJ8G 2F0WA 3FRPB 4GN4B 2BDNA 1N32L 4K5XA 5JJLA 4A3EB 4EQ5A 2QKIC 1X3FA 3M3YB 2Q2HA 4A75A 2UXCQ 2CW0D 2E76C 2QNDA 4OHJA 1JCKB 5FOBB 4YIJA 2FMCA 3B6YA 5DM63 2WAQE 2FJ2A 2SEBD 2X6LA 4MTNA 3E3XA 1UE6A 3PSIA 1SSOA 1MBYA 3TZUA 1S20A 2CTJA 3AU7A 3RZOB 2XRQD 1V9NA 3M4PA 1JICA 4BY7G 1PTOH 5C44H 1BQQT 1PH7A 1WTVA 2KVMA 2RHQB 2NZ1D 2JXMB 3FEWX 1VDZA 4BWGB 3QO2A 1LTTD 2K1BA 4N8X1 5LMUQ 2G5DA 1N9WA 1NNXA 3CMEA 4JI2L 3BVGA 4B9WA 3DHQA 1Q12A 1WJJA 1SNDA 2H1EA 4OL7A 4C3HG 3J81c 3H3VH 5GAHC 5FLMG 1K3BC 3FKIB 2O5IC 5JJZA 3GTQH 1F2YA 2Q2UA 2MJHA 4UP8A 5E1FA 1TXYA 4YWLA 4B3RQ 2OCEA 1CQFA 1HXYD 4R9WA 2IX0A 4GN3B 3ULLA 5IYBG 3BYTB 1QILA 1KHIA 4EQOA 4DV7L 4KI0A 4K8IA 1Y1WG 4HIDA 2N3SA 3DM1A 4IFDJ 3L0OA 4WJ4A 2F0NA 3Q6SA 3S2HB 1AW7A 1WCMH 2DN8A 4JCVE 4L5SA 4EC5A 4LFAH 3CQZB 4LFAL 3CCMA 4BBSG 1I94H 1BBUA 2R61A 2MHVA 3G6JB 1TUAA 1VMPA 1KDCA 4JYAL 3KDGA 1LTID 4ID6A 4MIUA 5C4JH 5HY6A 1ZZJA 4HJ7A 4KKUA 5FKAC 3OOCA 2M8WA 2NUCA 3GTOB 2PQAA 3PIPA 4GLXA 2CVRA 2UU9L 1JJ2A 4DR5Q 5IYDG 5F2DA 2F0KA 5IP7H 1DD2A 1E2WA 3NP8A 4HAEA 5IT9W 3KLSX 1YVCA 3G48A 5KNDA 2B2TC 1QVGA 1KAWA 4AM3A 4CDDC 1I5FA 2Y0SG 4B3MH 1PMRA 1STYA 4B3ML 4A3JH 1BCPC 4YY3L 3IAYA 1I6HH 1VQAA 1SMXA 4MTKA 4DR1H 1X3GA 1XNQH 4DR1L 3TRZA 3SK8A 1S40A 1FNWA 1YEZA 1EU4A 1D5ZC 4GKKQ 1SXTA 5EPLA 5M9OA 4A3KH 3M4QA 1K0SA 3T1YQ 1PZKD 2UXBQ 5J39A 2AQ2B 1HZ9A 2EY5A 4JI0H 2VUMG 4JI0L 4XYQA 3K81C 3HOUG 1CQVA 2AUKA 3GTJB 1I50H 2K6AA 2Z9HA 4UY8C 3Q22A 2CWAA 1B70B 4DV0H 4E9JA 3IKJA 4DV0L 1P8LA 2AWNA 4MHEA 4IQZA 1X3QA 4CJ2C 1KQSA 2MP1A 2M2LA 1GVPA 4F87A 3K8AA 4I65A 1GD7A 2SNMA 3SVMA 1CTMA 1PRTF 3SK5A 3S17B 4DR7H 4DR7L 1BCPD 2Q2TA 1IYVA 2PNHA 2ID0A 1CKNA 4PZ7A 1HR0L 1GUGA 1LM0A 4GS3A 1SEIA 1RDPD 3X3MA 2JA7H 4KJOA 2N55A 3CCRA 2P5ZX 4CJ1B 2VQEH 2NWGA 2VQEL 3H0GG 3CCLA 2ZJRA 5C4XG 4K2KA 1KABA 3UDGA 2DGRA 2K28A 4HR7B 2CWFA 1FR3A 2F52A 2WKCA 2SOBA 3GQBA 3HKZE 4DK1A 2L4NA 3OETA 5M5WB 4IOCA 1YHQA 4R8NA 4BY1H 3HEJA 2F4VH 3S1QB 3HOYB 2NZOA 4HSVA 1WTRA 1DM0B 3I8ZA 4YWMA 1F2ZA 5BR8Q 1WD1A 1TU2B 3I4OA 4HJ9A 2NYZD 4FJUA 1NAPA 2SNSA 3D4RA 2CTEA 1I6UA 5FO9B 2E2IH 2PMZE 3K80C 2G9HD 2JA5B 1AE3A 3C3LA 3X3NA 1HFNA 1HPCA 3T13A 1TS4A 4K6LA 4DUZL 1H9RA 1RL2A 1JE5A 3PO3H 4O1NA 4OIJA 4ZAIA 1SYGA 3MFYA 1L2FA 2CQOA 2OEOA 4OWTB 4H7BA 3F2DA 4ZRZA 3GTPH 3CP0A 2LXJA 4LMQD 4FNFA 1EEID 2ASBA 1SNMA 2JN4A 1MGSA 3HOZB 2IHFA 1VQGA 3HOVG 3S16B 4K0KH 4QGUA 4PDBA 2FFMA 1AP0A 3EROA 1E2VA 3PF4A 2K03A 1STNA 3CCSA 1FKAH 3CRLC 3HKSA 4RCNA 1JT8A 4JK1C 3CPWA 2R92G 3NCVA 5J1ZA 1X9NA 2OWOA 5IY0A 1DXMA 1W2BA 4YHHH 4MNOA 3SK4A 4YHHL 1U5KA 2E2HB 3ND8A 1TWFH 3HOXH 5IGFA 2PMZB 2UUAQ 3PMFA 4Q5VA 5AFWA 3DMUA 3KF8A 1HH2P 1PYWD 4JI5H 2MGSA 5KNCA 2BL5A 1Y14B 4KD4A 4P75A 4JI5L 4BY7B 2QA4A 1ESFA 3DEOA 4A3MH 1KDBA 1O78A 1TS3A 3MXNB 4LWCA 1EFWA 5A2QW 1B4OA 5LMUH 3J7AV 3EBEA 3UDIA 1CM9A 3QOJA 3KYHC 3MXGA 1I3QH 2QDLA 3KFUA 4A3FG 2MO1A 2JA6G 2E75C 4AYBE 4X66Q 3T53B 3JAMi 2Z4IA 1OO9B 1V9PA 4IFDH 2LY7A 4I7ZC 4C3HB 4JI1Q 3H15A 4HJ5A 3UDXA 4B3TQ 2UXDH 2UXDL 1LTAD 1ET6A 4KHVA 2RQXA 4H0LC 4IUNA 3STBC 4B3RH 1VQIA 4LFBL 4MZ9A 1D1KA 2NBFA 4JI8H 1KLGD 1WTHA 4JI8L 1Y1VG 1MSHA 4LUOA 1H9JA 4A3GG 4RKLA 5IT9c 3VR3A 1PXUA 2JQOA 1LT6D 2WIIB 2K32A 4K2LA 4X62H 4RGMA 1EYDA 4X62L 1GOZA 1Y1WB 5G3LD 3H3VI 4XQJA 5C3XA 3OIPA 1J5KA 4JBWA 4C3IG 5ELDA 4WALA 1ASYA 5C0XG 4BBSB 4A3CH 1TWCB 4RHSA 1N32Q 5FLXL 3AEVA 1VQLA 3QJYA 1EZ8A 1A63A 1YZ6A 3MEHA 2F0QA 1HJPA 1XMQL 3S2DH 3KF6A 1IL8A 5KNBA 1STGA
chains in the Genus database with same CATH topology
1DOLA 2RSOA 3H6MA 4EQNA 2K5DA 1EIFA 1N33L 1EWCA 3L2PA 3GTKH 4LK1C 4RGTA 2LSSA 4OXPA 3RZDB 3CCVA 3STBD 4DR4L 4IOAA 2VY3A 4EX5A 1JC7A 1XXGA 3T51B 4ME3A 1CT1D 4DV5L 4GNXA 3JAMc 1WTPA 1WOCA 5EKIA 1PYSB 5CBEE 4UP9A 3CC2A 3D4DA 4JI2Q 4WRDA 3N6RA 4LF4L 4K8JA 3D3RA 5AJ3L 1FNVA 1K83B 4RGNA 4XIGS 4DXGA 2R7FA 2GA4B 2VUMB 2GVAA 5J3BA 4B08A 2JJQA 1Q90A 1XYIA 3HOUB 2KHJA 2RKSA 3IL8A 3H09A 1C8CA 2F0UA 2E3UA 4DV7Q 4OO1H 1ILQA 5CV7A 2NVTH 4XT3B 4X3TA 2A73B 2KA7A 3IFDA 1W3SA 2EJFC 4OIKA 4LFAQ 3NWTA 1KXLA 2JEAI 3F2UA 4IPDA 4JYAQ 5E3FA 3D8GA 5M5XB 1IXRA 1HQRD 1SFOB 5IP9H 3W1BA 3BG3A 2UU9Q 1EY0A 4HIKA 3PIP3 1GUNA 1NTGA 4A3LH 1KRTA 5JOBA 2FINB 1HA5A 2LS01 3PUYA 3SGIA 5M3FG 5C4ZA 3L3OC 1B9NA 2B63B 2ZXPA 2WB1E 3S14H 4ZUJA 2B3GA 4B3MQ 3I56A 1YI2A 4AH6A 2B2WA 3I2ZA 3C46A 3UDFA 3D31A 5IP7G 2H4OA 1O80A 4YY3Q 3EFXD 3HFZB 4B8TA 2J7ZA 4C2MB 5IWAL 1Q81C 4Q0FA 4DV6L 3BZCA 4DR1Q 1QE6A 4GN5A 5HURA 1TWGH 1STHA 5ISRA 1YNJC 4A3JG 4Y52H 3L9AX 4XQQA 2NVYH 2G9DA 3R93A 3A56A 1SJED 4V190 1JE4A 2A5HA 3KDFB 1FGUA 3OPOA 4P74A 1KNAA 4JI0Q 1S5BD 1DOMA 1GO3E 4LNQA 2XN9C 4DAMA 1I4XA 3BS1A 2Q2IA 3M4YA 1U4PA 3KLWA 4A3KG 2B8GA 5EBCA 2VXWA 1PV4A 5A2QE 4DV0Q 1N36L 4GKJL 2Q8TA 2NVQB 1SE8A 3I4MH 1SNPA 2XWJB 2BDOA 1II3A 4H02A 2L15A 3BDLA 3RN5A 2EJGC 4DPGA 1VS0A 3PO2H 3SDZA 1GUOA 2RSNA 1TVXA 3HOVB 4ZK9B 4DR7Q 3I4NG 1K73C 3PIO3 4BBRH 1HR0Q 2F3WA 2ICEC 1HTPA 5I6YA 2J4XA 2ZJPA 2MPMA 3TSSA 2WB1B 3LWEA 2VQEQ 4X6AH 3DWPA 1GUSA 5GAEC 1ENCA 4JVHA 5T1IA 1YNJD 1TR5A 4DFAA 3VA7A 4APVA 4WFN3 4N9TA 3QB3A 4C3JH 3ICEA 1ENFA 2K14A 1CI3M 3GTGH 4ZQ3A 2Z1CA 2JA7G 1G8ZD 4LJZC 4GNXC 2DY7A 2LMCB 4XQNA 2AKWB 4R4TA 1D5MC 3MAQA 3URYA 2H5XA 1PTOC 5ELEA 1S5DD 2EYMA 3VKEA 2AWOA 4DK3C 5E4XA 2IT1A 1ASZA 3U58A 4BY1G 2F0HA 4DAYA 2E5LL 3ULPA 1RODA 4RMFA 1E7ZA 1QWYA 3RMHA 1ML0D 3AQQA 3P75A 4DUZQ 3GD7A 2D5DA 2L9HA 4LF5L 4YWKA 3HGBA 2NVXB 4A3DG 3EVQA 2FMMA 1EYGA 1XNRL 2KJXA 1K0RA 5C3WA 2KHIA 1H95A 3J80L 4YCUA 1B3AA 1CHQD 3OWFA 4YCVA 1SNQA 5CV6A 3D6WA 4FXGC 2DNEA 1M8AA 3PO3G 5ELOA 1J4WA 3A7AB 1CSPA 4A3GB 4X65L 1ET9A 1PTOD 5ELCA 2CKZB 1OXVA 5IYCH 2UUBL 1UAPA 4IPGA 2IW3A 4DKAC 4CKEA 2CQAA 1UE5A 4N9PA 2PI2E 1RIPA 4YHHQ 4A3EH 2YQRA 2VNUD 4XXEA 1MJCA 3M3YH 5CC4A 5M3MG 1WTQA 4KY6A 3AMUA 1EYCA 1PLFA 4UDUC 2DUDA 3M7NA 4L8JA 5M5YB 4A3IB 2CFMA 1ONLA 2ATWA 4QJFA 1Q1BA 5D14A 4JI5Q 1STEA 3RZOH 1VQNA 3Q0AA 2JA8B 4A4IA 1VQ6A 3HOXG 4JBMA 3FP9A 1SYBA 1G2TA 2BOSA 4DR6L 2I5LX 3BYYB 1KL9A 2EY1A 3AYHB 2R93G 3R2TA 3FHWA 1K9MC 2Z4HA 5BN5A 1A62A 1LV9A 1NUCA 5FK9C 3OTOL 1VCIA 4A3MG 2BA1A 5C6AA 1S72A 4ZUIA 3W1GA 1OXSC 3NBHB 2KQ3A 3OW7A 2UXDQ 4OGQC 3FKIH 1QZGA 1YHBA 2XNAC 1CA5A 3MXNA 5IE8A 1A6XA 1Q46A 1BUVT 2F0GA 3GV3A 4LFBQ 2TMPA 4IFDG 1Q7YC 4POGA 1KHMA 4JI8Q 1F9RA 5I2YA 3M85A 1KAAA 4GLAC 4LFCL 4KHPL 3M7GA 4NP5A 5GQOA 3FMCA 2UUCL 3AB9A 1HUNA 4A93B 3CF5A 4X62Q 3P1HA 3S1MB 4JI4L 2EDGA 4CHTB 1TWAB 3W5OA 1QZHA 1A0IA 4DV2L 5H1SE 3GP7A 4K14A 3R3OA 3S2HH 4RHRA 4UP7A 3QOLA 1B1ZA 2B2VC 3MEFA 3CC7A 1SMYC 2L1BA 2B2UA 1Y8PB 1UE7A 1XPOA 1O7ZA 1XMQQ 1ZXTA 3S1RB 1K3RA 1B53A 5IIFA 2KENA 3GTOH 3P20A 4YCWA 1X4MA 4A3CG 4OO1I 3V69A 1HNXL 5EKLA 1N33Q 2K50A 1VQMA 1QUQB 2DGYA 4DR4Q 5M3FB 2KHSA 5T1GA 5JPNC 2WINB 3PUXA 1VQFA 1D5XC 4DV5Q 1JB7A 4FF1A 2R3ZA 5JEAG 2AMCB 5EAYA 1F77A 1PFBA 3K7UC 1VQEA 3MFGA 4JV5L 4RA8A 4LF4Q 5AJ3Q 2QGQA 4KN7C 2F0MA 2VZAA 1MI2A 1I6HB 2ZXRA 5COYA 1SN8A 1C7YA 3A5UA 2ZXOA 4JI6L 4RGOS 1SMYD 1X4NA 3VR4A 3VDYA 1O7LA 3TZDA 3GTJH 2F4IA 2QEXA 1HRJA 4IJHA 1XPUA 2XWBB 1CZWA 4WORA 4QB4A 4DV3L 4PMBA 4PG3A 3DLLA 5K5PA 1JORA 1CSQA 1XMOL 1L0YB 4IUPA 3U4ZA 2WFWA 2B2YA 1WVNA 5CMDA 1LTRD 1PH4A 3QG1A 2JK8A 2EZVA 3S17H 3I4NB 4A3BG 4OO1G 1UNSA 2V1CC 3SXHA 5LMNL 3K57A 2EYFA 4KN4C 1RF2D 3GTLB 1YJNA 1FNUA 1VQ5A 3D6CA 1PFSA 1X56A 2ZTCA 1XJVA 2MJ8A 3TDQA 4FYDA 1HZBA 2EIFA 4RH6A 4RFBA 4J6HA 2JA7B 2R7ZG 5IP9G 1EY4A 2ANNA 1F9SA 4F8MA 1YIJA 1VQ7A 5M5WH 3F2CA 3GDEA 4PMCA 3K5LA 3S1QH 3HOYH 1VMCA 1NMGA 1LO5D 5IWAQ 1IKLA 3CAMA 1WFQA 4DV6Q 4IUTA 4AQYL 4NW2A 3PUVA 3GTMB 1STGA 4LF8L 2K33A 3LGJA 2QILA 3J81j 2I5MX 1SBBB 1PH5A 2I46A 3U1KA 4EGVA 2FFKB 2ZT9C 5I6WA 1IBML 2JA5H 5EQ0A 4RCOA 1X55A 1A3TA 2VB2X 4HCEA 3LNNA 1DTJA 3T1HL 5KGUA 1FJGL 1CZGA 3HRZC 1GJXA 1T9HA 1N36Q 4A3DB 5CV5A 4GKJQ 2WKDA 1RCVD 1WI5A 4XTCS 1DT4A 4JBKA 1T5EA 3I72A 3KDFA 3CCEA 3KLRA 2NN6H 3HOZH 1ZKOA 3J7A5 1BOSA 3S16H 3I4MG 2A69C 1TWHB 1HZAA 2ZJQA 2AHOB 3DM3A 1IW7C 3IFTA 3PO2G 4IO9A 3OSOA 4G57A 4K5VA 3MHBA 5FJ8H 4IALA 2KBNA 2D62A 4DA2A 4BBRG 1TT2A 3I55A 4HJAA 1L0WA 4LF6L 2IL8A 2MNAA 1BNZA 4DUYL 2YU9B 4JVYA 1QJOA 3FDTA 4B3SL 5M3MB 5C0XI 2MQHA 2E2HH 1D2BA 3A8JE 4RAUC 1U9RA 2J0TD 5ELFA 4CGYB 4TVAB 1EOVA 4P71A 2HCIA 3CC4A 2F1MA 4PMWA 3JC66 1WE8A 3EJIA 1CKOA 1NE3A 4KV6A 1FGBD 1RTOA 4JG2A 1AZQA 4IUQA 3T4AC 4BA1I 1PRTC 5HGTA 2EQSA 4DXFA 5IT9E 2E5LQ 1AEXA 3WOFA 1AZPA 2OPVA 1O7YA 4LUZA 2JZXA 4BXXG 3S24A 3K5NA 4F7XA 2A69D 1PDQA 4QUFA 3CRKC 2R93B 1G91A 2Y0SE 1SRUA 3W3AA 4PV1C 2YTXA 3KBXA 4LF5Q 4KHZA 2O5JC 1IW7D 1UE1A 3D0FA 2B2YC 4QL5A 5FLMH 1XNRQ 2PQUA 3RD4A 1HNWL 2EYOA 2RDGA 1R9TH 3KLSA 2PW5A 3S15B 5A35A 3NENA 1PYBA 1JWUD 3HOWH 2HQEA 5I2XA 1X3PA 4PNYA 4Z9CB 3DEPA 2CHBD 3K6OA 4X65Q 5FLXc 2OF1A 4FP5D 5GROA 4IN3A 3T56B 1U0LA 2UUBQ 4LF9L 3MC0B 1STAA 2C9OA 4PZ6A 1HNZL 1SJHD 1PRTD 1Q82C 3JAME 1SEBD 4GOPB 4G7HC 4BBSH 4R4CA 1TWCH 2PQAB 3PGZA 3CU7A 1DYQA 2KOLA 3RN2A 1TS2A 4OX9L 4ME5A 2FMRA 1WTOA 2QCPX 1F9QA 1LABA 5JJKA 2D0PA 2VQFL 3K7AB 4TSSA 4HIOA 1AE2A 2OTJA 3J7ZC 4A3EG 1V1OA 2BA0A 4X3KA 3RZDH 2Y0SB 1GM5A 1TS5A 3CPFA 2NTSA 2JSOA 4PZ8A 2HQLA 3BZKA 2EYLA 2Z0SA 5EGTA 4DR6Q 3VR6A 1KLUD 1ZEQX 5JAVA 2YYZA 5C44G 3A5ZB 4PQXA 4DNRB 1YHAA 2YTVA 3OTOQ 5E7NA 5KRUA 3D4WA 1K83H 3C1FA 2CCZA 2HHHL 2WV6D 4G7ZC 2VUMH 1NMFA 3M9BA 3HOUH 2K5NA 1LTGD 4C56C 1Y69U 3K5MA 1MJEA 1YBYA 4LFCQ 3HZXA 1VQKA 4KHPQ 1T5XD 1Z6HA 3FKIG 4NXML 2UUCQ 4EVOA 1BKBA 4DK6C 4JI4Q 3SK6A 5FO7B 1N34L 3WWVA 4DV2Q 1XTDA 3IRBA 3K5OA 1NSNS 2PY9A 3OW2A 1PFMA 3CXCA 3EQLC 2B29A 4A3BB 2I07B 1G2SA 1YNXA 4NPSA 3MXPA 5EPKA 1WCMG 5M5XH 1JJGA 3H0GB 3ZYYX 3TS2A 5C4XB 1TQOA 2IHEA 2PI2A 2WAQG 5E4WC 1KD1C 4RG1A 3MZ5A 4Y7NB 1E22A 1HNXQ 1WD0A 4P73A 1G6ZA 1B9MA 4C1NI 1N8RC 5DEHA 1L0XB 1P16A 4DN4M 4G7OC 4IPHA 2F0IA 3M4OB 2HT1A 5KYIA 2R7ZB 2B63H 4WJWA 4O0AA 3VA5A 1TIID 1I4PA 4FXDA 2FXQA 3EN2A 1V43A 2BH8A 1A2TA 2IWHA 5TSSA 4B9XA 1PA6A 1CHPD 2EY2A 2QDBA 3S14B 1LYLA 1RHPA 4JV5Q 2RA4A 2A74C 1NR4A 2TSSA 3CKIB 3NTIA 5C5LA 1B50A 1DGSA 4DAPA 1DZ1A 1HQMC 3VR2A 1L1OB 1WVLA 1YITA 3QIAA 2ALYB 4JI6Q 5EKKA 5IGEA 1JOQA 1HZCA 1TWGB 1OTCA 1Z7TA 2O4XA 5C4HA 5JVH3 2K5VA 3J80i 5C3EH 1I4HA 4DV3Q 1B8AA 4ULLA 1XMOQ 2NVQH 3OIQA 5CGKA 4J1MA 5I9OA 3UI2A 5IGBA 1R4PB 2BH2A 4JI3L 3G4SA 3F2BA 4H13C 2HH3A 3I4MB 4X64L 4HJ8A 5LMNQ 1G51A 3DXJC 2JP1A 5K36H 4BS9A 4XYOA 2M9VA 4KD3A 5CORA 2R92B 2PZTA 1CA6A 3VYSA 1V1PB 1UUPA 2F0SA 1IYJB 2LXKA 1GUTA 2N88A 1HR0W 2GVBA 2M00A 4L6TB 5LMNW 2NN6I 1QNKA 1JWSD 1HUMA 2F0OA 2N8NA 1ZYRC 4DR3L 2L0CA 1EIYB 1DJRD 5IODA 1RD9D 1JJCB 3A54A 4UPAA 4AQYQ 1W6JA 1E0BA 1J5EL 2IY5B 4LF8Q 2E8GA 5KEEA 3E6ZX 1WTXA 1EZ6A 4NXNL 2PQEA 3MXUA 1EOTA 1QB5D 1J9OA 2KCMA 3HOYG 2YV5A 3E0EA 2NZHA 1EL0A 1IBMQ 1PH9A 5A2QL 2KCNA 3S1NH 3J80c 2VB3X 3TP7A 2RCNA 4A3FB 2JA6B 3I70A 1WYDA 2IX3A 2F0FA 2F0LA 3E0JA 1Q86C 1AN8A 3T1HQ 2QF7A 1PH3A 1FJGQ 1VIGA 2QEJC 2R6GA 4DGZA 2JA5G 1BXTA 1PZID 2BE5C 4QUCA 4DAVA 2X6GA 2A8VA 1C48A 2B2TA 2EPBA 4P2CB 5BN3A 4J15A 3L7ZC 4S3SA 1LLRD 2NTTA 1Y1VB 3J7AF 1FVIA 1U4MA 3K59A 3Q23A 1U4LA 2NB0A 2KCTA 1ZYRD 4KKTA 2YTYA 4JC0A 2F0TA 4IFDI 4A3GH 1FYCA 2EYJA 4U673 2C35B 3CCUA 1YJWA 4ZKBB 4HN7A 2E2JB 2VS1A 4C3IB 1H9SB 2NN6G 1Y8NB 3WDNA 3TS0A 4DR2L 1EY6A 1BCPF 1QOHA 1DOKA 1M1KC 2B2WC 1HHVA 4LF6Q 2F0PA 1LT3D 3AFQA 1SNCA 4DUYQ 5JPMC 3J81E 4B3SQ 3HKZG 4FDBA 1KNEA 1X3EA 1C0AA 2I5HA 4R4IA 1JMCA 4L5TA 5M5YH 2HIVA 4A3IH 4LW1A 2BE5D 4O2DA 5I4DA 3TEHB 3U4VA 1SDFA 2IX1A 3TMEA 3VYTA 2CWPA 3NBIA 4IUUA 2JA8H 3EIVA 4GNXB 4F88A 4ODGA 3Q24A 5IGCA 1EQRA 3CD6A 1C9OA 3PUWA 1SE2A 2EXDA 1BDOA 1PTOB 2GN5A 2JVZA 3A7LA 5C44B 3BDCA 1B2TA 4DV1L 2HIXA 1UEAB 3GV6A 1EY8A 3UE0A 1LACA 4KY7A 3TP5A 4KTAA 1HNWQ 5LL6X 2EJMA 2KUMA 3BZDB 1JR0D 4V0BA 3OMCA 4DF7A 3E9HA 1MIUA 3GTQB 4QQBX 5DAUA 2R7DA 3A0JA 3NUCA 4A93H 3S1MH 4LF9Q 2RF4A 4JBJA 4AIMA 1SYDA 3SR1A 1TWAH 3HOWG 3N52A 1HNZQ 3BVMA 3J81L 3CQZH 4QIWE 1C4QA 1TKWB 2HCCA 1CUKA 2XGTA 3AFPA 5KYLA 2DNCA 1BBWA 2CPQA 4QF4A 1WCMB 1XX8A 1KRSA 1KDAA 1EIGA 1EQVA 4CKBA 4OX9Q 1FD7D 1VQOA 3U9OA 3S1RH 5BN4A 1BO0A 1SE4A 2OXPA 2RBMA 2WAQB 4DV4L 2VQFQ 1IBKL 1NCVA 3BJUA 3A74A 1I94L 4R4QA 4FVMA 2K04A 5C4JB 2FHTA 1J6QA 4XT1B 1E1OA 3ERSX 2KEEA 2K52A 5M3FH 2LKVA 3ER0A 2ENBA 4GOPA 1SAPA 5EBDA 5GAGC 1YJ9A 4DNTB 4ZKCB 1K8MA 1X6OA 2CTLA 1SYCA 3RLNA 5DLQE 1EEFD 1PHJA 2X69A 4RWSC 2HH2A 1B7YB 3ULJA 1YNNC 4A3JB 1G6PA 4AYBG 2VL6A 2F3IA 3ONAB 3E5SA 3NTHA 3G7LA 1X65A 5HGQA 2HHHQ 3NQIA 2P2RA 5CYUA 3NXWA 5NUCA 1XNQL 4A3KB 1E24A 1NBWA 4CJ0B 1EUJA 4QIWB 4JI7L 1A3UA 1EC6A 2K5WA 4NXMQ 3GO5A 1A15A 1JQYD 1LUZA 5JEAJ 2CTMA 3TN2A 3BU2A 1F9PA 2V4DA 1I50B 1TY0A 3K58A 1EIHA 3KBGA 1N34Q 4A76A 2KEDA 3MVVA 4U68A 1Q8KA 1QG7A 3TP6A 1R4QB 3U50C 1I4GA 2N49A 3I91A 1UWVA 3I4NH 1O7IA 3NPPA 1K8AC 4NKLA 5G3LF 2JEBI 2JA9A 5KIXA 3EA6A 3DUZA 2ZM6L 4FF2A 1YNND 3J7YW 5D65A 3NSWA 3GTLH 3PIOA 3QWNA 1V1QA 1D6EC 1GXDC 4TQUS 3E9IA 2AQ3B 1ILPA 4LF7L 1MSGA 3G6EA 3T16A 1VF5C 1JWMD 1EFID 1AFPA 4POFA 1LTBD 1IBLL 3VYUA 4A3LG 1IKMA 2ZTDA 3C1EA 1JOOA 2B39A 2A6EC 4DAYB 4KKSA 2MUYA 1XPRA 4GLVB 2B63G 3V05A 2MFIA 4BY1B 3GTMH 1SYEA 2Q8IB 1EWHA 1BCPB 1CK1A 3WOEA 4FF4A 3NHHA 1VQHA 4KJNA 2A6HC 2A19A 1VQ4A 2F4VL 1WTWA 2PNRC 1EU3A 1G291 3MA2B 3V96A 2PW7A 3SE0A 2E2IB 1Z47A 1SROA 3I4LA 4C1NK 3OHXC 3U9SA 1GHJA 1NR2A 1VF7A 1BF4A 3K0XA 4A3DH 1E2ZA 2WP8J 2XRSD 2D2CC 3NEMA 4L5QA 2K4KA 5CV9A 3MTSA 1L1OA 2B2UC 3PO3B 4ZYSA 5C3EG 4JI3Q 3GTPB 4KLKA 4X64Q 2K5HA 3Q8DA 2A6ED 1TWHH 1EQTA 3CCJA 2RDFA 1W6KA 2E74C 4HEDA 2OTLA 2AQ1B 2ZTEA 2K05A 3S9WA 1IZ6A 4GOPC 4NBQA 4QMGA 1S4ZA 2A6HD 3V2TA 1RKNA 2SDFA 4K0KL 4ILWA 2YU9H 5K36G 4MN3A 2WB1G 3HKZB 4IJLA 5M3MH 3TREA 2EE1A 2Z6KA 4ZLTF 4C3JG 1EWIA 4DR3Q 1PVOA 1VQJA 4K6DA 1QNUA 1QVCA 5JJIA 2UXCL 2AUJD 1V1PA 4JOIA 1TWFB 4BY7H 1J5EQ 5I9PA 3HOXB 4NXNQ 3RLFA 3ZJYC 1OXTA 3CMAA 5FLXE 1KIXA 1A2UA 2Z8LA 1I4QA 1VQBA 4TRDA 1I4RA 1GHKA 1LTLA 2L5TA 4BA2I 2CTKA 2R93H 4A3MB 1VQCA 4DNIA 4C3HH 3A8KE 4R1JA 3R2IA 1PZJD 4IURA 1I6VC 5CR3A 1I3QB 2F0VA 5LMUL 2PYKA 1OXUA 3G71A 2F0DA 1MD2D 2RDHA 3S15H 3VR5A 4GZYC 1BR9A 2OT2A 5IYBH 2F0JA 5EPJA 1Y1WH 2PPBC 4B3RL 1R9TB 3PCOB 1VIHA 1IYUA 1LT5D 3HOWB 1GKHA 4UAIA 4DR2Q 1K1GA 2MO0A 5IYCG 5ELBA 2HDMA 4IZ8A 3I90A 3VYRA 1Q8IA 4XDXA 4ALPA 5IYDH 1JB3A 4WANA 5IT9L 3K7AH 1H9SA 3FPUB 3CHBD 2OQKA 3CCQA 1SE3A 4R8IA 3S2DB 2EVBA 1ENAA 4FO2A 2EY6A 3PUZA 4M8AA 3UE1A 3HG9A 4DR5L 3SEBA 5C0XJ 2C5CA 3GTKB 4A3IG 4LIJA 4P72A 2ES2A 4DK0A 5C5MA 2XTIA 2F03A 4G4KA 5JEAH 3A8IE 3NELA 2JA8G 4FXKC 1BBXC 4R4OA 3LWUA 4DV1Q 4AYBB 3KK7A 1PH8A 1PRTB 4X3SA 1S5ED 1F2LA 1ICWA 1L1OC 1PH1A 1STBA 3DWAA 3F1ZA 3NTKA 3I3CA 1CKMA 3CW2C 4GKKL 1SLJA 3TP8A 1DCZA 2XSCA 2OQ0A 2E2DC 3T1YL 1D8LA 2UXBL 3LX0A 2VW9A 3JAML 3ERQA 3NBHA 3KUPA 3W2DA 4HMJA 3TBIB 1CKNB 2PZWA 1A3VA 1E1TA 5IGDA 2Z6KC 3KOJA 1PTOF 4QY7A 1HFGA 1PH2A 2NVTB 4A93G 4A3BH 4CKCA 5DNFA 1SFOH 1PFNA 4OONA 3DWQA 4RKBA 1NJIC 3H0GH 5C4XH 4JOIC 2IPKD 1KC8C 4HCSA 4DU9A 3FPPA 4DV4Q 4FF3A 2L55A 1X54A 1IBKQ 2K01A 4Y7NH 5GADC 1I94Q 2B8FA 2F0EA 1F2MA 2A68C 1LT4D 1ZZKA 5ELNA 4KY5A 4O42A 2WACA 3M4OH 1HCZA 2R7ZH 1DONA 5CBAE 1VQPA 4E6IA 2D0OA 3KJOA 4C2MH 1D7QA 4IPCA 1B44D 4KMUC 1RTNA 2ICIA 1X32A 3I7FA 3RR5A 1OXXK 1M90C 4ABNA 4HTHA 1QUQA 4K5WA 1CFMA 2EYPA 5D3DA 2L11A 1K8OA 3OYYA 3OWEB 2EYHA 5BR8L 1FL0A 2F3VA 3K0YA 1TY2A 3A55A 1J8IA 1XTCD 1NY4A 1S5CD 3HP3A 1XNQQ 3SHLA 3ITPA 1GUWA 2NVYB 1SYFA 3C2PA 4J8QA 2PZUA 4EQPA 2JE6I 1MKHA 3H91A 3OMGA 1S5FD 4JI7Q 1IHZA 1K8GA 1Q3LA 1RJTA 1IL2A 1KTKA 2A68D 2CTFA 5J22A 1Z9FA 3KJPA 3P7JA 3RNUA 4NDXA 5C3EB 3HOVH 3F8TA 1Y8OB 1UEBA 3NE5B 1M4VA 4H44C 5DM73 3FVQA 1VQDA 3PO2B 2ZM6Q 2O2LD 2JYOA 2R92H 2K75A 1BVSA 1VQ9A 4BBRB 3J80E 2PO4A 3PF5A 1V8QA 1A8VA 4LF7Q 2N78A 2L12A 4LAAA 2Q8RE 1D1IA 1EY9A 1LTSD 3KF8B 1AH9A 1IBLQ 1VQ8A 3BVZA 5CV8A 2KECA 1ZZIA 4M1UB 4C3JB 2OPUA 2AXYA 1H9MA 3GTGB 4QCLA 2DY8A 3ND9A 2XIWA 1U4RA 1S3OA 2RVLA 2HUGA 4HIMA 3NQTA 4NB3A 2BCOA 1HA6A 2B2VA 2UUAL 1JOKA 4X3UA 2EOTA 3NK9A 2F4VQ 3PV0A 5JVG3 1QCBD 4BXXH 1EY7A 1E3PA 2KCCA 3TQYA 2K7VA 3BDOA 3HS0C 4A3FH 2JA6H 1PH6A 2LFNA 2D9UA 2NVXH 2K5QA 5D3IB 2XVSA 4L5RC 2CW0C 5IGGA 5LHY1 3S1NB 4KK7A 4QMFB 2EXZA 2HDLA 3H94A 4TKOB 4X66L 3H3VC 3RUZA 1QVFA 1HTLD 1ESRA 4LUVA 2IJ0A 4OWXB 4B3TL 4JI1L 1Y1VH 4WJ3M 2I0QA 1ZTGA 5FO8B 3O13A 4IUVA 4NMZA 3J81i 5IOCA 5LL6S 5CV4A 3R8BA 1Q1EA 1EY5A 1H9KA 4CBVA 3RLOA 3HOZG 3AEVB 1XWEA 3I73A 3NWSA 4OWWB 2E2JH 4C3IH 2RHSB 3MWYW 3KF6B 5C0XH 1EYAA 1SR3A 5EJWA 4K0KQ 2ANRA 4HMIA 1EQQA 4L63B 2A1AA 2PCFB 1SNOA 5FJ8G 2F0WA 3FRPB 4GN4B 2BDNA 1N32L 4K5XA 5JJLA 4A3EB 4EQ5A 2QKIC 3M3YB 1X3FA 2Q2HA 4A75A 2UXCQ 2CW0D 2E76C 2QNDA 4OHJA 1JCKB 5FOBB 4YIJA 2FMCA 3B6YA 5DM63 2WAQE 2FJ2A 2SEBD 2X6LA 4MTNA 1UE6A 3PSIA 1SSOA 1MBYA 3TZUA 2CTJA 3AU7A 3RZOB 2XRQD 3M4PA 1JICA 4BY7G 1PTOH 5C44H 1BQQT 1PH7A 1WTVA 2KVMA 2RHQB 2NZ1D 2JXMB 3FEWX 1VDZA 4BWGB 3QO2A 1LTTD 2K1BA 5LMUQ 1N9WA 3CMEA 4JI2L 3BVGA 4B9WA 3DHQA 1Q12A 1WJJA 1SNDA 2H1EA 4OL7A 4C3HG 3J81c 3H3VH 5GAHC 5FLMG 3FKIB 2O5IC 5JJZA 3GTQH 1F2YA 2Q2UA 2MJHA 4UP8A 5E1FA 1TXYA 4YWLA 4B3RQ 2OCEA 1CQFA 1HXYD 4R9WA 2IX0A 4GN3B 3ULLA 5IYBG 3BYTB 1QILA 1KHIA 4EQOA 4DV7L 4KI0A 4K8IA 1Y1WG 4HIDA 2N3SA 3DM1A 4IFDJ 3L0OA 4WJ4A 2F0NA 3Q6SA 3S2HB 1AW7A 1WCMH 2DN8A 4JCVE 4L5SA 3CQZB 4LFAL 3CCMA 4BBSG 1BBUA 2R61A 2MHVA 3G6JB 1TUAA 1VMPA 1KDCA 4JYAL 1LTID 4ID6A 4MIUA 5C4JH 5HY6A 1ZZJA 4HJ7A 4KKUA 5FKAC 3OOCA 2NUCA 3GTOB 2PQAA 3PIPA 4GLXA 2CVRA 2UU9L 1JJ2A 4DR5Q 5IYDG 5F2DA 2F0KA 5IP7H 1DD2A 1E2WA 3NP8A 4HAEA 3KLSX 1YVCA 3G48A 5KNDA 2B2TC 1QVGA 1KAWA 4AM3A 1I5FA 2Y0SG 1PMRA 1STYA 4B3ML 4A3JH 1BCPC 4YY3L 3IAYA 1I6HH 1VQAA 1SMXA 1X3GA 4DR1L 3TRZA 3SK8A 1S40A 1FNWA 1YEZA 1EU4A 1D5ZC 4GKKQ 1SXTA 5EPLA 5M9OA 4A3KH 3M4QA 3T1YQ 1PZKD 2UXBQ 5J39A 2AQ2B 2EY5A 1HZ9A 2VUMG 4JI0L 4XYQA 3K81C 3HOUG 1CQVA 2AUKA 3GTJB 1I50H 2K6AA 4UY8C 3Q22A 2CWAA 1B70B 3IKJA 4DV0L 1P8LA 2AWNA 4MHEA 4IQZA 1X3QA 4CJ2C 1KQSA