2CTJA

Solution structure of the 8th kh type i domain from human vigilin
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
95
structure length
95
Chain Sequence
b'GSSGSSGSIQKDLANIAEVEVSIPAKLHNSLIGTKGRLIRSIMEECGGVHIHFPVEGSGSDTVVIRGPSSDVEKAKKQLLHLAEEKQTKSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vigilin
publication title Solution structure of the 8th KH type I domain from human Vigilin
rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 17
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2005-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 2ctjA00
4LIJA 1KHMA 2HH3A 1TUAA 2YQRA 5C0XG 1VIHA 1EC6A 2CTEA 4B8TA 1J5KA 4QMFB 4JVYA 4OO1G 1DTJA 2BL5A 2JA9A 4AIMA 4BA2I 1VIGA 2CTJA 1WVNA 1X4NA 3AEVB 1ZZIA 4IFDG 3U1KA 2QNDA 5K36G 2PQUA 2CTMA 2OPVA 2NN6G 2JEAI 2HH2A 2Z0SA 1K1GA 1ZTGA 2P2RA 4NBQA 2FMRA 2AXYA 1DT4A 2ANNA 3L7ZC 2PY9A 5JEAG 2CTKA 4AM3A 2JE6I 4WALA 2JVZA 2BA0A 3VKEA 1WE8A 2OPUA 2CTFA 2MJHA 2JEBI 4WANA 1ZZJA 1X4MA 2E3UA 2DGRA 2JZXA 1J4WA 4BA1I 4JVHA 2CPQA 1ZZKA 3V69A 2ANRA 2CTLA
chains in the Genus database with same CATH superfamily
5C0XG 1VIHA 3GKUA 4B8CD 4DR7H 1J5KA 1X0AA 1HNZH 3I0PA 1XNRH 2JA9A 2VQFH 4NZRM 4JV5H 2A1SA 4DR2H 1XNQH 2LTMA 4X62H 3AEVB 5IT9W 4NZTM 3U1KA 5LL6b 4EC5A 2JEAI 4JI1H 1K1GA 4KHPH 4LF9H 4AQYH 3RF2A 4DV0H 2CTKA 5LMNH 2UUCH 3SB1A 3QD7X 2UXBH 4OX9H 4DV4H 4JYAH 1WE8A 2OPUA 2CTFA 2MJHA 2K1HA 1AN7A 1X4MA 4DR3H 1ZZJA 1V9NA 4DR1H 4JI6H 4DR4H 4JI5H 1IBMH 2M6QA 2CPQA 2VKCA 3GR5A 4AIMA 4YY3H 1I94H 2ANRA 4JVHA 2HHHH 4LF4H 1KHMA 2HH3A 2YQRA 4LFCH 4GKKH 1SEIA 4G08A 1EC6A 2LRRA 4B8TA 2FPHX 4H8AA 1DTJA 1S03G 2D9IA 4BA2I 3J81W 1XMOH 1HNWH 1VIGA 4JI3H 1WHRA 5IWAH 1F0XA 2QNDA 2PQUA 5A2QW 3T1HH 4DV3H 4B3SH 2Z0SA 2Y3MA 2P2RA 3L7ZC 2VQEH 2UUBH 5JEAG 3KDGA 4B3TH 1N33H 4DR6H 3J80W 1S20A 4DV2H 4DUYH 3VKEA 2LF0A 4FJSA 4JI0H 4WANA 2E3UA 3EZJA 2UU9H 2JZXA 2UXCH 3OTOH 2LTLA 1VBIA 4B3MH 4OO1G 4LIJA 2ZM6H 5DT9A 2CWHA 1XMQH 1FJGH 1N34H 2X06A 2UXDH 1J5EH 4JVYA 3GABA 3OETA 3KDKA 5LMUH 1UG8A 3J7AK 1WTJA 4JI7H 3JAMW 1WVNA 1X4NA 4LFAH 1IBLH 5BR8H 5K36G 4X66H 1X9ZA 5FLXW 2NN6G 1Z2IA 2HH2A 1ZTGA 4NBQA 3NCVA 3UOEA 4LF6H 1XRHA 2F4VH 1NXUA 2JE6I 2UUAH 4WALA 4JI2H 4B3RH 1N32H 4DUZH 4K0KH 4X64H 2JEBI 4DV5H 1N36H 1J4WA 4OD6A 4JI4H 4GKJH 3V69A 4YHHH 1PQXA 1TUAA 2CPMA 2CTEA 2G8YA 2O4CA 4QMFB 2BL5A 2CWFA 4OCHA 2M8WA 2ZQEA 4LFBH 2CTJA 4E9JA 1IBKH 1MSZA 1ZZIA 4IFDG 4DV7H 4X65H 2CTMA 2OPVA 4FJUA 4PDBA 1HNXH 2FMRA 2AXYA 1DT4A 2E5LH 2ANNA 4LF7H 2PY9A 1V8CA 3FAUA 4AM3A 4NXMH 1FKAH 4DV1H 2JVZA 2PT7G 2BA0A 3OSSD 1I6UA 4DV6H 4JI8H 2FFMA 2DGRA 4DR5H 1ODHA 4NXNH 3T1YH 4BA1I 4LF8H 1HR0H 1ZZKA 4LF5H 2CTLA
chains in the Genus database with same CATH topology
4LIJA 1KHMA 2HH3A 1TUAA 2YQRA 5C0XG 1VIHA 1EC6A 2CTEA 4B8TA 1J5KA 4QMFB 4JVYA 4OO1G 1DTJA 2BL5A 2JA9A 4AIMA 4BA2I 1VIGA 2CTJA 1WVNA 1X4NA 3AEVB 1ZZIA 4IFDG 3U1KA 2QNDA 5K36G 2PQUA 2CTMA 2OPVA 2NN6G 2JEAI 2HH2A 2Z0SA 1K1GA 1ZTGA 2P2RA 4NBQA 2FMRA 2AXYA 1DT4A 2ANNA 3L7ZC 2PY9A 5JEAG 2CTKA 4AM3A 2JE6I 4WALA 2JVZA 2BA0A 3VKEA 1WE8A 2OPUA 2CTFA 2MJHA 2JEBI 4WANA 1ZZJA 1X4MA 2E3UA 2DGRA 2JZXA 1J4WA 4BA1I 4JVHA 2CPQA 1ZZKA 3V69A 2ANRA 2CTLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LIJ A;  1KHM A;  2HH3 A;  1TUA A;  2YQR A;  5C0X G;  1VIH A;  1EC6 A;  2CTE A;  4B8T A;  1J5K A;  4QMF B;  4JVY A;  4OO1 G;  1DTJ A;  2BL5 A;  2JA9 A;  4AIM A;  4BA2 I;  1VIG A;  2CTJ A;  1WVN A;  1X4N A;  3AEV B;  1ZZI A;  4IFD G;  3U1K A;  2QND A;  5K36 G;  2PQU A;  2CTM A;  2OPV A;  2NN6 G;  2JEA I;  2HH2 A;  2Z0S A;  1K1G A;  1ZTG A;  2P2R A;  4NBQ A;  2FMR A;  2AXY A;  1DT4 A;  2ANN A;  3L7Z C;  2PY9 A;  5JEA G;  2CTK A;  4AM3 A;  2JE6 I;  4WAL A;  2JVZ A;  2BA0 A;  3VKE A;  1WE8 A;  2OPU A;  2CTF A;  2MJH A;  2JEB I;  4WAN A;  1ZZJ A;  1X4M A;  2E3U A;  2DGR A;  2JZX A;  1J4W A;  4BA1 I;  4JVH A;  2CPQ A;  1ZZK A;  3V69 A;  2ANR A;  2CTL A; 
#chains in the Genus database with same CATH topology
 5C0X G;  1VIH A;  3GKU A;  4B8C D;  4DR7 H;  1J5K A;  1X0A A;  1HNZ H;  3I0P A;  1XNR H;  2JA9 A;  2VQF H;  4NZR M;  4JV5 H;  2A1S A;  4DR2 H;  1XNQ H;  2LTM A;  4X62 H;  3AEV B;  5IT9 W;  4NZT M;  3U1K A;  5LL6 b;  4EC5 A;  2JEA I;  4JI1 H;  1K1G A;  4KHP H;  4LF9 H;  4AQY H;  3RF2 A;  4DV0 H;  2CTK A;  5LMN H;  2UUC H;  3SB1 A;  3QD7 X;  2UXB H;  4OX9 H;  4DV4 H;  4JYA H;  1WE8 A;  2OPU A;  2CTF A;  2MJH A;  2K1H A;  1AN7 A;  1X4M A;  4DR3 H;  1ZZJ A;  1V9N A;  4DR1 H;  4JI6 H;  4DR4 H;  4JI5 H;  1IBM H;  2M6Q A;  2CPQ A;  2VKC A;  3GR5 A;  4AIM A;  4YY3 H;  1I94 H;  2ANR A;  4JVH A;  2HHH H;  4LF4 H;  1KHM A;  2HH3 A;  2YQR A;  4LFC H;  4GKK H;  1SEI A;  4G08 A;  1EC6 A;  2LRR A;  4B8T A;  2FPH X;  4H8A A;  1DTJ A;  1S03 G;  2D9I A;  4BA2 I;  3J81 W;  1XMO H;  1HNW H;  1VIG A;  4JI3 H;  1WHR A;  5IWA H;  1F0X A;  2QND A;  2PQU A;  5A2Q W;  3T1H H;  4DV3 H;  4B3S H;  2Z0S A;  2Y3M A;  2P2R A;  3L7Z C;  2VQE H;  2UUB H;  5JEA G;  3KDG A;  4B3T H;  1N33 H;  4DR6 H;  3J80 W;  1S20 A;  4DV2 H;  4DUY H;  3VKE A;  2LF0 A;  4FJS A;  4JI0 H;  4WAN A;  2E3U A;  3EZJ A;  2UU9 H;  2JZX A;  2UXC H;  3OTO H;  2LTL A;  1VBI A;  4B3M H;  4OO1 G;  4LIJ A;  2ZM6 H;  5DT9 A;  2CWH A;  1XMQ H;  1FJG H;  1N34 H;  2X06 A;  2UXD H;  1J5E H;  4JVY A;  3GAB A;  3OET A;  3KDK A;  5LMU H;  1UG8 A;  3J7A K;  1WTJ A;  4JI7 H;  3JAM W;  1WVN A;  1X4N A;  4LFA H;  1IBL H;  5BR8 H;  5K36 G;  4X66 H;  1X9Z A;  5FLX W;  2NN6 G;  1Z2I A;  2HH2 A;  1ZTG A;  4NBQ A;  3NCV A;  3UOE A;  4LF6 H;  1XRH A;  2F4V H;  1NXU A;  2JE6 I;  2UUA H;  4WAL A;  4JI2 H;  4B3R H;  1N32 H;  4DUZ H;  4K0K H;  4X64 H;  2JEB I;  4DV5 H;  1N36 H;  1J4W A;  4OD6 A;  4JI4 H;  4GKJ H;  3V69 A;  4YHH H;  1PQX A;  1TUA A;  2CPM A;  2CTE A;  2G8Y A;  2O4C A;  4QMF B;  2BL5 A;  2CWF A;  4OCH A;  2M8W A;  2ZQE A;  4LFB H;  2CTJ A;  4E9J A;  1IBK H;  1MSZ A;  1ZZI A;  4IFD G;  4DV7 H;  4X65 H;  2CTM A;  2OPV A;  4FJU A;  4PDB A;  1HNX H;  2FMR A;  2AXY A;  1DT4 A;  2E5L H;  2ANN A;  4LF7 H;  2PY9 A;  1V8C A;  3FAU A;  4AM3 A;  4NXM H;  1FKA H;  4DV1 H;  2JVZ A;  2PT7 G;  2BA0 A;  3OSS D;  1I6U A;  4DV6 H;  4JI8 H;  2FFM A;  2DGR A;  4DR5 H;  1ODH A;  4NXN H;  3T1Y H;  4BA1 I;  4LF8 H;  1HR0 H;  1ZZK A;  4LF5 H;  2CTL A; 
#chains in the Genus database with same CATH homology
 4LIJ A;  1KHM A;  2HH3 A;  1TUA A;  2YQR A;  5C0X G;  1VIH A;  1EC6 A;  2CTE A;  4B8T A;  1J5K A;  4QMF B;  4JVY A;  4OO1 G;  1DTJ A;  2BL5 A;  2JA9 A;  4AIM A;  4BA2 I;  1VIG A;  2CTJ A;  1WVN A;  1X4N A;  3AEV B;  1ZZI A;  4IFD G;  3U1K A;  2QND A;  5K36 G;  2PQU A;  2CTM A;  2OPV A;  2NN6 G;  2JEA I;  2HH2 A;  2Z0S A;  1K1G A;  1ZTG A;  2P2R A;  4NBQ A;  2FMR A;  2AXY A;  1DT4 A;  2ANN A;  3L7Z C;  2PY9 A;  5JEA G;  2CTK A;  4AM3 A;  2JE6 I;  4WAL A;  2JVZ A;  2BA0 A;  3VKE A;  1WE8 A;  2OPU A;  2CTF A;  2MJH A;  2JEB I;  4WAN A;  1ZZJ A;  1X4M A;  2E3U A;  2DGR A;  2JZX A;  1J4W A;  4BA1 I;  4JVH A;  2CPQ A;  1ZZK A;  3V69 A;  2ANR A;  2CTL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...