1ZTGA

Human alpha polyc binding protein kh1
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
72
structure length
72
Chain Sequence
ILTIRLLMHGKEVGSIIGKKGESVKRIREESGARINISEGNCPERIITLTGPTNAIFKAFAMIIDKLEEDIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna, rna binding protein/dna
molecule keywords POLY(RC)-BINDING PROTEIN 1
publication title Contribution of the first K-homology domain of poly(C)-binding protein 1 to its affinity and specificity for C-rich oligonucleotides
pubmed doi rcsb
source organism Homo sapiens
total genus 19
structure length 72
sequence length 72
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 1ztgA00
1EC6A 2HH2A 1ZZKA 2JZXA 4JVHA 3AEVB 2QNDA 2CTFA 3V69A 1WE8A 4OO1G 1ZZJA 2YQRA 2OPUA 2OPVA 2JA9A 1ZZIA 2PQUA 4WALA 4JVYA 1DT4A 4AIMA 2CTMA 2BL5A 5C0XG 2JEBI 2NN6G 1TUAA 2FMRA 2CTJA 2P2RA 2E3UA 4QMFB 2ANNA 2CPQA 2BA0A 4AM3A 2JVZA 4IFDG 1VIGA 4BA1I 2ANRA 4WANA 2MJHA 1ZTGA 1VIHA 1DTJA 2HH3A 1X4NA 2Z0SA 2CTEA 4LIJA 1WVNA 2DGRA 1X4MA 2CTLA 2JE6I 4NBQA 1J4WA 1K1GA 3L7ZC 5JEAG 5K36G 2JEAI 4B8TA 1KHMA 2AXYA 3U1KA 1J5KA 2PY9A 2CTKA 3VKEA 4BA2I
chains in the Genus database with same CATH superfamily
4GKJH 3T1YH 4JI4H 1NXUA 4B3SH 1X0AA 1J5EH 3J81W 2YQRA 2OPUA 4DUYH 4LF5H 4DR4H 1WHRA 3OTOH 4JI8H 4LF6H 4JV5H 2FMRA 2UXBH 2P2RA 2E3UA 4QMFB 1I6UA 1UG8A 4JI5H 2BA0A 2F4VH 2JVZA 4JI2H 4AM3A 2LF0A 2MJHA 4DR2H 4DR5H 1DTJA 4B3RH 1V8CA 1IBKH 4NBQA 2ZQEA 2LTMA 1X4MA 2CTLA 5FLXW 5LL6b 2ZM6H 4DV4H 3L7ZC 2CWFA 5IWAH 4DV2H 3OSSD 5BR8H 2UU9H 3QD7X 1HR0H 2HH2A 4DV0H 2CWHA 4JI6H 2CTFA 3EZJA 2VQFH 3UOEA 4B8CD 4LFAH 1XNRH 3T1HH 4OO1G 2FFMA 4LF4H 5LMNH 4FJUA 4B3MH 4K0KH 5IT9W 4JI7H 4OX9H 3NCVA 1XNQH 4LFCH 2Y3MA 1TUAA 2UXDH 2CTJA 4DR1H 4DV1H 2K1HA 2FPHX 4DV7H 2ANNA 1N33H 2ANRA 1V9NA 4LF7H 2HH3A 2Z0SA 1S03G 1WVNA 2DGRA 2JE6I 4X62H 2CPMA 1KHMA 4B8TA 3J7AK 4X65H 1I94H 3VKEA 4JI0H 2O4CA 3JAMW 2E5LH 4DR3H 4JVHA 4DV6H 3AEVB 2QNDA 3V69A 1WE8A 5LMUH 3J80W 1Z2IA 2OPVA 2JA9A 2M6QA 4NZTM 3RF2A 1FKAH 4WALA 1DT4A 4AIMA 2CTMA 4DR6H 4JI1H 1HNWH 2BL5A 4FJSA 2M8WA 1IBLH 2JEBI 2NN6G 4G08A 1XMQH 3I0PA 4X66H 3GR5A 2UXCH 2LRRA 4DV5H 2HHHH 4IFDG 1VIGA 2LTLA 3KDGA 1N36H 2UUAH 2UUBH 3FAUA 1VIHA 4B3TH 1PQXA 1XMOH 4LIJA 4H8AA 4KHPH 3GABA 1FJGH 5JEAG 2JEAI 1N32H 2G8YA 3U1KA 1J5KA 3KDKA 1F0XA 2CTKA 4AQYH 4PDBA 1HNXH 4LF8H 1EC6A 4LF9H 1ZZKA 4DUZH 2JZXA 4NXNH 4NZRM 4EC5A 4YHHH 4GKKH 1VBIA 5A2QW 2A1SA 3GKUA 2VKCA 3OETA 1XRHA 4YY3H 2PQUA 4JI3H 2VQEH 4JVYA 2UUCH 4E9JA 1S20A 1X9ZA 4LFBH 5C0XG 2D9IA 1ODHA 1AN7A 2PT7G 1N34H 4X64H 4NXMH 2CPQA 4BA1I 4WANA 1ZTGA 4DV3H 1IBMH 3SB1A 5DT9A 1MSZA 4OCHA 1WTJA 1X4NA 1ZZIA 2CTEA 1ZZJA 1J4WA 1HNZH 1K1GA 4JYAH 4OD6A 5K36G 4DR7H 2AXYA 1SEIA 2PY9A 2X06A 4BA2I
chains in the Genus database with same CATH topology
1EC6A 2HH2A 1ZZKA 2JZXA 4JVHA 3AEVB 2QNDA 2CTFA 3V69A 1WE8A 4OO1G 1ZZJA 2YQRA 2OPUA 2OPVA 2JA9A 1ZZIA 2PQUA 4WALA 4JVYA 1DT4A 4AIMA 2CTMA 2BL5A 5C0XG 2JEBI 2NN6G 1TUAA 2FMRA 2CTJA 2P2RA 2E3UA 4QMFB 2ANNA 2CPQA 2BA0A 4AM3A 2JVZA 4IFDG 1VIGA 4BA1I 2ANRA 4WANA 2MJHA 1ZTGA 1VIHA 1DTJA 2HH3A 1X4NA 2Z0SA 2CTEA 4LIJA 1WVNA 2DGRA 1X4MA 2CTLA 2JE6I 4NBQA 1J4WA 1K1GA 3L7ZC 5JEAG 5K36G 2JEAI 4B8TA 1KHMA 2AXYA 3U1KA 1J5KA 2PY9A 2CTKA 3VKEA 4BA2I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EC6 A;  2HH2 A;  1ZZK A;  2JZX A;  4JVH A;  3AEV B;  2QND A;  2CTF A;  3V69 A;  1WE8 A;  4OO1 G;  1ZZJ A;  2YQR A;  2OPU A;  2OPV A;  2JA9 A;  1ZZI A;  2PQU A;  4WAL A;  4JVY A;  1DT4 A;  4AIM A;  2CTM A;  2BL5 A;  5C0X G;  2JEB I;  2NN6 G;  1TUA A;  2FMR A;  2CTJ A;  2P2R A;  2E3U A;  4QMF B;  2ANN A;  2CPQ A;  2BA0 A;  4AM3 A;  2JVZ A;  4IFD G;  1VIG A;  4BA1 I;  2ANR A;  4WAN A;  2MJH A;  1ZTG A;  1VIH A;  1DTJ A;  2HH3 A;  1X4N A;  2Z0S A;  2CTE A;  4LIJ A;  1WVN A;  2DGR A;  1X4M A;  2CTL A;  2JE6 I;  4NBQ A;  1J4W A;  1K1G A;  3L7Z C;  5JEA G;  5K36 G;  2JEA I;  4B8T A;  1KHM A;  2AXY A;  3U1K A;  1J5K A;  2PY9 A;  2CTK A;  3VKE A;  4BA2 I; 
#chains in the Genus database with same CATH topology
 4GKJ H;  3T1Y H;  4JI4 H;  1NXU A;  4B3S H;  1X0A A;  1J5E H;  3J81 W;  2YQR A;  2OPU A;  4DUY H;  4LF5 H;  4DR4 H;  1WHR A;  3OTO H;  4JI8 H;  4LF6 H;  4JV5 H;  2FMR A;  2UXB H;  2P2R A;  2E3U A;  4QMF B;  1I6U A;  1UG8 A;  4JI5 H;  2BA0 A;  2F4V H;  2JVZ A;  4JI2 H;  4AM3 A;  2LF0 A;  2MJH A;  4DR2 H;  4DR5 H;  1DTJ A;  4B3R H;  1V8C A;  1IBK H;  4NBQ A;  2ZQE A;  2LTM A;  1X4M A;  2CTL A;  5FLX W;  5LL6 b;  2ZM6 H;  4DV4 H;  3L7Z C;  2CWF A;  5IWA H;  4DV2 H;  3OSS D;  5BR8 H;  2UU9 H;  3QD7 X;  1HR0 H;  2HH2 A;  4DV0 H;  2CWH A;  4JI6 H;  2CTF A;  3EZJ A;  2VQF H;  3UOE A;  4B8C D;  4LFA H;  1XNR H;  3T1H H;  4OO1 G;  2FFM A;  4LF4 H;  5LMN H;  4FJU A;  4B3M H;  4K0K H;  5IT9 W;  4JI7 H;  4OX9 H;  3NCV A;  1XNQ H;  4LFC H;  2Y3M A;  1TUA A;  2UXD H;  2CTJ A;  4DR1 H;  4DV1 H;  2K1H A;  2FPH X;  4DV7 H;  2ANN A;  1N33 H;  2ANR A;  1V9N A;  4LF7 H;  2HH3 A;  2Z0S A;  1S03 G;  1WVN A;  2DGR A;  2JE6 I;  4X62 H;  2CPM A;  1KHM A;  4B8T A;  3J7A K;  4X65 H;  1I94 H;  3VKE A;  4JI0 H;  2O4C A;  3JAM W;  2E5L H;  4DR3 H;  4JVH A;  4DV6 H;  3AEV B;  2QND A;  3V69 A;  1WE8 A;  5LMU H;  3J80 W;  1Z2I A;  2OPV A;  2JA9 A;  2M6Q A;  4NZT M;  3RF2 A;  1FKA H;  4WAL A;  1DT4 A;  4AIM A;  2CTM A;  4DR6 H;  4JI1 H;  1HNW H;  2BL5 A;  4FJS A;  2M8W A;  1IBL H;  2JEB I;  2NN6 G;  4G08 A;  1XMQ H;  3I0P A;  4X66 H;  3GR5 A;  2UXC H;  2LRR A;  4DV5 H;  2HHH H;  4IFD G;  1VIG A;  2LTL A;  3KDG A;  1N36 H;  2UUA H;  2UUB H;  3FAU A;  1VIH A;  4B3T H;  1PQX A;  1XMO H;  4LIJ A;  4H8A A;  4KHP H;  3GAB A;  1FJG H;  5JEA G;  2JEA I;  1N32 H;  2G8Y A;  3U1K A;  1J5K A;  3KDK A;  1F0X A;  2CTK A;  4AQY H;  4PDB A;  1HNX H;  4LF8 H;  1EC6 A;  4LF9 H;  1ZZK A;  4DUZ H;  2JZX A;  4NXN H;  4NZR M;  4EC5 A;  4YHH H;  4GKK H;  1VBI A;  5A2Q W;  2A1S A;  3GKU A;  2VKC A;  3OET A;  1XRH A;  4YY3 H;  2PQU A;  4JI3 H;  2VQE H;  4JVY A;  2UUC H;  4E9J A;  1S20 A;  1X9Z A;  4LFB H;  5C0X G;  2D9I A;  1ODH A;  1AN7 A;  2PT7 G;  1N34 H;  4X64 H;  4NXM H;  2CPQ A;  4BA1 I;  4WAN A;  1ZTG A;  4DV3 H;  1IBM H;  3SB1 A;  5DT9 A;  1MSZ A;  4OCH A;  1WTJ A;  1X4N A;  1ZZI A;  2CTE A;  1ZZJ A;  1J4W A;  1HNZ H;  1K1G A;  4JYA H;  4OD6 A;  5K36 G;  4DR7 H;  2AXY A;  1SEI A;  2PY9 A;  2X06 A;  4BA2 I; 
#chains in the Genus database with same CATH homology
 1EC6 A;  2HH2 A;  1ZZK A;  2JZX A;  4JVH A;  3AEV B;  2QND A;  2CTF A;  3V69 A;  1WE8 A;  4OO1 G;  1ZZJ A;  2YQR A;  2OPU A;  2OPV A;  2JA9 A;  1ZZI A;  2PQU A;  4WAL A;  4JVY A;  1DT4 A;  4AIM A;  2CTM A;  2BL5 A;  5C0X G;  2JEB I;  2NN6 G;  1TUA A;  2FMR A;  2CTJ A;  2P2R A;  2E3U A;  4QMF B;  2ANN A;  2CPQ A;  2BA0 A;  4AM3 A;  2JVZ A;  4IFD G;  1VIG A;  4BA1 I;  2ANR A;  4WAN A;  2MJH A;  1ZTG A;  1VIH A;  1DTJ A;  2HH3 A;  1X4N A;  2Z0S A;  2CTE A;  4LIJ A;  1WVN A;  2DGR A;  1X4M A;  2CTL A;  2JE6 I;  4NBQ A;  1J4W A;  1K1G A;  3L7Z C;  5JEA G;  5K36 G;  2JEA I;  4B8T A;  1KHM A;  2AXY A;  3U1K A;  1J5K A;  2PY9 A;  2CTK A;  3VKE A;  4BA2 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...