1ZTGA

Human alpha polyc binding protein kh1
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
72
structure length
72
Chain Sequence
ILTIRLLMHGKEVGSIIGKKGESVKRIREESGARINISEGNCPERIITLTGPTNAIFKAFAMIIDKLEEDIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POLY(RC)-BINDING PROTEIN 1
publication title Contribution of the first K-homology domain of poly(C)-binding protein 1 to its affinity and specificity for C-rich oligonucleotides
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna, rna binding protein/dna
total genus 19
structure length 72
sequence length 72
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 1ztgA00
4NBQA 2OPVA 4LIJA 3AEVB 3V69A 4AM3A 2ANRA 2CPQA 2JE6I 3VKEA 2CTJA 2QNDA 1WE8A 2BL5A 2PQUA 2HH2A 2CTEA 4OO1G 4JVYA 4WALA 1ZZKA 2CTKA 3U1KA 1K1GA 4IFDG 1ZZJA 4BA2I 3L7ZC 2Z0SA 2OPUA 4BA1I 2CTMA 2P2RA 1DT4A 2JEAI 1EC6A 1J5KA 4WANA 2CTLA 4QMFB 4B8TA 2JZXA 2YQRA 1DTJA 1X4NA 5JEAG 2MJHA 2CTFA 2E3UA 4AIMA 1TUAA 1VIHA 4JVHA 2HH3A 5K36G 1X4MA 2BA0A 1ZZIA 5C0XG 2ANNA 2NN6G 1J4WA 2JEBI 1WVNA 1ZTGA 2FMRA 2PY9A 1VIGA 2JVZA 2DGRA 2JA9A 1KHMA 2AXYA
chains in the Genus database with same CATH superfamily
4NBQA 1F0XA 4AM3A 1VBIA 4B8CD 4NXNH 2CWHA 5IT9W 3GKUA 1AN7A 2A1SA 4DUYH 2CWFA 2CTKA 1V9NA 3I0PA 2X06A 3RF2A 4NZRM 2LRRA 3FAUA 2UU9H 1FJGH 5LMUH 2LF0A 2CTMA 4JI0H 1DT4A 4JI1H 4X65H 4NZTM 2CTLA 1S20A 3GABA 4JI2H 1MSZA 1N34H 4LF4H 4LF6H 5DT9A 1XMQH 4X64H 2Y3MA 4JV5H 5K36G 4K0KH 3NCVA 1UG8A 2JEBI 4DR7H 2FMRA 3UOEA 2G8YA 4YY3H 2LTMA 3T1YH 2UUAH 4X62H 4B8TA 1K1GA 2UUBH 2VKCA 3AEVB 2ZM6H 2M8WA 2CPQA 3VKEA 1XNRH 2CTJA 1V8CA 1WHRA 1PQXA 2QNDA 1WE8A 4H8AA 4YHHH 4FJSA 1IBMH 4LF7H 4B3RH 4WALA 1HNWH 3J81W 4JI6H 4IFDG 1ZZJA 3JAMW 1NXUA 4E9JA 3OTOH 2Z0SA 4EC5A 4BA1I 4GKJH 4QMFB 1Z2IA 2JZXA 1N32H 2YQRA 4DR2H 1XMOH 4LF8H 2E3UA 4AIMA 1TUAA 4JVHA 2LTLA 4JI4H 5BR8H 1I6UA 2BA0A 3GR5A 1ZZIA 1X9ZA 1J5EH 1J4WA 1WVNA 4DV7H 4GKKH 4DR5H 4DR3H 3T1HH 2VQEH 2DGRA 1J5KA 1I94H 3J7AK 1KHMA 2O4CA 4DV0H 2AXYA 2OPVA 4LIJA 3V69A 1IBLH 2UXBH 2ANRA 4AQYH 4OCHA 4DV2H 4B3TH 4NXMH 2K1HA 4JVYA 2PQUA 4JI3H 2ZQEA 2VQFH 2UUCH 4LF5H 3U1KA 1N33H 1FKAH 3QD7X 4DR6H 3L7ZC 2P2RA 2JEAI 4JI5H 2E5LH 4DUZH 4B3MH 1X4NA 1VIHA 2F4VH 2HH3A 4DV4H 5C0XG 2ANNA 3OSSD 4OX9H 4PDBA 1VIGA 4KHPH 2JVZA 2JA9A 2D9IA 1S03G 2JE6I 4DR1H 5A2QW 3KDGA 2M6QA 4DV5H 4JI8H 2BL5A 4JI7H 1XNQH 2HH2A 2CTEA 4DR4H 4DV6H 4OO1G 2PT7G 1ZZKA 5LL6b 2HHHH 1HNZH 4G08A 3OETA 4LFAH 4BA2I 4LFBH 1X0AA 4LF9H 1WTJA 1EC6A 1SEIA 3KDKA 2FFMA 4WANA 1DTJA 5JEAG 3EZJA 2MJHA 2CTFA 4JYAH 2UXCH 5FLXW 4DV3H 1HNXH 1XRHA 3J80W 4DV1H 1X4MA 5IWAH 1IBKH 1ODHA 4B3SH 2NN6G 4FJUA 1ZTGA 4LFCH 2UXDH 2PY9A 1N36H 2FPHX 4OD6A 2CPMA 2OPUA 4X66H 3SB1A 1HR0H 5LMNH
chains in the Genus database with same CATH topology
4NBQA 2OPVA 4LIJA 3AEVB 3V69A 4AM3A 2ANRA 2CPQA 2JE6I 3VKEA 2CTJA 2QNDA 1WE8A 2BL5A 2PQUA 2HH2A 2CTEA 4OO1G 4JVYA 4WALA 1ZZKA 2CTKA 3U1KA 1K1GA 4IFDG 1ZZJA 4BA2I 3L7ZC 2Z0SA 2OPUA 4BA1I 2CTMA 2P2RA 1DT4A 2JEAI 1EC6A 1J5KA 4WANA 2CTLA 4QMFB 4B8TA 2JZXA 2YQRA 1DTJA 1X4NA 5JEAG 2MJHA 2CTFA 2E3UA 4AIMA 1TUAA 1VIHA 4JVHA 2HH3A 5K36G 1X4MA 2BA0A 1ZZIA 5C0XG 2ANNA 2NN6G 1J4WA 2JEBI 1WVNA 1ZTGA 2FMRA 2PY9A 1VIGA 2JVZA 2DGRA 2JA9A 1KHMA 2AXYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NBQ A;  2OPV A;  4LIJ A;  3AEV B;  3V69 A;  4AM3 A;  2ANR A;  2CPQ A;  2JE6 I;  3VKE A;  2CTJ A;  2QND A;  1WE8 A;  2BL5 A;  2PQU A;  2HH2 A;  2CTE A;  4OO1 G;  4JVY A;  4WAL A;  1ZZK A;  2CTK A;  3U1K A;  1K1G A;  4IFD G;  1ZZJ A;  4BA2 I;  3L7Z C;  2Z0S A;  2OPU A;  4BA1 I;  2CTM A;  2P2R A;  1DT4 A;  2JEA I;  1EC6 A;  1J5K A;  4WAN A;  2CTL A;  4QMF B;  4B8T A;  2JZX A;  2YQR A;  1DTJ A;  1X4N A;  5JEA G;  2MJH A;  2CTF A;  2E3U A;  4AIM A;  1TUA A;  1VIH A;  4JVH A;  2HH3 A;  5K36 G;  1X4M A;  2BA0 A;  1ZZI A;  5C0X G;  2ANN A;  2NN6 G;  1J4W A;  2JEB I;  1WVN A;  1ZTG A;  2FMR A;  2PY9 A;  1VIG A;  2JVZ A;  2DGR A;  2JA9 A;  1KHM A;  2AXY A; 
#chains in the Genus database with same CATH topology
 4NBQ A;  1F0X A;  4AM3 A;  1VBI A;  4B8C D;  4NXN H;  2CWH A;  5IT9 W;  3GKU A;  1AN7 A;  2A1S A;  4DUY H;  2CWF A;  2CTK A;  1V9N A;  3I0P A;  2X06 A;  3RF2 A;  4NZR M;  2LRR A;  3FAU A;  2UU9 H;  1FJG H;  5LMU H;  2LF0 A;  2CTM A;  4JI0 H;  1DT4 A;  4JI1 H;  4X65 H;  4NZT M;  2CTL A;  1S20 A;  3GAB A;  4JI2 H;  1MSZ A;  1N34 H;  4LF4 H;  4LF6 H;  5DT9 A;  1XMQ H;  4X64 H;  2Y3M A;  4JV5 H;  5K36 G;  4K0K H;  3NCV A;  1UG8 A;  2JEB I;  4DR7 H;  2FMR A;  3UOE A;  2G8Y A;  4YY3 H;  2LTM A;  3T1Y H;  2UUA H;  4X62 H;  4B8T A;  1K1G A;  2UUB H;  2VKC A;  3AEV B;  2ZM6 H;  2M8W A;  2CPQ A;  3VKE A;  1XNR H;  2CTJ A;  1V8C A;  1WHR A;  1PQX A;  2QND A;  1WE8 A;  4H8A A;  4YHH H;  4FJS A;  1IBM H;  4LF7 H;  4B3R H;  4WAL A;  1HNW H;  3J81 W;  4JI6 H;  4IFD G;  1ZZJ A;  3JAM W;  1NXU A;  4E9J A;  3OTO H;  2Z0S A;  4EC5 A;  4BA1 I;  4GKJ H;  4QMF B;  1Z2I A;  2JZX A;  1N32 H;  2YQR A;  4DR2 H;  1XMO H;  4LF8 H;  2E3U A;  4AIM A;  1TUA A;  4JVH A;  2LTL A;  4JI4 H;  5BR8 H;  1I6U A;  2BA0 A;  3GR5 A;  1ZZI A;  1X9Z A;  1J5E H;  1J4W A;  1WVN A;  4DV7 H;  4GKK H;  4DR5 H;  4DR3 H;  3T1H H;  2VQE H;  2DGR A;  1J5K A;  1I94 H;  3J7A K;  1KHM A;  2O4C A;  4DV0 H;  2AXY A;  2OPV A;  4LIJ A;  3V69 A;  1IBL H;  2UXB H;  2ANR A;  4AQY H;  4OCH A;  4DV2 H;  4B3T H;  4NXM H;  2K1H A;  4JVY A;  2PQU A;  4JI3 H;  2ZQE A;  2VQF H;  2UUC H;  4LF5 H;  3U1K A;  1N33 H;  1FKA H;  3QD7 X;  4DR6 H;  3L7Z C;  2P2R A;  2JEA I;  4JI5 H;  2E5L H;  4DUZ H;  4B3M H;  1X4N A;  1VIH A;  2F4V H;  2HH3 A;  4DV4 H;  5C0X G;  2ANN A;  3OSS D;  4OX9 H;  4PDB A;  1VIG A;  4KHP H;  2JVZ A;  2JA9 A;  2D9I A;  1S03 G;  2JE6 I;  4DR1 H;  5A2Q W;  3KDG A;  2M6Q A;  4DV5 H;  4JI8 H;  2BL5 A;  4JI7 H;  1XNQ H;  2HH2 A;  2CTE A;  4DR4 H;  4DV6 H;  4OO1 G;  2PT7 G;  1ZZK A;  5LL6 b;  2HHH H;  1HNZ H;  4G08 A;  3OET A;  4LFA H;  4BA2 I;  4LFB H;  1X0A A;  4LF9 H;  1WTJ A;  1EC6 A;  1SEI A;  3KDK A;  2FFM A;  4WAN A;  1DTJ A;  5JEA G;  3EZJ A;  2MJH A;  2CTF A;  4JYA H;  2UXC H;  5FLX W;  4DV3 H;  1HNX H;  1XRH A;  3J80 W;  4DV1 H;  1X4M A;  5IWA H;  1IBK H;  1ODH A;  4B3S H;  2NN6 G;  4FJU A;  1ZTG A;  4LFC H;  2UXD H;  2PY9 A;  1N36 H;  2FPH X;  4OD6 A;  2CPM A;  2OPU A;  4X66 H;  3SB1 A;  1HR0 H;  5LMN H; 
#chains in the Genus database with same CATH homology
 4NBQ A;  2OPV A;  4LIJ A;  3AEV B;  3V69 A;  4AM3 A;  2ANR A;  2CPQ A;  2JE6 I;  3VKE A;  2CTJ A;  2QND A;  1WE8 A;  2BL5 A;  2PQU A;  2HH2 A;  2CTE A;  4OO1 G;  4JVY A;  4WAL A;  1ZZK A;  2CTK A;  3U1K A;  1K1G A;  4IFD G;  1ZZJ A;  4BA2 I;  3L7Z C;  2Z0S A;  2OPU A;  4BA1 I;  2CTM A;  2P2R A;  1DT4 A;  2JEA I;  1EC6 A;  1J5K A;  4WAN A;  2CTL A;  4QMF B;  4B8T A;  2JZX A;  2YQR A;  1DTJ A;  1X4N A;  5JEA G;  2MJH A;  2CTF A;  2E3U A;  4AIM A;  1TUA A;  1VIH A;  4JVH A;  2HH3 A;  5K36 G;  1X4M A;  2BA0 A;  1ZZI A;  5C0X G;  2ANN A;  2NN6 G;  1J4W A;  2JEB I;  1WVN A;  1ZTG A;  2FMR A;  2PY9 A;  1VIG A;  2JVZ A;  2DGR A;  2JA9 A;  1KHM A;  2AXY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...