2LTMA

Solution nmr structure of nfu1 iron-sulfur cluster scaffold homolog from homo sapiens, northeast structural genomics consortium (nesg) target hr2876b
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
107
structure length
107
Chain Sequence
MGHHHHHHSHMFIQTQDTPNPNSLKFIPGKPVLETRTMDFPTPAAAFRSPLARQLFRIEGVKSVFFGPDSITVTKENEELDWNLLKPDIYATIMDFFASGLPLVTEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords NFU1 iron-sulfur cluster scaffold homolog, mitochondrial
publication title Solution NMR Structure of NFU1 Iron-Sulfur Cluster Scaffold Homolog from Homo sapiens, Northeast Structural Genomics Consortium (NESG) Target HR2876B
rcsb
source organism Homo sapiens
total genus 20
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2012-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08712 Nfu_N Scaffold protein Nfu/NifU N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Scaffold protein Nfu/NifU, N-terminal domain 2ltmA00
2FFMA 1PQXA 2LTLA 2M8WA 2LTMA 2M6QA 2K1HA
chains in the Genus database with same CATH superfamily
4JI7H 4LF6H 5FLXW 3I0PA 1ZTGA 2E3UA 2FMRA 3RF2A 4YY3H 2CTEA 1N36H 4JI3H 4JVHA 4H8AA 4OO1G 1X9ZA 4NXMH 2QNDA 3T1YH 5DT9A 1Z2IA 1ZZJA 2LF0A 3QD7X 4OCHA 1HR0H 4JV5H 2LTMA 3V69A 4JI5H 4OD6A 4BA2I 1PQXA 3UOEA 4DR1H 4DR7H 1HNXH 1S20A 1I6UA 1AN7A 4LF7H 2CTJA 3T1HH 4NZRM 4LFAH 2BL5A 2CTLA 4B3TH 1IBMH 4JYAH 2JEBI 3OSSD 2OPVA 1V9NA 3J80W 2VQFH 4EC5A 1XMQH 1KHMA 4DV2H 1IBLH 5LMNH 5LL6b 4JI6H 2JE6I 1J5EH 3GR5A 3L7ZC 2ANNA 1UG8A 1XRHA 2JVZA 2VKCA 5BR8H 1J5KA 4K0KH 1SEIA 1VIGA 4FJUA 4LF8H 4WANA 4E9JA 4WALA 5LMUH 4DV1H 1S03G 4LFCH 4B3SH 2FPHX 2LRRA 2JZXA 2UXCH 2UUCH 1ZZIA 4DV7H 2JA9A 1XNQH 3EZJA 2AXYA 2CTFA 5K36G 4DV4H 2X06A 2VQEH 2UXBH 1I94H 2UUAH 4QMFB 2MJHA 1N33H 1FKAH 3KDKA 1DTJA 3KDGA 3SB1A 2HH3A 4X64H 1X4NA 2NN6G 4JI8H 3AEVB 2Y3MA 4GKKH 1ODHA 2OPUA 4JI4H 1FJGH 3VKEA 3OETA 4DV0H 2PT7G 1TUAA 1WE8A 2ZQEA 1HNWH 1WHRA 1WVNA 2UXDH 2HH2A 1F0XA 2O4CA 4DR4H 2M8WA 4JI2H 4JI1H 4LF9H 4DV6H 3U1KA 4DR2H 1ZZKA 2Z0SA 4B8CD 1IBKH 4DR6H 2CTKA 2E5LH 4B8TA 4DV5H 1X4MA 1EC6A 2CPQA 4X66H 4DUYH 4AM3A 2ZM6H 3OTOH 4G08A 3NCVA 4JI0H 4LF4H 4YHHH 4LFBH 1N34H 2CWHA 2FFMA 1XNRH 2A1SA 2DGRA 2LTLA 1K1GA 2G8YA 3J7AK 1WTJA 5C0XG 2CTMA 2JEAI 2K1HA 4OX9H 1N32H 3GABA 3GKUA 4IFDG 2YQRA 4NBQA 5JEAG 4AQYH 4DR5H 1HNZH 2ANRA 4KHPH 4DR3H 5IT9W 4NZTM 1VIHA 1VBIA 3JAMW 2BA0A 2F4VH 2HHHH 4B3RH 5IWAH 4PDBA 2M6QA 2P2RA 4B3MH 2D9IA 4AIMA 3FAUA 4JVYA 4LF5H 1X0AA 1DT4A 5A2QW 1XMOH 2PY9A 4DUZH 4DV3H 1J4WA 4X62H 2PQUA 4FJSA 1NXUA 2CWFA 4GKJH 4LIJA 4X65H 2CPMA 4NXNH 4BA1I 2UU9H 1MSZA 2UUBH 1V8CA 3J81W
chains in the Genus database with same CATH topology
2FFMA 1PQXA 2LTLA 2M8WA 2LTMA 2M6QA 2K1HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FFM A;  1PQX A;  2LTL A;  2M8W A;  2LTM A;  2M6Q A;  2K1H A; 
#chains in the Genus database with same CATH topology
 4JI7 H;  4LF6 H;  5FLX W;  3I0P A;  1ZTG A;  2E3U A;  2FMR A;  3RF2 A;  4YY3 H;  2CTE A;  1N36 H;  4JI3 H;  4JVH A;  4H8A A;  4OO1 G;  1X9Z A;  4NXM H;  2QND A;  3T1Y H;  5DT9 A;  1Z2I A;  1ZZJ A;  2LF0 A;  3QD7 X;  4OCH A;  1HR0 H;  4JV5 H;  2LTM A;  3V69 A;  4JI5 H;  4OD6 A;  4BA2 I;  1PQX A;  3UOE A;  4DR1 H;  4DR7 H;  1HNX H;  1S20 A;  1I6U A;  1AN7 A;  4LF7 H;  2CTJ A;  3T1H H;  4NZR M;  4LFA H;  2BL5 A;  2CTL A;  4B3T H;  1IBM H;  4JYA H;  2JEB I;  3OSS D;  2OPV A;  1V9N A;  3J80 W;  2VQF H;  4EC5 A;  1XMQ H;  1KHM A;  4DV2 H;  1IBL H;  5LMN H;  5LL6 b;  4JI6 H;  2JE6 I;  1J5E H;  3GR5 A;  3L7Z C;  2ANN A;  1UG8 A;  1XRH A;  2JVZ A;  2VKC A;  5BR8 H;  1J5K A;  4K0K H;  1SEI A;  1VIG A;  4FJU A;  4LF8 H;  4WAN A;  4E9J A;  4WAL A;  5LMU H;  4DV1 H;  1S03 G;  4LFC H;  4B3S H;  2FPH X;  2LRR A;  2JZX A;  2UXC H;  2UUC H;  1ZZI A;  4DV7 H;  2JA9 A;  1XNQ H;  3EZJ A;  2AXY A;  2CTF A;  5K36 G;  4DV4 H;  2X06 A;  2VQE H;  2UXB H;  1I94 H;  2UUA H;  4QMF B;  2MJH A;  1N33 H;  1FKA H;  3KDK A;  1DTJ A;  3KDG A;  3SB1 A;  2HH3 A;  4X64 H;  1X4N A;  2NN6 G;  4JI8 H;  3AEV B;  2Y3M A;  4GKK H;  1ODH A;  2OPU A;  4JI4 H;  1FJG H;  3VKE A;  3OET A;  4DV0 H;  2PT7 G;  1TUA A;  1WE8 A;  2ZQE A;  1HNW H;  1WHR A;  1WVN A;  2UXD H;  2HH2 A;  1F0X A;  2O4C A;  4DR4 H;  2M8W A;  4JI2 H;  4JI1 H;  4LF9 H;  4DV6 H;  3U1K A;  4DR2 H;  1ZZK A;  2Z0S A;  4B8C D;  1IBK H;  4DR6 H;  2CTK A;  2E5L H;  4B8T A;  4DV5 H;  1X4M A;  1EC6 A;  2CPQ A;  4X66 H;  4DUY H;  4AM3 A;  2ZM6 H;  3OTO H;  4G08 A;  3NCV A;  4JI0 H;  4LF4 H;  4YHH H;  4LFB H;  1N34 H;  2CWH A;  2FFM A;  1XNR H;  2A1S A;  2DGR A;  2LTL A;  1K1G A;  2G8Y A;  3J7A K;  1WTJ A;  5C0X G;  2CTM A;  2JEA I;  2K1H A;  4OX9 H;  1N32 H;  3GAB A;  3GKU A;  4IFD G;  2YQR A;  4NBQ A;  5JEA G;  4AQY H;  4DR5 H;  1HNZ H;  2ANR A;  4KHP H;  4DR3 H;  5IT9 W;  4NZT M;  1VIH A;  1VBI A;  3JAM W;  2BA0 A;  2F4V H;  2HHH H;  4B3R H;  5IWA H;  4PDB A;  2M6Q A;  2P2R A;  4B3M H;  2D9I A;  4AIM A;  3FAU A;  4JVY A;  4LF5 H;  1X0A A;  1DT4 A;  5A2Q W;  1XMO H;  2PY9 A;  4DUZ H;  4DV3 H;  1J4W A;  4X62 H;  2PQU A;  4FJS A;  1NXU A;  2CWF A;  4GKJ H;  4LIJ A;  4X65 H;  2CPM A;  4NXN H;  4BA1 I;  2UU9 H;  1MSZ A;  2UUB H;  1V8C A;  3J81 W; 
#chains in the Genus database with same CATH homology
 2FFM A;  1PQX A;  2LTL A;  2M8W A;  2LTM A;  2M6Q A;  2K1H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...