2LTMA

Solution nmr structure of nfu1 iron-sulfur cluster scaffold homolog from homo sapiens, northeast structural genomics consortium (nesg) target hr2876b
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
107
structure length
107
Chain Sequence
b'MGHHHHHHSHMFIQTQDTPNPNSLKFIPGKPVLETRTMDFPTPAAAFRSPLARQLFRIEGVKSVFFGPDSITVTKENEELDWNLLKPDIYATIMDFFASGLPLVTEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NFU1 iron-sulfur cluster scaffold homolog, mitochondrial
molecule tags Electron transport
source organism Homo sapiens
publication title Solution NMR Structure of NFU1 Iron-Sulfur Cluster Scaffold Homolog from Homo sapiens, Northeast Structural Genomics Consortium (NESG) Target HR2876B
rcsb
total genus 20
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2012-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08712 Nfu_N Scaffold protein Nfu/NifU N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Scaffold protein Nfu/NifU, N-terminal domain 2ltmA00
2M8WA 2M6QA 1PQXA 2K1HA 2LTMA 2FFMA 2LTLA
chains in the Genus database with same CATH superfamily
1N33H 2P2RA 2CTFA 1ZZIA 4FJSA 4NZTM 3EZJA 5LL6b 4GKJH 1V8CA 2FPHX 2CTJA 4PDBA 4OD6A 3L7ZC 5LMUH 1N36H 4OX9H 2E3UA 1DT4A 4DV0H 4DR5H 2Y3MA 1XNQH 4DV5H 4DR4H 5FLXW 1DTJA 2UXDH 4DR3H 4B3TH 3I0PA 3VKEA 4DR1H 4B3MH 4DV6H 4X62H 4OO1G 1PQXA 4JVHA 1KHMA 2LF0A 2FFMA 1Z2IA 2X06A 4NZRM 2CTMA 1VBIA 1VIHA 4K0KH 4G08A 2FMRA 5A2QW 1J5KA 1J4WA 1ZTGA 4JI4H 2VQFH 2VKCA 2YQRA 4NXNH 1NXUA 4DUZH 2OPVA 4AQYH 4B3RH 1XRHA 5IWAH 4JV5H 3UOEA 2OPUA 1SEIA 2BL5A 4X64H 2Z0SA 4DV3H 2CPMA 2HH3A 1X4MA 2M6QA 3NCVA 4B8CD 3J81W 2MJHA 3OETA 4LF8H 4QMFB 4B8TA 1VIGA 1S03G 2UXBH 4AIMA 4DR6H 2UXCH 1HNZH 1HNWH 1XNRH 4JI2H 2M8WA 4DV7H 3T1YH 4LF9H 4X65H 1X0AA 2JEAI 4JI5H 5JEAG 1S20A 2JZXA 4JYAH 2LTLA 3KDKA 2ANRA 1FKAH 1V9NA 3T1HH 2CWFA 3OTOH 3FAUA 1X4NA 5LMNH 2LRRA 4IFDG 2JEBI 4WANA 5K36G 2PQUA 2NN6G 1AN7A 1EC6A 4DR7H 4JI8H 4LFAH 4FJUA 2ZM6H 2PY9A 4LFBH 2DGRA 3SB1A 2LTMA 4NBQA 1IBKH 4KHPH 4LF4H 3GABA 3AEVB 1XMOH 2UUBH 2HH2A 2F4VH 1HNXH 1J5EH 3QD7X 2JA9A 1ODHA 1K1GA 2K1HA 2CTKA 4LF5H 4YHHH 2A1SA 1ZZJA 2ANNA 5C0XG 3KDGA 2UU9H 1I94H 3U1KA 4JI3H 3V69A 1WTJA 4DR2H 1X9ZA 1WHRA 1IBMH 5IT9W 2QNDA 1F0XA 3GKUA 4YY3H 5BR8H 4AM3A 4OCHA 2HHHH 4H8AA 4EC5A 3J80W 4BA2I 4LIJA 2BA0A 1WVNA 1XMQH 2PT7G 3OSSD 2VQEH 4DV2H 4JI0H 4GKKH 2O4CA 3RF2A 1HR0H 2ZQEA 4X66H 1TUAA 3GR5A 4LF6H 1FJGH 1IBLH 1N34H 2UUAH 4BA1I 1N32H 2CWHA 2JE6I 4DUYH 3J7AK 4JI1H 5DT9A 1MSZA 4DV4H 2UUCH 4LF7H 4JVYA 4JI6H 2D9IA 4E9JA 4JI7H 4DV1H 1ZZKA 2CTEA 2CTLA 1WE8A 2AXYA 4B3SH 4NXMH 1UG8A 2G8YA 1I6UA 4WALA 4LFCH 2E5LH 2CPQA 2JVZA 3JAMW
chains in the Genus database with same CATH topology
2M8WA 2M6QA 1PQXA 2K1HA 2LTMA 2FFMA 2LTLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M8W A;  2M6Q A;  1PQX A;  2K1H A;  2LTM A;  2FFM A;  2LTL A; 
#chains in the Genus database with same CATH topology
 1N33 H;  2P2R A;  2CTF A;  1ZZI A;  4FJS A;  4NZT M;  3EZJ A;  5LL6 b;  4GKJ H;  1V8C A;  2FPH X;  2CTJ A;  4PDB A;  4OD6 A;  3L7Z C;  5LMU H;  1N36 H;  4OX9 H;  2E3U A;  1DT4 A;  4DV0 H;  4DR5 H;  2Y3M A;  1XNQ H;  4DV5 H;  4DR4 H;  5FLX W;  1DTJ A;  2UXD H;  4DR3 H;  4B3T H;  3I0P A;  3VKE A;  4DR1 H;  4B3M H;  4DV6 H;  4X62 H;  4OO1 G;  1PQX A;  4JVH A;  1KHM A;  2LF0 A;  2FFM A;  1Z2I A;  2X06 A;  4NZR M;  2CTM A;  1VBI A;  1VIH A;  4K0K H;  4G08 A;  2FMR A;  5A2Q W;  1J5K A;  1J4W A;  1ZTG A;  4JI4 H;  2VQF H;  2VKC A;  2YQR A;  4NXN H;  1NXU A;  4DUZ H;  2OPV A;  4AQY H;  4B3R H;  1XRH A;  5IWA H;  4JV5 H;  3UOE A;  2OPU A;  1SEI A;  2BL5 A;  4X64 H;  2Z0S A;  4DV3 H;  2CPM A;  2HH3 A;  1X4M A;  2M6Q A;  3NCV A;  4B8C D;  3J81 W;  2MJH A;  3OET A;  4LF8 H;  4QMF B;  4B8T A;  1VIG A;  1S03 G;  2UXB H;  4AIM A;  4DR6 H;  2UXC H;  1HNZ H;  1HNW H;  1XNR H;  4JI2 H;  2M8W A;  4DV7 H;  3T1Y H;  4LF9 H;  4X65 H;  1X0A A;  2JEA I;  4JI5 H;  5JEA G;  1S20 A;  2JZX A;  4JYA H;  2LTL A;  3KDK A;  2ANR A;  1FKA H;  1V9N A;  3T1H H;  2CWF A;  3OTO H;  3FAU A;  1X4N A;  5LMN H;  2LRR A;  4IFD G;  2JEB I;  4WAN A;  5K36 G;  2PQU A;  2NN6 G;  1AN7 A;  1EC6 A;  4DR7 H;  4JI8 H;  4LFA H;  4FJU A;  2ZM6 H;  2PY9 A;  4LFB H;  2DGR A;  3SB1 A;  2LTM A;  4NBQ A;  1IBK H;  4KHP H;  4LF4 H;  3GAB A;  3AEV B;  1XMO H;  2UUB H;  2HH2 A;  2F4V H;  1HNX H;  1J5E H;  3QD7 X;  2JA9 A;  1ODH A;  1K1G A;  2K1H A;  2CTK A;  4LF5 H;  4YHH H;  2A1S A;  1ZZJ A;  2ANN A;  5C0X G;  3KDG A;  2UU9 H;  1I94 H;  3U1K A;  4JI3 H;  3V69 A;  1WTJ A;  4DR2 H;  1X9Z A;  1WHR A;  1IBM H;  5IT9 W;  2QND A;  1F0X A;  3GKU A;  4YY3 H;  5BR8 H;  4AM3 A;  4OCH A;  2HHH H;  4H8A A;  4EC5 A;  3J80 W;  4BA2 I;  4LIJ A;  2BA0 A;  1WVN A;  1XMQ H;  2PT7 G;  3OSS D;  2VQE H;  4DV2 H;  4JI0 H;  4GKK H;  2O4C A;  3RF2 A;  1HR0 H;  2ZQE A;  4X66 H;  1TUA A;  3GR5 A;  4LF6 H;  1FJG H;  1IBL H;  1N34 H;  2UUA H;  4BA1 I;  1N32 H;  2CWH A;  2JE6 I;  4DUY H;  3J7A K;  4JI1 H;  5DT9 A;  1MSZ A;  4DV4 H;  2UUC H;  4LF7 H;  4JVY A;  4JI6 H;  2D9I A;  4E9J A;  4JI7 H;  4DV1 H;  1ZZK A;  2CTE A;  2CTL A;  1WE8 A;  2AXY A;  4B3S H;  4NXM H;  1UG8 A;  2G8Y A;  1I6U A;  4WAL A;  4LFC H;  2E5L H;  2CPQ A;  2JVZ A;  3JAM W; 
#chains in the Genus database with same CATH homology
 2M8W A;  2M6Q A;  1PQX A;  2K1H A;  2LTM A;  2FFM A;  2LTL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...