1ZTGA

Human alpha polyc binding protein kh1
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
72
structure length
72
Chain Sequence
ILTIRLLMHGKEVGSIIGKKGESVKRIREESGARINISEGNCPERIITLTGPTNAIFKAFAMIIDKLEEDIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Contribution of the first K-homology domain of poly(C)-binding protein 1 to its affinity and specificity for C-rich oligonucleotides
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna, rna binding protein/dna
molecule keywords POLY(RC)-BINDING PROTEIN 1
total genus 19
structure length 72
sequence length 72
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 1ztgA00
4AIMA 2CTLA 5K36G 2CTJA 2CTMA 2ANNA 2JZXA 3U1KA 1J4WA 4JVYA 1VIHA 2HH3A 3L7ZC 2AXYA 2P2RA 2HH2A 2CPQA 5C0XG 1EC6A 2OPUA 2E3UA 2CTKA 3V69A 4WANA 2NN6G 2FMRA 1WE8A 2Z0SA 2OPVA 1VIGA 4BA1I 4OO1G 3VKEA 2ANRA 1X4NA 4IFDG 2BA0A 1KHMA 5JEAG 1TUAA 2JVZA 2YQRA 2PY9A 2JE6I 2JEBI 1X4MA 4QMFB 4AM3A 2BL5A 2CTEA 4B8TA 1ZZKA 1ZZIA 1J5KA 3AEVB 4NBQA 2JEAI 1ZTGA 2MJHA 4BA2I 2PQUA 4LIJA 1ZZJA 4JVHA 1DT4A 4WALA 2CTFA 1DTJA 1WVNA 2QNDA 2DGRA 1K1GA 2JA9A
chains in the Genus database with same CATH superfamily
2CTLA 4JI4H 4DV2H 2JZXA 2LRRA 4B3SH 1F0XA 5IWAH 1EC6A 1VBIA 3J7AK 5C0XG 2E3UA 2X06A 2G8YA 4E9JA 4WANA 4JI0H 2FMRA 4FJUA 4NXMH 4OO1G 3VKEA 1X4NA 1XRHA 2O4CA 5JEAG 2YQRA 2JE6I 1X4MA 1J5EH 4QMFB 5FLXW 4DV1H 1ZZKA 3AEVB 4LF6H 1PQXA 1N33H 4LIJA 1S20A 3EZJA 3OSSD 3T1HH 2CTFA 1IBLH 3OTOH 1WVNA 2UXBH 4NZTM 3T1YH 4X66H 2UUBH 2UXDH 2CTJA 4B8CD 4AQYH 1J4WA 4EC5A 4DV7H 3KDGA 1UG8A 2M8WA 3GABA 2CWHA 2LTLA 2NN6G 3GR5A 4G08A 4DR7H 4PDBA 1WE8A 2FPHX 2OPVA 2Z0SA 4BA1I 4LF8H 4DR2H 4DR1H 1XMQH 1KHMA 1V8CA 1N32H 4JV5H 2PY9A 4NXNH 4LFBH 4JYAH 2Y3MA 3RF2A 4B8TA 1WHRA 4DV5H 1J5KA 4NZRM 1IBMH 4OD6A 1S03G 4KHPH 1AN7A 3J80W 4DR4H 2CPMA 4WALA 4B3RH 4YY3H 1FJGH 1DTJA 4DR6H 2F4VH 2ZM6H 4JI5H 1K1GA 4DR3H 5K36G 2LTMA 5LMUH 2CTMA 1I94H 2E5LH 2CWFA 4LF4H 3U1KA 2K1HA 3L7ZC 2HH3A 2M6QA 2AXYA 2ZQEA 3KDKA 2CPQA 2UU9H 4H8AA 2UUAH 3GKUA 1MSZA 1X9ZA 2ANRA 1XNRH 1N34H 1I6UA 4DV3H 5A2QW 4DUYH 3UOEA 1N36H 2HHHH 3J81W 4GKJH 4FJSA 4GKKH 1FKAH 4B3MH 1IBKH 1SEIA 1ZZIA 3FAUA 4NBQA 2JEAI 2MJHA 2PQUA 4OX9H 2UUCH 3I0PA 4JI7H 2VKCA 1DT4A 4X62H 1Z2IA 1XNQH 1X0AA 2VQEH 2JA9A 4AIMA 3JAMW 4DV4H 4JI1H 2FFMA 2PT7G 4DR5H 4DV0H 1HNZH 2ANNA 4LF5H 4LFCH 4JVYA 2UXCH 4DUZH 1VIHA 2LF0A 2VQFH 5LMNH 2P2RA 2HH2A 4LF7H 4LF9H 4JI2H 2OPUA 2CTKA 3V69A 5BR8H 2D9IA 1HR0H 2A1SA 4B3TH 1VIGA 4K0KH 4JI6H 1HNXH 4IFDG 2BA0A 1XMOH 1TUAA 2JVZA 2JEBI 3OETA 2BL5A 2CTEA 3NCVA 4OCHA 5LL6b 1HNWH 1WTJA 4X64H 4AM3A 3SB1A 4JI3H 1ZTGA 4BA2I 4DV6H 1V9NA 1ZZJA 4JVHA 5DT9A 4X65H 4YHHH 5IT9W 1NXUA 2QNDA 2DGRA 3QD7X 1ODHA 4LFAH 4JI8H
chains in the Genus database with same CATH topology
4AIMA 2CTLA 5K36G 2CTJA 2CTMA 2ANNA 2JZXA 3U1KA 1J4WA 4JVYA 1VIHA 2HH3A 3L7ZC 2AXYA 2P2RA 2HH2A 2CPQA 5C0XG 1EC6A 2OPUA 2E3UA 2CTKA 3V69A 4WANA 2NN6G 2FMRA 1WE8A 2Z0SA 2OPVA 1VIGA 4BA1I 4OO1G 3VKEA 2ANRA 1X4NA 4IFDG 2BA0A 1KHMA 5JEAG 1TUAA 2JVZA 2YQRA 2PY9A 2JE6I 2JEBI 1X4MA 4QMFB 4AM3A 2BL5A 2CTEA 4B8TA 1ZZKA 1ZZIA 1J5KA 3AEVB 4NBQA 2JEAI 1ZTGA 2MJHA 4BA2I 2PQUA 4LIJA 1ZZJA 4JVHA 1DT4A 4WALA 2CTFA 1DTJA 1WVNA 2QNDA 2DGRA 1K1GA 2JA9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AIM A;  2CTL A;  5K36 G;  2CTJ A;  2CTM A;  2ANN A;  2JZX A;  3U1K A;  1J4W A;  4JVY A;  1VIH A;  2HH3 A;  3L7Z C;  2AXY A;  2P2R A;  2HH2 A;  2CPQ A;  5C0X G;  1EC6 A;  2OPU A;  2E3U A;  2CTK A;  3V69 A;  4WAN A;  2NN6 G;  2FMR A;  1WE8 A;  2Z0S A;  2OPV A;  1VIG A;  4BA1 I;  4OO1 G;  3VKE A;  2ANR A;  1X4N A;  4IFD G;  2BA0 A;  1KHM A;  5JEA G;  1TUA A;  2JVZ A;  2YQR A;  2PY9 A;  2JE6 I;  2JEB I;  1X4M A;  4QMF B;  4AM3 A;  2BL5 A;  2CTE A;  4B8T A;  1ZZK A;  1ZZI A;  1J5K A;  3AEV B;  4NBQ A;  2JEA I;  1ZTG A;  2MJH A;  4BA2 I;  2PQU A;  4LIJ A;  1ZZJ A;  4JVH A;  1DT4 A;  4WAL A;  2CTF A;  1DTJ A;  1WVN A;  2QND A;  2DGR A;  1K1G A;  2JA9 A; 
#chains in the Genus database with same CATH topology
 2CTL A;  4JI4 H;  4DV2 H;  2JZX A;  2LRR A;  4B3S H;  1F0X A;  5IWA H;  1EC6 A;  1VBI A;  3J7A K;  5C0X G;  2E3U A;  2X06 A;  2G8Y A;  4E9J A;  4WAN A;  4JI0 H;  2FMR A;  4FJU A;  4NXM H;  4OO1 G;  3VKE A;  1X4N A;  1XRH A;  2O4C A;  5JEA G;  2YQR A;  2JE6 I;  1X4M A;  1J5E H;  4QMF B;  5FLX W;  4DV1 H;  1ZZK A;  3AEV B;  4LF6 H;  1PQX A;  1N33 H;  4LIJ A;  1S20 A;  3EZJ A;  3OSS D;  3T1H H;  2CTF A;  1IBL H;  3OTO H;  1WVN A;  2UXB H;  4NZT M;  3T1Y H;  4X66 H;  2UUB H;  2UXD H;  2CTJ A;  4B8C D;  4AQY H;  1J4W A;  4EC5 A;  4DV7 H;  3KDG A;  1UG8 A;  2M8W A;  3GAB A;  2CWH A;  2LTL A;  2NN6 G;  3GR5 A;  4G08 A;  4DR7 H;  4PDB A;  1WE8 A;  2FPH X;  2OPV A;  2Z0S A;  4BA1 I;  4LF8 H;  4DR2 H;  4DR1 H;  1XMQ H;  1KHM A;  1V8C A;  1N32 H;  4JV5 H;  2PY9 A;  4NXN H;  4LFB H;  4JYA H;  2Y3M A;  3RF2 A;  4B8T A;  1WHR A;  4DV5 H;  1J5K A;  4NZR M;  1IBM H;  4OD6 A;  1S03 G;  4KHP H;  1AN7 A;  3J80 W;  4DR4 H;  2CPM A;  4WAL A;  4B3R H;  4YY3 H;  1FJG H;  1DTJ A;  4DR6 H;  2F4V H;  2ZM6 H;  4JI5 H;  1K1G A;  4DR3 H;  5K36 G;  2LTM A;  5LMU H;  2CTM A;  1I94 H;  2E5L H;  2CWF A;  4LF4 H;  3U1K A;  2K1H A;  3L7Z C;  2HH3 A;  2M6Q A;  2AXY A;  2ZQE A;  3KDK A;  2CPQ A;  2UU9 H;  4H8A A;  2UUA H;  3GKU A;  1MSZ A;  1X9Z A;  2ANR A;  1XNR H;  1N34 H;  1I6U A;  4DV3 H;  5A2Q W;  4DUY H;  3UOE A;  1N36 H;  2HHH H;  3J81 W;  4GKJ H;  4FJS A;  4GKK H;  1FKA H;  4B3M H;  1IBK H;  1SEI A;  1ZZI A;  3FAU A;  4NBQ A;  2JEA I;  2MJH A;  2PQU A;  4OX9 H;  2UUC H;  3I0P A;  4JI7 H;  2VKC A;  1DT4 A;  4X62 H;  1Z2I A;  1XNQ H;  1X0A A;  2VQE H;  2JA9 A;  4AIM A;  3JAM W;  4DV4 H;  4JI1 H;  2FFM A;  2PT7 G;  4DR5 H;  4DV0 H;  1HNZ H;  2ANN A;  4LF5 H;  4LFC H;  4JVY A;  2UXC H;  4DUZ H;  1VIH A;  2LF0 A;  2VQF H;  5LMN H;  2P2R A;  2HH2 A;  4LF7 H;  4LF9 H;  4JI2 H;  2OPU A;  2CTK A;  3V69 A;  5BR8 H;  2D9I A;  1HR0 H;  2A1S A;  4B3T H;  1VIG A;  4K0K H;  4JI6 H;  1HNX H;  4IFD G;  2BA0 A;  1XMO H;  1TUA A;  2JVZ A;  2JEB I;  3OET A;  2BL5 A;  2CTE A;  3NCV A;  4OCH A;  5LL6 b;  1HNW H;  1WTJ A;  4X64 H;  4AM3 A;  3SB1 A;  4JI3 H;  1ZTG A;  4BA2 I;  4DV6 H;  1V9N A;  1ZZJ A;  4JVH A;  5DT9 A;  4X65 H;  4YHH H;  5IT9 W;  1NXU A;  2QND A;  2DGR A;  3QD7 X;  1ODH A;  4LFA H;  4JI8 H; 
#chains in the Genus database with same CATH homology
 4AIM A;  2CTL A;  5K36 G;  2CTJ A;  2CTM A;  2ANN A;  2JZX A;  3U1K A;  1J4W A;  4JVY A;  1VIH A;  2HH3 A;  3L7Z C;  2AXY A;  2P2R A;  2HH2 A;  2CPQ A;  5C0X G;  1EC6 A;  2OPU A;  2E3U A;  2CTK A;  3V69 A;  4WAN A;  2NN6 G;  2FMR A;  1WE8 A;  2Z0S A;  2OPV A;  1VIG A;  4BA1 I;  4OO1 G;  3VKE A;  2ANR A;  1X4N A;  4IFD G;  2BA0 A;  1KHM A;  5JEA G;  1TUA A;  2JVZ A;  2YQR A;  2PY9 A;  2JE6 I;  2JEB I;  1X4M A;  4QMF B;  4AM3 A;  2BL5 A;  2CTE A;  4B8T A;  1ZZK A;  1ZZI A;  1J5K A;  3AEV B;  4NBQ A;  2JEA I;  1ZTG A;  2MJH A;  4BA2 I;  2PQU A;  4LIJ A;  1ZZJ A;  4JVH A;  1DT4 A;  4WAL A;  2CTF A;  1DTJ A;  1WVN A;  2QND A;  2DGR A;  1K1G A;  2JA9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...