2CTJA

Solution structure of the 8th kh type i domain from human vigilin
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
95
structure length
95
Chain Sequence
GSSGSSGSIQKDLANIAEVEVSIPAKLHNSLIGTKGRLIRSIMEECGGVHIHFPVEGSGSDTVVIRGPSSDVEKAKKQLLHLAEEKQTKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vigilin
publication title Solution structure of the 8th KH type I domain from human Vigilin
rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 17
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2005-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 2ctjA00
1TUAA 1X4MA 4BA2I 2JZXA 4OO1G 3U1KA 1DT4A 1ZTGA 2JEBI 4JVYA 1EC6A 1WVNA 2CTMA 2P2RA 2OPUA 1KHMA 2FMRA 4WANA 2HH3A 2JA9A 4B8TA 2OPVA 2YQRA 2QNDA 4WALA 2E3UA 2CPQA 3VKEA 4BA1I 2PY9A 2JE6I 2Z0SA 2ANRA 2CTFA 4JVHA 3L7ZC 2CTEA 4LIJA 4NBQA 4QMFB 2JEAI 5C0XG 1X4NA 2NN6G 1DTJA 1ZZKA 1ZZJA 4IFDG 3V69A 2DGRA 2AXYA 1J5KA 1VIGA 2HH2A 2CTLA 4AM3A 2BA0A 2MJHA 1ZZIA 2PQUA 1J4WA 1WE8A 2BL5A 5K36G 1K1GA 3AEVB 2CTJA 2ANNA 2CTKA 5JEAG 1VIHA 2JVZA 4AIMA
chains in the Genus database with same CATH superfamily
3GABA 4H8AA 1DT4A 1WTJA 2FPHX 4DV1H 1KHMA 3KDGA 2HH3A 5LMUH 2QNDA 4WALA 4DR7H 1UG8A 1NXUA 1N34H 4NBQA 2JEAI 4NXMH 2CPMA 4KHPH 2UUBH 4JI4H 1XRHA 2CTLA 1HNZH 1Z2IA 2UUCH 2MJHA 4X65H 1IBLH 2VKCA 2O4CA 4X66H 4NXNH 4B3MH 4LF9H 1K1GA 4LF7H 2CTKA 3J81W 3OSSD 4DV7H 2Y3MA 3JAMW 1S03G 4DUZH 4LFAH 1X4MA 4JI3H 4AQYH 2X06A 1EC6A 2JEBI 2LF0A 4JYAH 4OX9H 2LTLA 2ZM6H 2LTMA 2OPVA 4JV5H 4YY3H 4DV5H 4LF4H 3VKEA 4DV0H 4K0KH 2FFMA 2Z0SA 4JVHA 3T1HH 1X0AA 4QMFB 2M6QA 1X4NA 3GR5A 1MSZA 4DUYH 1DTJA 4JI8H 1X9ZA 1N33H 1S20A 4GKJH 4IFDG 3V69A 2DGRA 2AXYA 1J5KA 1VIGA 2HH2A 1XMQH 4JI2H 1J5EH 1FKAH 4DR6H 4GKKH 2BA0A 4DR2H 4B3SH 2CWFA 2CWHA 4JI0H 4EC5A 1HR0H 1J4WA 1SEIA 5BR8H 2BL5A 2CTJA 1ODHA 2VQFH 1TUAA 5LL6b 5IWAH 3NCVA 4DR1H 2M8WA 2JZXA 2D9IA 4OO1G 4G08A 4DV2H 2CTMA 2P2RA 2OPUA 2JA9A 4B8TA 1XNQH 4DV3H 2UU9H 2CPQA 3OETA 4NZRM 2PY9A 2UXBH 2G8YA 1V9NA 2HHHH 2JE6I 4X62H 2ANRA 2F4VH 2CTFA 4DV4H 3L7ZC 4PDBA 2ZQEA 5C0XG 2LRRA 2NN6G 3J80W 3OTOH 1ZZJA 4DV6H 1HNWH 1HNXH 4AM3A 4DR4H 3UOEA 4LF5H 5A2QW 1IBKH 2K1HA 3J7AK 3AEVB 2UXCH 2ANNA 1F0XA 4YHHH 5JEAG 4JI7H 4LFBH 1VIHA 4BA2I 3U1KA 1ZTGA 1XMOH 4JVYA 4OD6A 1WVNA 5LMNH 2FMRA 4WANA 2A1SA 1I6UA 2YQRA 2PT7G 2E3UA 1VBIA 2VQEH 4BA1I 4DR5H 3T1YH 2UUAH 4JI6H 4E9JA 1IBMH 2E5LH 2UXDH 2CTEA 4LIJA 1PQXA 1N36H 1N32H 3EZJA 3FAUA 5DT9A 1AN7A 1ZZKA 1I94H 4DR3H 4OCHA 4FJUA 5FLXW 5IT9W 4JI1H 1FJGH 4B3RH 3RF2A 1V8CA 3KDKA 4NZTM 4X64H 4FJSA 3SB1A 1ZZIA 4LF8H 4JI5H 2PQUA 4LFCH 1WE8A 1WHRA 1XNRH 3GKUA 5K36G 3QD7X 3I0PA 4LF6H 4B8CD 2JVZA 4B3TH 4AIMA
chains in the Genus database with same CATH topology
1TUAA 1X4MA 4BA2I 2JZXA 4OO1G 3U1KA 1DT4A 1ZTGA 2JEBI 4JVYA 1EC6A 1WVNA 2CTMA 2P2RA 2OPUA 1KHMA 2FMRA 4WANA 2HH3A 2JA9A 4B8TA 2OPVA 2YQRA 2QNDA 4WALA 2E3UA 2CPQA 3VKEA 4BA1I 2PY9A 2JE6I 2Z0SA 2ANRA 2CTFA 4JVHA 3L7ZC 2CTEA 4LIJA 4NBQA 4QMFB 2JEAI 5C0XG 1X4NA 2NN6G 1DTJA 1ZZKA 1ZZJA 4IFDG 3V69A 2DGRA 2AXYA 1J5KA 1VIGA 2HH2A 2CTLA 4AM3A 2BA0A 2MJHA 1ZZIA 2PQUA 1J4WA 1WE8A 2BL5A 5K36G 1K1GA 3AEVB 2CTJA 2ANNA 2CTKA 5JEAG 1VIHA 2JVZA 4AIMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TUA A;  1X4M A;  4BA2 I;  2JZX A;  4OO1 G;  3U1K A;  1DT4 A;  1ZTG A;  2JEB I;  4JVY A;  1EC6 A;  1WVN A;  2CTM A;  2P2R A;  2OPU A;  1KHM A;  2FMR A;  4WAN A;  2HH3 A;  2JA9 A;  4B8T A;  2OPV A;  2YQR A;  2QND A;  4WAL A;  2E3U A;  2CPQ A;  3VKE A;  4BA1 I;  2PY9 A;  2JE6 I;  2Z0S A;  2ANR A;  2CTF A;  4JVH A;  3L7Z C;  2CTE A;  4LIJ A;  4NBQ A;  4QMF B;  2JEA I;  5C0X G;  1X4N A;  2NN6 G;  1DTJ A;  1ZZK A;  1ZZJ A;  4IFD G;  3V69 A;  2DGR A;  2AXY A;  1J5K A;  1VIG A;  2HH2 A;  2CTL A;  4AM3 A;  2BA0 A;  2MJH A;  1ZZI A;  2PQU A;  1J4W A;  1WE8 A;  2BL5 A;  5K36 G;  1K1G A;  3AEV B;  2CTJ A;  2ANN A;  2CTK A;  5JEA G;  1VIH A;  2JVZ A;  4AIM A; 
#chains in the Genus database with same CATH topology
 3GAB A;  4H8A A;  1DT4 A;  1WTJ A;  2FPH X;  4DV1 H;  1KHM A;  3KDG A;  2HH3 A;  5LMU H;  2QND A;  4WAL A;  4DR7 H;  1UG8 A;  1NXU A;  1N34 H;  4NBQ A;  2JEA I;  4NXM H;  2CPM A;  4KHP H;  2UUB H;  4JI4 H;  1XRH A;  2CTL A;  1HNZ H;  1Z2I A;  2UUC H;  2MJH A;  4X65 H;  1IBL H;  2VKC A;  2O4C A;  4X66 H;  4NXN H;  4B3M H;  4LF9 H;  1K1G A;  4LF7 H;  2CTK A;  3J81 W;  3OSS D;  4DV7 H;  2Y3M A;  3JAM W;  1S03 G;  4DUZ H;  4LFA H;  1X4M A;  4JI3 H;  4AQY H;  2X06 A;  1EC6 A;  2JEB I;  2LF0 A;  4JYA H;  4OX9 H;  2LTL A;  2ZM6 H;  2LTM A;  2OPV A;  4JV5 H;  4YY3 H;  4DV5 H;  4LF4 H;  3VKE A;  4DV0 H;  4K0K H;  2FFM A;  2Z0S A;  4JVH A;  3T1H H;  1X0A A;  4QMF B;  2M6Q A;  1X4N A;  3GR5 A;  1MSZ A;  4DUY H;  1DTJ A;  4JI8 H;  1X9Z A;  1N33 H;  1S20 A;  4GKJ H;  4IFD G;  3V69 A;  2DGR A;  2AXY A;  1J5K A;  1VIG A;  2HH2 A;  1XMQ H;  4JI2 H;  1J5E H;  1FKA H;  4DR6 H;  4GKK H;  2BA0 A;  4DR2 H;  4B3S H;  2CWF A;  2CWH A;  4JI0 H;  4EC5 A;  1HR0 H;  1J4W A;  1SEI A;  5BR8 H;  2BL5 A;  2CTJ A;  1ODH A;  2VQF H;  1TUA A;  5LL6 b;  5IWA H;  3NCV A;  4DR1 H;  2M8W A;  2JZX A;  2D9I A;  4OO1 G;  4G08 A;  4DV2 H;  2CTM A;  2P2R A;  2OPU A;  2JA9 A;  4B8T A;  1XNQ H;  4DV3 H;  2UU9 H;  2CPQ A;  3OET A;  4NZR M;  2PY9 A;  2UXB H;  2G8Y A;  1V9N A;  2HHH H;  2JE6 I;  4X62 H;  2ANR A;  2F4V H;  2CTF A;  4DV4 H;  3L7Z C;  4PDB A;  2ZQE A;  5C0X G;  2LRR A;  2NN6 G;  3J80 W;  3OTO H;  1ZZJ A;  4DV6 H;  1HNW H;  1HNX H;  4AM3 A;  4DR4 H;  3UOE A;  4LF5 H;  5A2Q W;  1IBK H;  2K1H A;  3J7A K;  3AEV B;  2UXC H;  2ANN A;  1F0X A;  4YHH H;  5JEA G;  4JI7 H;  4LFB H;  1VIH A;  4BA2 I;  3U1K A;  1ZTG A;  1XMO H;  4JVY A;  4OD6 A;  1WVN A;  5LMN H;  2FMR A;  4WAN A;  2A1S A;  1I6U A;  2YQR A;  2PT7 G;  2E3U A;  1VBI A;  2VQE H;  4BA1 I;  4DR5 H;  3T1Y H;  2UUA H;  4JI6 H;  4E9J A;  1IBM H;  2E5L H;  2UXD H;  2CTE A;  4LIJ A;  1PQX A;  1N36 H;  1N32 H;  3EZJ A;  3FAU A;  5DT9 A;  1AN7 A;  1ZZK A;  1I94 H;  4DR3 H;  4OCH A;  4FJU A;  5FLX W;  5IT9 W;  4JI1 H;  1FJG H;  4B3R H;  3RF2 A;  1V8C A;  3KDK A;  4NZT M;  4X64 H;  4FJS A;  3SB1 A;  1ZZI A;  4LF8 H;  4JI5 H;  2PQU A;  4LFC H;  1WE8 A;  1WHR A;  1XNR H;  3GKU A;  5K36 G;  3QD7 X;  3I0P A;  4LF6 H;  4B8C D;  2JVZ A;  4B3T H;  4AIM A; 
#chains in the Genus database with same CATH homology
 1TUA A;  1X4M A;  4BA2 I;  2JZX A;  4OO1 G;  3U1K A;  1DT4 A;  1ZTG A;  2JEB I;  4JVY A;  1EC6 A;  1WVN A;  2CTM A;  2P2R A;  2OPU A;  1KHM A;  2FMR A;  4WAN A;  2HH3 A;  2JA9 A;  4B8T A;  2OPV A;  2YQR A;  2QND A;  4WAL A;  2E3U A;  2CPQ A;  3VKE A;  4BA1 I;  2PY9 A;  2JE6 I;  2Z0S A;  2ANR A;  2CTF A;  4JVH A;  3L7Z C;  2CTE A;  4LIJ A;  4NBQ A;  4QMF B;  2JEA I;  5C0X G;  1X4N A;  2NN6 G;  1DTJ A;  1ZZK A;  1ZZJ A;  4IFD G;  3V69 A;  2DGR A;  2AXY A;  1J5K A;  1VIG A;  2HH2 A;  2CTL A;  4AM3 A;  2BA0 A;  2MJH A;  1ZZI A;  2PQU A;  1J4W A;  1WE8 A;  2BL5 A;  5K36 G;  1K1G A;  3AEV B;  2CTJ A;  2ANN A;  2CTK A;  5JEA G;  1VIH A;  2JVZ A;  4AIM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...