2LTMA

Solution nmr structure of nfu1 iron-sulfur cluster scaffold homolog from homo sapiens, northeast structural genomics consortium (nesg) target hr2876b
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
107
structure length
107
Chain Sequence
MGHHHHHHSHMFIQTQDTPNPNSLKFIPGKPVLETRTMDFPTPAAAFRSPLARQLFRIEGVKSVFFGPDSITVTKENEELDWNLLKPDIYATIMDFFASGLPLVTEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NFU1 iron-sulfur cluster scaffold homolog, mitochondrial
publication title Solution NMR Structure of NFU1 Iron-Sulfur Cluster Scaffold Homolog from Homo sapiens, Northeast Structural Genomics Consortium (NESG) Target HR2876B
rcsb
source organism Homo sapiens
molecule tags Electron transport
total genus 20
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2012-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08712 Nfu_N Scaffold protein Nfu/NifU N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Scaffold protein Nfu/NifU, N-terminal domain 2ltmA00
2FFMA 2M6QA 2M8WA 1PQXA 2LTLA 2LTMA 2K1HA
chains in the Genus database with same CATH superfamily
4DUZH 1X4MA 5C0XG 1X9ZA 2Y3MA 4DUYH 4JI1H 4LF7H 3OTOH 1N32H 5K36G 3T1HH 1TUAA 2CTJA 4H8AA 1V9NA 4YY3H 3J80W 2LTMA 3UOEA 2ANNA 4X64H 5IWAH 4LIJA 4K0KH 1J5EH 4BA1I 4NXNH 2VQEH 3VKEA 4LF9H 1XRHA 2ANRA 3AEVB 4X62H 2E3UA 4E9JA 2D9IA 2HH3A 3EZJA 4KHPH 4NBQA 4X66H 2ZQEA 2CTMA 4LFBH 1HNZH 4QMFB 5JEAG 4IFDG 1N36H 2JA9A 2AXYA 1X0AA 3FAUA 1ZZIA 2LTLA 1J5KA 4DV5H 3L7ZC 3U1KA 4LFAH 2VQFH 4AQYH 1IBLH 4DR5H 1VBIA 4LFCH 1Z2IA 3J7AK 5FLXW 2Z0SA 2YQRA 5LMNH 2UU9H 4JI4H 4JI7H 1K1GA 5DT9A 3GR5A 2JEBI 4OD6A 4GKKH 2FFMA 2CWHA 1HR0H 1XMOH 4EC5A 4YHHH 1XMQH 4B8TA 1J4WA 4DR4H 2BL5A 2NN6G 4X65H 1WE8A 1WVNA 2UUAH 1XNRH 1SEIA 1WHRA 2CTFA 4DR1H 4B3SH 4DR7H 2LF0A 2QNDA 3V69A 4PDBA 4JI3H 4FJUA 4LF8H 2ZM6H 4LF4H 2FPHX 2O4CA 2CPQA 1S20A 4DV1H 2BA0A 1NXUA 4DR6H 4BA2I 2OPUA 1I6UA 4B3RH 4JV5H 3GKUA 2CTEA 3RF2A 4JI6H 4GKJH 1N33H 2CPMA 2G8YA 4DV7H 4B3MH 2OPVA 3QD7X 1KHMA 2FMRA 4B8CD 4JVYA 5IT9W 2CTLA 3I0PA 2VKCA 4LF6H 4G08A 4NXMH 4NZTM 4OX9H 2JEAI 2UXDH 1AN7A 1UG8A 3J81W 1HNWH 5BR8H 2JVZA 4DV3H 1FKAH 1ZTGA 2HHHH 2UXBH 4AIMA 1EC6A 2JE6I 3OSSD 4LF5H 2PY9A 4JYAH 1DTJA 2DGRA 4DR2H 4DV6H 2K1HA 2LRRA 1F0XA 3KDKA 4FJSA 1VIHA 4JVHA 3NCVA 1ZZKA 3OETA 1HNXH 4DV4H 3GABA 2PQUA 2CWFA 4AM3A 1X4NA 4WANA 2X06A 3SB1A 1MSZA 1V8CA 5A2QW 1FJGH 3KDGA 4DV2H 1I94H 2A1SA 1IBMH 2JZXA 2E5LH 4OO1G 1N34H 1WTJA 4B3TH 1XNQH 5LL6b 2M6QA 2UUCH 3T1YH 4WALA 3JAMW 1IBKH 4JI8H 4DV0H 1ZZJA 2P2RA 1ODHA 2UUBH 4JI0H 4OCHA 4JI2H 2M8WA 1DT4A 4NZRM 2CTKA 1VIGA 1S03G 2MJHA 2F4VH 4JI5H 1PQXA 2UXCH 2HH2A 2PT7G 5LMUH 4DR3H
chains in the Genus database with same CATH topology
2FFMA 2M6QA 2M8WA 1PQXA 2LTLA 2LTMA 2K1HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FFM A;  2M6Q A;  2M8W A;  1PQX A;  2LTL A;  2LTM A;  2K1H A; 
#chains in the Genus database with same CATH topology
 4DUZ H;  1X4M A;  5C0X G;  1X9Z A;  2Y3M A;  4DUY H;  4JI1 H;  4LF7 H;  3OTO H;  1N32 H;  5K36 G;  3T1H H;  1TUA A;  2CTJ A;  4H8A A;  1V9N A;  4YY3 H;  3J80 W;  2LTM A;  3UOE A;  2ANN A;  4X64 H;  5IWA H;  4LIJ A;  4K0K H;  1J5E H;  4BA1 I;  4NXN H;  2VQE H;  3VKE A;  4LF9 H;  1XRH A;  2ANR A;  3AEV B;  4X62 H;  2E3U A;  4E9J A;  2D9I A;  2HH3 A;  3EZJ A;  4KHP H;  4NBQ A;  4X66 H;  2ZQE A;  2CTM A;  4LFB H;  1HNZ H;  4QMF B;  5JEA G;  4IFD G;  1N36 H;  2JA9 A;  2AXY A;  1X0A A;  3FAU A;  1ZZI A;  2LTL A;  1J5K A;  4DV5 H;  3L7Z C;  3U1K A;  4LFA H;  2VQF H;  4AQY H;  1IBL H;  4DR5 H;  1VBI A;  4LFC H;  1Z2I A;  3J7A K;  5FLX W;  2Z0S A;  2YQR A;  5LMN H;  2UU9 H;  4JI4 H;  4JI7 H;  1K1G A;  5DT9 A;  3GR5 A;  2JEB I;  4OD6 A;  4GKK H;  2FFM A;  2CWH A;  1HR0 H;  1XMO H;  4EC5 A;  4YHH H;  1XMQ H;  4B8T A;  1J4W A;  4DR4 H;  2BL5 A;  2NN6 G;  4X65 H;  1WE8 A;  1WVN A;  2UUA H;  1XNR H;  1SEI A;  1WHR A;  2CTF A;  4DR1 H;  4B3S H;  4DR7 H;  2LF0 A;  2QND A;  3V69 A;  4PDB A;  4JI3 H;  4FJU A;  4LF8 H;  2ZM6 H;  4LF4 H;  2FPH X;  2O4C A;  2CPQ A;  1S20 A;  4DV1 H;  2BA0 A;  1NXU A;  4DR6 H;  4BA2 I;  2OPU A;  1I6U A;  4B3R H;  4JV5 H;  3GKU A;  2CTE A;  3RF2 A;  4JI6 H;  4GKJ H;  1N33 H;  2CPM A;  2G8Y A;  4DV7 H;  4B3M H;  2OPV A;  3QD7 X;  1KHM A;  2FMR A;  4B8C D;  4JVY A;  5IT9 W;  2CTL A;  3I0P A;  2VKC A;  4LF6 H;  4G08 A;  4NXM H;  4NZT M;  4OX9 H;  2JEA I;  2UXD H;  1AN7 A;  1UG8 A;  3J81 W;  1HNW H;  5BR8 H;  2JVZ A;  4DV3 H;  1FKA H;  1ZTG A;  2HHH H;  2UXB H;  4AIM A;  1EC6 A;  2JE6 I;  3OSS D;  4LF5 H;  2PY9 A;  4JYA H;  1DTJ A;  2DGR A;  4DR2 H;  4DV6 H;  2K1H A;  2LRR A;  1F0X A;  3KDK A;  4FJS A;  1VIH A;  4JVH A;  3NCV A;  1ZZK A;  3OET A;  1HNX H;  4DV4 H;  3GAB A;  2PQU A;  2CWF A;  4AM3 A;  1X4N A;  4WAN A;  2X06 A;  3SB1 A;  1MSZ A;  1V8C A;  5A2Q W;  1FJG H;  3KDG A;  4DV2 H;  1I94 H;  2A1S A;  1IBM H;  2JZX A;  2E5L H;  4OO1 G;  1N34 H;  1WTJ A;  4B3T H;  1XNQ H;  5LL6 b;  2M6Q A;  2UUC H;  3T1Y H;  4WAL A;  3JAM W;  1IBK H;  4JI8 H;  4DV0 H;  1ZZJ A;  2P2R A;  1ODH A;  2UUB H;  4JI0 H;  4OCH A;  4JI2 H;  2M8W A;  1DT4 A;  4NZR M;  2CTK A;  1VIG A;  1S03 G;  2MJH A;  2F4V H;  4JI5 H;  1PQX A;  2UXC H;  2HH2 A;  2PT7 G;  5LMU H;  4DR3 H; 
#chains in the Genus database with same CATH homology
 2FFM A;  2M6Q A;  2M8W A;  1PQX A;  2LTL A;  2LTM A;  2K1H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...