2CTJA

Solution structure of the 8th kh type i domain from human vigilin
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
95
structure length
95
Chain Sequence
GSSGSSGSIQKDLANIAEVEVSIPAKLHNSLIGTKGRLIRSIMEECGGVHIHFPVEGSGSDTVVIRGPSSDVEKAKKQLLHLAEEKQTKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Vigilin
publication title Solution structure of the 8th KH type I domain from human Vigilin
rcsb
source organism Homo sapiens
total genus 17
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2005-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 2ctjA00
2YQRA 2PQUA 1X4NA 2HH2A 5C0XG 2DGRA 2JVZA 2CPQA 2OPVA 4BA2I 4OO1G 2MJHA 1J5KA 1VIHA 4IFDG 2E3UA 5K36G 1TUAA 1J4WA 2CTLA 2JEBI 2CTJA 1DTJA 2CTKA 2CTFA 4LIJA 2OPUA 2NN6G 1ZZJA 1ZZIA 2P2RA 2JEAI 2BA0A 1ZTGA 4BA1I 4QMFB 3VKEA 2ANRA 1EC6A 1KHMA 4JVHA 1K1GA 4WANA 4NBQA 2QNDA 2AXYA 4AM3A 2FMRA 1VIGA 3AEVB 4B8TA 2ANNA 1WVNA 3L7ZC 4JVYA 3U1KA 2CTMA 5JEAG 2HH3A 1ZZKA 4WALA 2JZXA 2JA9A 2PY9A 1DT4A 2Z0SA 4AIMA 1WE8A 1X4MA 2JE6I 2BL5A 2CTEA 3V69A
chains in the Genus database with same CATH superfamily
2UXCH 2YQRA 2PQUA 2UUBH 1X4NA 2HH2A 3KDGA 4H8AA 4DR7H 4JI2H 1Z2IA 1J5KA 3UOEA 1J4WA 4LFAH 4NXNH 2UUAH 2CTJA 1DTJA 4OX9H 4EC5A 3OSSD 5DT9A 5LL6b 4DV0H 4JI8H 1KHMA 3QD7X 4LF5H 4WANA 2CWFA 4OCHA 2FMRA 1XRHA 1VIGA 2K1HA 4LF8H 2VQEH 4LF6H 3L7ZC 2HHHH 1XNRH 1S20A 2CTMA 3U1KA 1IBKH 5LMNH 2F4VH 1FJGH 1N32H 1F0XA 3SB1A 1N33H 5IWAH 1WHRA 3GABA 4DR1H 4PDBA 1WTJA 3FAUA 1J5EH 3V69A 4DV3H 1SEIA 4GKKH 5C0XG 2UUCH 2DGRA 2OPVA 4BA2I 1X9ZA 2MJHA 1N34H 1VIHA 2E3UA 4OD6A 3J81W 4DV2H 3EZJA 2CTKA 2CTFA 4LIJA 4DUZH 2P2RA 2JEAI 1ZZIA 4YY3H 3VKEA 4QMFB 1XMQH 2LRRA 3I0PA 4FJSA 4X62H 4NBQA 4DUYH 2ZM6H 4AM3A 1HNXH 1WVNA 4DV7H 4B3SH 5JEAG 2D9IA 2VQFH 4NZRM 1HR0H 4B3RH 4JV5H 3RF2A 4WALA 2PY9A 2UU9H 2X06A 4K0KH 1HNWH 3T1YH 1TUAA 2AXYA 2LF0A 2OPUA 2LTMA 4OO1G 2CPQA 1V9NA 2A1SA 2M8WA 4IFDG 1I94H 4JI6H 4NZTM 4LFCH 2CTLA 4LF9H 2JEBI 1XNQH 4DR4H 2E5LH 4X64H 4DV6H 2NN6G 1ZZJA 4DR2H 4JI1H 4DR6H 4GKJH 1NXUA 2BA0A 4BA1I 2LTLA 1ZTGA 2ANRA 4JI5H 4DR5H 4JI7H 4JVHA 5LMUH 2CPMA 1IBMH 5IT9W 4FJUA 4X66H 3AEVB 4B8TA 2ANNA 4YHHH 4JVYA 3GR5A 2FPHX 4B3TH 2HH3A 1ZZKA 4B3MH 2G8YA 4JYAH 4AQYH 4KHPH 1S03G 1WE8A 2VKCA 1V8CA 1MSZA 3NCVA 3J80W 2CTEA 4DV1H 4NXMH 2PT7G 5BR8H 1VBIA 3KDKA 1FKAH 2JVZA 4JI3H 2M6QA 5A2QW 1IBLH 1XMOH 4G08A 5K36G 4DR3H 3OTOH 2Y3MA 1N36H 2UXDH 2ZQEA 4E9JA 3T1HH 1PQXA 4DV5H 1EC6A 1K1GA 1HNZH 4X65H 2QNDA 2UXBH 1I6UA 3JAMW 2O4CA 4B8CD 1UG8A 1X0AA 4LF7H 4JI4H 4LF4H 3GKUA 1AN7A 2JZXA 2JA9A 1DT4A 4DV4H 4LFBH 4JI0H 5FLXW 1ODHA 2Z0SA 4AIMA 2FFMA 3J7AK 1X4MA 2JE6I 2BL5A 3OETA 2CWHA
chains in the Genus database with same CATH topology
2YQRA 2PQUA 1X4NA 2HH2A 5C0XG 2DGRA 2JVZA 2CPQA 2OPVA 4BA2I 4OO1G 2MJHA 1J5KA 1VIHA 4IFDG 2E3UA 5K36G 1TUAA 1J4WA 2CTLA 2JEBI 2CTJA 1DTJA 2CTKA 2CTFA 4LIJA 2OPUA 2NN6G 1ZZJA 1ZZIA 2P2RA 2JEAI 2BA0A 1ZTGA 4BA1I 4QMFB 3VKEA 2ANRA 1EC6A 1KHMA 4JVHA 1K1GA 4WANA 4NBQA 2QNDA 2AXYA 4AM3A 2FMRA 1VIGA 3AEVB 4B8TA 2ANNA 1WVNA 3L7ZC 4JVYA 3U1KA 2CTMA 5JEAG 2HH3A 1ZZKA 4WALA 2JZXA 2JA9A 2PY9A 1DT4A 2Z0SA 4AIMA 1WE8A 1X4MA 2JE6I 2BL5A 2CTEA 3V69A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YQR A;  2PQU A;  1X4N A;  2HH2 A;  5C0X G;  2DGR A;  2JVZ A;  2CPQ A;  2OPV A;  4BA2 I;  4OO1 G;  2MJH A;  1J5K A;  1VIH A;  4IFD G;  2E3U A;  5K36 G;  1TUA A;  1J4W A;  2CTL A;  2JEB I;  2CTJ A;  1DTJ A;  2CTK A;  2CTF A;  4LIJ A;  2OPU A;  2NN6 G;  1ZZJ A;  1ZZI A;  2P2R A;  2JEA I;  2BA0 A;  1ZTG A;  4BA1 I;  4QMF B;  3VKE A;  2ANR A;  1EC6 A;  1KHM A;  4JVH A;  1K1G A;  4WAN A;  4NBQ A;  2QND A;  2AXY A;  4AM3 A;  2FMR A;  1VIG A;  3AEV B;  4B8T A;  2ANN A;  1WVN A;  3L7Z C;  4JVY A;  3U1K A;  2CTM A;  5JEA G;  2HH3 A;  1ZZK A;  4WAL A;  2JZX A;  2JA9 A;  2PY9 A;  1DT4 A;  2Z0S A;  4AIM A;  1WE8 A;  1X4M A;  2JE6 I;  2BL5 A;  2CTE A;  3V69 A; 
#chains in the Genus database with same CATH topology
 2UXC H;  2YQR A;  2PQU A;  2UUB H;  1X4N A;  2HH2 A;  3KDG A;  4H8A A;  4DR7 H;  4JI2 H;  1Z2I A;  1J5K A;  3UOE A;  1J4W A;  4LFA H;  4NXN H;  2UUA H;  2CTJ A;  1DTJ A;  4OX9 H;  4EC5 A;  3OSS D;  5DT9 A;  5LL6 b;  4DV0 H;  4JI8 H;  1KHM A;  3QD7 X;  4LF5 H;  4WAN A;  2CWF A;  4OCH A;  2FMR A;  1XRH A;  1VIG A;  2K1H A;  4LF8 H;  2VQE H;  4LF6 H;  3L7Z C;  2HHH H;  1XNR H;  1S20 A;  2CTM A;  3U1K A;  1IBK H;  5LMN H;  2F4V H;  1FJG H;  1N32 H;  1F0X A;  3SB1 A;  1N33 H;  5IWA H;  1WHR A;  3GAB A;  4DR1 H;  4PDB A;  1WTJ A;  3FAU A;  1J5E H;  3V69 A;  4DV3 H;  1SEI A;  4GKK H;  5C0X G;  2UUC H;  2DGR A;  2OPV A;  4BA2 I;  1X9Z A;  2MJH A;  1N34 H;  1VIH A;  2E3U A;  4OD6 A;  3J81 W;  4DV2 H;  3EZJ A;  2CTK A;  2CTF A;  4LIJ A;  4DUZ H;  2P2R A;  2JEA I;  1ZZI A;  4YY3 H;  3VKE A;  4QMF B;  1XMQ H;  2LRR A;  3I0P A;  4FJS A;  4X62 H;  4NBQ A;  4DUY H;  2ZM6 H;  4AM3 A;  1HNX H;  1WVN A;  4DV7 H;  4B3S H;  5JEA G;  2D9I A;  2VQF H;  4NZR M;  1HR0 H;  4B3R H;  4JV5 H;  3RF2 A;  4WAL A;  2PY9 A;  2UU9 H;  2X06 A;  4K0K H;  1HNW H;  3T1Y H;  1TUA A;  2AXY A;  2LF0 A;  2OPU A;  2LTM A;  4OO1 G;  2CPQ A;  1V9N A;  2A1S A;  2M8W A;  4IFD G;  1I94 H;  4JI6 H;  4NZT M;  4LFC H;  2CTL A;  4LF9 H;  2JEB I;  1XNQ H;  4DR4 H;  2E5L H;  4X64 H;  4DV6 H;  2NN6 G;  1ZZJ A;  4DR2 H;  4JI1 H;  4DR6 H;  4GKJ H;  1NXU A;  2BA0 A;  4BA1 I;  2LTL A;  1ZTG A;  2ANR A;  4JI5 H;  4DR5 H;  4JI7 H;  4JVH A;  5LMU H;  2CPM A;  1IBM H;  5IT9 W;  4FJU A;  4X66 H;  3AEV B;  4B8T A;  2ANN A;  4YHH H;  4JVY A;  3GR5 A;  2FPH X;  4B3T H;  2HH3 A;  1ZZK A;  4B3M H;  2G8Y A;  4JYA H;  4AQY H;  4KHP H;  1S03 G;  1WE8 A;  2VKC A;  1V8C A;  1MSZ A;  3NCV A;  3J80 W;  2CTE A;  4DV1 H;  4NXM H;  2PT7 G;  5BR8 H;  1VBI A;  3KDK A;  1FKA H;  2JVZ A;  4JI3 H;  2M6Q A;  5A2Q W;  1IBL H;  1XMO H;  4G08 A;  5K36 G;  4DR3 H;  3OTO H;  2Y3M A;  1N36 H;  2UXD H;  2ZQE A;  4E9J A;  3T1H H;  1PQX A;  4DV5 H;  1EC6 A;  1K1G A;  1HNZ H;  4X65 H;  2QND A;  2UXB H;  1I6U A;  3JAM W;  2O4C A;  4B8C D;  1UG8 A;  1X0A A;  4LF7 H;  4JI4 H;  4LF4 H;  3GKU A;  1AN7 A;  2JZX A;  2JA9 A;  1DT4 A;  4DV4 H;  4LFB H;  4JI0 H;  5FLX W;  1ODH A;  2Z0S A;  4AIM A;  2FFM A;  3J7A K;  1X4M A;  2JE6 I;  2BL5 A;  3OET A;  2CWH A; 
#chains in the Genus database with same CATH homology
 2YQR A;  2PQU A;  1X4N A;  2HH2 A;  5C0X G;  2DGR A;  2JVZ A;  2CPQ A;  2OPV A;  4BA2 I;  4OO1 G;  2MJH A;  1J5K A;  1VIH A;  4IFD G;  2E3U A;  5K36 G;  1TUA A;  1J4W A;  2CTL A;  2JEB I;  2CTJ A;  1DTJ A;  2CTK A;  2CTF A;  4LIJ A;  2OPU A;  2NN6 G;  1ZZJ A;  1ZZI A;  2P2R A;  2JEA I;  2BA0 A;  1ZTG A;  4BA1 I;  4QMF B;  3VKE A;  2ANR A;  1EC6 A;  1KHM A;  4JVH A;  1K1G A;  4WAN A;  4NBQ A;  2QND A;  2AXY A;  4AM3 A;  2FMR A;  1VIG A;  3AEV B;  4B8T A;  2ANN A;  1WVN A;  3L7Z C;  4JVY A;  3U1K A;  2CTM A;  5JEA G;  2HH3 A;  1ZZK A;  4WAL A;  2JZX A;  2JA9 A;  2PY9 A;  1DT4 A;  2Z0S A;  4AIM A;  1WE8 A;  1X4M A;  2JE6 I;  2BL5 A;  2CTE A;  3V69 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...