4OO1G

Structure of an rrp6-rna exosome complex bound to poly(a) rna
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
234
structure length
226
Chain Sequence
STFIFPGDSFPVDPTTPVKLGPGIYCDPNTQEIRPVNTGVLHVSTAYIDYSSKRYIPSVNDFVIGVIIGTFSDSYKVSLQNFSSSVSLSYMAFPNASKKNRPTLQVGDLVYARVCTAEKELEAEIECFDSTTGRDAGFGILEDGMIIDVNLNFARQLLFNNDFPLLKVLAAHTKFEVAIGLNGKIWVKCEELSNTLACYRTIMECCQKNDTAAFKDIAKRQFKEIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exosome complex component RRP45
publication title Structure of an Rrp6-RNA exosome complex bound to poly(A) RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/rna
total genus 36
structure length 226
sequence length 234
ec nomenclature
pdb deposition date 2014-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF15985 KH_6 KH domain
G PF18311 Rrp40_N Exosome complex exonuclease Rrp40 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4oo1G01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4oo1G02
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 4oo1G03
1Q7YC 3RLOA 2EJMA 2JA5H 2R7ZH 3ND8A 3FMCA 2B63H 4LFAQ 4DV7L 1K9MC 3RN2A 4H02A 1JE5A 3SDZA 3AFPA 1J5EQ 4PMWA 3V69A 1Z47A 4P74A 3PO2H 3VA7A 1YHQA 3PUYA 3F2CA 1DT4A 1U0LA 4QL5A 4WJ4A 2EQSA 5BN5A 3WWVA 4GNXA 4LF4Q 1GUGA 3S1NH 3HOYG 4JI1L 4JI6Q 4BXXG 4QQBX 3E9IA 1N8RC 5GAEC 4JV5L 3A74A 4IFDG 4FDBA 2IT1A 3UDXA 4X64L 5IYCH 3G4SA 5C44H 1BVSA 2DNCA 2E2JH 2OPVA 1I3QH 2WFWA 1SFOH 5KNCA 4G7OC 4WALA 1YVCA 4UPAA 5FJ8G 5IT9c 1X56A 1IBLL 2R7FA 4R4IA 4JI5Q 4JVHA 1K83H 5JEAJ 2QA4A 3RR5A 1EWHA 2O5JC 4DUZL 1PH6A 5HGQA 4BY7G 2RHQB 3GTOH 1K8GA 2AXYA 5IP9G 1H9SA 1UEBA 3H94A 3T1HL 2A1AA 1PH4A 2JEBI 2PNRC 1UE5A 2E8GA 1AE2A 4R4TA 3LGJA 4P72A 4IOCA 2UXBL 4LF9Q 5FLMH 1UE1A 2MJHA 3FKIG 1YNJC 1S3OA 2CQOA 4DK1A 5A35A 4OX9L 2HQLA 4P71A 1HR0Q 1OTCA 3NE5B 1N34L 3S16H 3J81c 1HTPA 1CKMA 3I56A 4MTNA 4GLAC 4NXMQ 2UXCQ 3HKZG 5C3EG 2QGQA 1VQNA 2A68D 1HQMC 1J5EL 3VKEA 1B7YB 1VQFA 1Y1WG 2VNUD 3M3YH 2IHFA 4L5RC 2YTYA 1WCMG 4I7ZC 4DV4Q 4DR6Q 3CP0A 4APVA 2VW9A 4YWLA 4POGA 3A0JA 2OCEA 2F3IA 3L2PA 1XMQL 5GQOA 1FVIA 1NBWA 3JC66 2Q8IB 1TWGH 4JI6L 2ZTDA 4EX5A 2B8GA 2KCMA 4A3DH 4A93H 1XNRQ 3N6RA 3KF6B 2D0OA 2LSSA 3CCEA 3CRLC 1D8LA 3PO3G 1VQ4A 4BY1G 1NE3A 3RZDH 4A3BH 4LUVA 3H15A 2Y0SE 4LF7Q 4JI5L 1E1TA 1E24A 1H9SB 1YI2A 3J81j 1VQGA 4A3EG 3BDOA 4H13C 1Y8NB 1VQ9A 1YJWA 5IYBH 1CUKA 1LACA 2BH2A 4R4OA 1LUZA 2JEAI 1CKOA 3S2HH 4X62L 2ZJQA 3L0OA 4UP9A 4LF9L 4A3LG 1VF5C 4GOPB 3WDNA 4AIMA 3LWUA 3PUWA 2Q2IA 5M5WH 3J80i 5C0XG 4OWTB 1DCZA 4JI7Q 1HPCA 4A3KH 1HR0L 1FR3A 2B3GA 4BBRG 1UE7A 1XPRA 5BN4A 3RN5A 4ALPA 4C3HH 1VIGA 1PH5A 3CPFA 2N78A 4DK6C 1X3GA 4XTCS 1C9OA 1J6QA 3I7FA 4IQZA 3J7A5 5GAHC 1VIHA 2A6ED 2I0QA 4IO9A 2JA5G 2UUBL 1YNNC 2R7ZG 2B63G 1Z7TA 1VQMA 4B3MQ 2NVQH 1K73C 3KJOA 4DV4L 2CTEA 4L8JA 1XMOQ 2AUKA 4IJLA 3PO2G 4NB3A 4YWKA 2A69C 4JBJA 3T53B 1SMYC 4OXPA 3M7NA 1ZKOA 1XNRL 3I72A 4A3FH 3CCMA 2K14A 5JJKA 1KAWA 4HJ8A 3EIVA 1J4WA 1PH7A 1X4NA 3SGIA 1EOVA 3I73A 5ELNA 5IYCG 1PYSB 3RLFA 2V4DA 4Y7NH 1VQHA 1HR0W 4LFBQ 1ZTGA 3G6EA 2CW0C 3EBEA 3U58A 1L1OB 1KL9A 4JG2A 1O7LA 1H9JA 2OPUA 5HY6A 5IYDH 1BDOA 3TZUA 2YTVA 4YWMA 4GKKQ 2PQAA 1I6VC 1IYJB 4C3IH 1BBUA 5EAYA 4HJAA 4YY3L 3OW7A 3TEHB 1FJGQ 4GN4B 1GUSA 4TKOB 1HCZA 4A3CH 4AQYL 2WB1E 3GTGH 3CCLA 3F8TA 2AUJD 4HJ7A 4NPSA 5FLMG 1TUAA 1MJEA 2CTJA 1Q90A 1GUTA 2AWNA 4B8TA 2Z6KA 2N49A 4PZ8A 2YQRA 2BH8A 1KRTA 2KHIA 2R92H 1VQIA 5IP7H 1CSQA 1XPUA 4HIMA 2DGYA 4C2MH 2K75A 1V43A 3A8JE 3VR5A 2E76C 1Y69U 1QVFA 4J15A 4B3ML 3GTQH 3NEMA 3L7ZC 2CTLA 4A3JH 1XMOL 4A3MH 1Q1EA 3RLNA 2KCTA 3M4YA 2BA0A 1K8OA 3CCVA 2N3SA 1XJVA 3PUZA 4A3IH 3UDFA 2OQKA 3S15H 2VL6A 4AH6A 1VDZA 3ULPA 4A3DG 1QZGA 4A93G 1L2FA 2IHEA 1JJGA 4LFBL 3TS2A 2PQAB 1K8AC 4A3BG 1JB7A 4GKJQ 3T1HQ 4DUYQ 3ICEA 3RNUA 3M4OH 2BDOA 2UUAQ 3PF4A 1YBYA 4DR2Q 3A5ZB 1VQJA 2ZT9C 2K5HA 1B8AA 3UDGA 3KOJA 2Q2TA 1FJGL 5IYBG 3S1MH 1IW7D 1GUOA 1EYGA 2O5IC 1VQBA 2L5TA 3CMAA 2A6HD 3HOZH 2HT1A 5ELOA 1K3RA 4IFDI 1ONLA 3U50C 1E7ZA 4B3TQ 1X6OA 2CTKA 3KF8B 4A3KG 5JJIA 3NENA 2D5DA 3EQLC 1GO3E 3NELA 3H0GH 1WYDA 3KDFB 4GNXC 1GJXA 4IPHA 1GM5A 4JI3Q 1E2ZA 1GVPA 1CTMA 4IPCA 1XMQQ 3E9HA 1MIUA 5M5YH 4DR4Q 1EUJA 3I4MH 4PG3A 1E1OA 3MEFA 4OWXB 4HIDA 2JA7H 1VQDA 1WVNA 1ZZKA 1O78A 1JMCA 4PZ7A 4TQUS 3TS0A 1DTJA 1TWCH 3KF6A 2YV5A 2BE5C 2OWOA 1J5KA 2WP8J 3S2DH 1V8QA 2F52A 5H1SE 2V1CC 1D7QA 3KJPA 3KFUA 1IBMQ 4A3FG 4AYBE 1KHIA 4JOIA 4G7HC 1C7YA 3TRZA 2VQFQ 4GZYC 1WFQA 3GQBA 4P73A 3PIPA 1IXRA 2OQ0A 3KLWA 3GTMH 4GKJL 4DUYL 4X62Q 3S1QH 1EQQA 1G6PA 2RCNA 2KENA 4DR3Q 2UUAL 3UDIA 4DR2L 5E7NA 3J81i 1RL2A 1JT8A 3ER0A 4O0AA 3PSIA 1S40A 5IYDG 1CFMA 1QJOA 2QEXA 1VF7A 1X55A 4DK3C 2WB1G 4P75A 4GOPA 1FGUA 3CCJA 3HGBA 3IFTA 3DM3A 2XGTA 3CRKC 4KKSA 3VR6A 4HJ5A 4HIOA 4BA1I 1S72A 1PV4A 2D62A 1QUQA 4A3CG 4B3TL 2H5XA 2UUBQ 2QNDA 3HOVH 2PY9A 1Y1VH 3EN2A 1P8LA 1UE6A 1ZZIA 1Q1BA 2VUMH 4JI3L 5IE8A 2HHHQ 1ASYA 4A75A 3OTOL 2JVZA 2R92G 2L15A 5IP7G 4RG1A 3F1ZA 5JEAH 3E0EA 4DR4L 2BL5A 4A3GH 2A8VA 3ERSX 3VDYA 2JA6H 4KKTA 4UY8C 1KHMA 1IYUA 2BA1A 2ZTEA 2ANRA 2Z0SA 4A3JG 1K0RA 4A3MG 4LWCA 2FMRA 3A5UA 2R7DA 4GS3A 2ID0A 2DGRA 5JJLA 5IY0A 4IFDJ 4A76A 1KIXA 5C0XI 3A7AB 4A3IG 2LMCB 4DNRB 1IBML 5KNBA 2I5LX 1XPOA 1HNXQ 3J7ZC 2EVBA 3SE0A 2VQFL 1QVGA 1L1OA 4YY3Q 5FLXc 4JI0Q 4ME3A 1TWFH 4DR3L 2A68C 2ATWA 4XIGS 1VQEA 4X65Q 1U5KA 1O7IA 2KCCA 4B3RL 4AQYQ 1N9WA 1XTDA 1NTGA 2AHOB 3CD6A 1HZBA 2WAQE 5C4JH 2E3UA 4AM3A 1VCIA 1HZ9A 2NN6H 1QUQB 1Y8OB 1Y14B 3T1YQ 1A8VA 1GHJA 2B8FA 4IPGA 3JAMc 3OPOA 3DLLA 1Q82C 2HH2A 3HOZG 4R4QA 3QIAA 4EQ5A 4DV0Q 4KI0A 1VQ8A 3K7UC 1LYLA 5LMUQ 1HZAA 2ZTCA 1E2VA 3TREA 1I5FA 1NY4A 2HHHL 3BG3A 1TWHH 3CAMA 1Y8PB 2ZJPA 1IBKQ 3H0GG 4BBSH 2YYZA 1G51A 3T51B 1HZCA 3D0FA 1B9MA 4G7ZC 5M5XH 3W3AA 1MJCA 1SN8A 1CKNA 2LXJA 1KC8C 2AKWB 2E5LL 3I4MG 4GN3B 2P2RA 1QVCA 2A19A 2YU9H 2JA7G 4JBKA 1E3PA 2CWPA 1PA6A 1VQLA 4JI4Q 3G71A 2XTIA 4LIJA 1N36Q 2CFMA 1SLJA 3W5OA 2R93H 3BZKA 1LTLA 1EIFA 3PUVA 1HNXL 1Q12A 1X3EA 4IJHA 2PNHA 3S14H 1MKHA 1XNQQ 3PF5A 5BN3A 4IPDA 4OGQC 2E75C 2IX0A 4JI0L 2K50A 4YCUA 2NZOA 2MO1A 3GTJH 3BZCA 2CCZA 3NBHB 3CC2A 2VY3A 1HH2P 2A6EC 5C4XH 4DKAC 3U4VA 1X65A 3KYHC 1RIPA 1DGSA 4X65L 2PCFB 4GN5A 3CCSA 4X66Q 3OOCA 2CKZB 1T5EA 2Z6KC 2MNAA 5IWAQ 3HOWH 4JC0A 3T1YL 1HJPA 1OXVA 3M4PA 4JCVE 5C0XJ 1VQPA 1GHKA 4KN4C 2NVTH 1G291 4KHPQ 1SRUA 5J3BA 4DV0L 1HNZQ 3GDEA 1H9RA 3HOXH 3HKSA 3KDFA 5LMUL 3STBD 2UXDQ 1VQCA 2B29A 4LUOA 1LM0A 1ZYRC 3CCQA 1CKNB 3HOVG 1IBKL 1AE3A 4HR7B 2IY5B 2F4VQ 1Y1VG 3K80C 4LW1A 3QG1A 4DPGA 2RHSB 1IZ6A 1L0WA 1M90C 2VUMG 4LF8L 3HOUH 2K52A 1OXSC 5GAGC 4JYAQ 4LF5Q 1V9PA 5JEAG 2Y0SG 1UWVA 4A3GG 3K81C 1H9MA 3LNNA 4YCWA 4NXNQ 4JI4L 2JA6G 2JA8H 3GTLH 4QJFA 2PMZE 1N36L 3I4LA 3M85A 4KN7C 3K0XA 1CI3M 2ALYB 1YJNA 5BR8Q 4R1JA 2CTMA 4LFCL 2JE6I 1XNQL 4GLVB 1YJ9A 3QJYA 2K7VA 1B9NA 2MQHA 4OWWB 3UE0A 1BBWA 3CCRA 1R9TH 1PHJA 4WANA 2AMCB 4DR5L 2BE5D 2NN6I 3MXUA 4GLXA 3KLRA 3RZOH 4DV2Q 1VS0A 1SE8A 2DNEA 4X66L 2K5NA 4DR1L 4DR7Q 2EJGC 2VQEQ 1Z6HA 3Q8DA 1A62A 1SROA 1HNWQ 5K36H 5IWAL 4RCNA 3W1BA 4H44C 4DV5Q 1NMGA 1LABA 1NJIC 1IL2A 2NN6G 2UUCQ 4KHPL 3I4OA 3F2DA 4KMUC 3OTOQ 5KNDA 1HNZL 4OO1H 2E2IH 1OXUA 1VQ6A 2C35B 4LNQA 2UXDL 3PV0A 2GN5A 1GKHA 4DAYB 2K32A 2NZHA 2K33A 2JJQA 2F4VL 3DXJC 3VR2A 3ZJYC 3W1GA 1Q8KA 2HH3A 3CQZH 1DXMA 2HIVA 1KD1C 3AQQA 3CF5A 4JYAL 1CSPA 2D2CC 4LF5L 1QZHA 4BBSG 5M3FH 4JOIC 1IW7C 3S17H 4NXNL 2KA7A 3ULJA 4LUZA 1PH1A 3FPPA 2A6HC 4UP7A 3S1RH 1A6XA 3MXNB 5BR8L 3CPWA 3PCOB 2UU9Q 2R93G 2ASBA 3I4NH 2I5MX 4B3RQ 1SMXA 4BA2I 1NMFA 3A7LA 1A63A 2R6GA 3AEVA 4C3JH 4GOPC 3H3VH 1FL0A 2OTJA 4HJ9A 1KXLA 2E2HH 4L5QA 4DV2L 1V1QA 1ZZJA 4DR7L 2AWOA 2VQEL 5C4XG 1JJCB 2PI2A 2N8NA 4JI8Q 3OW2A 1VQKA 5LMNQ 1HNWL 4DV1Q 2K5VA 1IYVA 4DV5L 2CTFA 3FHWA 3CCUA 1YNXA 4LJZC 1OXXK 4LFAL 2PQUA 2UUCL 3HOWG 3PIOA 4GNXB 4RMFA 1TXYA 1OXTA 3U1KA 4WJ3M 2KBNA 3B6YA 2YTXA 3TQYA 2D0PA 4LF4L 2E5LQ 4KKUA 2RF4A 1M1KC 3HOXG 1N33Q 2DUDA 3OYYA 4K0KQ 4JVYA 3GTPH 2OTLA 2JQOA 1TKWB 1YHAA 3ND9A 4DNTB 2EXDA 3BU2A 4YHHQ 1BKBA 4O2DA 3HOUG 4L5TA 1I50H 1FYCA 1L1OC 1N32Q 3K7AH 2A69D 1ASZA 4TVAB 1VQ5A 2JA8G 2CPQA 3I2ZA 3AEVB 3CW2C 4LK1C 1YITA 1PH3A 2UU9L 5AJ3Q 4B3SQ 4JI2Q 1VQOA 3M4QA 3AFQA 5M3MH 1H9KA 4R4CA 3JAMi 4KLKA 1H95A 4DV3Q 4DNIA 3I55A 2ZJRA 1I94Q 1I6HH 1SR3A 4JI8L 1WI5A 1WOCA 5LMNL 4H0LC 4DV1L 4DAMA 2ZM6Q 2NVXH 3J80c 4OO1I 3IKJA 4NXML 2UXCL 1KQSA 3MFYA 2I5HA 5K36G 3HOYH 4BXXH 3M9BA 3VR4A 4IFDH 2HIXA 3F2BA 1YIJA 1K1GA 1P16A 2GVBA 3CC7A 2PPBC 4DR6L 5FJ8H 4POFA 4LF8Q 1WJJA 4HIKA 4MNOA 4OO1G 4DV6Q 3A8KE 1N33L 4K0KL 2JXMB 4MZ9A 3PGZA 5GADC 3CC4A 2LXKA 1JJ2A 1GUNA 4BY7H 1Q81C 2NVYH 4AYBG 1PH2A 1A0IA 5IP9H 1K8MA 4JK1C 4YHHL 1GD7A 4DK0A 3D4RA 1B70B 3G48A 5GROA 5C44G 1EWIA 4LFCQ 4QIWE 4QMFB 5M3FG 4LF7L 1N32L 4PV1C 3T56B 5LMNW 2EDGA 4YCVA 1Z9FA 3FKIH 2EJFC 1TWAH 3H3VI 1AH9A 5AJ3L 4DR5Q 4B3SL 4JI2L 2ES2A 1PYBA 2VZAA 1X54A 1YEZA 3IRBA 1X4MA 1YZ6A 3VR3A 4JBMA 1PVOA 1C0AA 4DR1Q 4LF6Q 4A4IA 1VQAA 2GVAA 5C3EH 3U4ZA 1E2WA 3I4NG 3FP9A 4QY7A 3S24A 4DV3L 3GO5A 2CWAA 1PH9A 3A8IE 1I94L 2IX1A 4JI7L 4X6AH 2JA9A 4OONA 1Y1WH 2FXQA 1EFWA 1PFSA 1WCMH 4DV7Q 2PI2E 3HKZE 2ZM6L 1E22A 1Q46A 3ULLA 1KRSA 4UP8A 4NBQA 4L5SA 2JZXA 3GTKH 3HFZB 1Q86C 2VS1A 3P20A 2MFIA 3BJUA 1YHBA 2Q2HA 1EQRA 5DLQE 3PO3H 4JI1Q 2EIFA 1DD2A 1X9NA 4BY1H 3GD7A 4PZ6A 4KHZA 4JV5Q 4DV6L 1EC6A 4X64Q 1PMRA 2ANNA 2E74C 4A3EH 1IBLQ 3CXCA 2F1MA 3UE1A 1W3SA 3U9SA 4Y52H 1WE8A 4DUZQ 1EIYB 4JBWA 2JK8A 1W2BA 4A3LH 3D31A 1X3FA 5C0XH 3CMEA 3PUXA 4IOAA 4GKKL 2UXBQ 4BBRH 2WAQG 3K8AA 1TU2B 4QGUA 1PH8A 2Q2UA 4LF6L 3AB9A 2MO0A 4OX9Q 2KHJA 2K4KA 3STBC 1VQ7A 3AYHB 2DN8A 5M3MG 1N34Q 1T9HA 2QF7A
chains in the Genus database with same CATH superfamily
1Q7YC 3RLOA 2EJMA 2JA5H 3JAMW 2R7ZH 1QB5D 4OD6A 3ND8A 3FMCA 2B63H 4DN4M 4LFAQ 4DV7L 1K9MC 2EYOA 1U4MA 3RN2A 4H02A 1JE5A 3SDZA 4ZUIA 1EY8A 4Z9CB 3AFPA 1J5EQ 5DM73 4PMWA 3V69A 1Z47A 1HNXH 4P74A 3PO2H 3VA7A 3HOVB 3GABA 1YHQA 3PUYA 3F2CA 4K8IA 1DT4A 2E2DC 1LTTD 1L0XB 1SNMA 1SSOA 1U0LA 4QL5A 4WJ4A 2EQSA 3WWVA 5BN5A 2VUMB 2EZVA 3P1HA 4YY3H 4JI0H 3K5NA 4GNXA 3NTKA 4LF4Q 1GUGA 2WV6D 3S1NH 2WIIB 1WD1A 3HOYG 4JI1L 4JI6Q 4BXXG 2XWBB 1BOSA 4QQBX 2Y0SB 3E9IA 1N8RC 4A3DB 5GAEC 4A3GB 1A2UA 2L9HA 4JV5L 3A74A 5KIXA 4IFDG 4AQYH 3TP7A 4FDBA 2IT1A 2JA6B 3UDXA 4X64L 1HUMA 5IYCH 3G6JB 5C44H 3G4SA 1BVSA 2DNCA 5JPMC 2E2JH 1I3QH 2WFWA 2OPVA 1SFOH 5KNCA 4B8CD 4G7OC 4WALA 1YVCA 4RH6A 3D8GA 4UPAA 5FJ8G 1EYAA 5IT9c 2G9HD 2PQEA 1STBA 2XVSA 2F0VA 1X56A 3SXHA 5IGBA 3U9OA 1IBLL 3T1YH 2R7FA 4R4IA 5KYLA 2OT2A 2FMCA 1X32A 4JI5Q 2LTLA 4XQJA 4JVHA 1LTRD 1EIHA 1JE4A 1K83H 5JEAJ 1TY0A 2QA4A 3RR5A 1EWHA 4DUZL 2O5JC 2IJ0A 4N8FA 1PH6A 5HGQA 4BY7G 2B2UA 2RHQB 3GTOH 3QOLA 1K8GA 3QD7X 4DV0H 5CORA 2AXYA 1CHPD 4IURA 5IP9G 1V1OA 1GXDC 3H91A 1WTPA 3MFGA 1H9SA 1VBIA 2CQAA 2K03A 1UEBA 1FD7D 3FDTA 1AZQA 1XMOH 3H94A 1A3VA 2TSSA 3T1HL 2A1AA 2DJFC 5KYIA 1PH4A 2JEBI 3S2HB 2PNRC 4IUQA 1UE5A 1KLGD 1AE2A 2E8GA 5IGFA 1JOQA 4R4TA 1TWFB 4UAIA 3LGJA 4P72A 1IBKH 4IOCA 2UXBL 4RKLA 5ELBA 1B1ZA 5FLMH 4LF9Q 1UE1A 2F0FA 2MJHA 3FKIG 5CBEE 5JAVA 1YNJC 4OELB 1WTJA 1S3OA 2CQOA 1LTSD 4DK1A 4A3KB 4KHVA 5A35A 4OX9L 3FPUB 2HQLA 1STNA 4P71A 1HR0Q 1OTCA 3NE5B 2EYPA 2JYOA 1N34L 5C4JB 1WHRA 4H8AA 3S16H 3J81c 1HTPA 3ONAB 3TDQA 1CKMA 4ILWA 3I56A 1RTNA 4MTNA 4GLAC 5C4ZA 4JI4H 4NXMQ 2UXCQ 3HKZG 5C3EG 5D3DA 3T13A 1BCPC 4F87A 3SB1A 1N36H 2F0OA 4HTHA 2QGQA 5KRUA 1VQNA 4QB4A 2A68D 4B9WA 4L63B 1XYIA 1HQMC 1J5EL 2SOBA 1B7YB 1VQFA 2F4IA 3VKEA 1Y1WG 2VNUD 3M3YH 2IHFA 4L5RC 4FF3A 2B39A 2PZWA 2YTYA 4ULLA 3I91A 3O13A 3T4AC 1WCMG 1LTAD 3MEHA 1TS2A 4I7ZC 5TSSA 1XNQH 4DV4Q 3HRZC 4DR6Q 1SEIA 1I4GA 1S5CD 3CP0A 2HCCA 4APVA 2PT7G 2LTMA 1TWHB 2VW9A 4YWLA 1HA5A 3A0JA 1LT5D 4POGA 1LTGD 2OCEA 2F3IA 2RCFA 3L2PA 5CV8A 5GQOA 1XMQL 1FVIA 1NBWA 3JC66 4CHTB 4BBSB 2Q8IB 1TWGH 4JI6L 4QF4A 5DM63 2ZTDA 4EX5A 2B8GA 2NB0A 2KCMA 4A3DH 5M5XB 2HD3A 4A93H 1XNRQ 3N6RA 1F0XA 3KF6B 2D0OA 1NNXA 2LSSA 4X66H 5FO8B 3CCEA 1Z2IA 3CRLC 1CM9A 2B2WA 3T16A 4EQNA 1D8LA 3PO3G 4HEDA 1VQ4A 3MXPA 4BY1G 1NE3A 3RZDH 4A3BH 4LUVA 3H15A 2Y0SE 1AFPA 2K1HA 4V0BA 1WTRA 4LF7Q 4JI5L 1E1TA 1NXUA 1E24A 1H9SB 3LWEA 1YI2A 3J81j 1VQGA 1U4PA 4A3EG 3BDOA 4KHPH 4H13C 1SJHD 3SVMA 4HMJA 1Y8NB 1VQ9A 1YJWA 4RGNA 5IYBH 1JOKA 1HNZH 1SNQA 1JWSD 1CUKA 3S14B 1LACA 2G8YA 1G8ZD 4CDDC 2BH2A 1PLFA 4R4OA 1LUZA 2JEAI 4EVOA 1CKOA 2UXDH 3GTJB 2NTTA 3S2HH 4X62L 1I4HA 2ZJQA 3L0OA 5C4XB 2CH4A 1TS5A 1STEA 4UP9A 4O1NA 4LF9L 4A3LG 1VF5C 4GOPB 4FNFA 3WDNA 3LWUA 4AIMA 3PUWA 2Q2IA 5M5WH 2CWFA 3J80i 4OWTB 5C0XG 1EFID 2EY6A 2FHTA 1DCZA 4JI7Q 1HPCA 1DM0B 4A3KH 2JSOA 1C4QA 1HR0L 4O42A 4JYAH 1FR3A 2B3GA 3K6OA 1TIID 4BBRG 1UE7A 1XPRA 4N9TA 5BN4A 3RN5A 4ALPA 4C3HH 1VIGA 1CHQD 2EY5A 5EGTA 3HOWB 5LHY1 1PH5A 4NXNH 3CPFA 4HN7A 1QG7A 2N78A 4DK6C 1MSGA 1X3GA 4XTCS 1C9OA 1J6QA 3I7FA 4IQZA 3J7A5 5GAHC 1VIHA 2A6ED 2I0QA 1UUPA 4C56C 2NVTB 4B08A 3GV6A 4IO9A 4G08A 4DF7A 2ZQEA 2JA5G 5BR8H 1B44D 2UUBL 1YNNC 2R7ZG 1RHPA 2B63G 1R4PB 1Z7TA 2F3WA 3NPPA 1VQMA 4B3MQ 2QDBA 2NVQH 1K73C 4RA8A 2Q8RE 3KJOA 4DV4L 2CTEA 2M9VA 4L8JA 1HFNA 1XMOQ 2EYLA 1KDBA 2AUKA 1F2ZA 3BVMA 4IJLA 2WACA 3QWNA 3PO2G 4NB3A 4YWKA 2JP1A 2A69C 4HMIA 4JBJA 1CQVA 3T53B 1SMYC 2QEJC 2L4NA 1QILA 2ICEC 4OXPA 3M7NA 1S5ED 1ZKOA 1XNRL 1PZJD 3HOUB 1PDQA 3I72A 4A3FH 2OEOA 3CCMA 4DR7H 3SK8A 2VQEH 2K14A 4UDUC 4P2CB 5JOBA 5A2QE 1KAWA 4IALA 4HJ8A 2AQ1B 4MIUA 5JJKA 3EIVA 1J4WA 5FOBB 1PH7A 1HNWH 1X4NA 4MTKA 3SGIA 1EOVA 3I73A 1ENCA 5ELNA 4DV5H 5IYCG 1X9ZA 2JA8B 3GTLB 1PYSB 4FXKC 1PRTC 2FFKB 3RLFA 2V4DA 1HA6A 1RDPD 4Y7NH 1VQHA 1HR0W 4RGOS 4LFBQ 2VKCA 1ZTGA 1ZYRD 3G6EA 2CW0C 1ML0D 3EBEA 5CYUA 3U58A 1L1OB 2UUCH 1KL9A 4JG2A 1O7LA 1H9JA 1EEID 2OPUA 3OTOH 5HY6A 5IYDH 1BDOA 2RKSA 3TZUA 2YTVA 4YWMA 1PQXA 4GKKQ 1F2LA 3OSOA 2PQAA 5AFWA 5E4XA 1I6VC 2OF1A 1IYJB 4C3IH 1BBUA 5EAYA 1SYEA 4HJAA 1K28A 4YY3L 3Q23A 3OW7A 3TEHB 1R9TB 1FJGQ 1KTKA 3C3LA 5JPNC 4GN4B 1GUSA 5IGGA 4TKOB 3RZOB 1F9SA 2J4XA 4DXFA 1HCZA 4A3CH 4AQYL 2WB1E 2LF0A 1UEAB 3EROA 3GTGH 2VXWA 3CCLA 3F8TA 1ILQA 2AUJD 1LT3D 4H7BA 4HJ7A 4EGVA 4NPSA 5FLMG 1JORA 1TUAA 3NTIA 1X0AA 2PW5A 1MJEA 2CTJA 1QWYA 1Q90A 1GUTA 2AWNA 4B8TA 2Z6KA 2N49A 4IUPA 4PZ8A 2YQRA 2BH8A 4QMGA 1KRTA 2KHIA 1IHZA 3BDLA 4RHSA 2R92H 1VQIA 4WORA 5IP7H 3H0GB 1CSQA 1U9RA 2VQFH 1XPUA 2ICIA 4HAEA 4KTAA 4HIMA 2DGYA 3BYYB 4C2MH 2K75A 1V43A 5ELDA 3A8JE 3EJIA 3VR5A 2RA4A 2E76C 2M00A 1Y69U 1QVFA 5EQ0A 2E2IB 4K2LA 3KBXA 4J15A 2UU9H 4B3ML 3GTQH 3NEMA 3L7ZC 3I4MB 2CTLA 4A3JH 1IKLA 1V9NA 1XMOL 4A3MH 4K6LA 1EL0A 4B3RH 4ZKCB 1Q1EA 2AQ3B 2IL8A 4OEMB 2KCTA 3RLNA 1GUWA 3M4YA 2BA0A 1K8OA 5CBAE 1GOZA 2J7ZA 2N3SA 3CCVA 3AMUA 1XJVA 4AYBB 3J80L 1TVXA 3PUZA 3TSSA 1SNDA 4A3IH 3CQZB 5ELFA 1PXUA 3TN2A 5CC4A 2JN4A 3PIP3 3UDFA 1MD2D 1ILPA 4JI8H 5EBCA 2OQKA 3I70A 4KK7A 5M3FB 3S15H 4BS9A 1SYBA 2VL6A 4AH6A 5LMNH 1VDZA 3ULPA 1SE4A 4A3DG 1QZGA 4A93G 4M1UB 1L2FA 1SAPA 3WOEA 2IHEA 1JJGA 4LFBL 3TS2A 2PQAB 3S1RB 2CPMA 1K8AC 4A3BG 1JB7A 4GKJQ 3ITPA 3T1HQ 4DUYQ 1BBXC 4LAAA 2IX3A 3ICEA 1AN7A 1QOHA 1EY7A 5CV4A 3RNUA 3M4OH 4NW2A 2BDOA 2UUAQ 3PF4A 1YBYA 4DR2Q 3A5ZB 1VQJA 2ZT9C 3I4NB 5C5LA 2K5HA 1FNVA 1TT2A 1B8AA 3UDGA 3GP7A 1KABA 3KOJA 2Q2TA 4PQXA 1JB3A 1FJGL 5IYBG 3S1MH 1IW7D 1GUOA 4J6HA 4C3JB 5IIFA 1KDAA 1EYGA 3K5OA 2E5LH 3V05A 2O5IC 2K5DA 3SEBA 1VQBA 1N33H 4K0KH 2E2HB 2RSOA 2L5TA 3CMAA 2A6HD 4HCEA 1XTCD 2QW7A 3HOZH 1PFNA 2HT1A 1BQQT 5ELOA 2L1BA 5EPKA 3Q0AA 1R4QB 3A54A 3J80W 1DOMA 1K3RA 4IFDI 1JQYD 4YHHH 1CT1D 1ONLA 1V8CA 5I9PA 3U50C 1E7ZA 4K14A 4B3TQ 1SNOA 1X6OA 2CTKA 3KF8B 4A3KG 4RGMA 5JJIA 3NENA 1DZ1A 1AZPA 2M2LA 1Y1VB 4RWSC 2D5DA 3EQLC 1GO3E 3NELA 1RF2D 3H0GH 3NUCA 1WYDA 3KDFB 5M9OA 4GNXC 4C3HG 5L37A 1EIGA 4IPHA 5K5PA 1GJXA 2F0NA 1GM5A 4JI3Q 1U4LA 1E2ZA 4MHEA 1GVPA 1CTMA 4IPCA 1EYCA 3E0JA 1XMQQ 1O7ZA 2K5QA 1X3QA 3E9HA 3RD4A 1MIUA 1F77A 5M5YH 4JI2H 4B3SH 3F2UA 4PMBA 4DR4Q 1EUJA 2KJXA 3I4MH 3E6ZX 4X65H 2ENBA 4PG3A 1E1OA 3MEFA 4OWXB 2O2LD 1EU4A 4HIDA 2JA7H 2K1BA 1VQDA 4FO2A 2NWGA 1WVNA 1ZZKA 4RAUC 4X3SA 3TP8A 1O78A 1JMCA 3ERQA 4PZ7A 4TQUS 4X3TA 3OSSD 3TS0A 1DTJA 3QB3A 1PTOF 3MAQA 2NZ1D 3D6CA 3GTPB 4FF4A 4DV3H 4RGTA 1B3AA 1TWCH 3KF6A 2YV5A 2BE5C 3K5LA 2MJ8A 2B2VA 4Q5VA 2L55A 2F0QA 4EQPA 2OWOA 1I94H 1JR0D 1J5KA 4RCOA 1BF4A 1A2TA 2WP8J 4S3SA 3S2DH 2D9UA 1V8QA 1HXYD 2F52A 5FK9C 5H1SE 2V1CC 1MHWC 2B2UC 1D7QA 3FRPB 1NUCA 3KJPA 3KFUA 2ZM6H 1IBMQ 4A3FG 1PTOD 4AYBE 1KHIA 1I50B 1PFMA 4JOIA 1XRHA 3KLSX 4G7HC 1MSZA 4TSSA 1JWMD 1C7YA 3TRZA 1NSNS 4KY6A 1JICA 3K7AB 2VQFQ 4GZYC 1WFQA 3GQBA 1X3PA 4P73A 1G2TA 3NXWA 1IXRA 3C1FA 3I3CA 2OQ0A 3PIPA 3KLWA 5LMUH 3GTMH 4GKJL 1JWUD 3K59A 4DUYL 2WAQB 1FGBD 5I6YA 4X62Q 3S1QH 2F0TA 5FLXE 1EQQA 1G6PA 2RCNA 1AN8A 2KENA 4DR3Q 2SDFA 2UUAL 2XWJB 2FPHX 3UDIA 4DR2L 5E7NA 3J81i 1D2BA 5M3MB 1RL2A 1EOTA 1JT8A 3J7AK 2I07B 3ER0A 4PDBA 1ESFA 4O0AA 4LF8H 2H1EA 3PSIA 5C5MA 1S40A 5IYDG 1CFMA 1QJOA 2X69A 4DV6H 4NZTM 2QEXA 1K0SA 1VF7A 1X55A 4DK3C 4NZRM 2DY8A 2WB1G 4P75A 4ZKBB 4C3IG 4GOPA 1FGUA 3CCJA 3HGBA 4E6IA 3IFTA 3DM3A 2XGTA 5DNFA 3CRKC 1HRJA 4KKSA 3VR6A 4HJ5A 4OCHA 3FEWX 1UG8A 4HIOA 4BA1I 1S72A 4XT1B 1EY0A 1EEFD 3JAME 1PV4A 2D62A 1QUQA 4A3CG 4B3TL 2H5XA 3R8BA 2NVXB 2A1SA 2UUBQ 1W6KA 2QNDA 2NYZD 2SNSA 3HOVH 4LFCH 2QCPX 1II3A 1D1KA 1Y1VH 2PY9A 3EN2A 3C46A 1P8LA 1UE6A 3TBIB 3PMFA 4IUNA 5FKAC 3HOYB 2K6AA 1ZZIA 1Q1BA 1PYWD 2VUMH 4JI3L 5IE8A 2HHHQ 1VMPA 2IW3A 1ASYA 2PZTA 5CV9A 4A75A 2F0LA 3OTOL 1S5DD 2JVZA 2R92G 2L15A 5IP7G 1V1PB 4DR5H 2KVMA 1B4OA 4RG1A 3F1ZA 3E0EA 5JEAH 4DR4L 2BL5A 2EXZA 5IGCA 5COYA 5EBDA 4A3GH 2F0PA 5D65A 2A8VA 3ERSX 4CKEA 3DWAA 2B2WC 5LL6X 3VDYA 2JA6H 4DR1H 4LF6H 4KKTA 4UY8C 1KHMA 1IYUA 2BA1A 2LY7A 1TS4A 3K0YA 2ZTEA 2ANRA 2Z0SA 4A3JG 1K0RA 1RD9D 2YU9B 4A3MG 4LWCA 2FMRA 2HQEA 3A5UA 5IWAH 4QIWB 1QNUA 3KDKA 4DGZA 2R7DA 4GS3A 2ID0A 2DGRA 3NK9A 1NCVA 5JJLA 5IY0A 4BY7B 1C48A 2R93B 2NVYB 4IFDJ 4A76A 3UOEA 1KIXA 3MA2B 3X3NA 5C0XI 3A7AB 1EQVA 1MGSA 2DJGC 2LMCB 3URYA 4A3IG 4DNRB 1IBML 2I5LX 4KV6A 5KNBA 1XPOA 1HNXQ 3MTSA 3J7ZC 4DU9A 2EVBA 5KEEA 3SE0A 4NMZA 4R8IA 2L11A 5DAUA 2VQFL 5EPLA 4RKBA 2F0JA 4OIKA 1QVGA 1L1OA 1EY6A 2PYKA 3FKIB 4YY3Q 5FLXc 4JI0Q 4ME3A 3BDCA 1CA6A 1TWAB 1TWFH 2B2YA 4DR3L 2A68C 2ATWA 2F4VH 4XIGS 5IT9L 1VQEA 4K8JA 3J7AV 2EYFA 1U5KA 1O7IA 4X65Q 3D3RA 2KCCA 1CA5A 4B3RL 4AQYQ 3I8ZA 1N9WA 1ODHA 4JV5H 1XTDA 1ZEQX 1NTGA 2AHOB 1RODA 3CD6A 1HZBA 4X64H 4LF5H 5HURA 2WAQE 3NWTA 5C4JH 2E3UA 4AM3A 1STAA 1VCIA 1HZ9A 3FVQA 2NN6H 1QUQB 1Y8OB 1Y14B 5NUCA 5J22A 5I2XA 3T1YQ 1A8VA 1GHJA 1SNCA 1IBLH 4K5VA 1STHA 2B8FA 1AP0A 1Y1WB 4IPGA 3JAMc 1KNAA 5HGTA 1LTID 1WCMB 3OPOA 1DONA 3DLLA 1Q82C 2HH2A 3HOZG 4R4QA 4DUZH 3QIAA 3QOJA 4EQ5A 4DV0Q 4KI0A 4ODGA 1D5MC 1VQ8A 3HOXB 1SEBD 4TRDA 1PZID 3K7UC 1LYLA 5LMUQ 1HZAA 2ZTCA 1E2VA 3TREA 1I5FA 1NY4A 2HHHL 1TWHH 3BG3A 3GTKB 4FXDA 4HCSA 1PTOB 3CAMA 3SHLA 2A5HA 4QUFA 1Y8PB 2ZJPA 1IBKQ 1BXTA 3J81L 3H0GG 2CVRA 4BBSH 2YYZA 1WTOA 1G51A 3T51B 3PO3B 1HZCA 2UXBH 3D0FA 1B9MA 3QO2A 4DV2H 4G7ZC 4BY1B 4CGYB 2PMZB 4FJUA 5M5XH 1SBBB 3W3AA 4B9XA 1MJCA 3R2IA 1SYGA 1SN8A 1CKNA 2LXJA 1KC8C 4OX9H 2AKWB 2E5LL 2M8WA 1S03G 3I4MG 4GN3B 5CV7A 2P2RA 5IODA 1N34H 2MGSA 1HHVA 1QVCA 2A19A 2MP1A 2YU9H 2JA7G 4JBKA 5ELCA 1E3PA 2CWPA 1PA6A 2K28A 2B2TA 4A3EB 1BNZA 5I6WA 4L6TB 1VQLA 4JI4Q 3G71A 2F0DA 2QDLA 2XTIA 5KGUA 4LIJA 2XIWA 1CQFA 1N36Q 2CFMA 1SLJA 1LT4D 3W5OA 5E4WC 5CMDA 2R93H 4ABNA 3BZKA 1ET9A 4LFAH 2KUMA 1LTLA 2BOSA 2EY2A 1DOKA 1EIFA 1RTOA 3OWEB 1PFBA 3PUVA 1HNXL 1J5EH 1Q12A 1X3EA 3PQIA 4IJHA 2PNHA 2RDHA 3S14H 1MKHA 3NP8A 1XNQQ 3PF5A 5BN3A 4IPDA 4OGQC 2R61A 2E75C 1STYA 2IX0A 3VA5A 4F88A 4JI0L 2K50A 4YCUA 3DEOA 2NZOA 1QCBD 2MO1A 3GTJH 3BZCA 4NDXA 2CCZA 1EZ6A 3NBHB 4CKBA 3CC2A 2VY3A 1HH2P 2A6EC 4F7XA 5CR3A 5C4XH 1B2TA 4LF4H 4DKAC 3U4VA 1X65A 3KYHC 1RIPA 1DGSA 4WJWA 4X65L 4JI6H 4BBRB 1G91A 2PCFB 4GN5A 3CCSA 2PW7A 2H4OA 4X66Q 3LX0A 2KHSA 3OOCA 1T5XD 2CKZB 4ZCKA 1ICFB 1T5EA 4ZLTF 3P75A 2Z6KC 3J81W 1HQRD 1B50A 2CWHA 4OL7A 1I6UA 2MHVA 3DMUA 2MNAA 3G7LA 5IWAQ 2G5DA 3HZXA 3HOWH 4JC0A 1JC7A 5EKLA 2KOLA 3T1YL 5T1GA 1HJPA 1OXVA 3M4PA 2JA5B 4JCVE 1EY4A 2R7ZB 5C0XJ 1EY9A 1VQPA 2B63B 1GHKA 1NAPA 3KK7A 3E5SA 4JI5H 4KN4C 2NVTH 1G291 4KHPQ 1RKNA 4ZUJA 4KD3A 1SRUA 3W2DA 3KF8A 5ELEA 5J3BA 3R3OA 4DV0L 2G9DA 1HNZQ 3PO2B 3IL8A 1KAAA 3GDEA 1U4RA 4CDCC 1H9RA 3HOXH 3HKSA 3KDFA 4CDFC 2Y3MA 5LMUL 1K3BC 3STBD 2UXDQ 4FYDA 3J7YW 1VQCA 2B29A 4LUOA 1LM0A 1WTHA 1ZYRC 3MZ5A 3CCQA 1CKNB 3HOVG 1IBKL 1AE3A 4HR7B 2X6LA 4IN3A 2F4VQ 1Y1VG 2XSCA 2IY5B 3K80C 4LW1A 3S1NB 3QG1A 2L12A 4DPGA 4U673 2RHSB 4X3UA 1IZ6A 4KD4A 1L0WA 4LF9H 1M90C 4EQOA 2VUMG 2J0TD 3OMCA 4LF8L 3HOUH 2EYJA 2K52A 1OXSC 5GAGC 1M8AA 4JYAQ 5C44B 3EFXD 4LF5Q 1V9PA 2RDFA 1I3QB 1SFOB 5JEAG 4RFBA 2Y0SG 3X3MA 4DV1H 1UWVA 1SDFA 4A3GG 5LL6b 3K81C 4XYOA 1H9MA 3S17B 3LNNA 4YCWA 5EKIA 4NXNQ 4JI4L 2JA6G 1A15A 2JA8H 3GTLH 4QJFA 4ZRZA 2PMZE 4NXMH 1N36L 2UXCH 2XRSD 2AQ2B 2RDGA 3I4LA 3M85A 2F0EA 3K0XA 4KN7C 1WVLA 1CI3M 2ALYB 1YJNA 1K83B 3OWFA 4FJSA 2MPMA 1XX8A 5BR8Q 4R1JA 5D3IB 2C9OA 5F2DA 2CTMA 4LFCL 3GTOB 2JE6I 2K5WA 1XNQL 4WFN3 4GLVB 4JPBW 1YJ9A 3QJYA 2K7VA 2EYMA 1B9NA 2MQHA 4OWWB 3UE0A 4DV4H 4DR6H 1BBWA 1I4RA 3CCRA 2SEBD 1FKAH 4ZK9B 2Z4HA 1R9TH 1CZGA 1PHJA 4WANA 2AMCB 4DR5L 2BE5D 3L3OC 3Q22A 2NN6I 3MXUA 4GLXA 3KLRA 3RZOH 4DV2Q 1VS0A 1SE8A 3NTHA 1BR9A 3MHBA 2DNEA 2ZXPA 5C4HA 4X66L 2K5NA 4DR1L 4DR7Q 1XXGA 2EJGC 3K5MA 4K6DA 2VQEQ 1AEXA 1WTQA 1Z6HA 3Q8DA 1A62A 1SROA 3PIO3 1HNWQ 5K36H 2A74C 3S16B 5IWAL 2F0IA 2FFMA 4RCNA 3W1BA 4H44C 2HCIA 2K01A 4DV5Q 3MVVA 2HDMA 1EYDA 1HTLD 1HUNA 4LF7H 1N32H 1NMGA 1LABA 1KNEA 1ICWA 1NJIC 1IL2A 2NN6G 2HUGA 2UUCQ 4KHPL 1UNSA 3I4OA 1LLRD 1WD0A 3F2DA 4HSVA 4CJ2C 4KMUC 3OTOQ 1TR5A 5KNDA 1HNZL 2E2IH 4OO1H 1YNJD 3M3YB 1BCPF 4XXEA 1OXUA 3VYSA 1VQ6A 3I90A 1MBYA 1S5FD 2C35B 3SK4A 4LNQA 2UXDL 3PV0A 2MUYA 2QKIC 2GN5A 1GKHA 4DAYB 4DXGA 1ENAA 4YIJA 2K32A 2NZHA 2K33A 3D4WA 5G3LF 2JJQA 4FF1A 2NUCA 4PMCA 1G2SA 2F4VL 1CZWA 1V1PA 3EVQA 3DXJC 2PO4A 3VR2A 3BS1A 3ZJYC 3W1GA 1Q8KA 2LFNA 3Q24A 1TWGB 2HH3A 1BCPD 2O4XA 2B2VC 1JOOA 3CQZH 1DXMA 2HIVA 1KD1C 4A93B 4IUVA 4E9JA 2F0HA 3AQQA 2N55A 3CF5A 4JI7H 4JYAL 1CSPA 2D2CC 4LF5L 1QZHA 3H6MA 4BBSG 5M3FH 5G3LD 4C1NK 1HFGA 3QR8A 3DWPA 2SNMA 3KUPA 4JOIC 3RZDB 4A3BB 1IW7C 3IFDA 3S17H 4NXNL 2KA7A 3ULJA 1EWCA 4LUZA 2DY7A 1PH1A 3FPPA 2LKVA 3DM1A 1J9OA 3K58A 2A6HC 1SE2A 4UP7A 4NKLA 1DJRD 1A3UA 3S1RH 1ESRA 1A6XA 3KLSA 1STGA 4KY5A 3MXNB 5BR8L 3NSWA 3CPWA 1LV9A 2VB2X 3PCOB 2X06A 2UU9Q 2R93G 1F2MA 2ASBA 1SNPA 1IKMA 2IWHA 2LRRA 2K05A 4B3MH 3I4NH 2I5MX 4B3RQ 5CGKA 5A2QL 1SMXA 4BA2I 3DEPA 3RF2A 1NMFA 3MWYW 5CV6A 3A7LA 1A63A 2R6GA 3AEVA 4C3JH 2F0GA 4GOPC 3J7AF 3H3VH 1FL0A 2EYHA 2OTJA 4MN3A 2FINB 4HJ9A 1KXLA 3S9WA 3H09A 2E2HH 4L5QA 4DV2L 1V1QA 1LT6D 2M6QA 1ZZJA 5M5WB 2EPBA 1DYQA 3N52A 4XYQA 2AWOA 2F0MA 4DR7L 1I6HB 2KEEA 1J8IA 2VQEL 5C4XG 1JJCB 3TZDA 2PI2A 2N8NA 4JI8Q 3OMGA 3OW2A 1VQKA 4NP5A 3V2TA 4DAVA 1EZ8A 5LMNQ 1HNWL 3CKIB 5JVG3 2RSNA 4DV1Q 1D5XC 2K5VA 1IYVA 2CHBD 4C3HB 2CH4W 4U68A 4DV5L 3MXGA 2CTFA 3FHWA 3J80E 2Q8TA 2KCNA 2O4CA 3K57A 3CCUA 1YNXA 2EE1A 4DA2A 4LJZC 4LFBH 1OXXK 4R9WA 3OETA 4XQNA 4LFAL 1S5BD 1JCKB 1QE6A 2UUCL 2PQUA 3HOWG 1LTBD 2Z4IA 3A55A 1MI2A 5C3XA 3PIOA 4GNXB 4RMFA 4C1NI 3NCVA 4HSPA 1WTWA 1O7YA 3R2TA 2XNAC 5J39A 2NTSA 4DAPA 2NVQB 2VB3X 1TXYA 4GKKH 1OXTA 2FJ2A 1S20A 5T1IA 1I4QA 3U1KA 1PTOC 5IGEA 4BWGB 4WJ3M 4CJ1B 2KBNA 3B6YA 2HDLA 3CU7A 2C5CA 2YTXA 3TQYA 2D0PA 3MC0B 3UI2A 4LF4L 1FJGH 2E5LQ 4KKUA 2RF4A 1M1KC 1I4XA 3HOXG 1N33Q 2DUDA 3OYYA 4K0KQ 5I9OA 4JVYA 5J1ZA 3GTPH 3R93A 2OTLA 1ENFA 2JQOA 5A2QW 5CV5A 4CJ0B 1SXTA 1TKWB 4A3FB 1YHAA 3NQIA 3ND9A 4DNTB 3EA6A 1YNND 3DHQA 2EXDA 3BU2A 4DV7H 2EOTA 4YHHQ 3FAUA 2RQXA 2Z1CA 3A56A 5I2YA 1BKBA 2WINB 1EU3A 4O2DA 3HOUG 4QCLA 4L5TA 1I50H 1QNKA 1FYCA 1FNWA 4Y7NB 1L1OC 1N32Q 3K7AH 1TY2A 3BYTB 4K2KA 1SYDA 2A69D 4R8NA 1SMYD 1ASZA 2B2YC 4TVAB 1VQ5A 2JA8G 2CPQA 1KLUD 3I2ZA 3AEVB 3C2PA 3CW2C 1PRTF 4LK1C 1YITA 1PH3A 5AJ3Q 2UU9L 4B3SQ 4JI2Q 3VYTA 1O80A 1VQOA 2F0KA 3M4QA 4IUTA 1A3TA 1B3QA 1F9PA 4JI1H 3AFQA 5M3MH 2WB1B 3I0PA 4C3IB 1BUVT 1IL8A 1H9KA 4R4CA 3NBHA 3HKZB 3OIQA 5C3EB 3JAMi 5IOCA 3HS0C 4KLKA 5JJZA 1PRTD 2X6GA 1H95A 4FVMA 4J1MA 5FO9B 2ZXRA 4DV3Q 3L9AX 1WTVA 4DNIA 3I55A 2CW0D 3HEJA 2ZJRA 1I94Q 1I6HH 1D1IA 1SR3A 3GTGB 4JI8L 5IGDA 2F0SA 3DWQA 1WI5A 1WOCA 1EQTA 1C8CA 5LMNL 4H0LC 1BCPB 5C6AA 4DV1L 3V96A 2NBFA 3BVZA 4DAMA 4FXGC 4J8QA 2ZM6Q 2NVXH 3J80c 3P7JA 4OO1I 4N8X1 4OHJA 4RHRA 3IKJA 4NXML 2UXCL 1KQSA 2R92B 4JVZA 3MFYA 2I5HA 5K36G 3HOYH 4BXXH 1KDCA 4ID6A 4C2MB 4GKJH 3T1HH 3M9BA 1SYFA 4DUYH 3NWSA 3VR4A 3VYUA 4CBVA 4IFDH 3GR5A 4K5WA 2HIXA 2LS01 3F2BA 1YIJA 1K1GA 1P16A 2GVBA 2R3ZA 1EY5A 3GTQB 2UUAH 3TP5A 3CC7A 4ME5A 4DR2H 1Q8IA 3SR1A 2PPBC 4DR6L 5FJ8H 4XDXA 4A3JB 4KJNA 4POFA 4A3MB 3SK6A 4LF8Q 1WJJA 3RUZA 1D5ZC 4HIKA 4ZYSA 4MNOA 4DV6Q 4OO1G 5IT9W 3D6WA 1W6JA 3A8KE 1N33L 2F3VA 4K0KL 2B2TC 2JXMB 4MZ9A 3PGZA 5GADC 3CC4A 3HG9A 2LXKA 2GA4B 1FNUA 4A3IB 3IAYA 5I4DA 1JJ2A 1GUNA 5DT9A 4BY7H 1Q81C 2NVYH 4AYBG 1PH2A 1VMCA 1A0IA 3GKUA 3S15B 5IP9H 4IZ8A 1K8MA 4JK1C 4YHHL 3KBGA 1GD7A 1I4PA 4DK0A 4IUUA 3D4RA 1B70B 4B3TH 3G48A 5GROA 4XQQA 1G6ZA 3NHHA 5C44G 1EWIA 4LFCQ 3RMHA 1OO9B 4QIWE 4QMFB 3BVGA 2OXPA 5M3FG 4LF7L 4FF2A 4Q0FA 1N32L 4PV1C 3T56B 1B53A 5LMNW 1NR4A 4I65A 2EDGA 1L0YB 1F9RA 4YCVA 1Z9FA 3FKIH 4V190 3BZDB 4JI3H 3GV3A 2EJFC 1TWAH 3H3VI 1AH9A 2F03A 1PZKD 5AJ3L 4DR5Q 4B3SL 4JI2L 1XMQH 3HP3A 3M4OB 2ES2A 2D9IA 1PYBA 4X3KA 2VZAA 1X54A 1YEZA 3IRBA 4DR4H 1UAPA 1YZ6A 1X4MA 1CK1A 3NQTA 3VR3A 4JBMA 2WKCA 1SYCA 1PVOA 1SE3A 1C0AA 5EJWA 4DR1Q 3H3VC 2BCOA 4LF6Q 4A4IA 1VQAA 3S1MB 1ET6A 2GVAA 5C3EH 4G57A 2IPKD 3DUZA 3U4ZA 4KY7A 1LO5D 1E2WA 2PZUA 3I4NG 3SK5A 3FP9A 4EC5A 4QY7A 3S24A 4DV3L 2RBMA 3GO5A 2CWAA 1PH9A 2I46A 4G4KA 3A8IE 1I94L 3HOZB 2IX1A 1D6EC 4JI7L 4X6AH 2JA9A 4OONA 4C3JG 5EPJA 1Y1WH 2FXQA 3ZYYX 4JW0A 1EFWA 5FLXL 1PFSA 1Q3LA 1WCMH 4F8MA 4DV7Q 2N88A 2PI2E 3HKZE 1NR2A 2ZM6L 2RVLA 3Q6SA 1E22A 1AW7A 2KEDA 5D14A 1IBMH 1Q46A 3ULLA 1KRSA 4UP8A 4CKCA 4NBQA 3WOFA 4QUCA 5ISRA 1MSHA 3C1EA 4L5SA 2JZXA 4I7AA 3GTKH 3HFZB 1PTOH 1Q86C 1BO0A 2VS1A 1M4VA 4X62H 3P20A 2MFIA 3BJUA 1YHBA 2Q2HA 4DR3H 1EQRA 5DLQE 5M5YB 3PO3H 4JI1Q 2EIFA 2EY1A 1X9NA 4BY1H 1DD2A 3TMEA 2QILA 3GD7A 4PZ6A 4DAYA 2P5ZX 4KHZA 4JV5Q 2JA7B 3JAML 4DV6L 1RCVD 4X64Q 1EC6A 3D4DA 2E2JB 1HR0H 3KDGA 1PMRA 2ANNA 2E74C 4A3EH 4KJOA 5IT9E 1TWCB 2A73B 1IBLQ 3M7GA 5C3WA 3CXCA 1WTXA 2Z8LA 4K5XA 2F1MA 3UE1A 1W3SA 3S2DB 4CDEC 1PRTB 3CHBD 2KECA 1SJED 4N9PA 1DOLA 3U9SA 4PNYA 3NBIA 2K04A 2ZXOA 1TS3A 1TQOA 3OHXC 1S4ZA 1ZXTA 4Y52H 1WE8A 4DUZQ 1EIYB 2Z6BA 2UUBH 3TP6A 2F0WA 2WKDA 4ZQ3A 3VYRA 1F9QA 4JBWA 4DFAA 2JK8A 5JVH3 5FLXW 2Z9HA 4FP5D 1W2BA 1XWEA 4A3LH 4WRDA 2XRQD 3MXNA 3GTMB 2F0UA 1X3FA 3D31A 5FO7B 5EKKA 5C0XH 3CMEA 2HHHH 3S1QB 3PUXA 2TMPA 5E3FA 4IOAA 4GKKL 2UXBQ 3E3XA 2BDNA 4BBRH 2FMMA 4ZAIA 3EZJA 2WAQG 3K8AA 1RJTA 1TU2B 2KQ3A 4QGUA 1PH8A 1XNRH 4OIJA 2Q2UA 4LF6L 2MO0A 3AB9A 5E1FA 2L0CA 1F2YA 4OX9Q 5LL6S 2XN9C 2KHJA 4XT3B 2K4KA 3STBC 1VQ7A 3AYHB 2DN8A 5M3MG 1N34Q 4UHVA 3OIPA 1E0BA 5DEHA 4LMQD 1T9HA 4M8AA 3AU7A 3J81E 2QF7A
chains in the Genus database with same CATH topology
1Q7YC 3RLOA 2EJMA 2JA5H 2R7ZH 1QB5D 3ND8A 3FMCA 2B63H 4DN4M 4LFAQ 4DV7L 1K9MC 2EYOA 1U4MA 3RN2A 4H02A 1JE5A 3SDZA 4ZUIA 1EY8A 4Z9CB 3AFPA 1J5EQ 5DM73 4PMWA 3V69A 1Z47A 4P74A 3PO2H 3VA7A 3HOVB 1YHQA 3PUYA 3F2CA 4K8IA 1DT4A 2E2DC 1LTTD 1L0XB 1SNMA 1SSOA 1U0LA 4QL5A 4WJ4A 2EQSA 5BN5A 2VUMB 3WWVA 2EZVA 3P1HA 3K5NA 4GNXA 3NTKA 4LF4Q 1GUGA 2WV6D 3S1NH 2WIIB 1WD1A 3HOYG 4JI1L 4JI6Q 4BXXG 2XWBB 1BOSA 4QQBX 2Y0SB 3E9IA 1N8RC 4A3DB 5GAEC 4A3GB 1A2UA 2L9HA 4JV5L 3A74A 5KIXA 4IFDG 3TP7A 4FDBA 2IT1A 2JA6B 3UDXA 4X64L 1HUMA 5IYCH 3G6JB 5C44H 3G4SA 1BVSA 2DNCA 5JPMC 2E2JH 1I3QH 2WFWA 2OPVA 1SFOH 5KNCA 4G7OC 4WALA 1YVCA 4RH6A 3D8GA 4UPAA 5FJ8G 1EYAA 5IT9c 2G9HD 2PQEA 1STBA 2XVSA 2F0VA 1X56A 3SXHA 5IGBA 3U9OA 1IBLL 2R7FA 4R4IA 5KYLA 2OT2A 2FMCA 1X32A 4JI5Q 4JVHA 4XQJA 1LTRD 1EIHA 1JE4A 1K83H 5JEAJ 1TY0A 2QA4A 3RR5A 1EWHA 2O5JC 4DUZL 2IJ0A 1PH6A 5HGQA 4BY7G 2B2UA 2RHQB 3GTOH 3QOLA 1K8GA 5CORA 2AXYA 1CHPD 4IURA 5IP9G 1V1OA 1GXDC 3H91A 1WTPA 3MFGA 1H9SA 2CQAA 2K03A 1UEBA 1FD7D 3FDTA 1AZQA 3H94A 1A3VA 2TSSA 3T1HL 2A1AA 1PH4A 5KYIA 2JEBI 3S2HB 2PNRC 4IUQA 1UE5A 1KLGD 1AE2A 1JOQA 5IGFA 2E8GA 4R4TA 1TWFB 4UAIA 3LGJA 4P72A 4IOCA 2UXBL 4RKLA 5ELBA 1B1ZA 5FLMH 4LF9Q 1UE1A 2F0FA 2MJHA 3FKIG 5CBEE 5JAVA 1YNJC 1S3OA 2CQOA 1LTSD 4DK1A 4A3KB 4KHVA 5A35A 4OX9L 3FPUB 2HQLA 1STNA 4P71A 1HR0Q 1OTCA 3NE5B 2EYPA 2JYOA 1N34L 5C4JB 3S16H 3J81c 1HTPA 3ONAB 3TDQA 1CKMA 4ILWA 3I56A 1RTNA 4MTNA 4GLAC 5C4ZA 4NXMQ 2UXCQ 3HKZG 5C3EG 5D3DA 3T13A 1BCPC 4F87A 2F0OA 4HTHA 2QGQA 5KRUA 1VQNA 4QB4A 2A68D 4B9WA 4L63B 1XYIA 1HQMC 1J5EL 2SOBA 2F4IA 1B7YB 1VQFA 3VKEA 1Y1WG 2VNUD 3M3YH 2IHFA 4L5RC 4FF3A 2B39A 2PZWA 4ULLA 2YTYA 3I91A 3O13A 3T4AC 5TSSA 1LTAD 3MEHA 1TS2A 4I7ZC 1WCMG 4DV4Q 3HRZC 4DR6Q 1I4GA 1S5CD 3CP0A 2HCCA 4APVA 1TWHB 2VW9A 4YWLA 1HA5A 3A0JA 1LT5D 4POGA 1LTGD 2OCEA 2F3IA 3L2PA 5CV8A 5GQOA 1XMQL 1FVIA 1NBWA 3JC66 4CHTB 4BBSB 2Q8IB 1TWGH 4JI6L 4QF4A 5DM63 2ZTDA 4EX5A 2B8GA 2NB0A 2KCMA 4A3DH 5M5XB 4A93H 1XNRQ 3N6RA 3KF6B 2D0OA 2LSSA 5FO8B 3CCEA 3CRLC 1CM9A 2B2WA 3T16A 4EQNA 1D8LA 3PO3G 4HEDA 1VQ4A 3MXPA 4BY1G 1NE3A 3RZDH 4A3BH 4LUVA 3H15A 1AFPA 2Y0SE 4V0BA 1WTRA 4LF7Q 4JI5L 1E1TA 1E24A 1H9SB 3LWEA 1YI2A 3J81j 1VQGA 1U4PA 4A3EG 3BDOA 4H13C 1SJHD 3SVMA 4HMJA 1Y8NB 1VQ9A 1YJWA 4RGNA 5IYBH 1JOKA 1SNQA 1JWSD 3S14B 1CUKA 1LACA 1G8ZD 2BH2A 1PLFA 4R4OA 1LUZA 2JEAI 4EVOA 1CKOA 3GTJB 2NTTA 3S2HH 4X62L 1I4HA 2ZJQA 3L0OA 5C4XB 1TS5A 1STEA 4UP9A 4O1NA 4LF9L 4A3LG 1VF5C 4GOPB 4FNFA 3WDNA 3LWUA 4AIMA 3PUWA 2Q2IA 5M5WH 3J80i 5C0XG 4OWTB 1EFID 2EY6A 2FHTA 1DCZA 4JI7Q 1HPCA 1DM0B 4A3KH 2JSOA 1C4QA 1HR0L 4O42A 1FR3A 2B3GA 3K6OA 1TIID 4BBRG 1UE7A 1XPRA 4N9TA 5BN4A 3RN5A 4ALPA 4C3HH 1VIGA 1CHQD 2EY5A 5EGTA 3HOWB 5LHY1 1PH5A 3CPFA 4HN7A 1QG7A 2N78A 4DK6C 1MSGA 1X3GA 4XTCS 1C9OA 1J6QA 3I7FA 4IQZA 3J7A5 5GAHC 1VIHA 2A6ED 2I0QA 1UUPA 4C56C 2NVTB 4B08A 3GV6A 4IO9A 4DF7A 2JA5G 1B44D 2UUBL 1YNNC 2R7ZG 1RHPA 2B63G 1R4PB 1Z7TA 2F3WA 3NPPA 1VQMA 4B3MQ 2QDBA 2NVQH 1K73C 4RA8A 2Q8RE 3KJOA 4DV4L 2CTEA 2M9VA 4L8JA 1HFNA 1XMOQ 2EYLA 1KDBA 2AUKA 1F2ZA 3BVMA 4IJLA 2WACA 3QWNA 3PO2G 4NB3A 4YWKA 2JP1A 2A69C 4HMIA 4JBJA 1CQVA 3T53B 1SMYC 2QEJC 2L4NA 1QILA 2ICEC 4OXPA 3M7NA 1S5ED 1ZKOA 1XNRL 1PZJD 3HOUB 1PDQA 3I72A 4A3FH 2OEOA 3CCMA 3SK8A 2K14A 4UDUC 4P2CB 5JOBA 5A2QE 4IALA 1KAWA 4HJ8A 2AQ1B 4MIUA 5JJKA 3EIVA 1J4WA 5FOBB 1PH7A 1X4NA 3SGIA 1EOVA 3I73A 1ENCA 5ELNA 5IYCG 2JA8B 3GTLB 1PYSB 4FXKC 1PRTC 2FFKB 3RLFA 2V4DA 1HA6A 1RDPD 4Y7NH 1VQHA 1HR0W 4RGOS 4LFBQ 1ZTGA 1ZYRD 3G6EA 2CW0C 1ML0D 3EBEA 5CYUA 3U58A 1L1OB 1KL9A 4JG2A 1O7LA 1H9JA 1EEID 2OPUA 5HY6A 5IYDH 1BDOA 2RKSA 3TZUA 2YTVA 4YWMA 4GKKQ 1F2LA 3OSOA 5E4XA 5AFWA 2PQAA 1I6VC 2OF1A 1IYJB 4C3IH 1BBUA 5EAYA 1SYEA 4HJAA 4YY3L 3Q23A 3OW7A 1R9TB 3TEHB 1FJGQ 1KTKA 3C3LA 5JPNC 4GN4B 1GUSA 5IGGA 4TKOB 3RZOB 1F9SA 2J4XA 4DXFA 1HCZA 4A3CH 4AQYL 2WB1E 1UEAB 3EROA 3GTGH 2VXWA 3CCLA 3F8TA 1ILQA 2AUJD 1LT3D 4H7BA 4HJ7A 4EGVA 1JORA 4NPSA 5FLMG 1TUAA 3NTIA 2PW5A 1MJEA 2CTJA 1QWYA 1Q90A 1GUTA 2AWNA 4B8TA 2Z6KA 2N49A 4IUPA 4PZ8A 2YQRA 2BH8A 4QMGA 1KRTA 2KHIA 1IHZA 3BDLA 4RHSA 2R92H 4WORA 1VQIA 5IP7H 3H0GB 1CSQA 1U9RA 1XPUA 2ICIA 4HAEA 4KTAA 4HIMA 2DGYA 3BYYB 4C2MH 2K75A 1V43A 5ELDA 3A8JE 3EJIA 3VR5A 2RA4A 2E76C 2M00A 1Y69U 1QVFA 5EQ0A 2E2IB 4K2LA 3KBXA 4J15A 4B3ML 3GTQH 3NEMA 3L7ZC 3I4MB 2CTLA 4A3JH 1IKLA 1XMOL 4A3MH 4K6LA 1EL0A 4ZKCB 1Q1EA 2AQ3B 2IL8A 3RLNA 2KCTA 1GUWA 3M4YA 2BA0A 1K8OA 5CBAE 1GOZA 2J7ZA 3AMUA 2N3SA 3CCVA 1XJVA 4AYBB 3J80L 1TVXA 3PUZA 3TSSA 1SNDA 4A3IH 3CQZB 5ELFA 1PXUA 3TN2A 5CC4A 3PIP3 3UDFA 1MD2D 1ILPA 5EBCA 2OQKA 3I70A 4KK7A 5M3FB 3S15H 4BS9A 1SYBA 2VL6A 4AH6A 1VDZA 3ULPA 1SE4A 4A3DG 1QZGA 4A93G 4M1UB 1L2FA 1SAPA 3WOEA 2IHEA 1JJGA 4LFBL 3TS2A 2PQAB 3S1RB 1K8AC 4A3BG 1JB7A 4GKJQ 3ITPA 3T1HQ 4DUYQ 1BBXC 4LAAA 2IX3A 3ICEA 1QOHA 1EY7A 5CV4A 3RNUA 3M4OH 4NW2A 2BDOA 2UUAQ 3PF4A 1YBYA 4DR2Q 3A5ZB 1VQJA 2ZT9C 3I4NB 5C5LA 2K5HA 1FNVA 1TT2A 1B8AA 3UDGA 3GP7A 1KABA 3KOJA 2Q2TA 4PQXA 1JB3A 1FJGL 5IYBG 3S1MH 1IW7D 1GUOA 4J6HA 4C3JB 5IIFA 1KDAA 1EYGA 3K5OA 3V05A 2O5IC 2K5DA 3SEBA 1VQBA 2E2HB 2RSOA 2L5TA 3CMAA 2A6HD 4HCEA 1XTCD 3HOZH 1PFNA 2HT1A 1BQQT 5ELOA 2L1BA 5EPKA 3Q0AA 1R4QB 3A54A 1DOMA 1K3RA 4IFDI 1JQYD 1CT1D 1ONLA 5I9PA 3U50C 1E7ZA 4K14A 4B3TQ 1SNOA 1X6OA 2CTKA 3KF8B 4A3KG 4RGMA 5JJIA 3NENA 1DZ1A 1AZPA 2M2LA 1Y1VB 4RWSC 2D5DA 3EQLC 1GO3E 3NELA 1RF2D 3H0GH 3NUCA 1WYDA 3KDFB 5M9OA 4GNXC 4C3HG 1EIGA 5K5PA 1GJXA 4IPHA 2F0NA 1GM5A 4JI3Q 1U4LA 1E2ZA 4MHEA 1GVPA 1CTMA 4IPCA 1EYCA 3E0JA 1XMQQ 1O7ZA 2K5QA 1X3QA 3RD4A 3E9HA 1MIUA 1F77A 5M5YH 3F2UA 4PMBA 4DR4Q 1EUJA 2KJXA 3I4MH 3E6ZX 2ENBA 4PG3A 1E1OA 3MEFA 4OWXB 2O2LD 1EU4A 4HIDA 2JA7H 2K1BA 1VQDA 4FO2A 2NWGA 1WVNA 1ZZKA 4RAUC 4X3SA 3TP8A 1O78A 1JMCA 3ERQA 4PZ7A 4TQUS 4X3TA 3TS0A 1DTJA 3QB3A 1PTOF 3MAQA 2NZ1D 3D6CA 3GTPB 4FF4A 4RGTA 1B3AA 1TWCH 3KF6A 2YV5A 2BE5C 3K5LA 2MJ8A 2B2VA 4Q5VA 2L55A 2F0QA 4EQPA 2OWOA 1JR0D 1J5KA 4RCOA 1BF4A 1A2TA 2WP8J 4S3SA 3S2DH 2D9UA 1V8QA 1HXYD 2F52A 5FK9C 5H1SE 2V1CC 2B2UC 1D7QA 3FRPB 1NUCA 3KJPA 3KFUA 1IBMQ 4A3FG 1PTOD 4AYBE 1KHIA 1I50B 1PFMA 4JOIA 3KLSX 4G7HC 4TSSA 1JWMD 1C7YA 3TRZA 1NSNS 4KY6A 1JICA 3K7AB 2VQFQ 4GZYC 1WFQA 3GQBA 1X3PA 4P73A 1G2TA 3NXWA 1IXRA 3C1FA 3I3CA 2OQ0A 3PIPA 3KLWA 3GTMH 4GKJL 1JWUD 3K59A 4DUYL 2WAQB 1FGBD 5I6YA 4X62Q 3S1QH 2F0TA 5FLXE 1EQQA 1G6PA 2RCNA 1AN8A 2KENA 4DR3Q 2SDFA 2UUAL 2XWJB 3UDIA 4DR2L 5E7NA 3J81i 1D2BA 5M3MB 1RL2A 1EOTA 1JT8A 2I07B 3ER0A 1ESFA 4O0AA 2H1EA 3PSIA 5C5MA 1S40A 5IYDG 1CFMA 1QJOA 2X69A 2QEXA 1VF7A 1X55A 4DK3C 2DY8A 2WB1G 4P75A 4ZKBB 4C3IG 4GOPA 1FGUA 3CCJA 3HGBA 4E6IA 3IFTA 3DM3A 2XGTA 5DNFA 3CRKC 1HRJA 4KKSA 3VR6A 4HJ5A 3FEWX 4HIOA 4BA1I 1S72A 4XT1B 1EY0A 1EEFD 3JAME 1PV4A 2D62A 1QUQA 4A3CG 4B3TL 2NVXB 3R8BA 2H5XA 2UUBQ 1W6KA 2QNDA 2NYZD 2SNSA 3HOVH 2QCPX 1II3A 1D1KA 1Y1VH 2PY9A 3EN2A 3C46A 1P8LA 1UE6A 3TBIB 3PMFA 4IUNA 5FKAC 3HOYB 2K6AA 1ZZIA 1Q1BA 1PYWD 2VUMH 4JI3L 5IE8A 2HHHQ 1VMPA 2IW3A 1ASYA 2PZTA 5CV9A 4A75A 2F0LA 3OTOL 1S5DD 2JVZA 2R92G 2L15A 5IP7G 1V1PB 2KVMA 1B4OA 4RG1A 3F1ZA 5JEAH 3E0EA 4DR4L 2BL5A 2EXZA 5IGCA 5COYA 5EBDA 4A3GH 2F0PA 5D65A 2A8VA 4CKEA 3ERSX 3DWAA 2B2WC 5LL6X 3VDYA 2JA6H 4KKTA 4UY8C 1KHMA 1IYUA 2BA1A 2LY7A 1TS4A 3K0YA 2ZTEA 2ANRA 2Z0SA 4A3JG 1K0RA 1RD9D 2YU9B 4A3MG 4LWCA 2FMRA 2HQEA 3A5UA 4QIWB 1QNUA 4DGZA 2R7DA 4GS3A 2ID0A 2DGRA 3NK9A 1NCVA 5JJLA 5IY0A 4BY7B 1C48A 2R93B 2NVYB 4IFDJ 4A76A 1KIXA 3MA2B 3X3NA 5C0XI 3A7AB 1EQVA 1MGSA 4A3IG 2LMCB 3URYA 4DNRB 1IBML 5KNBA 4KV6A 2I5LX 1XPOA 1HNXQ 3MTSA 3J7ZC 4DU9A 2EVBA 5KEEA 3SE0A 4NMZA 4R8IA 2L11A 5DAUA 2VQFL 5EPLA 4RKBA 2F0JA 4OIKA 1QVGA 1L1OA 1EY6A 2PYKA 3FKIB 4YY3Q 5FLXc 4JI0Q 4ME3A 3BDCA 1CA6A 1TWAB 1TWFH 2B2YA 4DR3L 2A68C 2ATWA 4XIGS 5IT9L 1VQEA 4K8JA 3J7AV 2EYFA 1U5KA 1O7IA 4X65Q 3D3RA 2KCCA 1CA5A 4B3RL 4AQYQ 3I8ZA 1N9WA 1XTDA 1ZEQX 1NTGA 2AHOB 1RODA 3CD6A 1HZBA 5HURA 2WAQE 3NWTA 5C4JH 2E3UA 4AM3A 1STAA 1VCIA 1HZ9A 3FVQA 2NN6H 1QUQB 1Y8OB 1Y14B 5NUCA 5J22A 5I2XA 3T1YQ 1A8VA 1GHJA 1SNCA 4K5VA 1STHA 2B8FA 1AP0A 1Y1WB 4IPGA 3JAMc 1KNAA 5HGTA 1LTID 1WCMB 3OPOA 1DONA 3DLLA 1Q82C 2HH2A 3HOZG 4R4QA 3QIAA 3QOJA 4EQ5A 4DV0Q 4KI0A 4ODGA 1D5MC 1VQ8A 3HOXB 1SEBD 4TRDA 1PZID 3K7UC 1LYLA 5LMUQ 1HZAA 2ZTCA 1E2VA 3TREA 1I5FA 1NY4A 2HHHL 3BG3A 3GTKB 4FXDA 1TWHH 4HCSA 1PTOB 3CAMA 3SHLA 2A5HA 4QUFA 1Y8PB 2ZJPA 1IBKQ 1BXTA 3J81L 3H0GG 2CVRA 4BBSH 2YYZA 1WTOA 3PO3B 3T51B 1G51A 1HZCA 3D0FA 1B9MA 3QO2A 4G7ZC 4BY1B 4CGYB 2PMZB 5M5XH 1SBBB 3W3AA 4B9XA 1MJCA 3R2IA 1SYGA 1SN8A 1CKNA 2LXJA 1KC8C 2AKWB 2E5LL 3I4MG 4GN3B 5CV7A 2P2RA 5IODA 2MGSA 1HHVA 1QVCA 2A19A 2MP1A 2YU9H 2JA7G 4JBKA 5ELCA 1E3PA 2CWPA 1PA6A 2K28A 2B2TA 4A3EB 1BNZA 5I6WA 4L6TB 1VQLA 4JI4Q 3G71A 2F0DA 5KGUA 2XTIA 4LIJA 2XIWA 1CQFA 1N36Q 2CFMA 1SLJA 1LT4D 3W5OA 5E4WC 5CMDA 2R93H 4ABNA 3BZKA 1ET9A 2KUMA 2BOSA 1LTLA 2EY2A 1DOKA 1EIFA 1RTOA 3OWEB 1PFBA 3PUVA 1HNXL 1Q12A 1X3EA 4IJHA 2PNHA 2RDHA 3S14H 3NP8A 1MKHA 1XNQQ 3PF5A 5BN3A 4IPDA 4OGQC 2R61A 2E75C 1STYA 2IX0A 3VA5A 4F88A 4JI0L 2K50A 4YCUA 3DEOA 2NZOA 1QCBD 2MO1A 3GTJH 3BZCA 4NDXA 2CCZA 1EZ6A 3NBHB 4CKBA 3CC2A 2VY3A 1HH2P 2A6EC 4F7XA 5CR3A 1B2TA 5C4XH 4DKAC 3U4VA 1X65A 3KYHC 1RIPA 1DGSA 4WJWA 4X65L 4BBRB 1G91A 2PCFB 4GN5A 3CCSA 2PW7A 2H4OA 4X66Q 3LX0A 2KHSA 3OOCA 1T5XD 2CKZB 1T5EA 4ZLTF 3P75A 2Z6KC 1HQRD 1B50A 4OL7A 2MHVA 3DMUA 2MNAA 3G7LA 5IWAQ 3HZXA 3HOWH 4JC0A 1JC7A 5EKLA 2KOLA 3T1YL 5T1GA 1HJPA 1OXVA 3M4PA 2JA5B 4JCVE 1EY4A 2R7ZB 5C0XJ 1EY9A 1VQPA 2B63B 1GHKA 1NAPA 3KK7A 3E5SA 4KN4C 2NVTH 1G291 4KHPQ 1RKNA 4ZUJA 4KD3A 1SRUA 3W2DA 3KF8A 5ELEA 5J3BA 3R3OA 4DV0L 2G9DA 1HNZQ 3PO2B 3IL8A 1KAAA 3GDEA 1U4RA 1H9RA 3HOXH 3HKSA 3KDFA 5LMUL 3STBD 2UXDQ 4FYDA 3J7YW 1VQCA 2B29A 4LUOA 1LM0A 1ZYRC 3CCQA 3MZ5A 1CKNB 3HOVG 1IBKL 1AE3A 4HR7B 2X6LA 4IN3A 2F4VQ 1Y1VG 2XSCA 2IY5B 3K80C 4LW1A 3S1NB 3QG1A 2L12A 4DPGA 4U673 2RHSB 4X3UA 1IZ6A 4KD4A 1L0WA 1M90C 4EQOA 2VUMG 2J0TD 3OMCA 4LF8L 3HOUH 2EYJA 2K52A 1OXSC 5GAGC 1M8AA 4JYAQ 5C44B 3EFXD 4LF5Q 1V9PA 2RDFA 1I3QB 1SFOB 5JEAG 4RFBA 2Y0SG 3X3MA 1UWVA 1SDFA 4A3GG 3K81C 4XYOA 1H9MA 3S17B 3LNNA 4YCWA 5EKIA 4NXNQ 4JI4L 2JA6G 1A15A 2JA8H 3GTLH 4ZRZA 4QJFA 2PMZE 1N36L 2XRSD 2AQ2B 2RDGA 3I4LA 3M85A 2F0EA 4KN7C 3K0XA 1WVLA 1CI3M 2ALYB 1YJNA 1K83B 3OWFA 2MPMA 1XX8A 5BR8Q 4R1JA 5D3IB 2C9OA 5F2DA 2CTMA 4LFCL 3GTOB 2JE6I 2K5WA 1XNQL 4WFN3 4GLVB 1YJ9A 3QJYA 2K7VA 2EYMA 1B9NA 2MQHA 4OWWB 3UE0A 1BBWA 1I4RA 3CCRA 2SEBD 4ZK9B 2Z4HA 1R9TH 1CZGA 1PHJA 4WANA 2AMCB 4DR5L 2BE5D 3L3OC 3Q22A 2NN6I 3MXUA 4GLXA 3KLRA 3RZOH 4DV2Q 1VS0A 1SE8A 3NTHA 1BR9A 3MHBA 2DNEA 2ZXPA 5C4HA 4X66L 2K5NA 4DR1L 4DR7Q 1XXGA 2EJGC 3K5MA 4K6DA 2VQEQ 1AEXA 1WTQA 1Z6HA 3Q8DA 1A62A 1SROA 3PIO3 1HNWQ 5K36H 2A74C 3S16B 5IWAL 2F0IA 4RCNA 3W1BA 4H44C 2HCIA 2K01A 4DV5Q 3MVVA 2HDMA 1EYDA 1HTLD 1HUNA 1NMGA 1LABA 1KNEA 1ICWA 1NJIC 1IL2A 2NN6G 2HUGA 2UUCQ 4KHPL 1UNSA 3I4OA 1LLRD 1WD0A 3F2DA 4HSVA 4CJ2C 4KMUC 3OTOQ 1TR5A 5KNDA 1HNZL 4OO1H 2E2IH 1YNJD 3M3YB 1BCPF 4XXEA 1OXUA 3VYSA 1VQ6A 3I90A 1MBYA 1S5FD 2C35B 3SK4A 4LNQA 2UXDL 3PV0A 2MUYA 2QKIC 2GN5A 1GKHA 4DAYB 4DXGA 1ENAA 4YIJA 2K32A 2NZHA 2K33A 3D4WA 5G3LF 4FF1A 2JJQA 2NUCA 4PMCA 1G2SA 2F4VL 1CZWA 1V1PA 3EVQA 3DXJC 2PO4A 3VR2A 3BS1A 3Q24A 3W1GA 1Q8KA 2LFNA 3ZJYC 1TWGB 2HH3A 1BCPD 2O4XA 2B2VC 1JOOA 3CQZH 1DXMA 2HIVA 1KD1C 4A93B 4IUVA 2F0HA 3AQQA 2N55A 3CF5A 4JYAL 1CSPA 2D2CC 4LF5L 1QZHA 3H6MA 4BBSG 5M3FH 5G3LD 4C1NK 1HFGA 3DWPA 2SNMA 3KUPA 3RZDB 4JOIC 4A3BB 1IW7C 3IFDA 3S17H 4NXNL 2KA7A 3ULJA 1EWCA 4LUZA 2DY7A 1PH1A 3FPPA 2LKVA 3DM1A 1J9OA 3K58A 2A6HC 1SE2A 4UP7A 4NKLA 1DJRD 1A3UA 3S1RH 1ESRA 1A6XA 3KLSA 1STGA 4KY5A 3MXNB 5BR8L 3NSWA 3CPWA 1LV9A 2VB2X 3PCOB 2UU9Q 2R93G 1F2MA 2ASBA 1SNPA 1IKMA 2IWHA 2K05A 3I4NH 2I5MX 4B3RQ 5CGKA 5A2QL 1SMXA 4BA2I 3DEPA 1NMFA 3MWYW 5CV6A 3A7LA 1A63A 2R6GA 3AEVA 3J7AF 2F0GA 4C3JH 4GOPC 3H3VH 1FL0A 2EYHA 2OTJA 4MN3A 2FINB 4HJ9A 1KXLA 3S9WA 3H09A 2E2HH 4L5QA 4DV2L 1V1QA 1LT6D 1ZZJA 5M5WB 2EPBA 1DYQA 3N52A 4XYQA 2AWOA 2F0MA 1I6HB 1J8IA 2KEEA 4DR7L 2VQEL 5C4XG 3TZDA 1JJCB 2PI2A 2N8NA 4JI8Q 3OMGA 3OW2A 1VQKA 4NP5A 3V2TA 4DAVA 1EZ8A 5LMNQ 1HNWL 3CKIB 5JVG3 2RSNA 4DV1Q 1D5XC 2K5VA 1IYVA 2CHBD 4C3HB 4U68A 4DV5L 3MXGA 2CTFA 3FHWA 3J80E 2Q8TA 2KCNA 3K57A 3CCUA 1YNXA 2EE1A 4DA2A 4LJZC 1OXXK 4R9WA 4XQNA 4LFAL 1S5BD 1JCKB 1QE6A 2UUCL 2PQUA 3HOWG 1LTBD 2Z4IA 3A55A 1MI2A 5C3XA 3PIOA 4GNXB 4C1NI 4RMFA 4HSPA 1WTWA 1O7YA 3R2TA 2XNAC 5J39A 2NTSA 4DAPA 2NVQB 2VB3X 1TXYA 1OXTA 2FJ2A 5T1IA 1I4QA 3U1KA 1PTOC 5IGEA 4BWGB 4WJ3M 4CJ1B 2KBNA 3B6YA 2HDLA 3CU7A 2C5CA 2YTXA 3TQYA 2D0PA 3MC0B 3UI2A 4LF4L 2E5LQ 4KKUA 2RF4A 1M1KC 1I4XA 3HOXG 1N33Q 2DUDA 3OYYA 4K0KQ 5I9OA 4JVYA 5J1ZA 3GTPH 3R93A 2OTLA 1ENFA 2JQOA 5CV5A 4CJ0B 1SXTA 1TKWB 4A3FB 1YHAA 3NQIA 3ND9A 4DNTB 3EA6A 1YNND 3DHQA 2EXDA 3BU2A 2EOTA 4YHHQ 2RQXA 2Z1CA 3A56A 5I2YA 1BKBA 2WINB 1EU3A 4O2DA 3HOUG 4QCLA 4L5TA 1I50H 1QNKA 1FYCA 1FNWA 4Y7NB 1L1OC 1N32Q 4K2KA 1TY2A 3BYTB 3K7AH 1SYDA 2A69D 4R8NA 1SMYD 1ASZA 2B2YC 4TVAB 1VQ5A 2JA8G 2CPQA 1KLUD 3I2ZA 3AEVB 3C2PA 3CW2C 1PRTF 4LK1C 1YITA 1PH3A 5AJ3Q 2UU9L 4B3SQ 4JI2Q 3VYTA 1O80A 1VQOA 2F0KA 4IUTA 3M4QA 1A3TA 1F9PA 3AFQA 5M3MH 2WB1B 4C3IB 1BUVT 1IL8A 1H9KA 4R4CA 3NBHA 3HKZB 3OIQA 5C3EB 3JAMi 5IOCA 3HS0C 5JJZA 4KLKA 1PRTD 2X6GA 1H95A 4FVMA 4J1MA 5FO9B 2ZXRA 4DV3Q 3L9AX 1WTVA 4DNIA 3I55A 2CW0D 3HEJA 2ZJRA 1I94Q 1I6HH 1D1IA 3GTGB 1SR3A 4JI8L 5IGDA 2F0SA 3DWQA 1WI5A 1WOCA 1EQTA 1C8CA 5LMNL 4H0LC 1BCPB 5C6AA 4DV1L 3V96A 2NBFA 3BVZA 4DAMA 4FXGC 4J8QA 2ZM6Q 2NVXH 3J80c 3P7JA 4OO1I 4OHJA 4RHRA 3IKJA 4NXML 2UXCL 1KQSA 2R92B 3MFYA 2I5HA 5K36G 3HOYH 4BXXH 1KDCA 4ID6A 4C2MB 3M9BA 1SYFA 3NWSA 3VR4A 3VYUA 4CBVA 4IFDH 4K5WA 2LS01 2HIXA 3F2BA 1YIJA 1K1GA 1P16A 2GVBA 2R3ZA 1EY5A 3GTQB 3TP5A 3CC7A 4ME5A 1Q8IA 3SR1A 2PPBC 4DR6L 5FJ8H 4XDXA 4A3JB 4KJNA 4POFA 4A3MB 3SK6A 4LF8Q 1WJJA 3RUZA 1D5ZC 4HIKA 4ZYSA 4MNOA 4OO1G 4DV6Q 3D6WA 1W6JA 3A8KE 1N33L 2F3VA 4K0KL 2B2TC 2JXMB 4MZ9A 3PGZA 5GADC 3CC4A 3HG9A 2LXKA 2GA4B 1FNUA 4A3IB 3IAYA 5I4DA 1JJ2A 1GUNA 4BY7H 1Q81C 2NVYH 4AYBG 1PH2A 1VMCA 1A0IA 3S15B 5IP9H 4IZ8A 1K8MA 4JK1C 4YHHL 3KBGA 1GD7A 1I4PA 4DK0A 4IUUA 3D4RA 1B70B 4XQQA 3G48A 1G6ZA 5GROA 3NHHA 5C44G 1EWIA 4LFCQ 3RMHA 1OO9B 4QIWE 4QMFB 3BVGA