2LTMA

Solution nmr structure of nfu1 iron-sulfur cluster scaffold homolog from homo sapiens, northeast structural genomics consortium (nesg) target hr2876b
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
107
structure length
107
Chain Sequence
MGHHHHHHSHMFIQTQDTPNPNSLKFIPGKPVLETRTMDFPTPAAAFRSPLARQLFRIEGVKSVFFGPDSITVTKENEELDWNLLKPDIYATIMDFFASGLPLVTEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NFU1 iron-sulfur cluster scaffold homolog, mitochondrial
publication title Solution NMR Structure of NFU1 Iron-Sulfur Cluster Scaffold Homolog from Homo sapiens, Northeast Structural Genomics Consortium (NESG) Target HR2876B
rcsb
source organism Homo sapiens
molecule tags Electron transport
total genus 20
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2012-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08712 Nfu_N Scaffold protein Nfu/NifU N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Scaffold protein Nfu/NifU, N-terminal domain 2ltmA00
1PQXA 2LTMA 2LTLA 2M8WA 2FFMA 2K1HA 2M6QA
chains in the Genus database with same CATH superfamily
4DV7H 2CPQA 4LF4H 1X0AA 2LTLA 1J4WA 2MJHA 4OO1G 5BR8H 1X4MA 2M6QA 4B3RH 5LMNH 2E5LH 4DR1H 1XMQH 2PY9A 2UUAH 1PQXA 4DUYH 1IBLH 4DR6H 2BL5A 4B8TA 3KDGA 4BA2I 1FKAH 4JVHA 3T1YH 4JI6H 2X06A 4OCHA 4X64H 4JI0H 4NZTM 2E3UA 4JI4H 1XNRH 2VKCA 4K0KH 4JVYA 4X65H 2LF0A 2YQRA 3JAMW 2HH3A 3J81W 2ZM6H 5LL6b 3VKEA 4LF7H 4DR3H 1WE8A 4JI3H 3J7AK 1N32H 2CTJA 3V69A 2ANRA 2HHHH 4PDBA 2JZXA 1EC6A 2UXBH 2DGRA 3OTOH 1ZZJA 3L7ZC 2CWHA 4AM3A 4YY3H 5FLXW 2UU9H 4JI1H 2QNDA 3OSSD 4B8CD 4GKJH 1V8CA 4LF5H 4DR7H 2BA0A 4IFDG 3I0PA 1S20A 3T1HH 4DV1H 4LIJA 4DV0H 4KHPH 2OPUA 4JI8H 2P2RA 1V9NA 4DV6H 1ZZKA 2AXYA 2ZQEA 2UUBH 1ODHA 4B3SH 1X9ZA 4NXNH 1KHMA 1IBMH 1VIGA 1HNZH 2JEAI 1VIHA 4DV2H 1XMOH 4X62H 3U1KA 4DR5H 4LFBH 3RF2A 4FJUA 1N36H 4NBQA 1MSZA 1UG8A 3QD7X 4G08A 1TUAA 1AN7A 4JI7H 1WVNA 1VBIA 2FFMA 2HH2A 4DUZH 1F0XA 5C0XG 2JVZA 1XRHA 4JI5H 4LFAH 2LTMA 1WTJA 4DR2H 1N33H 2ANNA 2CTEA 2VQFH 4LF9H 5K36G 2O4CA 2PQUA 2CPMA 4JV5H 4BA1I 2CWFA 3GABA 3AEVB 4B3MH 3GR5A 1NXUA 2OPVA 2Z0SA 4JI2H 4LFCH 5LMUH 4EC5A 2Y3MA 4YHHH 2LRRA 2F4VH 1HNXH 1X4NA 5A2QW 1HR0H 4AIMA 2NN6G 4OD6A 1Z2IA 1N34H 1DTJA 2FPHX 2JEBI 2K1HA 1ZZIA 4DV4H 1WHRA 2CTKA 4WANA 4DR4H 4LF6H 1ZTGA 4DV5H 1HNWH 4OX9H 2G8YA 4LF8H 2CTLA 4FJSA 2FMRA 2A1SA 1FJGH 1DT4A 4QMFB 3NCVA 1I6UA 3J80W 4E9JA 5JEAG 2CTFA 4X66H 2JA9A 3FAUA 4H8AA 1J5EH 1K1GA 4NXMH 4GKKH 4JYAH 1S03G 2UXDH 4WALA 2D9IA 3EZJA 1IBKH 2M8WA 3UOEA 3GKUA 4DV3H 1SEIA 4B3TH 3OETA 2VQEH 1I94H 5IWAH 5DT9A 4AQYH 3KDKA 2UUCH 4NZRM 1XNQH 1J5KA 5IT9W 2UXCH 3SB1A 2PT7G 2CTMA 2JE6I
chains in the Genus database with same CATH topology
1PQXA 2LTMA 2LTLA 2M8WA 2FFMA 2K1HA 2M6QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PQX A;  2LTM A;  2LTL A;  2M8W A;  2FFM A;  2K1H A;  2M6Q A; 
#chains in the Genus database with same CATH topology
 4DV7 H;  2CPQ A;  4LF4 H;  1X0A A;  2LTL A;  1J4W A;  2MJH A;  4OO1 G;  5BR8 H;  1X4M A;  2M6Q A;  4B3R H;  5LMN H;  2E5L H;  4DR1 H;  1XMQ H;  2PY9 A;  2UUA H;  1PQX A;  4DUY H;  1IBL H;  4DR6 H;  2BL5 A;  4B8T A;  3KDG A;  4BA2 I;  1FKA H;  4JVH A;  3T1Y H;  4JI6 H;  2X06 A;  4OCH A;  4X64 H;  4JI0 H;  4NZT M;  2E3U A;  4JI4 H;  1XNR H;  2VKC A;  4K0K H;  4JVY A;  4X65 H;  2LF0 A;  2YQR A;  3JAM W;  2HH3 A;  3J81 W;  2ZM6 H;  5LL6 b;  3VKE A;  4LF7 H;  4DR3 H;  1WE8 A;  4JI3 H;  3J7A K;  1N32 H;  2CTJ A;  3V69 A;  2ANR A;  2HHH H;  4PDB A;  2JZX A;  1EC6 A;  2UXB H;  2DGR A;  3OTO H;  1ZZJ A;  3L7Z C;  2CWH A;  4AM3 A;  4YY3 H;  5FLX W;  2UU9 H;  4JI1 H;  2QND A;  3OSS D;  4B8C D;  4GKJ H;  1V8C A;  4LF5 H;  4DR7 H;  2BA0 A;  4IFD G;  3I0P A;  1S20 A;  3T1H H;  4DV1 H;  4LIJ A;  4DV0 H;  4KHP H;  2OPU A;  4JI8 H;  2P2R A;  1V9N A;  4DV6 H;  1ZZK A;  2AXY A;  2ZQE A;  2UUB H;  1ODH A;  4B3S H;  1X9Z A;  4NXN H;  1KHM A;  1IBM H;  1VIG A;  1HNZ H;  2JEA I;  1VIH A;  4DV2 H;  1XMO H;  4X62 H;  3U1K A;  4DR5 H;  4LFB H;  3RF2 A;  4FJU A;  1N36 H;  4NBQ A;  1MSZ A;  1UG8 A;  3QD7 X;  4G08 A;  1TUA A;  1AN7 A;  4JI7 H;  1WVN A;  1VBI A;  2FFM A;  2HH2 A;  4DUZ H;  1F0X A;  5C0X G;  2JVZ A;  1XRH A;  4JI5 H;  4LFA H;  2LTM A;  1WTJ A;  4DR2 H;  1N33 H;  2ANN A;  2CTE A;  2VQF H;  4LF9 H;  5K36 G;  2O4C A;  2PQU A;  2CPM A;  4JV5 H;  4BA1 I;  2CWF A;  3GAB A;  3AEV B;  4B3M H;  3GR5 A;  1NXU A;  2OPV A;  2Z0S A;  4JI2 H;  4LFC H;  5LMU H;  4EC5 A;  2Y3M A;  4YHH H;  2LRR A;  2F4V H;  1HNX H;  1X4N A;  5A2Q W;  1HR0 H;  4AIM A;  2NN6 G;  4OD6 A;  1Z2I A;  1N34 H;  1DTJ A;  2FPH X;  2JEB I;  2K1H A;  1ZZI A;  4DV4 H;  1WHR A;  2CTK A;  4WAN A;  4DR4 H;  4LF6 H;  1ZTG A;  4DV5 H;  1HNW H;  4OX9 H;  2G8Y A;  4LF8 H;  2CTL A;  4FJS A;  2FMR A;  2A1S A;  1FJG H;  1DT4 A;  4QMF B;  3NCV A;  1I6U A;  3J80 W;  4E9J A;  5JEA G;  2CTF A;  4X66 H;  2JA9 A;  3FAU A;  4H8A A;  1J5E H;  1K1G A;  4NXM H;  4GKK H;  4JYA H;  1S03 G;  2UXD H;  4WAL A;  2D9I A;  3EZJ A;  1IBK H;  2M8W A;  3UOE A;  3GKU A;  4DV3 H;  1SEI A;  4B3T H;  3OET A;  2VQE H;  1I94 H;  5IWA H;  5DT9 A;  4AQY H;  3KDK A;  2UUC H;  4NZR M;  1XNQ H;  1J5K A;  5IT9 W;  2UXC H;  3SB1 A;  2PT7 G;  2CTM A;  2JE6 I; 
#chains in the Genus database with same CATH homology
 1PQX A;  2LTM A;  2LTL A;  2M8W A;  2FFM A;  2K1H A;  2M6Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...