4OO1G

Structure of an rrp6-rna exosome complex bound to poly(a) rna
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
234
structure length
226
Chain Sequence
STFIFPGDSFPVDPTTPVKLGPGIYCDPNTQEIRPVNTGVLHVSTAYIDYSSKRYIPSVNDFVIGVIIGTFSDSYKVSLQNFSSSVSLSYMAFPNASKKNRPTLQVGDLVYARVCTAEKELEAEIECFDSTTGRDAGFGILEDGMIIDVNLNFARQLLFNNDFPLLKVLAAHTKFEVAIGLNGKIWVKCEELSNTLACYRTIMECCQKNDTAAFKDIAKRQFKEIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/rna
molecule keywords Exosome complex component RRP45
publication title Structure of an Rrp6-RNA exosome complex bound to poly(A) RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 36
structure length 226
sequence length 234
ec nomenclature
pdb deposition date 2014-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF15985 KH_6 KH domain
G PF18311 Rrp40_N Exosome complex exonuclease Rrp40 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4oo1G01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4oo1G02
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 4oo1G03
1I94L 4GLVB 3DLLA 1UWVA 2EJMA 2D62A 3J7A5 3KFUA 4RMFA 4DK6C 1E2ZA 4DV0L 2RHQB 2JVZA 4GKKL 5JJKA 2C35B 2DNEA 4GN5A 3KDFB 1VQIA 1N9WA 5GQOA 2A6HC 5C3EH 1Z9FA 2L5TA 2WAQE 3U4VA 2IHEA 1YNXA 4DUZL 1O7LA 3P20A 4GLXA 1E2WA 4DR5Q 3TRZA 3MEFA 1AE2A 1NE3A 1EIFA 1MKHA 2Y0SE 2R93H 3H0GG 2OWOA 1YI2A 3HOVH 4LF7L 2NVYH 3G48A 2CTEA 3KLRA 1PYSB 4HIOA 1T5EA 1VQ9A 2BH2A 1X65A 4KHPQ 3FMCA 2A68C 1N32Q 3EN2A 5GAGC 1E2VA 3CCUA 3T1YQ 4P73A 1I6HH 3GDEA 4Y52H 4JK1C 4IFDG 3W1BA 3IKJA 4GKJQ 2CQOA 1N34Q 2MO1A 4AYBE 3PUXA 1K8GA 5KNCA 2YTYA 2Q8IB 1W2BA 4UP7A 1H9SA 4YWMA 2WP8J 2AMCB 4A3FG 1H9RA 2E3UA 5FLMG 2AHOB 4XTCS 1DXMA 1Q90A 4XIGS 4LFCL 3NBHB 4IO9A 3JAMc 1UE7A 2DGRA 2YTVA 4DK1A 2Q2HA 4OO1G 4DV4Q 2EIFA 3K7AH 3STBD 4A3LH 1PH7A 4B3RQ 5K36G 4NXNL 3QIAA 5LMNQ 4YWKA 3GQBA 4X66L 3HFZB 1VS0A 3UE1A 3WWVA 4DR3L 4JYAQ 4BA2I 1ASZA 3ND8A 1LABA 3H0GH 4DV1L 1ASYA 1HTPA 1TWAH 5IWAL 3OTOQ 4BA1I 1E22A 1N36L 1U0LA 3RZOH 1NY4A 2VQEL 3HOZG 3H15A 2VZAA 3S1RH 2DUDA 4JVHA 4QY7A 1DTJA 4AIMA 2CTKA 3K0XA 3AEVB 1GHJA 5IT9c 2CCZA 2A6HD 3CCQA 2UUAL 4X65L 1GUGA 3HOYH 4NB3A 4GNXC 1IBML 2ZTDA 3CRLC 4P72A 1PV4A 1K83H 2JJQA 1UE6A 3GTMH 3ND9A 1B7YB 2VW9A 1BBWA 2CKZB 4JBKA 1AE3A 4JI0L 4C3JH 4B3SQ 3PO2H 5IE8A 1LM0A 2L15A 2BE5C 1LYLA 1S40A 2VL6A 5IYCH 4JI7Q 3E9HA 1HZCA 4DR6L 3K8AA 1L1OA 3A8KE 3AB9A 4LUOA 3CCLA 3U9SA 2VUMG 4A3BH 1XPRA 1IBKQ 3S1QH 3GTQH 1GM5A 2UXCL 1Z6HA 2A68D 3F2DA 1WI5A 3SE0A 1TWHH 1M90C 3Q8DA 1P8LA 4TVAB 1PH4A 3U58A 3CCVA 1GUSA 2HH2A 3KDFA 2NN6I 1KHMA 4R4IA 1PH8A 1SRUA 4P74A 4DR7L 3V69A 1I6VC 2V1CC 3A8JE 1P16A 2N3SA 2PMZE 4GN3B 4A3KG 4KI0A 4DV2Q 2YU9H 3UE0A 4GN4B 4DV7Q 3HOXG 3E0EA 4LUVA 2R92G 3J80c 3GTJH 4APVA 1I5FA 1ONLA 2O5JC 1VIHA 4A3GG 3CQZH 3RR5A 1IZ6A 1FL0A 2BDOA 4JI6Q 1T9HA 4RG1A 1G51A 4KN7C 4BY7G 4KN4C 2Q2UA 3AFPA 1KXLA 1FGUA 2UU9Q 1CSPA 3PO3H 4JI2L 4JOIA 4C3IH 1M1KC 1SR3A 3I56A 1HNZL 2AWOA 5FJ8H 2VY3A 1Y1WG 1GJXA 4A75A 1XMOL 3AFQA 3ER0A 1B9MA 4QQBX 3VA7A 1PA6A 1WCMG 4L5RC 1OXVA 3PF4A 3OW7A 3ULLA 2E74C 2R7ZG 1E1OA 3KJOA 5HY6A 3GTPH 3VR6A 5C0XI 4LFBQ 1VQPA 3F1ZA 1L2FA 4B3TQ 2UXBL 1PH6A 2R92H 4UPAA 3ULJA 1HZAA 1SLJA 2KCTA 4JI3L 5C44H 1K73C 2A19A 1EC6A 1VQAA 3DM3A 2PCFB 4A3GH 1Q46A 2OTJA 4P75A 4LNQA 2EJFC 2F3IA 1K3RA 2N49A 4YCVA 1Q12A 1CUKA 3AEVA 4IPGA 3QG1A 4JI5Q 1VQ4A 2HQLA 4YY3Q 1ZZKA 2GVBA 1Y1WH 4OONA 1HR0Q 2BL5A 4LF8Q 4KKTA 2KA7A 1EOVA 4IPDA 1KD1C 2A6EC 2NN6G 4DAMA 3CMEA 1K9MC 2EXDA 3CD6A 4DR4L 4JV5L 3T1HQ 4IJLA 2WB1E 3M4QA 2R7ZH 3CCSA 2BA0A 1X56A 3A74A 2IX1A 1Q1BA 2NZHA 1CFMA 3M4PA 2XGTA 3SDZA 4MZ9A 4BBRG 2Z0SA 4QGUA 3BU2A 2CFMA 1ZTGA 1WYDA 1UE5A 3KJPA 5IYBH 2R93G 4LF5L 2D0PA 3HOVG 1BBUA 1GKHA 1E1TA 4R4QA 2IX0A 1V43A 1D8LA 1L1OB 3I55A 2D0OA 3CCMA 1FJGQ 1X6OA 3NEMA 2GVAA 1GHKA 1VDZA 4FDBA 4DK0A 4YWLA 4DV3Q 2R7FA 5LMUL 1TKWB 4GNXB 3CXCA 3W5OA 1O78A 2F4VQ 1PMRA 2ANNA 2NN6H 2VQFQ 4K0KQ 1JMCA 4PZ6A 1XPUA 1HNWQ 2NVTH 3IRBA 1N8RC 1DT4A 1VQJA 4JBJA 3HKZG 2YYZA 2E5LQ 1NMGA 2HIXA 3HKZE 1FR3A 2GN5A 2K50A 3T56B 1VQOA 4BBRH 4JI8L 1GD7A 5JJLA 4AQYL 4A3LG 3VR5A 1U5KA 4B3MQ 1XMQL 3VR4A 2FMRA 2H5XA 1E3PA 3U50C 4X64L 3D31A 3A7AB 1HNXL 2A69D 2JA5H 1LTLA 1HJPA 3I72A 2KCCA 1VQDA 4DR2L 5AJ3Q 1IXRA 3D0FA 4POGA 2HH3A 2I5LX 1EYGA 3MFYA 2K32A 2K75A 2KCMA 1X55A 4DV6Q 3CCRA 4OX9Q 4H13C 2QGQA 2V4DA 4OWTB 5M3FG 2A6ED 1KAWA 1FYCA 3S14H 4DR1L 5JJIA 3TQYA 1HPCA 3VDYA 4A76A 1TWGH 1IYJB 3HOYG 1V8QA 3NELA 1ZKOA 3CC2A 2CTJA 5GADC 3TS2A 3LGJA 4DPGA 4KLKA 1K8MA 1VQNA 3GTLH 2PI2E 4LFAL 1V9PA 2ZM6Q 2RF4A 5M5WH 1NJIC 1CKOA 1EUJA 4H02A 3PO2G 4JI4L 5C0XH 5IYCG 1XNQL 2ES2A 2EDGA 3J7ZC 1KL9A 3HOWG 2ANRA 3RNUA 1X3EA 4A3BG 2I5HA 4LFBL 1JJGA 5BN5A 1QZGA 4MNOA 2YQRA 2O5IC 1EWIA 2JQOA 3S17H 4QMFB 1WOCA 5KNDA 4YHHL 1Y8OB 2UUBQ 5M3FH 4DNTB 4DV5Q 2HHHQ 3EQLC 3UDGA 2QA4A 1VQEA 4IOAA 1IBLQ 3RZDH 2DGYA 5IYDH 2KBNA 3T51B 2MQHA 4A4IA 4LF9Q 3I4LA 4OGQC 1S72A 2ZJRA 5M5XH 4WALA 1YVCA 4G7ZC 2VS1A 4X62L 3KF8B 3BZCA 4NXML 2Z6KC 1S3OA 4LF6Q 4PG3A 3OW2A 3GTKH 1OXSC 2UXDL 3S15H 1X4MA 2UUCQ 1N33Q 1LACA 1JJ2A 2DNCA 1Z7TA 2OPVA 1Y1VH 1IW7C 4JI1L 3LNNA 3HOWH 2QF7A 5C0XJ 3EBEA 1TWCH 3CP0A 5BR8L 1K1GA 3S2HH 1H9MA 3K80C 1IYUA 4H0LC 3I7FA 5M5YH 3CCJA 3PO3G 1I94Q 4GNXA 2F1MA 3PIPA 4QJFA 1CI3M 4LK1C 4LF4L 1OXXK 4NPSA 1K0RA 5FJ8G 1TUAA 4DV0Q 1J5EL 2MJHA 3HKSA 2K14A 4GKKQ 4NBQA 1EFWA 4DUYL 3K81C 4GOPC 1JE5A 2D2CC 1YJNA 1C9OA 1DD2A 1EQRA 1H95A 1YJ9A 3FHWA 1KHIA 4IPHA 4DUZQ 2AXYA 1DGSA 3GTGH 1B8AA 3BDOA 2BA1A 2ZT9C 2YV5A 5C44G 4IQZA 3N6RA 4LUZA 2PNHA 1VQ5A 3M85A 1X3GA 4LF7Q 1X54A 4A3JG 1G6PA 3PIOA 4GZYC 4DNIA 1KC8C 2JA8H 1NMFA 3M4YA 5ELOA 2ALYB 1YIJA 4R1JA 1Y14B 1AH9A 1YNNC 4DR5L 1SMXA 3T53B 4GOPA 2ZJQA 4L5TA 4HJ9A 5IP9H 2KHJA 1QUQA 1H9JA 2XTIA 3I73A 4AM3A 3E9IA 3KYHC 1PH9A 2F52A 2IHFA 2E2JH 1C0AA 1KIXA 1TU2B 1XNRQ 4JBWA 4KHPL 1EWHA 1N32L 4LFCQ 3UDXA 3T1YL 3HOUH 5C4XH 2RCNA 1VQGA 3PF5A 4GKJL 2B8GA 1N34L 2VNUD 2BE5D 3PUWA 5IP7H 1OXUA 3ULPA 2HT1A 4OXPA 3S2DH 4NXNQ 3TZUA 2I5MX 1KQSA 4X66Q 1VQ8A 1H9KA 4DR3Q 1NBWA 4KKSA 4DV1Q 5IYBG 1A63A 1YZ6A 1YHAA 4A3JH 2CTMA 3RLNA 3NE5B 5IWAQ 2MFIA 4DV4L 4A3EH 1N36Q 3PSIA 4B3RL 1ZZIA 3CPWA 2VQEQ 5LMNL 3M4OH 3UDIA 4JYAL 1YNJC 3I4MG 5H1SE 1G291 1YJWA 3K7UC 2OQ0A 4X6AH 3RLFA 2NZOA 3CF5A 4X65Q 2UUAQ 3OTOL 1IBMQ 1YHQA 4TKOB 3M3YH 4IFDI 3AQQA 3A7LA 1VQHA 1WFQA 3QJYA 4A3IG 3VKEA 5DLQE 4IOCA 4A3DH 1XJVA 3A5UA 4EQ5A 2ZTCA 4JI0Q 4I7ZC 2KHIA 1K8AC 1I3QH 3EIVA 4PMWA 4A3CH 1VIGA 4H44C 4DR6Q 2FXQA 1JB7A 3U1KA 2CTFA 1YHBA 3G4SA 4OO1I 1PFSA 4R4TA 4QL5A 2Q2IA 1O7IA 3KLWA 3FPPA 2UXCQ 2JA5G 4KMUC 3I4NH 2BH8A 1WVNA 3BZKA 4B3SL 5M3MG 2N8NA 5IY0A 1N33L 4P71A 4JI7L 3STBC 1PHJA 5E7NA 2IT1A 3F2CA 4L5QA 3PUZA 3I4MH 3KF6A 4R4OA 4DAYB 4O0AA 2E8GA 2N78A 1IBKL 3I4OA 4DR7Q 3CW2C 3H94A 2WFWA 4A3MH 1ZZJA 4A3IH 5JEAH 1GUOA 2YTXA 3OYYA 4JCVE 3M9BA 1VQMA 4YCWA 2CWAA 4LIJA 4PZ8A 3J81i 1MJCA 1K8OA 1QJOA 5C0XG 4PZ7A 3PGZA 4DV2L 1B70B 3FKIG 2WAQG 4WJ3M 4OWWB 1EQQA 1JT8A 2K4KA 1CSQA 4DV7L 1Q81C 4BXXH 2EQSA 5M3MH 5C4JH 1PH5A 1ZYRC 1W3SA 4JI2Q 3PV0A 1NTGA 1X3FA 2Y0SG 2KENA 4BY1H 1HNZQ 1HZ9A 3CC7A 2CWPA 1SFOH 1XMOQ 2K5VA 4JBMA 2JEBI 1L0WA 4BBSH 4JI6L 3I2ZA 2JA9A 4GOPB 2PY9A 1CTMA 1QUQB 4AH6A 5BN4A 2UU9L 2ASBA 2OPUA 5IYDG 4QIWE 4GS3A 3PUYA 1J4WA 2E2HH 1BKBA 1VQFA 4AYBG 3OPOA 5JEAJ 4J15A 1VQ6A 1TXYA 2UXBQ 3VR3A 3G71A 1XNRL 1GUNA 2JA6G 2AKWB 4JI3Q 2CTLA 3KOJA 3FP9A 3UDFA 3BG3A 3H3VI 4Y7NH 1Y1VG 4OWXB 1CKMA 2MNAA 4KKUA 3FKIH 3GD7A 1Q86C 2LXJA 4UP8A 3ICEA 2PPBC 1Z47A 2JZXA 4ME3A 4WJ4A 2A1AA 4B3TL 3TREA 4C2MH 2B8FA 2I0QA 3NENA 1GVPA 4UY8C 4IJHA 1PH1A 1BDOA 1YBYA 2ATWA 1QVCA 4L8JA 1A0IA 1PVOA 3LWUA 3A8IE 1L1OC 3JAMi 4DR4Q 3VR2A 4JV5Q 5FLXc 4JI5L 1LUZA 5LMNW 3M7NA 2PQAB 1HQMC 4IFDH 4YY3L 3OOCA 1HR0L 1J5KA 2B29A 4LF8L 2AWNA 3B6YA 1VF5C 1PH2A 4A3FH 1YEZA 3F8TA 2RHSB 2JA6H 5FLMH 1FVIA 4GLAC 4HJAA 1VF7A 3T1HL 4R4CA 4LF5Q 5GAHC 2AUKA 2NVQH 1VQLA 3WDNA 2IY5B 1SMYC 1YITA 4OO1H 1MJEA 2PNRC 1WE8A 2JA8G 1CKNA 4HJ5A 5K36H 4JVYA 4DNRB 4HJ7A 2LMCB 5IP9G 3HGBA 3PUVA 3JC66 1A8VA 2PQUA 4JG2A 5LMUQ 1PYBA 2A8VA 4HR7B 1A6XA 1QZHA 2EVBA 3RN2A 4POFA 2ZJPA 1KRTA 2Z6KA 3KF6B 3ZJYC 2D5DA 1FJGL 1VQ7A 3HOZH 1JJCB 3GTOH 2QNDA 2K52A 3HOUG 3CAMA 4DV3L 3ERSX 3CMAA 5C4XG 1B9NA 2OQKA 1KRSA 4IFDJ 3F2BA 3S1NH 5IP7G 4JOIC 4JI8Q 4EX5A 2F4VL 4AQYQ 3S1MH 2VQFL 5KNBA 2E75C 4O2DA 1XMQQ 1VQKA 1VCIA 4K0KL 2CPQA 3G6EA 1HNWL 4X64Q 5BN3A 4HIKA 1HNXQ 2E5LL 1HH2P 3W3AA 1I50H 3IFTA 3SGIA 4G7OC 1IYVA 1Y8NB 2LXKA 4DR2Q 1X4NA 1RIPA 4A3EG 1Y8PB 2Q2TA 1X9NA 4JC0A 5GROA 1BVSA 2K5NA 1R9TH 4B3ML 3J81j 1Y69U 3DXJC 3PCOB 3AYHB 2VUMH 2E76C 1Q8KA 1SE8A 4ALPA 4DR1Q 2PI2A 5J3BA 4HJ8A 3RN5A 2JE6I 5AJ3L 2JA7G 5GAEC 1C7YA 1XTDA 4DV6L 4OX9L 4PV1C 4G7HC 3RLOA 2B63G 4LW1A 1QVGA 2JEAI 3A0JA 4LFAQ 3CC4A 3J80i 4A3DG 1Q7YC 1UEBA 4L5SA 4JI4Q 4IPCA 1MIUA 1IW7D 1E7ZA 2AUJD 3GO5A 3CRKC 2QEXA 2JK8A 1XNQQ 4A3CG 4A3KH 4LJZC 1OTCA 2R7DA 1H9SB 3HOXH 3A5ZB 1IL2A 3W1GA 1UE1A 3CCEA 3H3VH 2ZM6L 1HCZA 3I4NG 1QVFA 3MXNB 2K7VA 1GUTA 4C3HH 1A62A 4B8TA 1VQCA 4YHHQ 2OTLA 1RL2A 2E2IH 4KHZA 4YCUA 2R6GA 2MO0A 1PH3A 1EIYB 1D7QA 4BY7H 1GO3E 3L7ZC 2A69C 3CPFA 3D4RA 2PQAA 2JA7H 5A35A 5HGQA 4A93G 4A3MG 4DK3C 1XPOA 1Q82C 2P2RA 4HIDA 4WANA 5JEAG 2B63H 2UUBL 2ZTEA 3TS0A 1SN8A 4X62Q 1Q1EA 4DV5L 2HHHL 4TQUS 3BJUA 4NXMQ 1WCMH 1V1QA 2UXDQ 1IBLL 4RCNA 1SROA 2WB1G 4LF9L 2OCEA 5EAYA 4JI1Q 5C3EG 2EJGC 5BR8Q 2K33A 2LSSA 3S16H 2B3GA 4HIMA 2K5HA 3L0OA 4MTNA 2NVXH 4BXXG 1HR0W 1WJJA 4LF6L 1J6QA 1HZBA 2UUCL 3U4ZA 1OXTA 2CW0C 4LF4Q 3J81c 3TEHB 4BY1G 3L2PA 1TWFH 2ID0A 4DKAC 1CKNB 3MXUA 2DN8A 1VQBA 1DCZA 2HIVA 1J5EQ 4LWCA 4BBSG 5ELNA 1E24A 4UP9A 4DUYQ 2JXMB 3S24A 4A93H
chains in the Genus database with same CATH superfamily
2K28A 5C3XA 1I94L 4GLVB 2NYZD 4LF8H 3DLLA 4K14A 1UWVA 2EJMA 2D62A 2LKVA 3J7A5 3HKZB 3KFUA 4RMFA 2IX3A 4C1NK 2BCOA 1SYCA 4DK6C 1B53A 4RGMA 1E2ZA 4DV0L 2RHQB 2JVZA 1AN7A 5D3DA 2F0SA 3V2TA 1UG8A 3T1HH 4GKKL 5JJKA 2C35B 3K7AB 2DNEA 1LLRD 4K5VA 5FO9B 4EVOA 4J6HA 2NZ1D 4GN5A 4RHRA 3KDFB 5IT9L 2PYKA 3NTIA 1VQIA 3L3OC 1N9WA 5GQOA 2A6HC 3J7AV 3ITPA 2I07B 5C3EH 3H0GB 1Z9FA 3DWAA 5HGTA 4B08A 2L5TA 4PDBA 2WAQE 4FXKC 3U4VA 1TWAB 2IHEA 1YNXA 4DUZL 3GP7A 1O7LA 3P20A 4MIUA 3ZYYX 4GLXA 4U68A 1CT1D 1D6EC 2UXCH 4KTAA 4RGTA 3RZOB 1E2WA 4QB4A 4DR5Q 3TRZA 1YNJD 3ERQA 3J81E 1F2YA 3MEFA 1AE2A 2RSOA 1NE3A 3PMFA 1XTCD 1U4PA 1EIFA 1MKHA 2Y0SE 3NPPA 2R93H 3H0GG 2OWOA 3S1RB 3C3LA 1YI2A 4FF2A 4LF7L 3HOVH 1BO0A 2O4CA 3NXWA 3KLSA 3MZ5A 2NVYH 3OWFA 1EQVA 3G48A 1FJGH 4QUFA 2CTEA 4QIWB 3KLRA 2Z8LA 4I65A 1PYSB 3HRZC 4HIOA 3HOYB 3EA6A 1T5EA 1VQ9A 2BH2A 1X65A 4DV3H 4KHPQ 3V96A 3FMCA 3TP8A 3OWEB 2A68C 3SXHA 4UAIA 1N32Q 4IUTA 1K83B 3EN2A 5GAGC 5I2XA 3A55A 1E2VA 3CCUA 1EEFD 3T1YQ 4P73A 3GTMB 1I6HH 3GDEA 5CGKA 4Y52H 2F4VH 4JK1C 3K57A 2F03A 4IFDG 2VQFH 3W1BA 3IKJA 4GKJQ 2CWHA 1O80A 2CQOA 2MO1A 1N34Q 4AYBE 3PUXA 1K8GA 4K0KH 4JVZA 1NNXA 5KNCA 4C3JB 3PO2B 2YTYA 2R3ZA 2Q8IB 1QNUA 4V0BA 1W2BA 4UP7A 1H9SA 4YWMA 2K05A 2WP8J 2AMCB 4A3FG 1H9RA 2E5LH 4ILWA 1LTGD 2E3UA 2EYJA 5FLMG 2AHOB 4XTCS 1DXMA 1Q90A 3URYA 3P7JA 4XIGS 4LFCL 3NBHB 4IO9A 3JAMc 1UE7A 1LTAD 1STNA 4A3BB 2DGRA 2YTVA 3S1QB 3GTQB 1G2TA 3FDTA 1PTOC 4DK1A 4ZKCB 2Q2HA 4IALA 4OO1G 1ODHA 4DV4Q 2EIFA 5DM73 2CW0D 3K7AH 1O7YA 3STBD 4A3LH 1PH7A 4B3RQ 5K36G 1I6UA 1TWHB 4NXNL 3QIAA 5LMNQ 4YWKA 3GQBA 4X66L 3HFZB 1VS0A 3UE1A 3WWVA 4DR3L 5CR3A 4JYAQ 1ASZA 4BA2I 3ND8A 2LY7A 1LABA 3H0GH 4DV1L 1ASYA 2FPHX 1HTPA 1VMPA 2EYMA 5DT9A 4ZCKA 4DXGA 1TWAH 1HNZH 4OX9H 5IWAL 3OTOQ 4BA1I 1SYGA 1E22A 5KGUA 1N36L 1U0LA 3RZOH 1NY4A 1R4QB 5DNFA 2L55A 2VQEL 5ELDA 1F2MA 3HOZG 5DAUA 2YU9B 3H15A 2VZAA 4M1UB 3BZDB 3S1RH 2DUDA 1A2UA 4JVHA 4QY7A 1DTJA 1BNZA 2BDNA 4AIMA 2CTKA 3K0XA 2PO4A 3AEVB 5CV4A 1GHJA 1TS5A 4CBVA 5IT9c 1EWCA 3FPUB 2CCZA 2A6HD 3CCQA 4X65L 2UUAL 1NR2A 1GUGA 5EBCA 3HOYH 4NB3A 4GNXC 1SYBA 2ZTDA 3CRLC 1IBML 3GTJB 4P72A 4R8IA 1J9OA 2NB0A 4B9XA 2PZWA 4KHVA 1PV4A 4IUNA 1K83H 1PRTB 3JAME 2JJQA 1IKMA 1UE6A 4FNFA 3GTMH 3ND9A 1B7YB 2VW9A 1BBWA 3CQZB 3E3XA 2CKZB 1PZJD 3DHQA 5D14A 4JI3H 4JBKA 1EYAA 1AE3A 3PIP3 4C3JH 4JI0L 4B3SQ 3PO2H 2R61A 5IE8A 1STBA 1LM0A 2L15A 2FMCA 2BE5C 1LYLA 3PO3B 1S40A 1RD9D 2VL6A 4FP5D 5IYCH 4JI7Q 1TT2A 1SE4A 3R8BA 3E9HA 4C3IB 3MEHA 1EL0A 1HZCA 4DR6L 3NTHA 1CA5A 3K8AA 1L1OA 5J1ZA 5IGGA 3A8KE 4HCEA 2B2YC 3AB9A 2WV6D 4P2CB 4RFBA 4LUOA 1EYCA 3CCLA 2F0JA 3U9SA 2VUMG 4A3BH 1XPRA 1IBKQ 3S1QH 3GTQH 1HFNA 3E5SA 1EY7A 1GM5A 2UXCL 1DZ1A 2RA4A 2D9UA 4PMCA 1Z6HA 2A68D 3F2DA 4UDUC 1WI5A 3SE0A 2UUBH 2PT7G 1TWHH 1M90C 3Q8DA 1F9SA 5E1FA 4DV5H 2HHHH 4C3IG 1P8LA 5EPLA 4TVAB 2DY8A 1PH4A 3HZXA 4MTKA 5E4XA 3U58A 3CCVA 1GUSA 2HH2A 1D5ZC 3KDFA 2NN6I 1KHMA 1OO9B 4LF9H 3GTPB 4R4IA 1PH8A 1A15A 3QOLA 3PQIA 2FHTA 1SRUA 4P74A 2R92B 4DR7L 1TS3A 4BS9A 3V69A 1I6VC 2V1CC 5IGEA 3A8JE 2KECA 1P16A 2N3SA 2PMZE 5C44B 3PIO3 4B8CD 4GN3B 4A3KG 1G8ZD 5EPKA 3K5NA 4KI0A 1EYDA 4DV2Q 1SE2A 2YU9H 4A3GB 3UE0A 4GN4B 4DV7Q 2UUCH 3OHXC 2PZTA 3Q22A 2EYOA 3HOXG 3M7GA 3E0EA 3H6MA 4LUVA 2R92G 3J80c 1HTLD 3GTJH 1AW7A 4APVA 1I5FA 4N8FA 1D5MC 4C3HG 1ONLA 5CV8A 1EY6A 2O5JC 4K5WA 1VIHA 5IT9W 3KBGA 1U4RA 1KDBA 4A3GG 3CQZH 3RR5A 1Y1WB 1IZ6A 1FL0A 2F0GA 3OSSD 2BDOA 5C6AA 1I94H 1SYFA 4JI6Q 1T9HA 4RG1A 1G51A 3MTSA 4KN7C 4BY7G 4KN4C 2Q2UA 2D9IA 2CVRA 1EFID 1MBYA 4XDXA 3AFPA 5LMUH 1KXLA 1FGUA 2UU9Q 1CSPA 3I0PA 3PO3H 1FKAH 3T16A 1IKLA 2MJ8A 2DY7A 2EY1A 4JI2L 3MAQA 1HUNA 4JOIA 4C3IH 1M1KC 1SR3A 5G3LD 3I56A 1HNZL 5JAVA 2AWOA 1SEIA 4E6IA 2R7ZB 5FJ8H 2VY3A 1Y1WG 1GJXA 4A75A 1XMOL 3AFQA 4M8AA 3ER0A 1B9MA 2QKIC 5A2QE 5FKAC 1CZWA 4QQBX 3VA7A 1PA6A 3R2IA 2EYFA 1WCMG 2F0PA 1C4QA 2AQ1B 2HUGA 4L5RC 1OXVA 3W2DA 3PF4A 1SJHD 2TMPA 2K6AA 3OW7A 1SEBD 1CHQD 1JC7A 1EY0A 4DUZH 2SNMA 3ULLA 1SMYD 1JWMD 4WFN3 2E74C 3EFXD 2R7ZG 3HP3A 2WIIB 1CA6A 4IN3A 1SJED 1XMQH 2F0UA 1E1OA 3KJOA 4PMBA 5HY6A 3GTPH 3MC0B 3VR6A 4F87A 5C0XI 5ISRA 3J80E 4LFBQ 4X64H 1F9PA 3F1ZA 1VQPA 1L2FA 4B3TQ 2UXBL 5CMDA 1AZPA 1PH6A 2R92H 4LMQD 4UPAA 1B50A 3ULJA 1HZAA 1SLJA 1ZEQX 2KCTA 4JI3L 5C44H 2L12A 1K73C 2A19A 4IUUA 4IUVA 4DR2H 5KRUA 1EC6A 3SB1A 1VQAA 4K5XA 3DM3A 3K0YA 2PCFB 4A3GH 1Q46A 2OTJA 4P75A 4LNQA 2EJFC 2F3IA 5LL6S 3C1EA 1K3RA 4HAEA 1CHPD 4G57A 2N49A 4NMZA 3BVGA 2F0IA 4CDFC 5IGFA 1KDCA 4YCVA 5EQ0A 1Q12A 3RF2A 1CUKA 3AEVA 4IPGA 1D2BA 2F0QA 3QG1A 4JI5Q 2G5DA 4DAVA 1VQ4A 2HQLA 4YY3Q 1ZZKA 2GVBA 4DXFA 4XXEA 1Y1WH 4OIJA 4OONA 1HR0Q 2BL5A 4LF8Q 4KKTA 2KA7A 3N52A 1EOVA 4IPDA 4LFCH 5JPMC 4BBRB 1KD1C 1PDQA 2A6EC 1EQTA 2NN6G 2EY2A 4DAMA 1TVXA 3CMEA 1K9MC 2EXDA 3NK9A 3KF8A 3EROA 4OEMB 1XXGA 3CD6A 1NSNS 1D1KA 3FEWX 4O1NA 4DR4L 4JV5L 3Q6SA 3OMCA 1PTOB 3T1HQ 1B3AA 4IJLA 2WB1E 1GOZA 2F4IA 4XYQA 3M4QA 4JI4H 2R7ZH 3CCSA 1X56A 2BA0A 3A74A 2IX1A 1Q1BA 4KV6A 3KDGA 2NZHA 1V1OA 1CFMA 3M4PA 3MWYW 2XGTA 3SDZA 4MZ9A 4BBRG 1LT3D 2Z0SA 4DV1H 5CBEE 4QGUA 4FYDA 5CV9A 3BU2A 2H4OA 2CFMA 1ZTGA 1WYDA 1UE5A 4ZUJA 2B2TC 3KJPA 4KD4A 5IYBH 4FO2A 1SYEA 1KDAA 4S3SA 2R93G 2XSCA 4LF5L 2D0PA 1KNEA 3HOVG 1C48A 1BBUA 5JPNC 1UNSA 2VQEH 1GKHA 4KJOA 1E1TA 5KEEA 2F0DA 4RCOA 4R4QA 1WTOA 3J7AF 3S14B 2B2VC 2IX0A 1V43A 4PQXA 1D8LA 1L1OB 1TWGB 3I55A 1KNAA 3NP8A 2IL8A 2D0OA 3CCMA 1FJGQ 2B2UA 1X6OA 3NEMA 1MGSA 2GVAA 3BS1A 1HA6A 1GHKA 1RF2D 1VDZA 1WVLA 4FDBA 1W6JA 4X65H 2UUAH 2F0OA 4DK0A 1IBMH 4YWLA 3GTLB 4DV3Q 2R7FA 1PFBA 1NR4A 5LMUL 1TKWB 4GNXB 3CXCA 1BXTA 4ZLTF 3W5OA 1RTNA 1XYIA 1O78A 2VKCA 4FVMA 5JOBA 5M5WB 4N9PA 2F4VQ 1PMRA 2ANNA 2NN6H 3VA5A 1DOMA 4O42A 3K59A 2VQFQ 3O13A 4X62H 4OELB 4K0KQ 1JMCA 4PZ6A 1XPUA 4JI0H 1PRTD 4NXMH 1HNWQ 2NVTH 1ESFA 3IRBA 3SR1A 4J1MA 2HDMA 3H09A 2UXDH 2WAQB 1N8RC 1DT4A 4KY6A 1VQJA 4JBJA 5D65A 3HKZG 2YYZA 4EQOA 5FLXL 2E5LQ 2MUYA 3BDCA 1BCPC 1NMGA 2WINB 2HIXA 3HKZE 1FR3A 2GN5A 2K50A 3DM1A 2RQXA 4DR6H 3GKUA 5IODA 3HEJA 3T56B 1VQOA 1SYDA 1UEAB 4BBRH 1MSHA 4JI8L 1GD7A 5JJLA 4AQYL 1HXYD 4A3LG 4RA8A 2CH4W 3VR5A 2Y0SB 3S17B 3VYUA 3MHBA 1U5KA 4B3MQ 1XMQL 3UOEA 1LT4D 2FFKB 3VR4A 1RKNA 2FMRA 4EQPA 1PTOH 2H5XA 1E3PA 2H1EA 3U50C 5I2YA 4X64L 1WTHA 3D31A 3A7AB 5M3FB 1HNXL 2A69D 2JA5H 1LTLA 1HJPA 3D3RA 3I72A 4N8X1 4LF4H 2MHVA 2KCCA 1VQDA 1X3QA 5JVG3 4DR2L 5AJ3Q 3RZDB 1IXRA 3D0FA 2FFMA 4POGA 2WKDA 1S4ZA 2HH3A 2I5LX 4K2KA 1EYGA 2G9DA 3MFYA 2K32A 1J5EH 2K75A 2KCMA 4F88A 1DJRD 1X55A 4IURA 4DV6Q 3CCRA 3IFDA 4OX9Q 2QGQA 4H13C 2Q8TA 2OF1A 4HMIA 2V4DA 4DR7H 4OWTB 5M5XB 5M3FG 5J22A 1BF4A 2A6ED 2F0WA 5NUCA 1KAWA 4EGVA 1FYCA 2F0KA 2ZXOA 4E9JA 3S14H 5C4HA 4DR1L 3TQYA 5JJIA 1HPCA 1K0SA 1X0AA 4C56C 3VDYA 4A76A 1TWGH 3GTKB 1IYJB 3SEBA 1RCVD 2ZQEA 1A3TA 3HOYG 3S15B 4CJ0B 1V8QA 3NELA 4EQNA 1ZKOA 3CC2A 2HD3A 1Y1VB 2CTJA 5GADC 3TS2A 3LGJA 3HOWB 4DPGA 4KLKA 4XT1B 1K8MA 5L37A 1VQNA 3GTLH 2K1BA 4R9WA 4U673 4HMJA 2PI2E 2BOSA 1TWCB 4HSVA 4LFAL 1V9PA 1X32A 2ZM6Q 2RF4A 2M00A 5G3LF 3S2HB 5EKKA 5M5WH 1NJIC 4C3JG 1CKOA 1EUJA 4H02A 3PO2G 2Z1CA 4K8IA 5M5YB 4JI4L 2QDBA 5CV7A 5C0XH 1XX8A 5EKIA 5IYCG 4G08A 3GV3A 3NTKA 4QCLA 1XNQL 1HUMA 3TMEA 2ES2A 2EDGA 3J7ZC 1KL9A 1AZQA 3HOWG 1F9RA 2K01A 3DEOA 2ANRA 1ENCA 3RNUA 1HFGA 1X3EA 1SDFA 5C3WA 4DR5H 4FF1A 4JI2H 4A3BG 3CKIB 2X69A 2EOTA 2I5HA 4LFBL 1JJGA 5BN5A 2EY6A 1QG7A 1QZGA 4QUCA 4MNOA 1RHPA 4ULLA 1SXTA 2HCIA 1WTXA 3SK6A 2O5IC 2YQRA 2EYLA 1EWIA 2NWGA 3OSOA 2B2WC 2JQOA 3S17H 4QMFB 1EIGA 4EC5A 1XMOH 1VMCA 1FD7D 5KIXA 2RKSA 1WOCA 5KNDA 4YHHL 1HRJA 1Y8OB 2UUBQ 5M3FH 4DNTB 4IUPA 4DV5Q 2HHHQ 3EQLC 3UDGA 1V1PB 3QWNA 3GTGB 2QA4A 1VQEA 4IOAA 1IBLQ 3RZDH 2F0FA 1DOKA 2DGYA 5C4ZA 5IYDH 1ET6A 5JJZA 4HN7A 5EGTA 2KBNA 3T51B 1T5XD 2MQHA 4A4IA 4LF9Q 2A1SA 1BCPD 1ENFA 3I4LA 2JYOA 4OGQC 4XT3B 4XQQA 2X6GA 2UXBH 1S72A 2ZJRA 3K6OA 1TS4A 1NXUA 1RTOA 5LL6b 5M5XH 2RBMA 2JSOA 3KK7A 4WALA 1SNOA 1YVCA 1EZ8A 4G7ZC 2VS1A 1PXUA 4X62L 2L1BA 3KF8B 1QOHA 2NUCA 2JA8B 3BZCA 4ODGA 1SNCA 4OL7A 2CH4A 4NXML 2Z6KC 1S3OA 4LF6Q 4PG3A 3OW2A 3GTKH 3DEPA 1CZGA 4Z9CB 1OXSC 2UXDL 2Z4IA 3S15H 1X4MA 2UUCQ 1FGBD 1F9QA 1N33Q 1LACA 1JJ2A 3NHHA 1PZID 2DJGC 2DNCA 2PQEA 1Z7TA 2OPVA 1ICWA 1Y1VH 2SEBD 1IW7C 4JI1L 3LNNA 3HOWH 2QF7A 5C0XJ 5E4WC 3BDLA 3HS0C 3EBEA 2KCNA 1TWCH 3CP0A 4CKCA 5BR8L 3QOJA 2FMMA 3QR8A 1FNVA 2RVLA 4CHTB 1K1GA 2RDHA 3S2HH 1H9MA 3K80C 2E2JB 4ZK9B 2Z6BA 1TS2A 3R2TA 1IYUA 1I4XA 1S5FD 5I9PA 4H0LC 3I7FA 5M5YH 1SSOA 3CCJA 3BYTB 3PO3G 3E0JA 1I94Q 1BR9A 4GNXA 2F1MA 2J0TD 1ML0D 3UI2A 3PIPA 4QJFA 1M4VA 1WTPA 1CI3M 4LK1C 4LF4L 1OXXK 4NPSA 4NW2A 4ZKBB 3HOUB 1K0RA 2G8YA 5C4XB 5FJ8G 1TUAA 1BQQT 1E0BA 3DWPA 4DV0Q 4DR4H 3J7YW 1D5XC 5IT9E 1J5EL 4JV5H 2MJHA 4MHEA 3HKSA 2K14A 3NWTA 4GKKQ 5CORA 1LO5D 4ID6A 4NBQA 3S2DB 1EFWA 1EY5A 3SK8A 4DUYL 3K81C 3I70A 4GOPC 3D4DA 1JE5A 2D2CC 1YJNA 1PTOD 1C9OA 2X06A 1DD2A 1STEA 1EQRA 3DWQA 1H95A 4A3JB 1YJ9A 2B2YA 3FHWA 1KHIA 4IPHA 4DUZQ 2AXYA 1DGSA 3GTGH 1B8AA 2RDFA 4A3EB 3BDOA 4FXGC 2BA1A 4LF5H 2ZT9C 2YV5A 4Q5VA 2L0CA 1HQRD 1RODA 1SNMA 4X3TA 4B3SH 5C44G 4RGOS 4IQZA 3N6RA 4LUZA 2PNHA 1VQ5A 3M85A 1X3GA 4LF7Q 1X54A 3TDQA 4A3JG 4C1NI 3IAYA 4OCHA 2QCPX 1G6PA 3PIOA 4GZYC 5FLXW 4DNIA 1KC8C 1V9NA 1PRTF 2JA8H 1SBBB 4IUQA 5F2DA 1NMFA 2RSNA 3M4YA 5E3FA 3GR5A 3D6WA 3RUZA 3M3YB 5ELOA 1STGA 2ALYB 1YIJA 1IBKH 4R1JA 4FJUA 1Y14B 1AH9A 1YNNC 4DR5L 1SMXA 3T53B 4GOPA 1R4PB 2MPMA 2ZJQA 4L5TA 4HJ9A 5IP9H 2KHJA 1BBXC 1QUQA 1DONA 1H9JA 2XTIA 1PQXA 3I73A 4N9TA 3J81L 4AM3A 3E9IA 3KYHC 4F8MA 5D3IB 4A3DB 5ELCA 3TN2A 4JW0A 2QEJC 3KLSX 2F52A 1PH9A 2IHFA 1KAAA 2PW7A 2E2JH 1C0AA 1KIXA 1TU2B 1XNRQ 1I3QB 4JBWA 4KHPL 1JOQA 3BVMA 1TY2A 1EWHA 1BCPB 1N32L 4LFCQ 3TZDA 3T13A 3UDXA 3T1YL 1U4MA 2AQ3B 3HOUH 1NCVA 4JI8H 4AQYH 5C4XH 2RCNA 1VQGA 2CQAA 3AMUA 4NP5A 3PF5A 4GKJL 2B8GA 1N34L 3L9AX 2ICIA 2VNUD 2BE5D 3KBXA 3I4NB 2EYHA 3PUWA 4DV2H 5IP7H 1OXUA 4KY5A 3ULPA 2AQ2B 3SK4A 2HT1A 4OXPA 3S2DH 2CPMA 4NXNQ 5I6YA 3TZUA 1HNXH 2I5MX 1KQSA 5ELBA 4X66Q 1VQ8A 1ZXTA 1H9KA 3OIPA 1NBWA 2EY5A 4DR3Q 4CKBA 4KKSA 4RWSC 2F0EA 4K2LA 3P1HA 4DV1Q 5IYBG 3DMUA 1A63A 1QWYA 3I4MB 1YZ6A 3CHBD 1YHAA 4A3JH 2CTMA 1A2TA 2A5HA 3V05A 5IGCA 3RLNA 3NE5B 5COYA 5IWAQ 2MFIA 1DM0B 5M9OA 4DV4L 1WD0A 4A3EH 2KEEA 1N36Q 3PSIA 4A3MB 2F0MA 4B3RL 1ZZIA 3CPWA 2ZXRA 2B39A 3NSWA 2VQEQ 5LMNL 3M4OH 3UDIA 4A3IB 4DR1H 1V1PA 5C5LA 4JYAL 2NVTB 5LHY1 1YNJC 3I4MG 5H1SE 1G291 1YJWA 3K7UC 2OQ0A 2JN4A 4X6AH 3RLFA 2NZOA 3CF5A 5FOBB 4X3KA 4X65Q 3D6CA 2UUAQ 1JORA 5ELFA 4DU9A 3OTOL 1IBMQ 1YHQA 2LRRA 4TKOB 3M3YH 4NZRM 2K04A 1I4QA 1JWSD 1MHWC 2WB1B 4IFDI 4LFAH 3AQQA 5ELEA 3A7LA 1VQHA 1EY8A 1WFQA 3QJYA 4A3IG 2K5QA 2K03A 1L0XB 3VKEA 5DLQE 4IOCA 3I90A 2QDLA 1F77A 4A3DH 1XJVA 3A5UA 4EQ5A 1EU3A 2JA5B 1XNQH 2ZTCA 4JI0Q 2Y3MA 3NUCA 1JOKA 4I7ZC 2VB2X 1LT6D 1F0XA 1SNDA 3LWEA 2VXWA 2KHIA 5M3MB 5C4JB 1K8AC 1I4HA 3Q23A 5CV6A 1X9ZA 1I3QH 2C5CA 3EIVA 4PMWA 3H3VC 3K5LA 4A3CH 2KVMA 1MSZA 1WTRA 1AFPA 1VIGA 3QO2A 4H44C 4DR6Q 1ILQA 2FXQA 4BY1B 1JB7A 4LFBH 1G6ZA 3U1KA 4B3TH 2CTFA 1CQVA 1YHBA 3G4SA 4MN3A 4OO1I 1PFSA 1JWUD 1Q3LA 4QL5A 4R4TA 2Q2IA 1O7IA 3KLWA 2HCCA 3JAML 1SFOB 3FPPA 5IGBA 2NTTA 2UXCQ 2PW5A 3S9WA 2JA5G 4KMUC 4BBSB 3I4NH 1YNND 2BH8A 4YHHH 1WVNA 3BZKA 3IL8A 4B3SL 5M3MG 3KDKA 1QILA 2N8NA 3VYRA 1WTJA 2IWHA 3BVZA 4ZUIA 3C46A 1IL8A 5IY0A 1N33L 2KUMA 3X3NA 3D4WA 4P71A 4JI7L 4NZTM 5EKLA 4K6DA 3STBC 2HDLA 1PHJA 2E2HB 4CJ2C 5E7NA 2IT1A 3F2CA 1DOLA 1WHRA 3BYYB 4L5QA 3PUZA 3I4MH 5EJWA 3KF6A 4R4OA 2P5ZX 2XWBB 4O0AA 2E8GA 4DAYB 2N78A 1J8IA 1IBKL 3GV6A 1EEID 2NTSA 1TQOA 3I4OA 2L9HA 2WKCA 3CW2C 4DR7Q 3H94A 4XYOA 2Z9HA 2WACA 2WFWA 4A3MH 2XNAC 1ZZJA 3KUPA 1HR0H 4FF4A 3EJIA 2Z4HA 5KYLA 5KYIA 1WD1A 1AEXA 4A3IH 5JEAH 1GUOA 1JB3A 3K58A 2B2TA 4Y7NB 4UHVA 2YTXA 1SAPA 4ZAIA 3OYYA 3FKIB 4JCVE 3M9BA 2PZUA 1HA5A 4K6LA 1EY4A 4L6TB 3C2PA 2EE1A 2M9VA 1VQMA 1EY9A 2XN9C 4YCWA 4JI1H 2CWAA 1CQFA 4LIJA 4PZ8A 2B2VA 4C2MB 3C1FA 3J81i 1MJCA 5BR8H 1K8OA 1QJOA 5C0XG 1W6KA 4PNYA 3H91A 4PZ7A 3PGZA 4DV2L 2RCFA 1B70B 5I4DA 3FKIG 2WAQG 2QILA 4OWWB 1EQQA 4WJ3M 1JT8A 2K4KA 1AN8A 1UUPA 1CSQA 3HG9A 4DV7L 1Q81C 1S03G 3K5MA 3EVQA 4BXXH 2F0LA 2EQSA 1PTOF 1XWEA 2L4NA 5M3MH 5C4JH 2ZXPA 1PH5A 3SK5A 1ZYRC 1W3SA 4JI2Q 3PV0A 1NTGA 1X3FA 1PLFA 2Y0SG 3CU7A 2KENA 4BY1H 1BOSA 1ET9A 1HNZQ 2J7ZA 1STHA 3AU7A 1V8CA 1HZ9A 3MFGA 3CC7A 4AYBB 2CWPA 4DUYH 1SFOH 1XMOQ 2K5VA 4JBMA 2LF0A 1EZ6A 2JEBI 3OMGA 1L0WA 4BBSH 2NBFA 4JI6L 1Q8IA 3I2ZA 2EZVA 2JA9A 2KJXA 4GOPB 2PY9A 1CTMA 2M6QA 1QUQB 4A3FB 4AH6A 5BN4A 3Q24A 2JA6B 2UU9L 2ASBA 2OPUA 4CDEC 5IYDG 4QIWE 4GS3A 2Q8RE 3PUYA 5FO8B 1D1IA 1J4WA 3SVMA 2E2HH 1BKBA 3FAUA 1VQFA 1B4OA 4AYBG 3OPOA 2NVQB 4KD3A 5JEAJ 4DN4M 3NQIA 1MI2A 3J81W 1HNWH 4J15A 4DF7A 1VQ6A 1TXYA 2UXBQ 3VR3A 3ONAB 2K5DA 1JCKB 3G71A 5T1GA 1XNRL 1GUNA 2JA6G 5A2QL 2AKWB 4BWGB 4JI3Q 4ME5A 3Q0AA 2CTLA 3KOJA 1QE6A 3FP9A 3UDFA 3BG3A 4WORA 4I7AA 3MXNA 3H3VI 2SDFA 4Y7NH 1EIHA 1Y1VG 4OWXB 1CKMA 2MNAA 4KKUA 3FKIH 3GD7A 4RH6A 1Q86C 2LXJA 4B3MH 1G2SA 4UP8A 3ICEA 2PPBC 1ILPA 1Z47A 2JZXA 4LAAA 4ME3A 1SE3A 1NUCA 4WJ4A 2A1AA 4B3TL 4RAUC 3NCVA 3TREA 4C2MH 2B8FA 2JP1A 2MP1A 2I0QA 3J80L 1BUVT 2J4XA 3NENA 3NBIA 4TRDA 2A74C 3HOZB 1GVPA 4UY8C 3QB3A 3GTOB 2XRSD 1JOOA 5HURA 1F2ZA 1RDPD 2O4XA 3I91A 4IJHA 5AFWA 4KHPH 1PH1A 1BDOA 1YBYA 3TP5A 4DV6H 2KEDA 1N32H 1ENAA 2ATWA 1QVCA 4L8JA 1XRHA 1A0IA 1PVOA 3S1NB 3T1YH 2MGSA 3SHLA 3S1MB 3LWUA 2FJ2A 2N88A 4OIKA 3A8IE 1S5CD 1L1OC 3JAMi 4DR4Q 3VR2A 1N34H 4GKJH 2O2LD 4JV5Q 5FLXc 4JI5L 1LUZA 5LMNW 3M7NA 2PQAB 1HQMC 4YY3L 4IFDH 1LT5D 5CYUA 4ABNA 1I50B 5FO7B 4CJ1B 1PFMA 3OOCA 1HR0L 3A56A 2B29A 1JE4A 2LS01 4LF8L 1JR0D 1J5KA 3K5OA 4ZRZA 2AWNA 3B6YA 3P75A 1STAA 1VF5C 1PH2A 3VYSA 1YEZA 3F8TA 4A3FH 2RHSB 2JA6H 5FLMH 5TSSA 3MXPA 4DGZA 1FVIA 4YIJA 1HHVA 3X3MA 2ZM6H 2A73B 3TBIB 1R9TB 1U4LA 1WTWA 5J39A 1F2LA 4J8QA 4GLAC 4HJAA 2B2WA 1VF7A 4DV4H 3T1HL 1EOTA 4OHJA 4R4CA 4LF5Q 1FNUA 2VUMB 4NKLA 5GAHC 1LTSD 4B3RH 2AUKA 2NVQH 1VQLA 3WDNA 2IY5B 4H7BA 1ZYRD 1SMYC 1YITA 5LMNH 5DM63 2QW7A 2TSSA 2XWJB 5IGDA 1MJEA 4OO1H 1MD2D 2PNRC 2OT2A 4HEDA 1WE8A 1KLUD 2IPKD 3WOFA 2JA8G 2X6LA 3I3CA 1WTQA 4JYAH 1B1ZA 1CKNA 4HJ5A 5K36H 1CK1A 1B3QA 4DAYA 3FVQA 4DNRB 5CC4A 2ENBA 4JVYA 4HJ7A 4OD6A 2OXPA 1CM9A 3U9OA 4Q0FA 2LMCB 1G91A 5IP9G 3OTOH 4RKBA 3HGBA 3PUVA 1FNWA 3JC66 1A8VA 5FK9C 2PQUA 4JG2A 5LMUQ 4JPBW 2CHBD 2EYPA 4CDCC 1PYBA 2A8VA 1X3PA 4HR7B 2XIWA 1A6XA 2N55A 3JAMW 1QZHA 3GABA 4KK7A 2EVBA 1LTID 3RN2A 2ICEC 4POFA 2ZJPA 2PMZB 3A54A 4F7XA 1KRTA 2Z6KA 3KF6B 3ZJYC 1C8CA 2D5DA 1PZKD 4DAPA 3NQTA 5FLXE 4A3KB 1FJGL 4NDXA 1VQ7A 3HOZH 1A3VA 1JJCB 4KJNA 1IBLH 2F0VA 5DEHA 2IW3A 3GTOH 1S20A 2QNDA 2K52A 1LTBD 2F3VA 3HOUG 3CAMA 4DV3L 3ERSX 3CMAA 5C4XG 2DJFC 4G4KA 3HOXB 1B9NA 1I4PA 2OQKA 1KRSA 3RMHA 4IFDJ 4V190 3F2BA 5C5MA 3S1NH 2F3WA 5CV5A 5IP7G 1AP0A 4JOIC 4JI8Q 4EX5A 2F4VL 4AQYQ 3S1MH 1K28A 3MVVA 4ZQ3A 4C3HB 2VQFL 5KNBA 2E75C 4O2DA 1XMQQ 1VQKA 1VCIA 4K0KL 1NAPA 2CPQA 4HCSA 3M4OB 1II3A 3G6EA 1HNWL 4LF6H 4X64Q 1UAPA 2E2IB 4FJSA 5BN3A 4HIKA 1HNXQ 2E5LL 1HH2P 1I50H 3W3AA 1N33H 3IFTA 3SGIA 4JI7H 1LTTD 4G7OC 4BY7B 1IYVA 1Y8NB 2LXKA 1Z2IA 4FF3A 4DR2Q 5LL6X 2CWFA 1X4NA 1A3UA 1RIPA 4CDDC 2F0NA 4A3EG 2JA7B 1Y8PB 2M2LA 2Q2TA 1I4RA 3QD7X 1VBIA 1X9NA 4JC0A 4X3UA 5GROA 1BVSA 2K5NA 1R9TH 4B3ML 3J81j 2G9HD 1Y69U 1SNQA 3TP6A 3DXJC 3PCOB 4L63B 3AYHB 2B63B 1JQYD 5IOCA 2VUMH 3T4AC 1RJTA 1B2TA 2E76C 1Q8KA 1U9RA 1SE8A 4ALPA 4DR1Q 2PI2A 5J3BA 4HJ8A 2KHSA 3RN5A 1LV9A 2GA4B 1WCMB 2JE6I 1M8AA 5AJ3L 2IJ0A 2JA7G 2VB3X 5GAEC 4DV0H 1QB5D 1B44D 1C7YA 1KABA 3EZJA 1XTDA 1O7ZA 1IHZA 4GKKH 4DV6L 4OX9L 1LTRD 4PV1C 3TSSA 4DFAA 4DA2A 3RLOA 4G7HC 2B63G 4LW1A 1QCBD 1TIID 3DUZA 3A0JA 1QVGA 2JEAI 5CBAE 4LFAQ 3S16B 3CC4A 2F0HA 5EBDA 3J80i 4RHSA 1Q7YC 1S5ED 4A3DG 1UEBA 2L11A 4L5SA 3RD4A 2SNSA 3NBHA 1S5BD 2NVXB 1QNKA 2K5WA 4HSPA 4CKEA 4JI4Q 4IPCA 1MIUA 2C9OA 1IW7D 4DV7H 1E7ZA 2AUJD 3GO5A 3CRKC 2QEXA 2JK8A 1XNQQ 4A3CG 4XQNA 4A3KH 4LJZC 2OEOA 2LFNA 1KLGD 1OTCA 4ZYSA 2RDGA 2R7DA 1TWFB 1H9SB 3NWSA 1STYA 3R93A 1DYQA 1TY0A 1PRTC 3D8GA 3HOXH 3A5ZB 1IL2A 3W1GA 1UE1A 3CCEA 3H3VH 2ZM6L 1HCZA 2SOBA 3I4NG 1QVFA 3MXNB 4LF7H 2K7VA 3I8ZA 1GUTA 4C3HH 4A93B 1JICA 1A62A 4JI6H 4B8TA 1VQCA 5K5PA 4YHHQ 5A2QW 3G7LA 4KY7A 2OTLA 2K1HA 1RL2A 2E2IH 1I4GA 2E2DC 3TP7A 1K3BC 4KHZA 2UU9H 3R3OA 4YCUA 2R6GA 2MO0A 4CGYB 1PH3A 1EIYB 1D7QA 4BY7H 1GO3E 4X3SA 1MSGA 1TR5A 3L7ZC 2A69C 3CPFA 1EU4A 3D4RA 3OIQA 2PQAA 2JA7H 5A35A 5HGQA 4RKLA 4A93G 4A3MG 4DK3C 1XPOA 2EXZA 2XRQD 1S5DD 1Q82C 2P2RA 3G6JB 4HIDA 1PFNA 1GUWA 4K8JA 3WOEA 3LX0A 3J80W 4H8AA 4WANA 5JEAG 2B63H 5C3EB 1XNRH 2I46A 2UUBL 2ZTEA 3TS0A 4IZ8A 1SN8A 3J7AK 4X62Q 2M8WA 5I6WA 1Q1EA 4DV5L 2HHHL 4TQUS 4RGNA 3BJUA 2FINB 4NXMQ 1WCMH 1V1QA 2UXDQ 2B2UC 1IBLL 4RCNA 1SROA 4XQJA 2WB1G 4LF9L 4QF4A 2OCEA 3MA2B 3F2UA 2EPBA 5EAYA 4JI1Q 1L0YB 5IIFA 2R93B 5C3EG 2LTLA 4NXNH 4WRDA 3HOVB 2EJGC 5BR8Q 2K33A 2LSSA 3S16H 2B3GA 1WTVA 2NVYB 4X66H 4HIMA 2K5HA 4QMGA 5I9OA 5EPJA 3E6ZX 4DR3H 3L0OA 4MTNA 1BCPF 3VYTA 2NVXH 4WJWA 2KOLA 4BXXG 1HR0W 1GXDC 1WJJA 5JVH3 4LF6L 1J6QA 1HZBA 2UUCL 3U4ZA 1PYWD 1OXTA 5IWAH 2XVSA 2CW0C 3MXGA 4LF4Q 3J81c 3TEHB 4BY1G 1SNPA 3L2PA 4R8NA 1TWFH 1I6HB 1N36H 2ID0A 4DKAC 1CKNB 3MXUA 1KTKA 2DN8A 1VQBA 2KQ3A 1DCZA 1ESRA 2HIVA 5T1IA 1J5EQ 2LTMA 2F0TA 4HTHA 4LWCA 4BBSG 5ELNA 1ICFB 4JI5H 4FXDA 1E24A 3FRPB 4TSSA 4YY3H 4UP9A 4DUYQ 2JXMB 4B9WA 3S24A 3OETA 4A93H 2HQEA
chains in the Genus database with same CATH topology
2K28A 5C3XA 1I94L 4GLVB 2NYZD 3DLLA 4K14A 1UWVA 2EJMA 2D62A 2LKVA 3J7A5 3HKZB 3KFUA 2IX3A 4RMFA 4C1NK 2BCOA 1SYCA 4DK6C 1B53A 4RGMA 1E2ZA 4DV0L 2RHQB 2JVZA 5D3DA 2F0SA 3V2TA 4GKKL 5JJKA 2C35B 3K7AB 2DNEA 1LLRD 4K5VA 5FO9B 4EVOA 4J6HA 2NZ1D 4GN5A 4RHRA 5IT9L 3KDFB 2PYKA 3NTIA 1VQIA 3L3OC 1N9WA 5GQOA 2A6HC 3J7AV 3ITPA 2I07B 5C3EH 3H0GB 3DWAA 5HGTA 1Z9FA 4B08A 2L5TA 2WAQE 4FXKC 3U4VA 1TWAB 2IHEA 1YNXA 4DUZL 3GP7A 1O7LA 3P20A 4MIUA 3ZYYX 4GLXA 4U68A 1CT1D 1D6EC 4KTAA 4RGTA 3RZOB 1E2WA 4QB4A 4DR5Q 3TRZA 1YNJD 3ERQA 3J81E 1F2YA 3MEFA 1AE2A 2RSOA 1NE3A 3PMFA 1XTCD 1U4PA 1EIFA 1MKHA 3NPPA 2Y0SE 2R93H 3H0GG 2OWOA 3S1RB 3C3LA 4FF2A 1YI2A 4LF7L 3HOVH 1BO0A 3NXWA 3KLSA 3MZ5A 2NVYH 3OWFA 1EQVA 3G48A 4QUFA 2CTEA 4QIWB 3KLRA 2Z8LA 4I65A 3HRZC 1PYSB 4HIOA 3HOYB 3EA6A 1T5EA 1VQ9A 2BH2A 1X65A 4KHPQ 3V96A 3FMCA 3TP8A 3OWEB 2A68C 3SXHA 4UAIA 1N32Q 4IUTA 1K83B 5I2XA 3EN2A 5GAGC 3A55A 1E2VA 3CCUA 1EEFD 3T1YQ 3GTMB 4P73A 1I6HH 5CGKA 3GDEA 4Y52H 4JK1C 3K57A 2F03A 4IFDG 3W1BA 3IKJA 4GKJQ 1O80A 2CQOA 2MO1A 1N34Q 4AYBE 3PUXA 1K8GA 5KNCA 4C3JB 3PO2B 2YTYA 2R3ZA 2Q8IB 1QNUA 4V0BA 1W2BA 4UP7A 1H9SA 4YWMA 2K05A 2WP8J 2AMCB 4A3FG 1H9RA 4ILWA 1LTGD 2E3UA 2EYJA 5FLMG 2AHOB 4XTCS 1DXMA 1Q90A 3URYA 3P7JA 4XIGS 4LFCL 3NBHB 4IO9A 3JAMc 1UE7A 1LTAD 1STNA 4A3BB 2DGRA 2YTVA 3S1QB 3GTQB 1G2TA 3FDTA 1PTOC 4DK1A 4ZKCB 2Q2HA 4IALA 4OO1G 4DV4Q 5DM73 2EIFA 2CW0D 3K7AH 1O7YA 3STBD 4A3LH 1PH7A 4B3RQ 5K36G 1TWHB 4NXNL 3QIAA 5LMNQ 4YWKA 3GQBA 4X66L 3HFZB 1VS0A 3UE1A 3WWVA 4DR3L 5CR3A 4JYAQ 4BA2I 1ASZA 3ND8A 2LY7A 1LABA 3H0GH 4DV1L 1ASYA 1HTPA 1VMPA 2EYMA 4DXGA 1TWAH 5IWAL 3OTOQ 4BA1I 1SYGA 5KGUA 1E22A 1N36L 1U0LA 3RZOH 1NY4A 1R4QB 5DNFA 2L55A 2VQEL 5ELDA 1F2MA 3HOZG 5DAUA 2YU9B 3H15A 2VZAA 4M1UB 3BZDB 3S1RH 2DUDA 1A2UA 4JVHA 4QY7A 1DTJA 1BNZA 2BDNA 4AIMA 2CTKA 3K0XA 2PO4A 3AEVB 5CV4A 1GHJA 1TS5A 4CBVA 5IT9c 1EWCA 3FPUB 2CCZA 2A6HD 3CCQA 4X65L 2UUAL 1NR2A 1GUGA 5EBCA 3HOYH 4NB3A 4GNXC 1SYBA 2ZTDA 3CRLC 1IBML 3GTJB 4P72A 4R8IA 1J9OA 2NB0A 4B9XA 2PZWA 4KHVA 1PV4A 4IUNA 1K83H 1PRTB 3JAME 1IKMA 2JJQA 1UE6A 4FNFA 3GTMH 3ND9A 1B7YB 2VW9A 3CQZB 1BBWA 2CKZB 1PZJD 3DHQA 5D14A 4JBKA 1EYAA 1AE3A 3PIP3 4C3JH 4JI0L 4B3SQ 3PO2H 2R61A 5IE8A 1STBA 1LM0A 2L15A 2FMCA 2BE5C 1LYLA 3PO3B 1S40A 1RD9D 2VL6A 4FP5D 5IYCH 4JI7Q 1TT2A 1SE4A 3R8BA 3E9HA 4C3IB 3MEHA 1EL0A 1HZCA 4DR6L 3NTHA 1CA5A 3K8AA 5J1ZA 1L1OA 5IGGA 3A8KE 4HCEA 2B2YC 3AB9A 2WV6D 4P2CB 4RFBA 4LUOA 1EYCA 3CCLA 2F0JA 3U9SA 2VUMG 4A3BH 1XPRA 1IBKQ 1HFNA 3GTQH 3S1QH 3E5SA 1EY7A 1GM5A 2UXCL 1DZ1A 2RA4A 2D9UA 4PMCA 1Z6HA 2A68D 3F2DA 4UDUC 1WI5A 3SE0A 1TWHH 1M90C 3Q8DA 1F9SA 5E1FA 4C3IG 1P8LA 5EPLA 4TVAB 2DY8A 1PH4A 3HZXA 5E4XA 3U58A 3CCVA 1GUSA 2HH2A 1D5ZC 3KDFA 2NN6I 1KHMA 1OO9B 3GTPB 4R4IA 1PH8A 1A15A 3QOLA 2FHTA 1SRUA 2R92B 4P74A 4DR7L 1TS3A 4BS9A 3V69A 1I6VC 2V1CC 5IGEA 3A8JE 2KECA 1P16A 2N3SA 5C44B 2PMZE 3PIO3 4GN3B 4A3KG 1G8ZD 5EPKA 3K5NA 4KI0A 1EYDA 4DV2Q 1SE2A 2YU9H 4A3GB 3UE0A 4GN4B 4DV7Q 3OHXC 2PZTA 3Q22A 2EYOA 3HOXG 3M7GA 3E0EA 3H6MA 4LUVA 2R92G 3J80c 1HTLD 3GTJH 1AW7A 4APVA 1I5FA 1D5MC 4C3HG 1ONLA 5CV8A 1EY6A 2O5JC 4K5WA 1VIHA 3KBGA 1U4RA 1KDBA 4A3GG 3CQZH 3RR5A 1Y1WB 1IZ6A 2F0GA 1FL0A 2BDOA 5C6AA 1SYFA 4JI6Q 1T9HA 4RG1A 3MTSA 1G51A 4KN7C 4BY7G 4KN4C 2Q2UA 2CVRA 1EFID 1MBYA 4XDXA 3AFPA 1KXLA 1FGUA 2UU9Q 1CSPA 3PO3H 3T16A 1IKLA 2MJ8A 2DY7A 2EY1A 1HUNA 3MAQA 4JI2L 4JOIA 4C3IH 1M1KC 1SR3A 5G3LD 3I56A 1HNZL 5JAVA 2AWOA 4E6IA 2R7ZB 5FJ8H 2VY3A 1Y1WG 1GJXA 4A75A 1XMOL 3AFQA 4M8AA 3ER0A 1B9MA 2QKIC 5A2QE 5FKAC 1CZWA 4QQBX 3VA7A 1PA6A 3R2IA 2EYFA 2F0PA 1WCMG 1C4QA 2AQ1B 2HUGA 4L5RC 1OXVA 3W2DA 3PF4A 1SJHD 2TMPA 2K6AA 3OW7A 1SEBD 1CHQD 1JC7A 1EY0A 2SNMA 3ULLA 1SMYD 1JWMD 4WFN3 2E74C 3EFXD 2R7ZG 3HP3A 2WIIB 1CA6A 4IN3A 1SJED 2F0UA 1E1OA 3KJOA 4PMBA 5HY6A 3GTPH 3MC0B 3VR6A 4F87A 5C0XI 5ISRA 3J80E 4LFBQ 1F9PA 3F1ZA 1VQPA 1L2FA 4B3TQ 2UXBL 5CMDA 1AZPA 1PH6A 2R92H 4LMQD 4UPAA 1B50A 3ULJA 1HZAA 1SLJA 1ZEQX 2KCTA 4JI3L 5C44H 2L12A 1K73C 4IUUA 2A19A 4IUVA 5KRUA 1EC6A 1VQAA 4K5XA 3DM3A 3K0YA 2PCFB 4A3GH 1Q46A 2OTJA 4P75A 4LNQA 2EJFC 2F3IA 5LL6S 3C1EA 4HAEA 1K3RA 1CHPD 4G57A 2N49A 4NMZA 3BVGA 2F0IA 5IGFA 1KDCA 4YCVA 5EQ0A 1Q12A 1CUKA 3AEVA 4IPGA 1D2BA 2F0QA 3QG1A 4JI5Q 4DAVA 1VQ4A 2HQLA 4YY3Q 1ZZKA 4DXFA 2GVBA 4XXEA 1Y1WH 4OIJA 4OONA 1HR0Q 2BL5A 4LF8Q 4KKTA 2KA7A 3N52A 1EOVA 4IPDA 5JPMC 4BBRB 1KD1C 1PDQA 2A6EC 1EQTA 2NN6G 2EY2A 4DAMA 1TVXA 3CMEA 1K9MC 2EXDA 3NK9A 3KF8A 3EROA 3CD6A 1XXGA 1NSNS 1D1KA 3FEWX 4O1NA 4DR4L 4JV5L 3Q6SA 3OMCA 1PTOB 3T1HQ 1B3AA 4IJLA 2WB1E 1GOZA 2F4IA 4XYQA 3M4QA 2R7ZH 3CCSA 2BA0A 1X56A 3A74A 2IX1A 1Q1BA 4KV6A 2NZHA 1V1OA 1CFMA 3M4PA 3MWYW 2XGTA 3SDZA 4MZ9A 4BBRG 1LT3D 2Z0SA 5CBEE 4FYDA 4QGUA 5CV9A 3BU2A 2H4OA 2CFMA 1ZTGA 1WYDA 1UE5A 4ZUJA 2B2TC 3KJPA 4KD4A 5IYBH 1SYEA 4FO2A 1KDAA 4S3SA 2R93G 2XSCA 4LF5L 2D0PA 1KNEA 3HOVG 1C48A 1BBUA 5JPNC 1UNSA 4KJOA 1GKHA 5KEEA 1E1TA 2F0DA 4RCOA 1WTOA 3J7AF 4R4QA 3S14B 2B2VC 2IX0A 1V43A 4PQXA 1TWGB 1L1OB 1D8LA 3I55A 1KNAA 3NP8A 2IL8A 2D0OA 3CCMA 1FJGQ 2B2UA 1X6OA 3NEMA 1MGSA 3BS1A 1HA6A 2GVAA 1GHKA 1RF2D 1VDZA 1WVLA 4FDBA 1W6JA 2F0OA 4DK0A 4YWLA 3GTLB 4DV3Q 2R7FA 1PFBA 1NR4A 5LMUL 1TKWB 4GNXB 3CXCA 1BXTA 4ZLTF 3W5OA 1RTNA 1XYIA 1O78A 4FVMA 5JOBA 5M5WB 4N9PA 2F4VQ 1PMRA 2ANNA 2NN6H 3VA5A 1DOMA 4O42A 3K59A 2VQFQ 3O13A 4K0KQ 1JMCA 4PZ6A 1XPUA 1PRTD 1HNWQ 2NVTH 1ESFA 3IRBA 3SR1A 4J1MA 2HDMA 3H09A 2WAQB 1N8RC 1DT4A 4KY6A 4EQOA 5D65A 5FLXL 1VQJA 2YYZA 3HKZG 4JBJA 2E5LQ 2MUYA 3BDCA 1BCPC 1NMGA 2WINB 2HIXA 3HKZE 1FR3A 2GN5A 2K50A 3DM1A 2RQXA 5IODA 3HEJA 3T56B 1VQOA 1SYDA 1UEAB 4BBRH 1MSHA 4JI8L 1GD7A 5JJLA 4AQYL 1HXYD 4A3LG 4RA8A 3VR5A 2Y0SB 3S17B 3VYUA 3MHBA 1U5KA 4B3MQ 1XMQL 1LT4D 2FFKB 3VR4A 1RKNA 2FMRA 4EQPA 1PTOH 2H5XA 2H1EA 1E3PA 5I2YA 3U50C 4X64L 3D31A 3A7AB 5M3FB 1HNXL 2A69D 2JA5H 1LTLA 1HJPA 3D3RA 3I72A 2MHVA 2KCCA 1VQDA 1X3QA 5JVG3 4DR2L 5AJ3Q 3RZDB 1IXRA 3D0FA 4POGA 2WKDA 1S4ZA 2HH3A 2I5LX 4K2KA 1EYGA 2G9DA 3MFYA 2K32A 2K75A 4F88A 2KCMA 1DJRD 1X55A 4IURA 4DV6Q 3CCRA 3IFDA 4OX9Q 4H13C 2Q8TA 2QGQA 2OF1A 4HMIA 2V4DA 4OWTB 5M5XB 5M3FG 5J22A 1BF4A 2A6ED 2F0WA 5NUCA 1KAWA 4EGVA 1FYCA 2F0KA 2ZXOA 3S14H 5C4HA 4DR1L 3TQYA 5JJIA 1HPCA 4C56C 3VDYA 4A76A 1TWGH 3GTKB 3SEBA 1IYJB 1RCVD 1A3TA 3HOYG 3S15B 4CJ0B 1V8QA 3NELA 4EQNA 1ZKOA 3CC2A 1Y1VB 2CTJA 5GADC 3TS2A 3LGJA 3HOWB 4DPGA 4XT1B 4KLKA 1K8MA 1VQNA 3GTLH 2K1BA 4R9WA 4U673 4HMJA 2PI2E 2BOSA 1TWCB 4HSVA 4LFAL 1V9PA 1X32A 2ZM6Q 2RF4A 2M00A 5G3LF 3S2HB 5EKKA 5M5WH 1NJIC 4C3JG 1CKOA 1EUJA 4H02A 3PO2G 2Z1CA 4K8IA 5M5YB 4JI4L 2QDBA 5CV7A 5C0XH 1XX8A 5EKIA 5IYCG 3GV3A 3NTKA 4QCLA 1XNQL 1HUMA 3TMEA 2ES2A 2EDGA 3J7ZC 1KL9A 1AZQA 3HOWG 1F9RA 2K01A 3DEOA 2ANRA 1ENCA 3RNUA 1HFGA 1X3EA 1SDFA 5C3WA 4FF1A 4A3BG 3CKIB 2X69A 2EOTA 2I5HA 4LFBL 1JJGA 5BN5A 2EY6A 1QG7A 1QZGA 4QUCA 4MNOA 1RHPA 4ULLA 1SXTA 2HCIA 1WTXA 3SK6A 2O5IC 2YQRA 2EYLA 1EWIA 2NWGA 3OSOA 2B2WC 2JQOA 3S17H 4QMFB 1EIGA 1VMCA 1FD7D 5KIXA 2RKSA 1WOCA 5KNDA 4YHHL 1HRJA 1Y8OB 2UUBQ 5M3FH 4DNTB 4IUPA 4DV5Q 2HHHQ 3EQLC 3UDGA 1V1PB 3QWNA 3GTGB 2QA4A 1VQEA 4IOAA 1IBLQ 3RZDH 2F0FA 1DOKA 2DGYA 5C4ZA 5IYDH 1ET6A 5JJZA 4HN7A 5EGTA 2KBNA 3T51B 1T5XD 2MQHA 4A4IA 4LF9Q 1BCPD 1ENFA 3I4LA 2JYOA 4OGQC 4XT3B 4XQQA 2X6GA 1S72A 2ZJRA 3K6OA 1TS4A 1RTOA 5M5XH 2RBMA 2JSOA 3KK7A 4WALA 1SNOA 1YVCA 1EZ8A 4G7ZC 2VS1A 1PXUA 4X62L 2L1BA 3KF8B 1QOHA 2NUCA 2JA8B 3BZCA 4ODGA 1SNCA 4OL7A 4NXML 2Z6KC 1S3OA 4LF6Q 4PG3A 3OW2A 3GTKH 3DEPA 1CZGA 4Z9CB 1OXSC 2UXDL 2Z4IA 3S15H 1X4MA 2UUCQ 1FGBD 1F9QA 1N33Q 1LACA 1JJ2A 3NHHA 1PZID 2DNCA 2PQEA 1Z7TA 2OPVA 1ICWA 1Y1VH 2SEBD 1IW7C 4JI1L 3LNNA 3HOWH 2QF7A 5C0XJ 5E4WC 3BDLA 3HS0C 3EBEA 2KCNA 4CKCA 1TWCH 3CP0A 5BR8L 3QOJA 2FMMA 1FNVA 2RVLA 4CHTB 1K1GA 2RDHA 3S2HH 1H9MA 3K80C 2E2JB 4ZK9B 1TS2A 3R2TA 1IYUA 1I4XA 1S5FD 5I9PA 4H0LC 3I7FA 5M5YH 1SSOA 3CCJA 3BYTB 3PO3G 3E0JA 1I94Q 1BR9A 4GNXA 2F1MA 2J0TD 1ML0D 3UI2A 3PIPA 4QJFA 1M4VA 1WTPA 1CI3M 4LK1C 4LF4L 1OXXK 4NPSA 4NW2A 4ZKBB 3HOUB 1K0RA 5C4XB 5FJ8G 1TUAA 1BQQT 1E0BA 3DWPA 4DV0Q 3J7YW 1D5XC 5IT9E 1J5EL 2MJHA 4MHEA 3HKSA 2K14A 3NWTA 4GKKQ 5CORA 1LO5D 4ID6A 4NBQA 3S2DB 1EFWA 1EY5A 3SK8A 4DUYL 3K81C 3I70A 4GOPC 3D4DA 1JE5A 2D2CC 1YJNA 1PTOD 1C9OA 1DD2A 1STEA 3DWQA 1EQRA 1H95A 4A3JB 1YJ9A 2B2YA 3FHWA 1KHIA 4IPHA 4DUZQ 2AXYA 1DGSA 3GTGH 1B8AA 2RDFA 4A3EB 3BDOA 4FXGC 2BA1A 2ZT9C 2YV5A 4Q5VA 2L0CA 1HQRD 1RODA 1SNMA 4X3TA 5C44G 4RGOS 4IQZA 3N6RA 4LUZA 2PNHA 1VQ5A 3M85A 1X3GA 4LF7Q 1X54A 3TDQA 4A3JG 4C1NI 3IAYA 2QCPX 1G6PA 3PIOA 4GZYC 4DNIA 1KC8C 1PRTF 2JA8H 1SBBB 4IUQA 5F2DA 1NMFA 2RSNA 3M4YA 5E3FA 3D6WA 3RUZA 3M3YB 5ELOA 1STGA 2ALYB 1YIJA 4R1JA 1Y14B 1AH9A 1YNNC 4DR5L 1SMXA 3T53B 4GOPA 1R4PB 2MPMA 1DONA 4L5TA 4HJ9A 5IP9H 1BBXC 2KHJA 1QUQA 2ZJQA 1H9JA 2XTIA 3I73A 4N9TA 3J81L 4AM3A 3E9IA 3KYHC 4F8MA 5D3IB 4A3DB 5ELCA 3TN2A 2QEJC 3KLSX 2F52A 1PH9A 2IHFA 1KAAA 2PW7A 2E2JH 1C0AA 1KIXA 1TU2B 1XNRQ 1I3QB 4JBWA 4KHPL 1JOQA 3BVMA 1TY2A 1EWHA 1BCPB 1N32L 4LFCQ 3TZDA 3T13A 3UDXA 3T1YL 1U4MA 2AQ3B 3HOUH 1NCVA 5C4XH 2RCNA 1VQGA 2CQAA 3AMUA 4NP5A 3PF5A 4GKJL 2B8GA 1N34L 3L9AX 2ICIA 2VNUD 2BE5D 3KBXA 3I4NB 2EYHA 3PUWA 5IP7H 1OXUA 4KY5A 3ULPA 2AQ2B 3SK4A 2HT1A 4OXPA 3S2DH 4NXNQ 5I6YA 3TZUA 2I5MX 1KQSA 5ELBA 4X66Q 1VQ8A 1ZXTA 1H9KA 3OIPA 2EY5A 1NBWA 4DR3Q 4CKBA 4KKSA 4RWSC 2F0EA 4K2LA 3P1HA 4DV1Q 5IYBG 3DMUA 1A63A 1QWYA 3I4MB 3CHBD 1YZ6A 1YHAA 4A3JH 2CTMA 1A2TA 2A5HA 3V05A 5IGCA 3RLNA 3NE5B 5COYA 5IWAQ 2MFIA 1DM0B 5M9OA 4DV4L 1WD0A 4A3EH 2KEEA 1N36Q 3PSIA 4A3MB 2F0MA 4B3RL 1ZZIA 3CPWA 2ZXRA 2B39A 3NSWA 2VQEQ 5LMNL 3M4OH 4A3IB 3UDIA 1V1PA 5C5LA 4JYAL 2NVTB 5LHY1 1YNJC 3I4MG 5H1SE 1G291 1YJWA 3K7UC 2OQ0A 4X6AH 3RLFA 2NZOA 3CF5A 5FOBB 4X3KA 4X65Q 3D6CA 1JORA 2UUAQ 5ELFA 4DU9A 3OTOL 1IBMQ 1YHQA 4TKOB 3M3YH 2K04A 1I4QA 1JWSD 2WB1B 4IFDI 3AQQA 5ELEA 3A7LA 1VQHA 1EY8A 1WFQA 3QJYA 4A3IG 2K5QA 2K03A 1L0XB 3VKEA 5DLQE 4IOCA 3I90A 1F77A 4A3DH 1XJVA 3A5UA 4EQ5A 1EU3A 2JA5B 2ZTCA 4JI0Q 3NUCA 1JOKA 4I7ZC 2VB2X 1LT6D 1SNDA 3LWEA 2VXWA 5M3MB 2KHIA 5C4JB 1K8AC 1I4HA 3Q23A 5CV6A 4PMWA 2C5CA 1I3QH 3EIVA 3H3VC 3K5LA 4A3CH 2KVMA 1WTRA 1AFPA 1VIGA 3QO2A 4H44C 4DR6Q 1ILQA 2FXQA 4BY1B 1JB7A 1G6ZA 3U1KA 2CTFA 1CQVA 1YHBA 4OO1I 4MN3A 3G4SA 1PFSA 1JWUD 1Q3LA 4QL5A 4R4TA 2Q2IA 1O7IA 3KLWA 2HCCA 3JAML 1SFOB 3FPPA 5IGBA 2NTTA 2UXCQ 2PW5A 3S9WA 2JA5G 4KMUC 4BBSB 3I4NH 1YNND 2BH8A 1WVNA 3BZKA 3IL8A 4B3SL 5M3MG 1QILA 2N8NA 3VYRA 2IWHA 3BVZA 4ZUIA 3C46A 1IL8A 5IY0A 1N33L 2KUMA 3X3NA 3D4WA 4P71A 4JI7L 5EKLA 4K6DA 3STBC 2HDLA 1PHJA 2E2HB 4CJ2C 5E7NA 2IT1A 3F2CA 1DOLA 3BYYB 4L5QA 3PUZA 3I4MH 5EJWA 3KF6A 4R4OA 4DAYB 2XWBB 4O0AA 2E8GA 2N78A 1J8IA 1IBKL 3GV6A 1EEID 2NTSA 1TQOA 3I4OA 2L9HA 2WKCA 3CW2C 4DR7Q 3H94A 4XYOA 2WACA 2WFWA 4A3MH 2XNAC 1ZZJA 3KUPA 4FF4A 3EJIA 2Z4HA 5KYLA 5KYIA 1WD1A 1AEXA 4A3IH 5JEAH 1GUOA 1JB3A 3K58A 2B2TA 4Y7NB 2YTXA 1SAPA 4ZAIA 3OYYA 3FKIB 4JCVE 3M9BA 2PZUA 1HA5A 4K6LA 1EY4A 4L6TB 3C2PA 2EE1A 2M9VA 1VQMA 1EY9A 2XN9C 4YCWA 2CWAA 1CQFA 4LIJA 4PZ8A 2B2VA 4C2MB 3C1FA 3J81i 1MJCA 1K8OA 1QJOA 5C0XG 1W6KA 4PNYA 3H91A 4PZ7A 3PGZA 4DV2L 1B70B 5I4DA 3FKIG 2WAQG 2QILA 4OWWB 1EQQA 4WJ3M 1JT8A 2K4KA 1AN8A 1UUPA 1CSQA 3HG9A 4DV7L 1Q81C 3K5MA 3EVQA 4BXXH 2F0LA 2EQSA 1PTOF 1XWEA 2L4NA 5M3MH 5C4JH 2ZXPA 1PH5A 3SK5A 1ZYRC 1W3SA 4JI2Q 3PV0A 1NTGA 1X3FA 1PLFA 2Y0SG 3CU7A 2KENA 4BY1H 1BOSA 1ET9A 1HNZQ 2J7ZA 1STHA 3AU7A 1HZ9A 3MFGA 3CC7A 4AYBB 2CWPA 1SFOH 1XMOQ 2K5VA 4JBMA 1EZ6A 2JEBI 3OMGA 1L0WA 4BBSH 2NBFA 4JI6L 1Q8IA 3I2ZA 2EZVA 2JA9A 2KJXA 4GOPB 2PY9A 1CTMA 1QUQB 4A3FB 4AH6A 5BN4A 3Q24A 2JA6B 2UU9L 2ASBA 2OPUA 5IYDG 4QIWE 4GS3A 2Q8RE 3PUYA 5FO8B 1D1IA 1J4WA 3SVMA 2E2HH 1BKBA 1VQFA 1B4OA 4AYBG 3OPOA 2NVQB 4KD3A 5JEAJ 4DN4M 3NQIA 1MI2A 4J15A 4DF7A 1VQ6A 1TXYA 2UXBQ 3VR3A 3ONAB 2K5DA 1JCKB 3G71A 5T1GA 1XNRL 1GUNA 2JA6G 5A2QL 2AKWB 4BWGB 4JI3Q 4ME5A 3Q0AA 2CTLA 3KOJA 1QE6A 3FP9A 3UDFA 3BG3A 4WORA 3MXNA 3H3VI 2SDFA 4Y7NH 1EIHA 1Y1VG 4OWXB 1CKMA 2MNAA 4KKUA 3FKIH 3GD7A 4RH6A 1Q86C 2LXJA 1G2SA 4UP8A 3ICEA 2PPBC 1ILPA 1Z47A 2JZXA 4LAAA 4ME3A 1SE3A 1NUCA 4WJ4A 2A1AA 4B3TL 4RAUC 3TREA 4C2MH 2B8FA 2JP1A 2MP1A 2I0QA 3J80L 1BUVT 2J4XA 3NENA 3NBIA 4TRDA 2A74C 3HOZB 1GVPA 4UY8C 3QB3A 3GTOB 2XRSD 1JOOA 5HURA 1F2ZA 1RDPD 2O4XA 3I91A 4IJHA 5AFWA 1PH1A 1BDOA 3TP5A 1YBYA 2KEDA 1ENAA 2ATWA 1QVCA 4L8JA 1A0IA 1PVOA 3S1NB 2MGSA 3SHLA 3S1MB 3LWUA 2FJ2A 2N88A 4OIKA 3A8IE 1S5CD 1L1OC 3JAMi 4DR4Q 3VR2A 2O2LD 4JV5Q 5FLXc 4JI5L 1LUZA 5LMNW 3M7NA 2PQAB 1HQMC 4IFDH 4YY3L 1LT5D 5CYUA 4ABNA 1I50B 5FO7B 4CJ1B 1PFMA 3OOCA 1HR0L 3A56A 2B29A 1JE4A 2LS01 4LF8L 1JR0D 1J5KA 3K5OA 4ZRZA 2AWNA 3B6YA 3P75A 1STAA 1VF5C 1PH2A 3VYSA 1YEZA 3F8TA 4A3FH 2RHSB 2JA6H 5FLMH 5TSSA 3MXPA 4DGZA 4YIJA 1HHVA 1FVIA 3X3MA 2A73B 3TBIB 1R9TB 1U4LA 1WTWA 5J39A 1F2LA 4J8QA 4GLAC 4HJAA 2B2WA 1VF7A 3T1HL 1EOTA 4OHJA 2VUMB 4R4CA 1FNUA 4LF5Q 4NKLA 5GAHC 1LTSD 2AUKA 2NVQH 1VQLA 3WDNA 2IY5B 4H7BA 1ZYRD 1SMYC 1YITA 5DM63 4OO1H 2TSSA 2XWJB 5IGDA 1MJEA 1MD2D 2PNRC 2OT2A 4HEDA 1WE8A 1KLUD 2IPKD 3WOFA 2JA8G 2X6LA 3I3CA 1WTQA 1B1ZA 1CKNA 4HJ5A 5K36H 1CK1A 4DAYA 3FVQA 4DNRB 5CC4A 2ENBA 4JVYA 4HJ7A 2OXPA 1CM9A 3U9OA 4Q0FA 2LMCB 1G91A 5IP9G 4RKBA 3HGBA 3PUVA 1FNWA 3JC66 1A8VA 5FK9C 2PQUA 4JG2A 5LMUQ 2CHBD 2EYPA 1PYBA 2A8VA 1X3PA 4HR7B 2XIWA 1A6XA 2N55A 1QZHA 4KK7A 2EVBA 1LTID 3RN2A 2ICEC 4POFA 2ZJPA 2PMZB 3A54A 4F7XA 1KRTA 2Z6KA 1C8CA 3KF6B 3ZJYC 2D5DA 1PZKD 4DAPA 3NQTA 5FLXE 4A3KB 1FJGL 4NDXA 1VQ7A 3HOZH 1A3VA 1JJCB 4KJNA 2F0VA 5DEHA 2IW3A 3GTOH 2QNDA 2K52A 1LTBD 2F3VA 3HOUG 3CAMA 4DV3L 3ERSX 3CMAA 5C4XG 4G4KA 3HOXB 1B9NA 1I4PA 2OQKA 1KRSA 3RMHA 4IFDJ 4V190 3F2BA 5C5MA 3S1NH 2F3WA 5CV5A 1AP0A 5IP7G 4JOIC 4JI8Q 4EX5A 2F4VL 4AQYQ 3S1MH 3MVVA 4ZQ3A 4C3HB 2VQFL 5KNBA 2E75C 4O2DA 1XMQQ 1VQKA 1VCIA 4K0KL 1NAPA 2CPQA 4HCSA 3M4OB 1II3A 3G6EA 1HNWL 4X64Q 1UAPA 2E2IB 5BN3A 4HIKA 1HNXQ 2E5LL 1HH2P 3W3AA 1I50H 3IFTA 3SGIA 1LTTD 4G7OC 4BY7B 1IYVA 1Y8NB 2LXKA 4FF3A 4DR2Q 5LL6X 1X4NA 1A3UA 1RIPA 2F0NA 4A3EG 2JA7B 1Y8PB 2M2LA 2Q2TA 1I4RA 1X9NA 4JC0A 4X3UA 5GROA 1BVSA 2K5NA 1R9TH 4B3ML 3J81j 2G9HD 1Y69U 1SNQA 3TP6A 3DXJC 3PCOB 4L63B 3AYHB 2B63B 1JQYD 5IOCA 2VUMH 3T4AC 1RJTA 1B2TA 2E76C 1Q8KA 1U9RA 1SE8A 4ALPA 4DR1Q 2PI2A 5J3BA 4HJ8A 2KHSA 3RN5A 1LV9A 2GA4B 1WCMB