4OO1G

Structure of an rrp6-rna exosome complex bound to poly(a) rna
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
234
structure length
226
Chain Sequence
STFIFPGDSFPVDPTTPVKLGPGIYCDPNTQEIRPVNTGVLHVSTAYIDYSSKRYIPSVNDFVIGVIIGTFSDSYKVSLQNFSSSVSLSYMAFPNASKKNRPTLQVGDLVYARVCTAEKELEAEIECFDSTTGRDAGFGILEDGMIIDVNLNFARQLLFNNDFPLLKVLAAHTKFEVAIGLNGKIWVKCEELSNTLACYRTIMECCQKNDTAAFKDIAKRQFKEIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of an Rrp6-RNA exosome complex bound to poly(A) RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/rna
molecule keywords Exosome complex component RRP45
total genus 36
structure length 226
sequence length 234
ec nomenclature
pdb deposition date 2014-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF15985 KH_6 KH domain
G PF18311 Rrp40_N Exosome complex exonuclease Rrp40 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4oo1G01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4oo1G02
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 4oo1G03
2LMCB 2XGTA 2VZAA 1GVPA 3EIVA 3OPOA 1GJXA 1GO3E 1TWGH 5GROA 1L0WA 1VDZA 4DR7Q 4A76A 3U58A 3W1GA 4B8TA 3H0GH 3J80c 2UXCQ 1VQIA 1YITA 1K1GA 4GN5A 3A7LA 4KKSA 4YHHL 1EYGA 2DN8A 1T9HA 1AE3A 2NVTH 2NN6G 4GLAC 4LFAL 4L5QA 1HR0Q 3KYHC 4NB3A 1PH9A 2UUCQ 4DV5Q 1YJNA 2B63G 4GKJQ 4J15A 1GD7A 1PH4A 1EFWA 1UE6A 1YNXA 2IHEA 2D5DA 1Y1VH 4ME3A 1EUJA 3JAMi 3IFTA 2ZM6Q 1VF7A 3AQQA 4RMFA 4DV7L 3HOWG 4DR2L 1QVCA 4BY1G 1OXSC 3OTOL 4R4QA 2PQUA 2JA9A 2CFMA 3JAMc 5JJLA 1IBKQ 4GKKL 3ULLA 1VQPA 2Q2TA 4LF6Q 2E5LQ 1N32Q 1S40A 1HH2P 2E2IH 3UDIA 4L5SA 4PV1C 2XTIA 3HOXH 2F4VQ 3PO3G 3GTPH 4B3RQ 2Q2UA 3Q8DA 4JBWA 1X6OA 2VQEQ 2OTLA 3CAMA 3KDFB 2K4KA 1A0IA 2E74C 1XMOQ 3A5ZB 2EDGA 1FJGQ 2ASBA 3T51B 1L1OC 1QVGA 3CC4A 4JI3Q 4QMFB 2AUJD 5A35A 1PV4A 2UU9L 5IP9H 3QIAA 5IYBG 1K73C 1HNZQ 3K81C 2IT1A 3CC7A 1U5KA 1KHIA 4GN3B 1N36Q 3FKIH 4A3JG 2VUMH 3GTJH 2UUBQ 3DM3A 1SE8A 2V4DA 1YHQA 4A93G 2BDOA 1P16A 1X56A 3B6YA 3HFZB 5GQOA 3GTMH 3FMCA 1OXTA 5KNCA 4HJ5A 3W1BA 4A3FG 1IL2A 1WVNA 1PFSA 4OWTB 2B29A 4LFCL 3CMAA 1YHAA 1HCZA 3A74A 5GAGC 2FXQA 2UUAL 4IQZA 1KAWA 2V1CC 4OO1H 1UE7A 3J7ZC 1B8AA 3KLRA 4DAYB 1JT8A 4JV5L 2KCTA 4BY7G 5IYDH 1KD1C 5KNBA 3LGJA 5C0XG 4X64L 3LWUA 1K8AC 3HOYG 3M9BA 5JJKA 1WI5A 3PUVA 1XTDA 1N8RC 2AWNA 1Q1BA 2ANNA 4DK3C 1GUTA 3S16H 2Q8IB 3PIOA 5C44H 4JI3L 2MO1A 3CPWA 3I55A 4JI6L 5GAEC 5FJ8H 1YJWA 3A0JA 4QIWE 2UUCL 3S1MH 2CTLA 2VS1A 4JI1Q 2EJGC 4JI7Q 2JVZA 1QZGA 3CRLC 1MJEA 4C2MH 1VCIA 2OQKA 2ZJPA 1H95A 1MJCA 1WYDA 3I4MH 4BBSH 2WAQG 2CTJA 3PUWA 2RF4A 1QUQA 2EVBA 1PYSB 2PI2A 5JEAH 5H1SE 1LTLA 2JA7H 3S2DH 2E3UA 2NVYH 2Y0SG 2JE6I 3TREA 4OX9Q 1TKWB 4DR1Q 4HIMA 1K83H 3E9IA 2A68C 1ZYRC 3PV0A 4LF5L 3M4QA 2Z6KC 4JOIC 3VA7A 4FDBA 1E2VA 4YY3L 2RHQB 4DUYL 4DV0Q 4AQYL 3CCEA 1KIXA 1IBLL 1ASYA 2A68D 5ELNA 4JI0Q 3MFYA 3ER0A 4DR6Q 2R6GA 1PA6A 1IW7D 2YU9H 3BU2A 4QL5A 1EIFA 1HQMC 2AMCB 3VR4A 3S1RH 2NVQH 2D0OA 3F2BA 4OWWB 2N3SA 2ZJRA 4HJ7A 4KHZA 1D7QA 4R1JA 1R9TH 2N49A 1H9SA 2JXMB 2HQLA 3FP9A 3NELA 5C0XJ 2YTVA 2ZTDA 2K7VA 1RIPA 4IJLA 3SDZA 3G71A 1LACA 4H02A 2ZM6L 4KKUA 1X65A 4ALPA 3HOVG 4QY7A 4A3GG 4DR2Q 1X4MA 4IOAA 3UE0A 1B7YB 1VQDA 4GS3A 3L2PA 4KI0A 1EWHA 1MKHA 1Q82C 2VUMG 1E2WA 3ZJYC 4A3LG 1Z6HA 4UPAA 1NMFA 1H9MA 3KOJA 3PO2G 4A75A 4TQUS 2GVAA 3BJUA 2I0QA 4P72A 1WJJA 1JMCA 3OW7A 5DLQE 1HTPA 1NTGA 4A3DH 4P73A 5LMNL 1N34Q 4KMUC 2QA4A 4HIDA 4DR4L 4PZ8A 1PVOA 3F2CA 4JI8L 3CRKC 1GUNA 4DNTB 3K7UC 5IE8A 3PUXA 1ONLA 4GZYC 1PH5A 4X65Q 3GDEA 2NZHA 3I7FA 1JB7A 3ND9A 1X3GA 1OXXK 1VQOA 4LFAQ 2HHHQ 4JBMA 2DUDA 2LSSA 3AYHB 4PZ7A 4B3TQ 2EIFA 5J3BA 4O2DA 2R7FA 4KHPQ 2VQFL 3T1HQ 4LK1C 1Q46A 3KJOA 1H9SB 2EJMA 4GOPC 2QGQA 1NJIC 2HT1A 2JA5H 1VQJA 1N33L 3NBHB 1K8GA 3CXCA 4IJHA 1D8LA 4LF9Q 2UXDQ 2BA0A 1CUKA 3H0GG 4L5RC 2R93H 1SROA 2ID0A 2E2HH 2A6HC 4AIMA 3HOZG 3PGZA 1QZHA 1FGUA 1O7LA 3D0FA 1B9NA 4RG1A 1A62A 3NENA 3KLWA 5M3MG 3HOUH 3HOZH 4BXXG 2A69D 1IYUA 4H13C 1PMRA 3KFUA 1Q8KA 1H9RA 4A3KH 4JCVE 5BN4A 4X65L 2AWOA 5C4XG 5IWAL 2E76C 1HZ9A 1QUQB 1RL2A 5M3FH 4LF7Q 2GVBA 4GLVB 3RLFA 1V9PA 1LYLA 4IPCA 4P75A 1XNRQ 3GTKH 1W3SA 2JA8G 4NPSA 3TS2A 1C9OA 1C0AA 3RNUA 2PI2E 3AEVB 1DD2A 1I50H 1I94Q 2CTKA 1Y8PB 4DNRB 1KXLA 2CQOA 4LNQA 4QJFA 1BDOA 1VQ5A 2E5LL 2DGRA 4G7ZC 2Z0SA 3CCRA 1Y1WH 2OPVA 3M4YA 4IPHA 3T1YQ 3PUYA 3BG3A 1HR0W 4JI7L 4UP8A 3KF6A 1G6PA 4AQYQ 3RR5A 1BBWA 3S24A 1VQ8A 1YNJC 4L8JA 2A1AA 2C35B 3FHWA 1XPRA 4JI0L 2FMRA 3J81i 2MO0A 4HIKA 5IT9c 2HHHL 1FR3A 3WDNA 3GO5A 4LW1A 4OXPA 4JI2L 2NN6H 4A3CG 4JVYA 3CP0A 1FYCA 4WANA 1TU2B 4I7ZC 2O5JC 4WJ3M 4R4IA 1MIUA 2KBNA 4IPDA 3HOVH 4A3GH 2BL5A 1X54A 1T5EA 5C4JH 3CCQA 3AB9A 4GNXA 4JI4Q 1VQ6A 3HOWH 2MFIA 1CFMA 3L0OA 4EX5A 5HGQA 3KJPA 2NN6I 1ZKOA 3FPPA 4OGQC 2ALYB 4DV4L 4WJ4A 2JEBI 1IZ6A 2Q2HA 2IY5B 2R7ZH 1Y14B 1BKBA 4IFDG 1H9KA 4L5TA 2AXYA 2D2CC 3M7NA 3VR2A 3U50C 1HZCA 3OYYA 2I5HA 3PIPA 4JI6Q 1AH9A 2PNRC 2B8GA 1VQGA 2JQOA 2NVXH 1GHJA 3RLOA 4LF8L 1SMYC 3TS0A 3T53B 4NXMQ 1V1QA 4BA1I 2I5LX 3K80C 1PH6A 1VIGA 1VQEA 2KHJA 1LM0A 3KDFA 4DV2Q 1FVIA 2OCEA 5EAYA 1TWCH 3KF6B 2AUKA 2K50A 3U4VA 1Q86C 4JYAL 1UEBA 4TKOB 3H15A 1A8VA 2AHOB 3I4LA 4PG3A 4R4TA 3CCVA 1N33Q 4YY3Q 2K75A 1WE8A 3I4NH 4A3IH 1PYBA 5LMNQ 4DR6L 5BN5A 4KHPL 4A3KG 4EQ5A 3J7A5 3QJYA 1L1OB 2PQAB 2A6EC 4HJ9A 2QNDA 4TVAB 1LABA 3GQBA 2JA5G 4DK0A 1E3PA 2K52A 3OTOQ 2MQHA 2PNHA 1CI3M 3J80i 1E7ZA 2UUAQ 2A69C 5C3EG 4BY7H 4LF5Q 2NZOA 2L15A 2KA7A 1HNXL 5K36G 2O5IC 4IFDJ 1DTJA 1DXMA 3CCLA 4B3SL 1GM5A 1ZZKA 2VQEL 4DK1A 3HKZE 1Y1WG 3CPFA 4B3MQ 1N34L 1SRUA 1J6QA 2F52A 2A8VA 1E2ZA 1GUOA 4DR7L 3I4OA 1N32L 2Y0SE 1YNNC 4G7OC 1Y1VG 2A19A 4AYBG 4DV6L 2R92H 2OTJA 2QF7A 4JI1L 2WFWA 1HNZL 1A63A 4DV3L 3TEHB 3K8AA 1PHJA 1QVFA 1L1OA 4JOIA 3H94A 1OXUA 1J4WA 2EJFC 5BR8Q 4WALA 5LMNW 5JEAJ 4LJZC 3F2DA 1SMXA 5AJ3Q 3PUZA 1EWIA 3NEMA 3T1YL 4GNXC 1H9JA 2IX0A 2F4VL 3P20A 4LF6L 4BBRH 1EC6A 2UUBL 4LUOA 1Y8NB 1K9MC 1X4NA 2HH3A 1DCZA 1YBYA 3K0XA 4PZ6A 5FLMH 3A8JE 2PPBC 1PH2A 3BDOA 1EQRA 1I5FA 3GTQH 2MJHA 4C3IH 4A3BH 1VQFA 4YWLA 4DR3L 3F8TA 5FLMG 2KCCA 4YWMA 1FJGL 5C0XH 5GADC 5KNDA 1JE5A 1BVSA 2KHIA 4DR1L 2DNCA 1HR0L 3SGIA 1NMGA 1JJCB 1K8MA 3CQZH 4UP9A 4DV1Q 4YCUA 4HJAA 2E75C 3OOCA 1C7YA 4NXNQ 3BZCA 2OPUA 2CPQA 4H44C 2IHFA 1HNWL 4X6AH 4DR3Q 3EQLC 4LF7L 3CD6A 3CCJA 4XIGS 1XPOA 4A4IA 3TZUA 1XMOL 4LFCQ 1FL0A 2K5HA 2B3GA 2N8NA 4LUZA 1Q81C 4BBSG 4A3DG 4JYAQ 1PH1A 3ICEA 4HIOA 2K5VA 3IRBA 4B3RL 3VDYA 4GKJL 3OW2A 4DKAC 3RN5A 1VIHA 5JEAG 4DV2L 4A3FH 2PY9A 1TWAH 2KCMA 4GOPB 2VNUD 1SN8A 1TWHH 3AFPA 1IBMQ 4JV5Q 5FJ8G 2BH8A 1W2BA 3H3VH 5BN3A 1S72A 4HR7B 2D0PA 1AE2A 2WP8J 1J5EL 5JJIA 3IKJA 5K36H 1I6VC 2AKWB 3FKIG 4XTCS 2K14A 3UDFA 1K0RA 4A3JH 1NY4A 2UU9Q 3MEFA 3UDXA 2Z6KA 4DV3Q 3CCMA 1PH8A 2CWAA 4QQBX 1KHMA 1EOVA 3D4RA 3T56B 2VY3A 1KC8C 2LXKA 1CKOA 2RHSB 4OWXB 4DV4Q 4A3MH 4X62L 1J5KA 1HNWQ 4Y52H 4YCWA 5M3FG 3DLLA 5AJ3L 1E1TA 1Q7YC 1Y69U 3W5OA 3S1QH 2OQ0A 5IP7H 4IFDI 3VKEA 1HZBA 1YEZA 2QEXA 1CTMA 1Q12A 2ZTEA 3JC66 1IBLQ 1TUAA 1GUSA 1XMQL 1IXRA 3E0EA 3I2ZA 1KL9A 1NE3A 1WCMG 4X66Q 2JA7G 2YTXA 2K32A 4LFBL 1SR3A 4JBKA 1PH3A 1M1KC 1L2FA 3RLNA 1VQ4A 1WCMH 5IYCG 1VQ9A 3HOYH 3ULJA 4DV6Q 2JA6G 3EBEA 2ANRA 3F1ZA 1CKNA 4JI4L 3STBC 5IYCH 3U4ZA 1XJVA 1E24A 1SLJA 2HIXA 4DK6C 1K8OA 4B3SQ 1HZAA 4X66L 2F3IA 2BE5D 5IP9G 5BR8L 3GTGH 2ZTCA 4DUYQ 4POGA 4LFBQ 3N6RA 1IYJB 1IYVA 1V43A 4LIJA 2WAQE 4DAMA 1JJGA 4G7HC 3PF5A 3VR6A 1EQQA 1IW7C 4AM3A 5E7NA 3HKSA 2UXBL 2JEAI 3MXUA 2WB1E 3E9HA 1Y8OB 4KKTA 4YHHQ 4NXML 1YHBA 4IFDH 3S17H 5HY6A 3TRZA 4A3BG 4A3LH 4LF4L 3QG1A 4KN7C 1P8LA 4PMWA 2BH2A 1I94L 2VL6A 1G291 1G51A 4JBJA 2EXDA 1V8QA 3PO3H 4A3IG 1OXVA 5IYDG 3I56A 3RZDH 1ASZA 1BBUA 3W3AA 1EIYB 1ZZJA 5M3MH 4GLXA 3G48A 1E1OA 4DV5L 4DPGA 3UE1A 5M5WH 3G6EA 1S3OA 4B3TL 1N36L 1U0LA 4X64Q 4BA2I 5LMUQ 2CTFA 5C4XH 2HH2A 3LNNA 1GHKA 1K3RA 5C3EH 3J81j 1VS0A 3I4MG 1UWVA 1IBML 3PO2H 3NE5B 2L5TA 3VR5A 4OO1G 4LUVA 4LWCA 2MNAA 1WOCA 2CCZA 3HGBA 5IY0A 3UDGA 4APVA 2JA8H 2CTMA 1CKNB 4OO1I 3CW2C 2P2RA 2B8FA 4P74A 4OX9L 3CCSA 1I3QH 1Z47A 3DXJC 2YV5A 4KN4C 3CCUA 1JJ2A 1HNXQ 2R7DA 2F1MA 1VQBA 3M4OH 4R4OA 5C44G 2CWPA 3S2HH 1J5EQ 1ZTGA 1LUZA 1UE5A 1YIJA 2VQFQ 4POFA 3T1HL 1NBWA 2CKZB 4GN4B 3I4NG 4HJ8A 2JZXA 3CF5A 3SE0A 1Q1EA 4A3EG 2IX1A 3KF8B 3S14H 1HJPA 4LF8Q 4IO9A 3A8IE 4MZ9A 3K7AH 4Y7NH 2ES2A 1X3EA 5IWAQ 3I73A 5C0XI 3HOUG 4BXXH 2GN5A 1VQAA 3ERSX 4IPGA 1E22A 1GUGA 2PQAA 4OONA 2N78A 2JA6H 1Z9FA 4DR4Q 2YQRA 2A6HD 4JG2A 4JI8Q 1YI2A 3RN2A 5M5YH 3GD7A 1KQSA 3M3YH 1CSQA 4IOCA 4QGUA 1N9WA 2R7ZG 1I6HH 1IBKL 4GKKQ 1YZ6A 4NXNL 1XNQL 2PMZE 1O78A 1QJOA 3ULPA 3PF4A 3RZOH 2OWOA 4K0KQ 3STBD 2JJQA 4MNOA 3L7ZC 1M90C 3U9SA 4DV0L 3A7AB 1Z7TA 4DV7Q 1XNRL 4GOPA 1KRSA 3HOXG 2BE5C 3A8KE 1A6XA 4R4CA 4BBRG 2B63H 1DGSA 2K5NA 4JI5L 2ZJQA 3U1KA 1VQCA 1YJ9A 4JVHA 5M5XH 4MTNA 1CSPA 2UXCL 5GAHC 1XNQQ 4C3JH 1O7IA 2Q2IA 4K0KL 4BY1H 1VQNA 2YTYA 4KLKA 2WB1G 4DUZL 3H3VI 1X9NA 2E2JH 1B70B 3D31A 2ATWA 2K33A 2UXBQ 4NBQA 1VQHA 2RCNA 1UE1A 4JI5Q 1PH7A 2E8GA 1Q90A 4JI2Q 4GNXB 3AFQA 2BA1A 3VR3A 4C3HH 3A5UA 1XPUA 4H0LC 4DR5L 3CC2A 3I72A 1GKHA 2HIVA 2EQSA 3WWVA 1ZZIA 3GTLH 2DNEA 3EN2A 2LXJA 2PCFB 3CMEA 1DT4A 4JK1C 4DV1L 4A3CH 1X55A 2A6ED 1SFOH 3HKZG 2ZT9C 4X62Q 5IYBH 2DGYA 5LMUL 1YVCA 2R93G 1VQMA 4YCVA 3M85A 4YWKA 4RCNA 4B3ML 3S1NH 2H5XA 3MXNB 1VQ7A 4O0AA 1TWFH 4AYBE 4UY8C 2CW0C 1VQKA 4A93H 1VF5C 4AH6A 3G4SA 1CKMA 4A3MG 1OTCA 4LF9L 2UXDL 1XMQQ 1VQLA 3TQYA 4LF4Q 1KRTA 1WFQA 5FLXc 5IP7G 4DUZQ 1B9MA 3AEVA 2CTEA 4UP7A 4A3EH 2KENA 2YYZA 3S15H 1X3FA 3PSIA 2VW9A 4DNIA 4P71A 2JK8A 5ELOA 3GTOH 3ND8A 3BZKA 3PCOB 3V69A 2D62A 3J81c 4DR5Q 4JC0A 3M4PA 1HPCA 2I5MX 1TXYA 2R92G
chains in the Genus database with same CATH superfamily
2LMCB 2Q8RE 5C5MA 2EYFA 1PTOB 5LHY1 1GO3E 1TWGH 4JI4H 4PNYA 3U58A 4DXGA 3J80c 1VQIA 1K1GA 4GN5A 4B08A 1AE3A 5ELFA 4LFAL 1HR0Q 1WTRA 3KYHC 1K0SA 2UUCQ 1MBYA 3DMUA 1SAPA 1K9MC 1EUJA 3I8ZA 3IFTA 4X65H 4RMFA 4KY5A 4K5VA 1QVCA 1ESFA 4R4QA 2JA9A 1IBKQ 2BOSA 4V190 2XTIA 2F4VQ 2WAQB 3GTPH 4BY1B 1EY7A 5EGTA 2LRRA 2KVMA 4XQNA 1XMOQ 1FJGQ 4ILWA 4JI3Q 4QMFB 5A35A 5IP9H 2IT1A 1U5KA 1KHIA 3FKIH 4FO2A 3K7AB 2L0CA 3X3MA 3PO3B 1IL2A 4A3FG 4OWTB 4CKBA 1D1KA 1TIID 1UE7A 4ZKCB 3GTJB 3SB1A 1KD1C 3TP5A 1K8AC 1XTDA 1GUTA 3S16H 1X3PA 3CPWA 4JI6L 2PQEA 2VS1A 4JI1Q 4BS9A 2X69A 1QZGA 3CRLC 4JYAH 4MIUA 1KLUD 1WYDA 2H1EA 5CR3A 1U4LA 2EVBA 2PO4A 3TZDA 4FF4A 2KUMA 2PI2A 4CDEC 1LTLA 2Y0SG 2JE6I 2UXBQ 4OX9Q 3E9IA 1ZYRC 1NR2A 4LF5L 2Z6KC 4DV0Q 4YY3L 4FDBA 1IBLL 3S1NH 2RHQB 5ELNA 4DR6Q 3ER0A 5D65A 4QL5A 1LTSD 2AMCB 3RMHA 1VMCA 5IT9L 4HJ7A 5G3LF 2EYPA 3C3LA 2CQAA 3A56A 2VXWA 1PZJD 4IJLA 2Q8TA 3G71A 2ZM6L 4ALPA 4QY7A 4DR2Q 2K1HA 1VQDA 4GS3A 4M8AA 3L2PA 4QB4A 1E2WA 1Z6HA 4ZRZA 3KOJA 2FMCA 2NUCA 1JMCA 4ZLTF 1NTGA 4P73A 5LMNL 3Q6SA 4HIDA 4DR4L 4PZ8A 3K7UC 3K59A 3PUXA 4GZYC 3I7FA 3ND9A 1B3QA 1OXXK 2DUDA 2LSSA 1HUMA 4O2DA 2F4IA 3T1HQ 2KEEA 4LK1C 1Q46A 1H9SB 4OX9H 5IGEA 3IFDA 1NJIC 2HT1A 1EYCA 1N33L 4N8FA 3CXCA 2BA0A 3L9AX 2NZ1D 4RG1A 5EKIA 4DFAA 4I7AA 4DV6H 2RBMA 3NENA 1AN7A 1I50B 4BXXG 2A69D 1IYUA 1H9RA 4HMIA 3SVMA 5C4XG 1MI2A 5M3FH 3I4NH 1V9PA 4AYBB 3GTKH 1W3SA 4NPSA 3TS2A 1C9OA 2PI2E 4IURA 2CVRA 3V2TA 1I94Q 1Y8PB 3UOEA 4DNRB 2K05A 1KXLA 1D5ZC 2DY8A 4CKEA 1VQ5A 2LY7A 4LNQA 4HMJA 2J4XA 5IT9W 2OPVA 1XXGA 1SNQA 4AQYQ 1BBWA 3S24A 1VQ8A 2C35B 4K2KA 4JI0L 2KOLA 2MO0A 5IT9c 1BCPD 4A3CG 2WIIB 3CP0A 1SNPA 1TS3A 1BF4A 1KTKA 2BL5A 3K5LA 4GNXA 3AB9A 2CH4W 3C46A 1JOQA 3I4NB 1XMOH 2VKCA 3KJPA 2R7ZH 1QCBD 4IFDG 3I0PA 2AXYA 3M7NA 3U50C 3OYYA 3PIPA 1EY9A 1AH9A 1HA5A 3TP7A 3RLOA 4BA1I 1PH6A 4DV2Q 1FVIA 2OCEA 3J81W 2F0KA 3KF6B 1QG7A 1BBXC 4XQQA 1TVXA 1UEBA 2WKCA 3H15A 2A1SA 4DR4H 3I4LA 4R4TA 1N33Q 3FRPB 4A3IH 5LMNQ 4KHPL 5BN5A 4A3KG 4EQ5A 4FP5D 2A6EC 2JA5G 3GTGB 4DK0A 2K52A 2MQHA 2PNHA 1CI3M 1E7ZA 1HXYD 4AQYH 2A69C 5C3EG 1DJRD 1ZZKA 4L63B 4IFDJ 1ODHA 1DXMA 3CCLA 4B3SL 2ZXPA 3HKZE 4KJNA 5CMDA 1N34L 2FFKB 2F52A 2A8VA 1E2ZA 1B4OA 3I4OA 2Y0SE 1YNNC 4AYBG 4DV6L 1F2MA 4JI1L 1WTVA 3K5OA 4DV3L 3TEHB 3K8AA 2LS01 4JOIA 3H94A 1J4WA 2EJFC 5I6WA 4DGZA 4Q0FA 3MFGA 1BCPC 1KHMA 3NEMA 2IX0A 4BBRH 3MXNA 2UUBL 1QILA 4LUOA 1X4NA 3K0XA 3QWNA 3BDOA 1ICWA 4A3BH 4LFAH 2RVLA 3D6WA 5GADC 4JI0H 2EY2A 4DR1L 3SGIA 4HJAA 1JJCB 3CQZH 1VQKA 4RCOA 3OWEB 2E75C 1GXDC 1C7YA 2CPQA 2WV6D 4ZKBB 4EQOA 4DR3Q 1XMOL 4LFCQ 1PFNA 1SBBB 4OIKA 2JA7B 4X62H 1PH1A 4B3RL 1G2TA 1WTHA 3VDYA 4JVYA 3OW2A 4DKAC 1VIHA 4F8MA 1PDQA 4OL7A 2A5HA 2BH8A 3H3VH 1RHPA 4HR7B 2WP8J 1AE2A 2NVQB 5JJIA 3EJIA 5K36H 1K0RA 1WD0A 3DM1A 3UDXA 2Z6KA 3I90A 1PH8A 4QQBX 3MTSA 3T56B 4FF1A 4OWXB 5ELCA 4FF3A 1HNWQ 4Y52H 1G2SA 5M3FG 3DLLA 3HZXA 1I4RA 1JR0D 3S1QH 5IP7H 4IFDI 1HZBA 1YEZA 1LTRD 2R92B 3JC66 1TUAA 1NXUA 2XWJB 3E0EA 1BOSA 2L9HA 2YTXA 4LFBL 2PW5A 1SR3A 5IYCG 2F0QA 2JA6G 1CKNA 1JWUD 1DONA 1PFMA 1SLJA 2HIXA 4DK6C 4B3SQ 1ILPA 1K8OA 2BE5D 4IN3A 4XYOA 1A3UA 5BR8L 2ZTCA 4XQJA 1IYJB 1B53A 1CA6A 2DJGC 1JJGA 4LF5H 1EZ6A 3E9HA 1BXTA 4NXML 4YHHQ 2L11A 4IFDH 1STGA 5HY6A 4A3LH 4KN7C 1P8LA 1G51A 2UUBH 1V8QA 2Z4IA 3NXWA 3L3OC 4DA2A 1E1OA 4DPGA 3ITPA 4QMGA 1S3OA 3NHHA 5LMUQ 4BA2I 2HH2A 5C4XH 2FINB 3J81j 1VS0A 3PO2H 3VR5A 2L5TA 1ENAA 4APVA 2CTMA 1CKNB 4OO1I 1II3A 1Y1WB 5T1GA 1I3QH 1HNXQ 3DXJC 4DF7A 2R7DA 2F1MA 5IGBA 2E5LH 4BWGB 3M4OH 5C44G 4K6LA 1J5EQ 3T1HL 2JA8B 3D3RA 4GN4B 1MHWC 1N36H 3HKZB 4LF8Q 2L12A 4DN4M 1ENFA 2XNAC 1QOHA 4IO9A 4Y7NH 4DV7H 2ES2A 1F9PA 1X3EA 1YNJD 1XRHA 1HUNA 3ERSX 4IPGA 1EEFD 4DR4Q 2N78A 3M7GA 4K0KH 3H0GB 1LTAD 3M3YH 4IOCA 2R7ZG 2A74C 1I6HH 5IT9E 4C56C 1I3QB 3ULPA 4HCSA 4CGYB 2JJQA 3L7ZC 2XRSD 4KV6A 4DV0L 4DV7Q 1I4HA 2BE5C 3A8KE 5HGTA 1PRTB 4BBRG 2K5NA 5JAVA 3H3VC 3FEWX 5FLXE 1YJ9A 4JVHA 4IUQA 5M5XH 4MTNA 2RDGA 4XT3B 4C3JH 1O7IA 2RCFA 1B70B 1CQFA 3D31A 5K5PA 2K33A 4NBQA 3KBXA 4QIWB 1RODA 1UE1A 1PH7A 3H91A 3K6OA 2EYMA 1JOKA 2M6QA 1PTOC 3AFQA 2BA1A 4JV5H 3WWVA 4U68A 2E2JB 4JK1C 4DV1L 1X55A 1SFOH 1X9ZA 2ZT9C 3D4WA 1LT3D 1TY2A 5IGDA 5IYBH 4X62Q 5LMUL 3M85A 3FAUA 3MXNB 4UY8C 3GTOB 4AH6A 4A3MG 2UXDL 1F2ZA 2XIWA 2B39A 1I4PA 1KRTA 1QNUA 4DUZQ 4UP7A 1PTOH 5DM63 2VW9A 3MAQA 1F9QA 5ELOA 3VYRA 5KIXA 3NK9A 2D62A 3V69A 4A3KB 4NMZA 2M2LA 4XDXA 1SFOB 2F0LA 3EIVA 5GROA 1L0WA 4DR7Q 2F0GA 2UXCQ 1YITA 2Z6BA 4KHPH 1EYGA 5J22A 2DN8A 3QOLA 2NN6G 3DWPA 2B63G 2K5WA 1YJNA 1FKAH 2IHEA 3J7AF 3PIO3 4RGTA 3AQQA 4DV7L 3HOWG 4BY1G 3OTOL 2PQUA 3GKUA 2CFMA 3JAMc 4ZAIA 4LF6Q 2XRQD 4L5SA 3UDIA 1I94H 4PV1C 1G6ZA 2Q2UA 4I65A 2OTLA 2K4KA 2E74C 1ET9A 2F0TA 4JI1H 2ASBA 1L1OC 1IKLA 5J1ZA 5JJZA 4IUPA 1K73C 1HNZQ 1DOMA 1N36Q 4RAUC 3GTJH 2UUBQ 2NVXB 1PQXA 3DM3A 3LX0A 2V4DA 1P16A 1X56A 4MTKA 5CYUA 1EEID 3HFZB 4A3BB 5COYA 3FMCA 5I6YA 4DV4H 4Q5VA 5GAGC 3A74A 1STBA 2UUAL 1KAWA 4IQZA 4FYDA 3BDCA 3KLRA 4TSSA 1JT8A 2EXZA 5JVH3 4JV5L 1DZ1A 2ZQEA 5KNBA 2MJ8A 3KK7A 1N8RC 4DK3C 3NCVA 3PIOA 5C44H 4JI3L 1CHQD 2MO1A 5FJ8H 4LMQD 1YJWA 2UUCL 5A2QE 2EJGC 3EFXD 4JI7Q 3SXHA 1BCPF 2UXDH 2ZJPA 4DAPA 4BBSH 2WAQG 4B3RH 4WRDA 1SYDA 4PQXA 5JEAH 3TREA 1T5XD 4HIMA 2A68C 2AQ3B 4XXEA 5FOBB 1KIXA 4ZCKA 1EZ8A 3CCEA 3E5SA 3CU7A 1PA6A 1FNWA 1BO0A 1HQMC 5CGKA 3OETA 1NUCA 3F2BA 1W6KA 2N3SA 2ZJRA 4KHZA 1E0BA 5C44B 1R9TH 2N49A 1PRTC 1H9SA 2HQLA 2JXMB 3NELA 1AEXA 3ZYYX 4DR7H 1DOLA 2K7VA 3E0JA 4CDDC 4KKUA 4HCEA 4IOAA 5DT9A 3UE0A 3KDGA 1B7YB 1ET6A 1EWHA 1MKHA 2VUMG 4UPAA 3PO2G 1H9MA 2JA5B 4A75A 2I07B 3BJUA 1EU4A 2I0QA 2M9VA 3TP6A 1EY0A 5DLQE 4A3DH 1N34Q 3S9WA 4LF6H 1PVOA 3HOUB 1PH5A 1ZXTA 4X65Q 2NZHA 3T4AC 2MUYA 4IUTA 1VQOA 2HD3A 4K5WA 4PZ7A 4B3TQ 3I70A 2Z1CA 1TWAB 2EY6A 4FJSA 2KECA 3T13A 1D1IA 3KUPA 1SNMA 2JA5H 2QCPX 4LF9Q 3H0GG 2R93H 1AP0A 2E2HH 2A6HC 3D8GA 1S20A 1QZHA 1B9NA 1QB5D 1A2UA 2K03A 1EQVA 3HOUH 3HOZH 4H13C 5CV8A 2F0SA 2F0FA 1CA5A 5KRUA 2AWOA 1I6UA 4LF7Q 4GLVB 1XNRQ 4IPCA 4RKBA 3LWEA 2JA8G 4R8NA 3RNUA 2F4VH 4HAEA 4R9WA 3E6ZX 2IX3A 2DGRA 2E5LL 1KDAA 1HFGA 2Z0SA 4LAAA 3M4YA 2NWGA 4MN3A 4JI7L 1STAA 3R2TA 4UAIA 1G6PA 1EQTA 4FXGC 1EYDA 1SYFA 2KJXA 2UU9H 2HHHL 4HIKA 2B2TC 2L55A 3S14B 1MIUA 2KBNA 3TBIB 3HOVH 4A3GH 1T5EA 1A2TA 1IZ6A 2IY5B 1FNVA 2PZTA 4L6TB 4L5TA 2D2CC 5JPNC 3FVQA 1HZCA 4J1MA 5M5XB 4JI6Q 4DV0H 2PNRC 4C3JB 2B8GA 2EPBA 4N9PA 4NXMQ 2I5LX 3K80C 4CJ2C 2HDMA 2KHJA 4E6IA 4X3TA 1I4QA 1Q86C 2XWBB 2OT2A 1N34H 4YY3Q 1R9TB 1K28A 3EZJA 3J7A5 1UNSA 3QJYA 2O2LD 3VYTA 4NDXA 1LABA 3GQBA 5NUCA 1EY6A 2F0VA 1J8IA 1SNCA 4ABNA 1TS4A 2UUAQ 4DR2H 3OMCA 2MHVA 3GTPB 1ZEQX 1HNXL 5M3FB 2BCOA 4DK1A 5C3WA 1Y1VB 1Y1WG 1XTCD 4B3MQ 2HDLA 1SRUA 1FNUA 4G7OC 2F3VA 3S1NB 4OD6A 2WFWA 1A63A 2F0PA 3FKIB 5M3MB 1PHJA 1OXUA 4DR1H 2XSCA 5JEAJ 4WORA 2SNSA 3F2DA 3PUZA 3T1YL 1H9JA 1ILQA 2F4VL 3P20A 1RTNA 2O4CA 2FJ2A 2LTLA 1Y8NB 4KY6A 1N32H 4PZ6A 2CHBD 3A8JE 2PPBC 3GTQH 1EQRA 4NXNH 2MJHA 4YWLA 1NCVA 1BVSA 2TMPA 2ICIA 4UP9A 4YCUA 3OOCA 3BZCA 1WTQA 2UXCH 3NTHA 4X6AH 4CBVA 2K04A 3TZUA 1W6JA 2QEJC 4BBSG 1RJTA 4M1UB 3ICEA 4HIOA 4G08A 3IRBA 3J80W 1MSZA 4DR3H 5JEAG 5A2QW 4GOPB 3AFPA 4C2MB 3I3CA 1W2BA 5IWAH 1D2BA 2AKWB 2UU9Q 1LTGD 1CZGA 3MEFA 4DV3Q 3AU7A 3CCMA 3AMUA 3D4RA 1KC8C 1CKOA 4A3MH 1JWMD 3DEOA 4YCWA 3GTMB 1KABA 1Q7YC 1Y69U 2WINB 2OQ0A 4X3KA 3KF8A 1CTMA 2ZTEA 1IBLQ 4KD4A 1GUSA 3KBGA 1IXRA 2NVTB 1NE3A 1KNEA 4X66Q 4N9TA 3I91A 2JA7G 4JI3H 4K5XA 3RUZA 1M1KC 1EWCA 1VQ9A 4JPBW 2XN9C 1D6EC 4JI4L 1UUPA 3K5NA 3HOYG 2X6GA 1HZAA 4DR5H 3N6RA 3BVZA 1V43A 4DAMA 3PF5A 2SEBD 3S15B 1EQQA 1IW7C 4BY7B 1EY8A 3HKSA 2WB1E 4KKTA 4F87A 3WOFA 1SSOA 1F0XA 2FMMA 2R7ZB 4LF4L 4OCHA 3C2PA 2BH2A 4JBJA 2EXDA 5C6AA 1OXVA 5C5LA 5IYDG 2JP1A 1BBUA 1EIYB 2XVSA 4GLXA 3UE1A 1DM0B 1N36L 1U0LA 3LNNA 3NE5B 4LWCA 4U673 4OO1G 2JVZA 2JA8H 1WOCA 5IY0A 3GV6A 3QO2A 3UDGA 3KDKA 2VQEH 2P2RA 3CCSA 2YV5A 3CCUA 2D9IA 3S1MB 2EYLA 3BVGA 4F7XA 1ZTGA 1EY5A 1CHPD 3I4NG 2JZXA 4DV5H 3I4MB 3CF5A 2IX1A 3A55A 1LT5D 4MZ9A 3TDQA 5IWAQ 5C0XI 1STEA 2N88A 1JB3A 1VQAA 4OONA 2YQRA 5M5YH 1KQSA 3HOZB 5F2DA 4V0BA 1CSQA 2TSSA 1V9NA 4PMBA 1IBKL 5C4ZA 4C3IG 1XNQL 4K0KQ 1QJOA 3MHBA 3PF4A 2OWOA 4EC5A 1XNRL 1M90C 1Z7TA 4R4CA 5IOCA 1DGSA 4QUFA 3V05A 4DV1H 4OIJA 1CSPA 1VQNA 2YTYA 3WOEA 2WB1G 4B8CD 2E2JH 2CPMA 1EYAA 2JYOA 4N8X1 2RCNA 4CJ1B 3IL8A 4JI5Q 1Q90A 1KAAA 2K6AA 4DR5L 3CC2A 3Q0AA 1LTID 3GTLH 2F0MA 2LXJA 2PCFB 4PDBA 3HKZG 3KLSX 1VQMA 5I2XA 4YWKA 4LF4H 4AYBE 1TWFH 4ZUJA 1CKMA 2G9DA 4LF4Q 5FLXc 1B9MA 3P75A 4A3EH 2KENA 2X6LA 4P71A 2JK8A 2G9HD 1LLRD 5IGFA 5ISRA 3PCOB 3J81c 4OX9L 2KHSA 2XGTA 2VZAA 1EY4A 1GVPA 5J39A 3OPOA 1GJXA 1N33H 1VDZA 4A76A 3H0GH 2NTTA 2IW3A 3D6CA 1T9HA 4YHHL 4GLAC 4NB3A 1PH9A 1C8CA 4DV5Q 4S3SA 4J15A 1GD7A 1PH4A 1EFWA 1UE6A 4ME3A 3JAMi 4LF7L 1Y1VH 2R92G 2ZM6Q 4DR2L 2CWHA 1HNXH 4HTHA 4GKKL 3ULLA 1BNZA 2E5LQ 1HH2P 3PQIA 2L1BA 3PO3G 4B3RQ 3QOJA 2VQEQ 4JBWA 3URYA 1AN8A 3KDFB 2UUAH 1A0IA 4GKJH 2EDGA 2R61A 3T51B 1QVGA 1C48A 2AUJD 1WVLA 1PV4A 3QIAA 3CC7A 2QDLA 1IBMH 4GN3B 3NPPA 1SE8A 4A93G 3T1YH 2BDOA 3B6YA 4J6HA 5GQOA 4ZQ3A 2F0HA 1WVNA 3W1BA 1ML0D 4PMCA 2B29A 1YHAA 1HCZA 2V1CC 2M8WA 4OO1H 1B8AA 4BY7G 2E2DC 4RGMA 4X64L 2K5DA 3MZ5A 3LWUA 3K5MA 3M9BA 1WI5A 3PUVA 2ANNA 4FVMA 1Q1BA 1Q3LA 3MC0B 1XMQH 4J8QA 2Q8IB 2VB3X 1S03G 3A0JA 4RA8A 1STNA 5E3FA 1MJEA 2EYOA 1F9SA 4RHSA 4C2MH 5LL6X 1VCIA 1HQRD 1MJCA 1HA6A 2CTJA 2Z9HA 2RF4A 1QUQA 1XYIA 4OHJA 1PYSB 4Y7NB 2E3UA 5H1SE 3S2DH 4RGNA 1TKWB 3VYSA 4DR1Q 3PV0A 3TRZA 3M4QA 1SJHD 2VB2X 3VA7A 4DUYL 4AQYL 2A68D 4JI0Q 1B2TA 3S1RH 4DUZH 3VR4A 1PRTD 4B3SH 2NVYB 4R1JA 1TWFB 3UI2A 2YTVA 2KEDA 4EVOA 4C3HG 4H02A 1XX8A 5C4XB 3DWQA 3HOVG 3QR8A 4A3GG 1X4MA 3PIP3 4KI0A 4C1NI 5CC4A 4A3LG 4H8AA 4KK7A 1OO9B 4TRDA 2OF1A 2GVAA 2ICEC 3GP7A 3KLSA 3BYTB 5CBAE 1WJJA 3OW7A 1HTPA 2MP1A 4KMUC 2QA4A 1F2LA 1GUNA 1SXTA 1S5CD 1HTLD 1ONLA 3GDEA 2WACA 4CKCA 2R93B 2G5DA 3AYHB 4JBMA 5ELDA 2EIFA 1SYBA 4KHPQ 3E3XA 3R93A 3EROA 3KJOA 2L4NA 2R3ZA 2QGQA 1VQJA 1GUWA 4IJHA 1D8LA 1V1OA 4H7BA 1CUKA 4L5RC 4JI8H 2DY7A 4JVZA 1SROA 1B44D 2ID0A 2LFNA 4AIMA 3HOZG 4NP5A 1O7LA 4EQPA 2JA6B 1AZQA 1A62A 4JI7H 1HNZH 4K14A 1PMRA 5IGCA 3KFUA 4A3KH 1O80A 2HCIA 5BN4A 4X65L 2VQFH 1QUQB 2E76C 1RL2A 1MSHA 3I4MG 4P75A 3CQZB 4FXKC 3SR1A 1C0AA 2F03A 2CTKA 1R4PB 4QJFA 1BDOA 1B1ZA 3CCRA 4IPHA 3PUYA 4A3FB 3BG3A 1HR0W 4Z9CB 2QW7A 4DR6L 2ENBA 2A1AA 3FHWA 2FMRA 1XPRA 3S16B 4ME5A 4A3JB 4OXPA 2NN6H 2EY5A 1TU2B 4C3HB 1U4PA 4R4IA 2I46A 4JI4Q 3HOWH 1VQ6A 2MFIA 1CFMA 2QDBA 4K6DA 5HGQA 4FNFA 3TSSA 4OGQC 2Q2HA 1Y14B 5FO8B 2EYJA 5FLXW 4X3SA 2JQOA 3S1QB 2NVXH 4LF8L 3NBIA 4DAVA 1SMYC 1V1QA 1VQEA 1LM0A 3KDFA 3HOYB 2AUKA 2K50A 3HRZC 4JYAL 1WTPA 4TKOB 2AHOB 4QUCA 3CCVA 1WE8A 3HG9A 1PYBA 5FO7B 3J81E 1TWCB 4G57A 5IIFA 3OTOQ 1RF2D 1G8ZD 2EZVA 2NZOA 2L15A 2K01A 5K36G 2O5IC 1S5BD 3CPFA 3SK6A 1J6QA 3FDTA 1N32L 5CORA 3NUCA 1WD1A 1STYA 2SOBA 3SHLA 2P5ZX 1HNZL 2KQ3A 3HOXB 1L1OA 3NQTA 5BR8Q 4WALA 5LMNW 3OIQA 4G4KA 1A3VA 2F0IA 1SMXA 5AJ3Q 3C1FA 1EWIA 1EC6A 4K8JA 5D14A 1YBYA 1VBIA 2HQEA 1I5FA 2EYHA 4C3IH 4HSVA 1VQFA 4B9XA 4FF2A 4DR3L 5FLMG 1FJGL 4B3TH 4DR6H 4LF7H 4JW0A 5KNDA 2KHIA 2DNCA 1HR0L 4WJ3M 1K8MA 4DV1Q 4NXNQ 3NP8A 2DJFC 2PYKA 3DEPA 2IHFA 1JC7A 5DM73 3CD6A 3CCJA 4XIGS 5TSSA 4C1NK 1JORA 1FL0A 2PT7G 1V1PA 2K5HA 4JYAQ 4A3DG 5E1FA 4A93B 1JQYD 1LO5D 4GKJL 4HEDA 4DV2L 3J80E 4A3FH 3P7JA 1TWAH 2KCMA 5FKAC 1TWHH 5FJ8G 4LF8H 5FLXL 4IUNA 1J5EL 3IKJA 1I6VC 4NKLA 4A3JH 1B50A 1WHRA 4RWSC 4QCLA 5EPJA 2VY3A 3S2HB 2LXKA 2RHSB 4DV4Q 3HP3A 1TWGB 1ENCA 2QEXA 1Q12A 4RKLA 1O7YA 2B2UC 4CHTB 1KNAA 3GV3A 2LTMA 3NWTA 1XMQL 1KL9A 4A3DB 2K32A 4JBKA 1L2FA 3RLNA 1WCMH 3HOYH 3SK5A 3ULJA 4DV6Q 3EBEA 3U9OA 3F1ZA 3STBC 4A3IB 3OHXC 3U4ZA 1XJVA 2SDFA 4KY7A 2PZWA 4K8IA 5IP9G 3GTGH 2F3WA 4RH6A 4DUYQ 4POGA 4LFBQ 1SYEA 4LIJA 1RDPD 3J81L 3GTQB 5IGGA 3VR6A 4AM3A 2UXBL 2IPKD 3GABA 4K2LA 1Y8OB 4WJWA 3OTOH 1LV9A 3DWAA 3S17H 1WTWA 4PMWA 1I94L 3PO3H 2F0JA 3RZDH 1FD7D 1EIHA 1ASZA 4DXFA 3W3AA 3G48A 5T1IA 4DV5L 1RD9D 5M5WH 1I4GA 3G6EA 1FJGH 4B3TL 1SJED 1SEBD 1EL0A 2CTFA 1TR5A 1K3RA 3OIPA 1UWVA 1DT4A 4LUVA 4ULLA 2MNAA 3HGBA 4RGOS 5E4WC 2E2IB 3CW2C 5EBCA 4P74A 1PZID 1LTTD 5EJWA 1IHZA 3H09A 4R4OA 1IBKH 5C3EB 2CWPA 3R3OA 2K28A 5M5YB 4HJ8A 1XNRH 2JN4A 3S14H 3KF8B 5D3DA 1J9OA 1TS2A 5M5WB 1ICFB 4BXXH 1U4RA 1Z2IA 1E22A 2JA6H 4JG2A 3RN2A 3GD7A 3BYYB 1YZ6A 3X3NA 2PMZE 1O78A 2JSOA 3STBD 4MNOA 1UAPA 3A7AB 4IUUA 1TT2A 1KRSA 2O4XA 3DUZA 2B63H 1SEIA 5FK9C 3G6JB 3U1KA 1D5XC 4CDCC 5GAHC 4FJUA 2Q2IA 4BY1H 2FFMA 3NTIA 4P2CB 2J0TD 4XT1B 3OSOA 1IL8A 3H3VI 3RZOB 5D3IB 1B3AA 2ATWA 5L37A 3CKIB 1VQHA 4EGVA 2E8GA 2C9OA 4GNXB 1HRJA 1KDBA 2LKVA 3VR3A 4C3HH 3A5UA 4H0LC 1PZKD 5JOBA 2EQSA 1MD2D 2RSNA 1EOTA 3CMEA 1L0YB 4JI5H 2YU9B 4A3EB 1YVCA 4B3ML 4RCNA 1UEAB 2H5XA 4O0AA 2CW0C 3K57A 1VF5C 5C4HA 4LF9L 1OTCA 1VQLA 5CV6A 4F88A 3AEVA 2ZXOA 2CTEA 1CM9A 1NNXA 1PRTF 4RFBA 1AW7A 3BZKA 4ZYSA 5ELBA 4DR5Q 2I5MX 4MHEA 2F0EA 2WKDA 3GTKB 3W1GA 4B8TA 3A7LA 3OWFA 4KKSA 3RZDB 2NVTH 4L5QA 1DOKA 3ERQA 1YNXA 2D5DA 2HHHQ 1VF7A 4C3JG 4NXMH 1OXSC 5JJLA 2PW7A 1VQPA 2Q2TA 1N32Q 1HNWH 1S40A 3NQIA 2E2IH 3HOXH 2Z8LA 3Q8DA 1X6OA 1TS5A 5LL6S 3CAMA 5DEHA 2E2HB 3A5ZB 3HS0C 3CC4A 2M00A 4X64H 2UU9L 5IYBG 1MGSA 3K81C 1U9RA 2VUMH 4A3JG 3M3YB 3GR5A 1YHQA 4B9WA 3GTMH 1OXTA 5KNCA 4HJ5A 2B2TA 1PFSA 4LFCL 3CMAA 2SNMA 2FXQA 1K83B 2F0OA 3T1HH 3J7ZC 3TN2A 4DAYB 1SYGA 3Q22A 2Y0SB 2KCTA 3OMGA 5IYDH 5IODA 3LGJA 5C0XG 1IKMA 1HR0H 5JJKA 2AWNA 1A15A 3CHBD 2B63B 3I55A 5GAEC 2CTLA 3S1MH 4QIWE 3D4DA 1K3BC 1S4ZA 5ELEA 4R8IA 1PTOF 1TWHB 2PZUA 3T16A 3J7AV 2B2WA 5DAUA 2OQKA 1H95A 1UG8A 4LF9H 3I4MH 1QE6A 3PUWA 3S1RB 4X66H 4DV2H 1M8AA 2OEOA 2JA7H 2NVYH 3QB3A 2K1BA 1K83H 3JAML 2H4OA 4JOIC 1E2VA 2J7ZA 1ASYA 1ZYRD 3MFYA 3O13A 2R6GA 2YU9H 1IW7D 3BU2A 1EIFA 2NVQH 1KDCA 2D0OA 1D7QA 3EA6A 4OWWB 4EQNA 1NR4A 1F77A 2NTSA 1JICA 5C0XJ 2CH4A 3FP9A 2ZTDA 1RIPA 4BBRB 3SDZA 1LACA 1X65A 1S5DD 1Q82C 3ZJYC 1AZPA 1IBLH 1NMFA 3W2DA 5CBEE 5LMUH 4TQUS 4CDFC 1HHVA 4P72A 3SK8A 4UDUC 3R2IA 3H6MA 2WB1B 3F2CA 4JI8L 3CRKC 4DNTB 1CK1A 5IE8A 2ZM6H 1TQOA 5I4DA 2N55A 1JB7A 2RSOA 1X3GA 3S17B 4LFAQ 1RTOA 3P1HA 3VA5A 5J3BA 2F0NA 2UXBH 2R7FA 4ZK9B 2VQFL 2EJMA 2MPMA 4GOPC 2RA4A 1X32A 3NBHB 1K8GA 5LMNH 2UXDQ 1F2YA 1M4VA 5I9PA 3RF2A 2GA4B 4LFCH 3PGZA 1XWEA 1FGUA 3D0FA 4OEMB 5CV7A 3KLWA 1G91A 3PMFA 5M3MG 1D5MC 1U4MA 1Q8KA 4JCVE 3J80L 5EKLA 5IWAL 1HZ9A 2GVBA 3RLFA 1LYLA 3JAMW 2A73B 1QWYA 1LTBD 2MGSA 3Q23A 3AEVB 1I50H 1DD2A 5EPKA 3VYUA 3EVQA 2CQOA 4G7ZC 2EY1A 3MXGA 1Y1WH 3T1YQ 2FHTA 4UP8A 3KF6A 3HOWB 3RR5A 4IZ8A 3HEJA 1YNJC 4L8JA 4ZUIA 3J81i 4JI2L 1FR3A 3GO5A 4LW1A 3WDNA 4XYQA 1NAPA 1FYCA 4WANA 4I7ZC 2EOTA 2O5JC 4WFN3 2X06A 3J7YW 4IPDA 1I4XA 1X54A 2RKSA 5C4JH 3CCQA 3DHQA 3MXPA 4EX5A 3L0OA 1SE4A 2NN6I 1ZKOA 2ALYB 3FPPA 2B2UA 1RKNA 4DV4L 4BBSB 1LT6D 2JEBI 3G7LA 4WJ4A 1BKBA 2IWHA 1H9KA 3VR2A 2HCCA 3NSWA 2I5HA 1VQGA 2B2VC 5LL6b 1GHJA 1SE3A 5G3LD 3TS0A 3T53B 3JAME 1VIGA 1SMYD 5EKKA 1JOOA 2KCNA 5EAYA 2UUCH 1TWCH 3K58A 4QF4A 3U4VA 3SK4A 2IL8A 5AFWA 1A8VA 4PG3A 5C4JB 1X0AA 2K75A 2PQAB 1L1OB 4KD3A 4HJ9A 2QNDA 4TVAB 1E3PA 3BVMA 1PXUA 2EE1A 1ESRA 1WTOA 3NWSA 3J80i 4BY7H 2C5CA 5DNFA 4LF5Q 2NBFA 2KA7A 1DTJA 1BR9A 1AFPA 1GM5A 2NB0A 2VQEL 2CWFA 1YNND 4UHVA 5I9OA 2HUGA 4DR7L 1GUOA 1Y1VG 2A19A 2R92H 1CZWA 2OTJA 2QF7A 1PYWD 3BDLA 1DYQA 1QVFA 5I2YA 1VMPA 5KYIA 3N52A 5EBDA 4X3UA 4C3IB 4LJZC 1JE4A 4ODGA 5KEEA 1PLFA 4GNXC 1O7ZA 4LF6L 4NW2A 2HH3A 1DCZA 5FLMH 1PH2A 1GOZA 1XNQH 2CW0D 1PFBA 3F8TA 4DV3H 1EU3A 2KCCA 3MVVA 4YWMA 5C0XH 1JE5A 4O42A 2RQXA 1NMGA 3K0YA 5EPLA 1J5EH 2ZXRA 2OPUA 3ONAB 4H44C 2FPHX 1SYCA 4NZRM 4JI6H 1HNWL 4GKJQ 5JVG3 3EQLC 3BS1A 1XPOA 4A4IA 3S2DB 2B3GA 2N8NA 4LUZA 1Q81C 1SNOA 2K5VA 4HSPA 2VUMB 5JPMC 3RN5A 4OELB 1JWSD 3PO2B 2PY9A 3TMEA 2VNUD 1SN8A 1IBMQ 4JV5Q 5BN3A 5HURA 1S72A 4CJ0B 2D0PA 4YY3H 3MWYW 3IAYA 3HOVB 4A3GB 3FKIG 4XTCS 2K14A 3A54A 3UDFA 1CQVA 1NY4A 1MSGA 5FO9B 5CV5A 1WTJA 2AQ2B 3M4OB 2B2VA 2CWAA 3V96A 5C3XA 1EOVA 5EQ0A 1TY0A 2AQ1B 2Y3MA 1SNDA 4X62L 1LT4D 1J5KA 2OXPA 5AJ3L 1E1TA 3W5OA 3VKEA 3NTKA 1JCKB 2G8YA 2HHHH 2F0UA 3I2ZA 3GTLB 1WCMG 4KJOA 2B2WC 1PH3A 1A3TA 2QILA 1VQ4A 2F0WA 3NBHA 2ANRA 1V1PB 1RCVD 1QNKA 5IYCH 1E24A 5A2QL 5CV4A 2LF0A 4X66L 2F3IA 4YHHH 4YIJA 1IYVA 2B2YA 2WAQE 4G7HC 5E7NA 4E9JA 2JEAI 5M9OA 3MXUA 4LFBH 1SE2A 1YHBA 4GKKH 4A3BG 3QG1A 5KGUA 2VL6A 1SDFA 1G291 4IUVA 4A3IG 3I56A 2K5QA 1Q8IA 1HFNA 5BR8H 1ZZJA 5M3MH 4DU9A 2QKIC 3FPUB 4X64Q 1GHKA 5C3EH 1IBML 4FXDA 2CCZA 2B8FA 4KHVA 1EFID 1JJ2A 1Z47A 4KN4C 1C4QA 1VQBA 3J7AK 3S2HH 1LUZA 1UE5A 1X3QA 2PMZB 4POFA 2VQFQ 1NBWA 2CKZB 1YIJA 4NZTM 3SE0A 1Q1EA 4A3EG 1HJPA 3A8IE 3K7AH 3I73A 3HOUG 1STHA 2GN5A 1S5ED 1GUGA 2PQAA 3Q24A 1F9RA 1R4QB 1Z9FA 2A6HD 4JI8Q 1YI2A 1L0XB 1BCPB 4QGUA 4RHRA 1N9WA 4GKKQ 1WCMB 3BZDB 4NXNL 4O1NA 1EIGA 5CV9A 3RZOH 3U9SA 2B2YC 4GOPA 1KLGD 2NYZD 3MEHA 4DAYA 3HOXG 1A6XA 4JI5L 2ZJQA 4DUYH 1VQCA 3TP8A 2RDFA 1FGBD 1I6HB 3R8BA 2UXCL 1XNQQ 4K0KL 3RD4A 2Z4HA 4B3MH 4KLKA 4DUZL 2D9UA 1X9NA 3OSSD 4A3MB 3C1EA 2F0DA 4JI2Q 5E4XA 5KYLA 1XPUA 2BDNA 3I72A 1GKHA 2HIVA 1ZZIA 1PTOD 2DNEA 3EN2A 2RDHA 3QD7X 4JI2H 4A3CH 2A6ED 2DGYA 4IALA 1WTXA 4YCVA 2R93G 1V8CA 1VQ7A 4A93H 3G4SA 3MA2B 1BQQT 4HN7A 4KTAA 1XMQQ 3TQYA 3SEBA 1BUVT 1WFQA 1S5FD 5IP7G 3F2UA 2YYZA 3S15H 1NSNS 1X3FA 3PSIA 4ID6A 4DNIA 2IJ0A 3GTOH 1CT1D 3ND8A 4JC0A 3M4PA 1HPCA 1TXYA
chains in the Genus database with same CATH topology
2LMCB 2Q8RE 5C5MA 2EYFA 1PTOB 5LHY1 1GO3E 1TWGH 4PNYA 3U58A 4DXGA 3J80c 1VQIA 1K1GA 4GN5A 4B08A 5ELFA 1AE3A 4LFAL 1HR0Q 1WTRA 3KYHC 2UUCQ 1MBYA 3DMUA 1SAPA 1K9MC 3I8ZA 1EUJA 3IFTA 4RMFA 4KY5A 4K5VA 1QVCA 1ESFA 4R4QA 2JA9A 1IBKQ 2BOSA 4V190 2XTIA 2F4VQ 2WAQB 3GTPH 4BY1B 1EY7A 5EGTA 2KVMA 4XQNA 1XMOQ 1FJGQ 4ILWA 4JI3Q 4QMFB 5A35A 5IP9H 2IT1A 1U5KA 1KHIA 3FKIH 4FO2A 3K7AB 2L0CA 3X3MA 3PO3B 1IL2A 4A3FG 4OWTB 4CKBA 1D1KA 1TIID 4ZKCB 3GTJB 1UE7A 1KD1C 3TP5A 1K8AC 1XTDA 1GUTA 3S16H 1X3PA 3CPWA 4JI6L 2PQEA 2VS1A 4JI1Q 4BS9A 2X69A 1QZGA 3CRLC 4MIUA 1KLUD 2H1EA 1WYDA 5CR3A 1U4LA 4FF4A 2EVBA 2PO4A 3TZDA 2KUMA 2PI2A 1LTLA 2Y0SG 2JE6I 2UXBQ 4OX9Q 3E9IA 1ZYRC 1NR2A 4LF5L 2Z6KC 4DV0Q 4YY3L 4FDBA 1IBLL 3S1NH 2RHQB 5ELNA 4DR6Q 5D65A 3ER0A 4QL5A 1LTSD 3RMHA 2AMCB 1VMCA 5IT9L 4HJ7A 5G3LF 2EYPA 3C3LA 2CQAA 3A56A 2VXWA 1PZJD 2Q8TA 4IJLA 3G71A 2ZM6L 4ALPA 4QY7A 4DR2Q 1VQDA 4M8AA 4GS3A 3L2PA 4QB4A 1E2WA 1Z6HA 4ZRZA 3KOJA 2FMCA 2NUCA 1JMCA 4ZLTF 1NTGA 4P73A 5LMNL 3Q6SA 4HIDA 4DR4L 4PZ8A 3K7UC 3K59A 3PUXA 4GZYC 3I7FA 3ND9A 1OXXK 2DUDA 2LSSA 1HUMA 4O2DA 2F4IA 3T1HQ 2KEEA 4LK1C 1Q46A 1H9SB 5IGEA 3IFDA 1NJIC 2HT1A 1EYCA 1N33L 3CXCA 2BA0A 3L9AX 2NZ1D 4DFAA 5EKIA 4RG1A 2RBMA 3NENA 1I50B 4BXXG 2A69D 1IYUA 1H9RA 4HMIA 3SVMA 5C4XG 1MI2A 5M3FH 3I4NH 1V9PA 4AYBB 3GTKH 1W3SA 4NPSA 3TS2A 1C9OA 2PI2E 4IURA 2CVRA 3V2TA 1I94Q 1Y8PB 4DNRB 2K05A 1KXLA 1D5ZC 2DY8A 4CKEA 1VQ5A 2LY7A 4LNQA 4HMJA 2J4XA 2OPVA 1XXGA 1SNQA 4AQYQ 1BBWA 3S24A 1VQ8A 4K2KA 2C35B 4JI0L 2KOLA 2MO0A 5IT9c 1BCPD 4A3CG 2WIIB 3CP0A 1SNPA 1TS3A 1BF4A 1KTKA 2BL5A 3K5LA 3C46A 3AB9A 4GNXA 1JOQA 3I4NB 3KJPA 2R7ZH 1QCBD 4IFDG 2AXYA 3M7NA 3U50C 3OYYA 3PIPA 1EY9A 1AH9A 1HA5A 3TP7A 3RLOA 4BA1I 1PH6A 4DV2Q 1FVIA 2OCEA 2F0KA 3KF6B 1QG7A 1BBXC 4XQQA 1TVXA 1UEBA 2WKCA 3H15A 3I4LA 4R4TA 1N33Q 3FRPB 4A3IH 5LMNQ 4KHPL 5BN5A 4A3KG 4EQ5A 4FP5D 2A6EC 3GTGB 2JA5G 4DK0A 2K52A 2MQHA 2PNHA 1CI3M 1HXYD 1E7ZA 2A69C 5C3EG 1DJRD 1ZZKA 4L63B 4IFDJ 1DXMA 3CCLA 4B3SL 2ZXPA 3HKZE 4KJNA 5CMDA 1N34L 2FFKB 2F52A 2A8VA 1E2ZA 1B4OA 3I4OA 2Y0SE 1YNNC 4AYBG 4DV6L 1F2MA 4JI1L 1WTVA 3K5OA 4DV3L 3TEHB 3K8AA 2LS01 4JOIA 3H94A 1J4WA 2EJFC 5I6WA 4DGZA 4Q0FA 3MFGA 1BCPC 1KHMA 3NEMA 2IX0A 4BBRH 3MXNA 2UUBL 1QILA 4LUOA 1X4NA 3K0XA 3QWNA 3BDOA 1ICWA 4A3BH 2RVLA 3D6WA 5GADC 2EY2A 4DR1L 3SGIA 4HJAA 1JJCB 3CQZH 1VQKA 4RCOA 3OWEB 2E75C 1GXDC 1C7YA 2CPQA 2WV6D 4ZKBB 4EQOA 4DR3Q 1XMOL 4LFCQ 1PFNA 1SBBB 4OIKA 2JA7B 1PH1A 4B3RL 1G2TA 3VDYA 4JVYA 3OW2A 4DKAC 1VIHA 4F8MA 1PDQA 4OL7A 2A5HA 2BH8A 3H3VH 1RHPA 4HR7B 2WP8J 1AE2A 2NVQB 5JJIA 3EJIA 5K36H 1K0RA 1WD0A 3DM1A 3UDXA 2Z6KA 3I90A 1PH8A 4QQBX 3MTSA 3T56B 4FF1A 4OWXB 5ELCA 4FF3A 1HNWQ 4Y52H 1G2SA 5M3FG 3DLLA 3HZXA 1I4RA 1JR0D 3S1QH 5IP7H 4IFDI 1HZBA 1YEZA 1LTRD 2R92B 3JC66 1TUAA 2XWJB 3E0EA 1BOSA 2L9HA 2YTXA 4LFBL 2PW5A 1SR3A 5IYCG 2F0QA 2JA6G 1DONA 1JWUD 1CKNA 1PFMA 1ILPA 1SLJA 2HIXA 4DK6C 1K8OA 4B3SQ 2BE5D 4IN3A 4XYOA 1A3UA 5BR8L 2ZTCA 4XQJA 1IYJB 1B53A 1CA6A 1JJGA 1EZ6A 3E9HA 1BXTA 4NXML 4YHHQ 2L11A 4IFDH 1STGA 5HY6A 4A3LH 4KN7C 1P8LA 1G51A 1V8QA 2Z4IA 3NXWA 3L3OC 4DA2A 1E1OA 4DPGA 3ITPA 4QMGA 1S3OA 3NHHA 5LMUQ 4BA2I 2HH2A 5C4XH 2FINB 3J81j 1VS0A 3PO2H 3VR5A 2L5TA 1ENAA 4APVA 2CTMA 1CKNB 4OO1I 1II3A 1Y1WB 5T1GA 1I3QH 1HNXQ 3DXJC 4DF7A 2R7DA 2F1MA 5IGBA 4BWGB 3M4OH 5C44G 4K6LA 1J5EQ 3T1HL 2JA8B 3D3RA 4GN4B 3HKZB 4LF8Q 2L12A 4DN4M 1ENFA 2XNAC 1QOHA 4IO9A 4Y7NH 2ES2A 1F9PA 1X3EA 1YNJD 1HUNA 3ERSX 4IPGA 1EEFD 4DR4Q 3M7GA 2N78A 3H0GB 1LTAD 3M3YH 4IOCA 2R7ZG 2A74C 1I6HH 5IT9E 4C56C 1I3QB 3ULPA 4HCSA 4CGYB 2JJQA 3L7ZC 2XRSD 4KV6A 4DV0L 4DV7Q 1I4HA 2BE5C 3A8KE 5HGTA 1PRTB 4BBRG 2K5NA 5JAVA 3H3VC 3FEWX 5FLXE 1YJ9A 4JVHA 4IUQA 5M5XH 4MTNA 2RDGA 4XT3B 4C3JH 1O7IA 1B70B 1CQFA 3D31A 5K5PA 2K33A 4NBQA 3KBXA 4QIWB 1RODA 1UE1A 1PH7A 3H91A 3K6OA 2EYMA 1JOKA 1PTOC 3AFQA 2BA1A 3WWVA 4U68A 2E2JB 4JK1C 4DV1L 1X55A 1SFOH 2ZT9C 3D4WA 1LT3D 1TY2A 5IGDA 5IYBH 4X62Q 5LMUL 3M85A 3MXNB 4UY8C 3GTOB 4AH6A 4A3MG 2UXDL 1F2ZA 2XIWA 2B39A 1I4PA 1KRTA 1QNUA 4DUZQ 4UP7A 1PTOH 5DM63 2VW9A 3MAQA 1F9QA 5ELOA 3VYRA 5KIXA 3NK9A 2D62A 3V69A 4A3KB 4NMZA 2M2LA 4XDXA 1SFOB 2F0LA 3EIVA 5GROA 1L0WA 4DR7Q 2F0GA 2UXCQ 1YITA 1EYGA 5J22A 2DN8A 3QOLA 2NN6G 3DWPA 2B63G 2K5WA 1YJNA 2IHEA 3J7AF 3PIO3 4RGTA 3AQQA 4DV7L 3HOWG 4BY1G 3OTOL 2PQUA 2CFMA 3JAMc 4ZAIA 4LF6Q 2XRQD 4L5SA 3UDIA 4PV1C 1G6ZA 2Q2UA 4I65A 2OTLA 2K4KA 2E74C 1ET9A 2F0TA 2ASBA 1L1OC 1IKLA 5J1ZA 5JJZA 4IUPA 1K73C 1HNZQ 1DOMA 1N36Q 4RAUC 3GTJH 2NVXB 2UUBQ 3DM3A 3LX0A 2V4DA 1P16A 1X56A 5CYUA 1EEID 4A3BB 3HFZB 5COYA 3FMCA 5I6YA 4Q5VA 5GAGC 3A74A 1STBA 2UUAL 4IQZA 4FYDA 1KAWA 3BDCA 3KLRA 4TSSA 1JT8A 2EXZA 5JVH3 1DZ1A 4JV5L 5KNBA 2MJ8A 3KK7A 1N8RC 4DK3C 3PIOA 5C44H 4JI3L 1CHQD 2MO1A 5FJ8H 4LMQD 1YJWA 2UUCL 5A2QE 2EJGC 3EFXD 4JI7Q 3SXHA 1BCPF 2ZJPA 4DAPA 4BBSH 2WAQG 4WRDA 1SYDA 4PQXA 5JEAH 3TREA 1T5XD 4HIMA 2A68C 2AQ3B 4XXEA 5FOBB 1KIXA 1EZ8A 3CCEA 3E5SA 3CU7A 1PA6A 1FNWA 1BO0A 1HQMC 5CGKA 1NUCA 3F2BA 1W6KA 2N3SA 2ZJRA 4KHZA 1E0BA 5C44B 1R9TH 2N49A 1PRTC 1H9SA 2JXMB 3ZYYX 2HQLA 1AEXA 3NELA 1DOLA 2K7VA 3E0JA 4KKUA 4HCEA 4IOAA 3UE0A 1B7YB 1EWHA 1MKHA 2VUMG 4UPAA 3PO2G 1H9MA 2JA5B 4A75A 2I07B 3BJUA 1EU4A 2I0QA 2M9VA 3TP6A 1EY0A 5DLQE 4A3DH 1N34Q 3S9WA 1PVOA 3HOUB 1PH5A 1ZXTA 4X65Q 2NZHA 3T4AC 2MUYA 4IUTA 1VQOA 4K5WA 4PZ7A 4B3TQ 3I70A 2Z1CA 1TWAB 2EY6A 2KECA 3T13A 1D1IA 3KUPA 1SNMA 2JA5H 2QCPX 4LF9Q 3H0GG 2R93H 1AP0A 2E2HH 2A6HC 3D8GA 1QZHA 1B9NA 1QB5D 1A2UA 2K03A 1EQVA 3HOUH 3HOZH 4H13C 5CV8A 2F0SA 2F0FA 1CA5A 5KRUA 2AWOA 4LF7Q 4GLVB 1XNRQ 4IPCA 4RKBA 3LWEA 2JA8G 4R8NA 3RNUA 4HAEA 4R9WA 3E6ZX 2IX3A 2DGRA 2E5LL 1KDAA 1HFGA 4LAAA 2Z0SA 3M4YA 2NWGA 4MN3A 4JI7L 1STAA 3R2TA 4UAIA 1G6PA 1EQTA 4FXGC 1EYDA 1SYFA 2KJXA 2HHHL 4HIKA 2B2TC 2L55A 3S14B 1MIUA 3TBIB 2KBNA 3HOVH 4A3GH 1T5EA 1A2TA 1IZ6A 2IY5B 1FNVA 2PZTA 4L6TB 4L5TA 2D2CC 5JPNC 3FVQA 4J1MA 5M5XB 1HZCA 4JI6Q 2PNRC 4C3JB 2B8GA 2EPBA 4N9PA 4NXMQ 2I5LX 3K80C 4CJ2C 2HDMA 2KHJA 4E6IA 4X3TA 1I4QA 1Q86C 2XWBB 2OT2A 4YY3Q 1R9TB 3J7A5 1UNSA 3QJYA 2O2LD 3VYTA 4NDXA 1LABA 3GQBA 5NUCA 1EY6A 2F0VA 1J8IA 1SNCA 4ABNA 1TS4A 2UUAQ 3OMCA 2MHVA 3GTPB 1ZEQX 1HNXL 5M3FB 2BCOA 4DK1A 5C3WA 1Y1VB 1Y1WG 1XTCD 4B3MQ 2HDLA 1SRUA 1FNUA 4G7OC 2F3VA 3S1NB 2WFWA 1A63A 2F0PA 3FKIB 5M3MB 1PHJA 1OXUA 2XSCA 5JEAJ 4WORA 2SNSA 3F2DA 3PUZA 3T1YL 1H9JA 1ILQA 2F4VL 3P20A 1RTNA 2FJ2A 1Y8NB 4KY6A 4PZ6A 2CHBD 3A8JE 2PPBC 3GTQH 1EQRA 2MJHA 4YWLA 1NCVA 1BVSA 2TMPA 2ICIA 4UP9A 4YCUA 3OOCA 3BZCA 1WTQA 3NTHA 4X6AH 2K04A 3TZUA 1W6JA 2QEJC 4BBSG 1RJTA 4M1UB 3ICEA 4HIOA 3IRBA 5JEAG 4GOPB 4C2MB 3AFPA 3I3CA 1W2BA 1D2BA 2AKWB 2UU9Q 1LTGD 1CZGA 3MEFA 4DV3Q 3AU7A 3CCMA 3AMUA 3D4RA 1KC8C 1CKOA 4A3MH 1JWMD 3DEOA 4YCWA 3GTMB 1KABA 1Q7YC 1Y69U 2WINB 2OQ0A 4X3KA 3KF8A 1CTMA 2ZTEA 1IBLQ 4KD4A 1GUSA 3KBGA 2NVTB 1IXRA 1NE3A 1KNEA 4X66Q 4N9TA 3I91A 2JA7G 4K5XA 3RUZA 1M1KC 1EWCA 1VQ9A 2XN9C 1D6EC 4JI4L 1UUPA 3K5NA 3HOYG 2X6GA 1HZAA 3N6RA 3BVZA 1V43A 3M4PA 4DAMA 3PF5A 2SEBD 3S15B 4BY7B 1IW7C 1EQQA 1EY8A 3HKSA 2WB1E 4KKTA 4F87A 3WOFA 1SSOA 2FMMA 2R7ZB 4LF4L 3C2PA 2BH2A 4JBJA 5C6AA 2EXDA 1OXVA 5C5LA 5IYDG 2JP1A 1BBUA 1EIYB 2XVSA 4GLXA 3UE1A 1DM0B 1N36L 1U0LA 3LNNA 3NE5B 4U673 4OO1G 4LWCA 2JVZA 2JA8H 1WOCA 5IY0A 3GV6A 3QO2A 3UDGA 2P2RA 3CCSA 2YV5A 3CCUA 3S1MB 2EYLA 3BVGA 4F7XA 1ZTGA 1EY5A 1CHPD 3I4NG 2JZXA 3I4MB 3CF5A 2IX1A 3A55A 1LT5D 4MZ9A 3TDQA 5IWAQ 5C0XI 1STEA 2N88A 1JB3A 1VQAA 4OONA 2YQRA 5M5YH 1KQSA 3HOZB 5F2DA 4V0BA 1CSQA 2TSSA 4PMBA 1IBKL 5C4ZA 4C3IG 1XNQL 4K0KQ 1QJOA 3MHBA 3PF4A 2OWOA 1XNRL 1M90C 1Z7TA 4R4CA 5IOCA 1DGSA 4QUFA 3V05A 4OIJA 1CSPA 1VQNA 3WOEA 2YTYA 2WB1G 2E2JH 1EYAA 2JYOA 2RCNA 4CJ1B 3IL8A 4JI5Q 1Q90A 1KAAA 2K6AA 4DR5L 3CC2A 3Q0AA 1LTID 3GTLH 2F0MA 2LXJA 2PCFB 3HKZG 3KLSX 1VQMA 5I2XA 4YWKA 4AYBE 1TWFH 4ZUJA 1CKMA 2G9DA 4LF4Q 5FLXc 1B9MA 3P75A 4A3EH 2KENA 2X6LA 4P71A 2JK8A 2G9HD 1LLRD 5IGFA 5ISRA 3PCOB 3J81c 4OX9L 2KHSA 2XGTA 2VZAA 1EY4A 5J39A 1GVPA 3OPOA 1GJXA 1VDZA 4A76A 3H0GH 2NTTA 2IW3A 3D6CA 1T9HA 4YHHL 4GLAC 4NB3A 1PH9A 1C8CA 4DV5Q 4S3SA 4J15A 1GD7A 1PH4A 1EFWA 1UE6A 4ME3A 3JAMi 4LF7L 1Y1VH 2R92G 2ZM6Q 4DR2L 4HTHA 4GKKL 1BNZA 3ULLA 2E5LQ 1HH2P 2L1BA 3PO3G 4B3RQ 3QOJA 2VQEQ 4JBWA 3URYA 1AN8A 3KDFB 1A0IA 2EDGA 2R61A 3T51B 1QVGA 1C48A 2AUJD 1WVLA 1PV4A 3QIAA 3CC7A 4GN3B 3NPPA 1SE8A 4A93G 2BDOA 4J6HA 3B6YA 5GQOA 4ZQ3A 2F0HA 1WVNA 3W1BA 1ML0D 4PMCA 2B29A 1YHAA 1HCZA 2V1CC 4OO1H 1B8AA 4BY7G 2E2DC 4RGMA 4X64L 2K5DA 3MZ5A 3LWUA 3K5MA 3M9BA 1WI5A 3PUVA 2ANNA 4FVMA 1Q1BA 1Q3LA 3MC0B 4J8QA 2Q8IB 2VB3X 3A0JA 4RA8A 1STNA 5E3FA 1MJEA 2EYOA 1F9SA 4RHSA 4C2MH 5LL6X 1VCIA 1HQRD 1HA6A 1MJCA 2CTJA 2RF4A 1QUQA 1XYIA 4OHJA 1PYSB 4Y7NB 2E3UA 5H1SE 3S2DH 4RGNA 1TKWB 3VYSA 4DR1Q 3PV0A 3TRZA 3M4QA 1SJHD 2VB2X 3VA7A 4DUYL 4AQYL 2A68D 4JI0Q 1B2TA 3S1RH 3VR4A 1PRTD 2NVYB 4R1JA 1TWFB 3UI2A 2YTVA 4EVOA 2KEDA 4C3HG 4H02A 1XX8A 5C4XB 3DWQA 3HOVG 4A3GG 1X4MA 3PIP3 4KI0A 4C1NI 5CC4A 4A3LG 4KK7A 1OO9B 4TRDA 2OF1A 2GVAA 2ICEC 3GP7A 3KLSA 3BYTB 5CBAE 1WJJA 3OW7A 1HTPA 2MP1A 4KMUC 2QA4A 1F2LA 1GUNA 1SXTA 1S5CD 1HTLD 1ONLA 3GDEA 2WACA 4CKCA 2R93B 4JBMA 3AYHB 5ELDA 2EIFA 1SYBA 4KHPQ 3R93A 3EROA 3KJOA 2L4NA 2R3ZA 2QGQA 1VQJA 1GUWA 4IJHA 1D8LA 1V1OA 4H7BA 1CUKA 4L5RC 2DY7A 1SROA 2ID0A 1B44D 2LFNA 4AIMA 3HOZG 4NP5A 1O7LA 4EQPA 2JA6B 1AZQA 1A62A 4K14A 1PMRA 5IGCA 3KFUA 4A3KH 1O80A 2HCIA 5BN4A 4X65L 2E76C 1QUQB 1RL2A 1MSHA 3I4MG 4P75A 3CQZB 4FXKC 3SR1A 1C0AA 2F03A 2CTKA 1R4PB 4QJFA 1BDOA 1B1ZA 3CCRA 4IPHA 3PUYA 4A3FB 3BG3A 1HR0W 4Z9CB 4DR6L 2ENBA 2A1AA 3FHWA 2FMRA 1XPRA 3S16B 4ME5A 4A3JB 4OXPA 2NN6H 2EY5A 1TU2B 4C3HB 1U4PA 4R4IA 2I46A 4JI4Q 3HOWH 1VQ6A 2QDBA 1CFMA 4K6DA 2MFIA 5HGQA 4FNFA 3TSSA 4OGQC 2Q2HA 1Y14B 5FO8B 2EYJA 4X3SA 2JQOA 3S1QB 2NVXH 4LF8L 3NBIA 4DAVA 1SMYC 1V1QA 1VQEA 1LM0A 3KDFA 3HOYB 2AUKA 2K50A 3HRZC 4JYAL 1WTPA 4TKOB 2AHOB 4QUCA 3CCVA 1WE8A 3HG9A 1PYBA 3J81E 5FO7B 1TWCB 4G57A 5IIFA 3OTOQ 1RF2D 1G8ZD 2EZVA 2NZOA 2L15A 2K01A 5K36G 2O5IC 1S5BD 3CPFA 3SK6A 3FDTA 1J6QA 1N32L 5CORA 3NUCA 1WD1A 1STYA 2SOBA 3SHLA 1HNZL 2KQ3A 3HOXB 1L1OA 3NQTA 5BR8Q 4WALA 5LMNW 3OIQA 4G4KA 1A3VA 2F0IA 1SMXA 5AJ3Q 3C1FA 1EWIA 1EC6A 4K8JA 5D14A 1YBYA 2HQEA 2EYHA 1I5FA 4C3IH 4HSVA 4B9XA 4FF2A 1VQFA 4DR3L 5FLMG 1FJGL 5KNDA 2KHIA 2DNCA 1HR0L 4WJ3M 1K8MA 4DV1Q 4NXNQ 3NP8A 2PYKA 3DEPA 2IHFA 1JC7A 5DM73 3CD6A 3CCJA 4XIGS 5TSSA 4C1NK 1JORA 1FL0A 1V1PA 2K5HA 4JYAQ 4A3DG 5E1FA 4A93B 1JQYD 1LO5D 4GKJL 4HEDA 4DV2L 3J80E 4A3FH 3P7JA 1TWAH 2KCMA 5FKAC 1TWHH 5FJ8G 5FLXL 4IUNA 1J5EL 3IKJA 1I6VC 4NKLA 4A3JH 1B50A 4RWSC 4QCLA 5EPJA 3S2HB 2VY3A 2LXKA 2RHSB 4DV4Q 3HP3A 1TWGB 1ENCA 2QEXA 1Q12A 4RKLA 1O7YA 2B2UC 4CHTB 1KNAA 3GV3A 3NWTA 1XMQL 1KL9A 4A3DB 2K32A 4JBKA 1L2FA 3RLNA 1WCMH 3HOYH 3SK5A 3ULJA 4DV6Q 3EBEA 3U9OA 3F1ZA 3STBC 4A3IB 3OHXC 3U4ZA 1XJVA 2SDFA 4KY7A 2PZWA 4K8IA 5IP9G 3GTGH 2F3WA 4RH6A 4DUYQ 4POGA 4LFBQ 1SYEA 4LIJA 1RDPD 3J81L 3GTQB 5IGGA 3VR6A 4AM3A 2UXBL 2IPKD 4K2LA 1Y8OB 4WJWA 1LV9A 3DWAA 3S17H 1WTWA 4PMWA 1I94L 3PO3H 2F0JA 3RZDH 1FD7D 1EIHA 1ASZA 4DXFA 3W3AA 5T1IA 3G48A 4DV5L 1RD9D 5M5WH 1I4GA 3G6EA 4B3TL 1SJED 1SEBD 1EL0A 2CTFA 1TR5A 1K3RA 3OIPA 1UWVA 1DT4A 4LUVA 4ULLA 2MNAA 3HGBA 4RGOS 5E4WC 2E2IB 3CW2C 5EBCA 4P74A 1PZID 1LTTD 5EJWA 1IHZA 3H09A 4R4OA 5C3EB 2CWPA 3R3OA 2K28A 5M5YB 4HJ8A 3S14H 3KF8B 5D3DA 1J9OA 1TS2A 5M5WB 4BXXH 1U4RA 1E22A 2JA6H 4JG2A 3RN2A 3GD7A 3BYYB 3X3NA 1YZ6A 2PMZE 1O78A 2JSOA 3STBD 4MNOA 1UAPA 3A7AB 4IUUA 1TT2A 2O4XA 1KRSA 3DUZA 2B63H 5FK9C 3G6JB 3U1KA 1D5XC 5GAHC 2Q2IA 4BY1H 3NTIA 4P2CB 2J0TD 4XT1B 3OSOA 1IL8A 3RZOB 3H3VI 5D3IB 1B3AA 2ATWA 3CKIB 4EGVA 1VQHA 2E8GA 2C9OA 1HRJA 4GNXB 1KDBA 2LKVA 3VR3A 4C3HH 3A5UA 4H0LC 1PZKD 5JOBA 2EQSA 1MD2D 2RSNA 1EOTA 3CMEA 1L0YB 2YU9B 4A3EB 1YVCA 4B3ML 4RCNA 1UEAB 2H5XA 4O0AA 2CW0C 3K57A 1VF5C 5C4HA 4LF9L 1OTCA 1VQLA 5CV6A 4F88A 3AEVA 2ZXOA 2CTEA 1CM9A 1PRTF 4RFBA 1AW7A 3BZKA 4ZYSA 5ELBA 4DR5Q 2I5MX 4MHEA 2F0EA 2WKDA 3GTKB 3W1GA 4B8TA 3A7LA 3OWFA 4KKSA 3RZDB 2NVTH 4L5QA 1DOKA 3ERQA 1YNXA 2D5DA 2HHHQ 1VF7A 4C3JG 1OXSC 5JJLA 2PW7A 1VQPA 2Q2TA 1N32Q 1S40A 3NQIA 2E2IH 3HOXH 2Z8LA 3Q8DA 1X6OA 1TS5A 5LL6S 3CAMA 5DEHA 2E2HB 3A5ZB 3HS0C 3CC4A 2M00A 2UU9L 5IYBG 1MGSA 3K81C 1U9RA 2VUMH 4A3JG 3M3YB 1YHQA 4B9WA 3GTMH 1OXTA 5KNCA 4HJ5A 2B2TA 1PFSA 4LFCL 3CMAA 2SNMA 2FXQA 1K83B 2F0OA 3J7ZC 3TN2A 4DAYB 1SYGA 3Q22A 2Y0SB 2KCTA 3OMGA 5IYDH 5IODA 3LGJA 5C0XG 1IKMA 5JJKA 2AWNA 1A15A 3CHBD 2B63B 3I55A 5GAEC 2CTLA 3S1MH 4QIWE 3D4DA 1S4ZA 5ELEA 4R8IA 1PTOF 1TWHB 2PZUA 3T16A 3J7AV 2B2WA 5DAUA 2OQKA 1H95A 3I4MH 1QE6A 3PUWA 3S1RB 1M8AA 2OEOA 2JA7H 2NVYH 3QB3A 2K1BA 1K83H 3JAML 2H4OA 4JOIC 1E2VA 2J7ZA 1ASYA 1ZYRD 3MFYA 3O13A 2R6GA 2YU9H 1IW7D 3BU2A 1EIFA 2NVQH 1KDCA 2D0OA 1D7QA 3EA6A 4OWWB 4EQNA 1NR4A 1F77A 2NTSA 1JICA 5C0XJ 3FP9A 2ZTDA 1RIPA 4BBRB 3SDZA 1LACA 1X65A 1S5DD 1Q82C 3ZJYC 1AZPA 1NMFA 3W2DA 5CBEE 4TQUS 1HHVA 4P72A 3SK8A 4UDUC 3R2IA 3H6MA 2WB1B 3F2CA 4JI8L 3CRKC 4DNTB 1CK1A 5IE8A 1TQOA 5I4DA 2N55A 1JB7A 2RSOA 1X3GA 3S17B 4LFAQ 1RTOA 3P1HA 3VA5A 5J3BA 2F0NA 2R7FA 4ZK9B 2VQFL 2EJMA 2MPMA 4GOPC 2RA4A 1X32A 3NBHB 1K8GA 2UXDQ 1F2YA 1M4VA 5I9PA 2GA4B 3PGZA 1XWEA 1FGUA 3D0FA 5CV7A 1G91A 3KLWA 3PMFA 5M3MG 1D5MC 1U4MA 1Q8KA 4JCVE 3J80L 5EKLA 5IWAL 1HZ9A 2GVBA 3RLFA 1LYLA 2A73B 1QWYA 1LTBD 2MGSA 3Q23A 3AEVB 1DD2A 1I50H 5EPKA 3VYUA 3EVQA 2CQOA 4G7ZC 2EY1A 3MXGA 1Y1WH 3T1YQ 2FHTA 4UP8A 3HOWB 3KF6A 3RR5A 4IZ8A 3HEJA 1YNJC 4L8JA 4ZUIA 3J81i 4JI2L 1FR3A 3GO5A 3WDNA 4LW1A 4XYQA 1NAPA 1FYCA 4WANA 4I7ZC 2EOTA 2O5JC 4WFN3 3J7YW 4IPDA 1I4XA 1X54A 2RKSA 5C4JH 3CCQA 3DHQA 3MXPA 4EX5A 3L0OA 1SE4A 2NN6I 1ZKOA 3FPPA 4BBSB 2B2UA 1RKNA 2ALYB 4DV4L 1LT6D 2JEBI 3G7LA 4WJ4A 1BKBA 2IWHA 1H9KA 3VR2A 2HCCA 3NSWA 2I5HA 1VQGA 2B2VC 1GHJA 1SE3A 5G3LD 3TS0A 3T53B 3JAME 1VIGA 1SMYD 5EKKA 1JOOA 2KCNA 5EAYA 1TWCH 3K58A 4QF4A 3U4VA 3SK4A 2IL8A 5AFWA 1A8VA 4PG3A 5C4JB 2K75A 4KD3A 1L1OB 2PQAB 4HJ9A 2QNDA 4TVAB 1E3PA 3BVMA 1PXUA 2EE1A 1ESRA 1WTOA 3NWSA 3J80i 4BY7H 2C5CA 5DNFA 4LF5Q 2NBFA 2KA7A 1DTJA 1BR9A 1AFPA 1GM5A 2NB0A 2VQEL 1YNND 5I9OA 2HUGA 4DR7L 1GUOA 1Y1VG 2A19A 2R92H 1CZWA 2OTJA 2QF7A 1PYWD 3BDLA 1DYQA 1QVFA 5I2YA 1VMPA 5KYIA 3N52A 5EBDA 4X3UA 4C3IB 4LJZC 1JE4A 4ODGA 5KEEA 1PLFA 4GNXC 1O7ZA 4LF6L 4NW2A 2HH3A