1ZTGA

Human alpha polyc binding protein kh1
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
72
structure length
72
Chain Sequence
ILTIRLLMHGKEVGSIIGKKGESVKRIREESGARINISEGNCPERIITLTGPTNAIFKAFAMIIDKLEEDIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POLY(RC)-BINDING PROTEIN 1
publication title Contribution of the first K-homology domain of poly(C)-binding protein 1 to its affinity and specificity for C-rich oligonucleotides
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna, rna binding protein/dna
total genus 19
structure length 72
sequence length 72
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 1ztgA00
1WE8A 1X4MA 2CTLA 2MJHA 4OO1G 4BA2I 1J4WA 1KHMA 4NBQA 2CTFA 2NN6G 2YQRA 2ANRA 2CTEA 3L7ZC 2Z0SA 4JVHA 2FMRA 4WALA 1WVNA 4WANA 2CTMA 5JEAG 1K1GA 4IFDG 2JEAI 2JE6I 2CPQA 1DT4A 1ZZJA 4LIJA 2PQUA 3AEVB 3VKEA 4JVYA 2CTJA 1X4NA 2OPUA 4BA1I 1ZZKA 2PY9A 1EC6A 5C0XG 2BA0A 4B8TA 1VIGA 2HH2A 2HH3A 2JEBI 2QNDA 4QMFB 1J5KA 4AIMA 2CTKA 1VIHA 2BL5A 2P2RA 2ANNA 2JA9A 3V69A 4AM3A 1ZZIA 1TUAA 1DTJA 3U1KA 1ZTGA 5K36G 2JZXA 2E3UA 2AXYA 2JVZA 2DGRA 2OPVA
chains in the Genus database with same CATH superfamily
4G08A 3EZJA 3GABA 5A2QW 1HNWH 1X9ZA 1N32H 2X06A 4AQYH 2A1SA 4DR4H 4JV5H 4WALA 4DV4H 1HNZH 1FJGH 4NXMH 1UG8A 1IBMH 2LTLA 4LF7H 4X65H 3AEVB 4DR2H 2O4CA 3QD7X 2OPUA 1IBLH 2UUCH 1EC6A 2ZM6H 4B8TA 3GKUA 4DUZH 3JAMW 4LF5H 5IWAH 1VIHA 1ODHA 1NXUA 1XMOH 1S20A 4DR6H 2UXBH 2P2RA 2ANNA 2JA9A 4AM3A 1MSZA 1ZZIA 2M6QA 5FLXW 2HHHH 5K36G 4DR1H 4DV0H 2AXYA 4YY3H 3T1HH 2MJHA 2VKCA 4DV6H 1J4WA 1KHMA 2G8YA 2CTFA 2ANRA 4JI7H 4E9JA 4DR3H 2Z0SA 2FMRA 4JI6H 4JI1H 1K1GA 4LFBH 4OX9H 4IFDG 4B3TH 2PT7G 4NXNH 1HNXH 2F4VH 4JVYA 3I0PA 5DT9A 4DR7H 1N36H 1XRHA 4GKJH 3KDKA 2UXCH 1ZZKA 4B3SH 2BA0A 1J5KA 2HH2A 3NCVA 4NZTM 2CTKA 1S03G 4DUYH 5LL6b 5IT9W 4B8CD 2BL5A 4NZRM 1DTJA 1VBIA 2M8WA 3KDGA 4DR5H 1ZTGA 2JZXA 5LMNH 1XNQH 4JYAH 1V9NA 1F0XA 1X4MA 4JI4H 2UUAH 2LRRA 4BA2I 4NBQA 4DV5H 1J5EH 2YQRA 2LF0A 2CTEA 2UXDH 4B3RH 4JVHA 2CPMA 1WTJA 2CTMA 3UOEA 1N33H 3OTOH 1IBKH 3T1YH 1XNRH 4LF6H 4LF9H 4X64H 2CPQA 4H8AA 5LMUH 4LIJA 1ZZJA 1XMQH 3VKEA 4DV2H 1N34H 1HR0H 2PQUA 2VQEH 4JI8H 2VQFH 4BA1I 2PY9A 2UU9H 1VIGA 1Z2IA 3J80W 2QNDA 1X0AA 4AIMA 4B3MH 4OD6A 1SEIA 2JEAI 3OETA 3V69A 4KHPH 2Y3MA 4LFAH 4JI2H 2FFMA 2FPHX 1FKAH 3FAUA 2E3UA 2JVZA 4DV3H 1WE8A 2D9IA 2CTLA 4FJUA 4YHHH 4JI5H 4LF4H 4OO1G 2NN6G 4DV7H 2E5LH 4EC5A 3L7ZC 3OSSD 3GR5A 1WVNA 4WANA 3SB1A 1V8CA 5JEAG 2LTMA 1I94H 4GKKH 2JE6I 1DT4A 4OCHA 4X66H 4LF8H 4JI0H 2CTJA 3RF2A 3J7AK 2CWFA 2K1HA 1X4NA 4LFCH 1I6UA 5BR8H 5C0XG 4K0KH 1PQXA 4QMFB 2HH3A 2JEBI 2UUBH 1WHRA 4JI3H 2CWHA 4X62H 3J81W 4DV1H 1TUAA 1AN7A 3U1KA 4PDBA 2ZQEA 4FJSA 2DGRA 2OPVA
chains in the Genus database with same CATH topology
1WE8A 1X4MA 2CTLA 2MJHA 4OO1G 4BA2I 1J4WA 1KHMA 4NBQA 2CTFA 2NN6G 2YQRA 2ANRA 2CTEA 3L7ZC 2Z0SA 4JVHA 2FMRA 4WALA 1WVNA 4WANA 2CTMA 5JEAG 1K1GA 4IFDG 2JEAI 2JE6I 2CPQA 1DT4A 1ZZJA 4LIJA 2PQUA 3AEVB 3VKEA 4JVYA 2CTJA 1X4NA 2OPUA 4BA1I 1ZZKA 2PY9A 1EC6A 5C0XG 2BA0A 4B8TA 1VIGA 2HH2A 2HH3A 2JEBI 2QNDA 4QMFB 1J5KA 4AIMA 2CTKA 1VIHA 2BL5A 2P2RA 2ANNA 2JA9A 3V69A 4AM3A 1ZZIA 1TUAA 1DTJA 3U1KA 1ZTGA 5K36G 2JZXA 2E3UA 2AXYA 2JVZA 2DGRA 2OPVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WE8 A;  1X4M A;  2CTL A;  2MJH A;  4OO1 G;  4BA2 I;  1J4W A;  1KHM A;  4NBQ A;  2CTF A;  2NN6 G;  2YQR A;  2ANR A;  2CTE A;  3L7Z C;  2Z0S A;  4JVH A;  2FMR A;  4WAL A;  1WVN A;  4WAN A;  2CTM A;  5JEA G;  1K1G A;  4IFD G;  2JEA I;  2JE6 I;  2CPQ A;  1DT4 A;  1ZZJ A;  4LIJ A;  2PQU A;  3AEV B;  3VKE A;  4JVY A;  2CTJ A;  1X4N A;  2OPU A;  4BA1 I;  1ZZK A;  2PY9 A;  1EC6 A;  5C0X G;  2BA0 A;  4B8T A;  1VIG A;  2HH2 A;  2HH3 A;  2JEB I;  2QND A;  4QMF B;  1J5K A;  4AIM A;  2CTK A;  1VIH A;  2BL5 A;  2P2R A;  2ANN A;  2JA9 A;  3V69 A;  4AM3 A;  1ZZI A;  1TUA A;  1DTJ A;  3U1K A;  1ZTG A;  5K36 G;  2JZX A;  2E3U A;  2AXY A;  2JVZ A;  2DGR A;  2OPV A; 
#chains in the Genus database with same CATH topology
 4G08 A;  3EZJ A;  3GAB A;  5A2Q W;  1HNW H;  1X9Z A;  1N32 H;  2X06 A;  4AQY H;  2A1S A;  4DR4 H;  4JV5 H;  4WAL A;  4DV4 H;  1HNZ H;  1FJG H;  4NXM H;  1UG8 A;  1IBM H;  2LTL A;  4LF7 H;  4X65 H;  3AEV B;  4DR2 H;  2O4C A;  3QD7 X;  2OPU A;  1IBL H;  2UUC H;  1EC6 A;  2ZM6 H;  4B8T A;  3GKU A;  4DUZ H;  3JAM W;  4LF5 H;  5IWA H;  1VIH A;  1ODH A;  1NXU A;  1XMO H;  1S20 A;  4DR6 H;  2UXB H;  2P2R A;  2ANN A;  2JA9 A;  4AM3 A;  1MSZ A;  1ZZI A;  2M6Q A;  5FLX W;  2HHH H;  5K36 G;  4DR1 H;  4DV0 H;  2AXY A;  4YY3 H;  3T1H H;  2MJH A;  2VKC A;  4DV6 H;  1J4W A;  1KHM A;  2G8Y A;  2CTF A;  2ANR A;  4JI7 H;  4E9J A;  4DR3 H;  2Z0S A;  2FMR A;  4JI6 H;  4JI1 H;  1K1G A;  4LFB H;  4OX9 H;  4IFD G;  4B3T H;  2PT7 G;  4NXN H;  1HNX H;  2F4V H;  4JVY A;  3I0P A;  5DT9 A;  4DR7 H;  1N36 H;  1XRH A;  4GKJ H;  3KDK A;  2UXC H;  1ZZK A;  4B3S H;  2BA0 A;  1J5K A;  2HH2 A;  3NCV A;  4NZT M;  2CTK A;  1S03 G;  4DUY H;  5LL6 b;  5IT9 W;  4B8C D;  2BL5 A;  4NZR M;  1DTJ A;  1VBI A;  2M8W A;  3KDG A;  4DR5 H;  1ZTG A;  2JZX A;  5LMN H;  1XNQ H;  4JYA H;  1V9N A;  1F0X A;  1X4M A;  4JI4 H;  2UUA H;  2LRR A;  4BA2 I;  4NBQ A;  4DV5 H;  1J5E H;  2YQR A;  2LF0 A;  2CTE A;  2UXD H;  4B3R H;  4JVH A;  2CPM A;  1WTJ A;  2CTM A;  3UOE A;  1N33 H;  3OTO H;  1IBK H;  3T1Y H;  1XNR H;  4LF6 H;  4LF9 H;  4X64 H;  2CPQ A;  4H8A A;  5LMU H;  4LIJ A;  1ZZJ A;  1XMQ H;  3VKE A;  4DV2 H;  1N34 H;  1HR0 H;  2PQU A;  2VQE H;  4JI8 H;  2VQF H;  4BA1 I;  2PY9 A;  2UU9 H;  1VIG A;  1Z2I A;  3J80 W;  2QND A;  1X0A A;  4AIM A;  4B3M H;  4OD6 A;  1SEI A;  2JEA I;  3OET A;  3V69 A;  4KHP H;  2Y3M A;  4LFA H;  4JI2 H;  2FFM A;  2FPH X;  1FKA H;  3FAU A;  2E3U A;  2JVZ A;  4DV3 H;  1WE8 A;  2D9I A;  2CTL A;  4FJU A;  4YHH H;  4JI5 H;  4LF4 H;  4OO1 G;  2NN6 G;  4DV7 H;  2E5L H;  4EC5 A;  3L7Z C;  3OSS D;  3GR5 A;  1WVN A;  4WAN A;  3SB1 A;  1V8C A;  5JEA G;  2LTM A;  1I94 H;  4GKK H;  2JE6 I;  1DT4 A;  4OCH A;  4X66 H;  4LF8 H;  4JI0 H;  2CTJ A;  3RF2 A;  3J7A K;  2CWF A;  2K1H A;  1X4N A;  4LFC H;  1I6U A;  5BR8 H;  5C0X G;  4K0K H;  1PQX A;  4QMF B;  2HH3 A;  2JEB I;  2UUB H;  1WHR A;  4JI3 H;  2CWH A;  4X62 H;  3J81 W;  4DV1 H;  1TUA A;  1AN7 A;  3U1K A;  4PDB A;  2ZQE A;  4FJS A;  2DGR A;  2OPV A; 
#chains in the Genus database with same CATH homology
 1WE8 A;  1X4M A;  2CTL A;  2MJH A;  4OO1 G;  4BA2 I;  1J4W A;  1KHM A;  4NBQ A;  2CTF A;  2NN6 G;  2YQR A;  2ANR A;  2CTE A;  3L7Z C;  2Z0S A;  4JVH A;  2FMR A;  4WAL A;  1WVN A;  4WAN A;  2CTM A;  5JEA G;  1K1G A;  4IFD G;  2JEA I;  2JE6 I;  2CPQ A;  1DT4 A;  1ZZJ A;  4LIJ A;  2PQU A;  3AEV B;  3VKE A;  4JVY A;  2CTJ A;  1X4N A;  2OPU A;  4BA1 I;  1ZZK A;  2PY9 A;  1EC6 A;  5C0X G;  2BA0 A;  4B8T A;  1VIG A;  2HH2 A;  2HH3 A;  2JEB I;  2QND A;  4QMF B;  1J5K A;  4AIM A;  2CTK A;  1VIH A;  2BL5 A;  2P2R A;  2ANN A;  2JA9 A;  3V69 A;  4AM3 A;  1ZZI A;  1TUA A;  1DTJ A;  3U1K A;  1ZTG A;  5K36 G;  2JZX A;  2E3U A;  2AXY A;  2JVZ A;  2DGR A;  2OPV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...