2O4CA

Crystal structure of d-erythronate-4-phosphate dehydrogenase complexed with nad
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
380
structure length
380
Chain Sequence
MRILADENIPVVDAFFADQGSIRRLPGRAIDRAALAEVDVLLVRSVTEVSRAALAGSPVRFVGTCTIGTDHLDLDYFAEAGIAWSSAPGCNARGVVDYVLGCLLAMAEVRGADLAERTYGVVGAGQVGGRLVEVLRGLGWKVLVCDPPRQAREPDGEFVSLERLLAEADVISLHTPLNRDGEHPTRHLLDEPRLAALRPGTWLVNASRGAVVDNQALRRLLEGGADLEVALDVWEGEPQADPELAARCLIATPHIAGYSLEGKLRGTAQIYQAYCAWRGIAERVSLQDVLPETWLAGLQLNPGCDPAWALATLCRAVYDPRSDDAAFRRSLTGDSATRRAAFDALRKHYPPRREITGLRVATGGQAELQRVVRALGAQLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of d-Erythronate-4-phosphate Dehydrogenase Complexed with NAD
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Oxidoreductase
molecule keywords Erythronate-4-phosphate dehydrogenase
total genus 125
structure length 380
sequence length 380
chains with identical sequence B
ec nomenclature ec 1.1.1.290: 4-phosphoerythronate dehydrogenase.
pdb deposition date 2006-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00389 2-Hacid_dh D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain
A PF02826 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain
A PF11890 DUF3410 Domain of unknown function (DUF3410)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.170 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 2o4cA03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2o4cA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2o4cA01
2ZB4A 2DFDA 2C54A 4HFRA 1HE4A 1U2DA 2YHUA 3LDHA 4XA8A 1K2WA 4WCDA 3D4OA 5EINA 3L9XA 1EK5A 2X9GA 3ZW9A 4K28A 4DQVA 3ZWAA 1G6KA 4DGSA 4NI5A 1FDVA 2X8LA 4KTVE 1IPFA 3A06A 1GY8A 5B37A 4DPKA 5ICSA 1JVSA 1B26A 1WW8A 4GL4A 4ZRNA 1NHGA 4N5NA 1YL6A 4YJHA 3D4PA 4BMSA 1GYRA 4E32A 1KY5A 2P5UA 3MJVA 4DLBA 5C5IA 1Y9AA 2Y1CA 2X23A 2OL4A 1DAOA 4FFNA 2X5OA 4HFJA 4CJXA 3HG7A 2A35A 3QJ5A 2VRCA 2HU2A 4BGIA 4HKTA 2CDCA 1SC6A 4QQRA 3WGQA 2CVOA 4AICA 3TFQA 5JC1A 2G5CA 2H5LA 4G65A 3GGGA 1ADGA 2CSUA 1P31A 2CDAA 3IDSA 4NK4A 4YJGB 3ANLA 3VDQA 3FWZA 1XU7A 2G82A 1QSGA 4BO1A 3PDJA 3FPCA 4OIMA 4WOKA 2FN7A 2YHIB 3GDGA 3U0BA 4JN6B 3AY7A 2FOIA 1EQUA 2IZ1A 3H5RA 1ADBA 4ITUA 4CQLB 1NVGA 3K9QO 4NHEA 3TZQA 1MG5A 5T6BA 1DLJA 4GBJA 4WE3A 3FRJA 4RPGA 2GN6A 5LC1A 2WYUA 3LK7A 1NVTA 4XIJA 5A5FA 1KVQA 4OHUA 4EZBA 5JDCC 2BHLA 3ZNPA 4OKIA 4BUCA 4S1VA 5EQFA 2D5AA 4BO9A 2B69A 3DZJA 4XQCA 1EFLA 4CMCA 1VSVA 1YL7A 5GZ6A 2O2YA 5CDSA 3RSHA 1LDYA 1Q0HA 4EGFA 4XX0A 2IYOA 1C0IA 3WQQA 3W8FA 3K31A 5H83A 4WK6A 1PGJA 1LEHA 1P1KA 2NVBA 1S7CA 3EMKA 1NXQA 3I6QA 1O89A 3PVZA 2DFVA 5JLAA 2AQ8A 4R3WA 4UUOA 3GN2A 3ZHZA 4JLWA 4MDHA 4FR5A 4IDGA 5A4DA 2NU9A 1NPYA 4PVCA 4IJKA 4RPKA 4NDNE 4BNJA 3DTTA 3VH4A 4U6QA 2G76A 3CKYA 3ORFA 4LMRA 4YTEA 1GR0A 4K1LA 3PZBA 5LCXA 1MLDA 1ISIA 3PRJA 2VWGA 1Q7CA 3GVXA 4XR4A 3L6EA 4BO4A 2Q45A 1V35A 1SEVA 4D3FA 5JAIA 5HA5A 4GLOA 2F1KA 5DBGA 2AA3A 2I6TA 3WGYA 4BNIA 2P68A 2X4GA 4TQGA 3RI3A 5BSHA 3M2TA 2AQHA 2X0RA 1H6AA 4AG3A 4CUZA 2EKPA 4WKGA 3KYDB 4BQPA 2Z5LA 1U1IA 3OIDA 1LI4A 4Y98A 2O3UA 1E7SA 4YWJA 1YQDA 2VT2A 3JQFC 3KBOA 4OYRA 4B3HA 1I3NA 1JKIA 4CM8A 2FSSA 2WEKA 4DXHA 4BKQA 1J0XO 2IE0A 2QRKA 3TDKA 3VTFA 1LLUA 4YRAA 2D1YA 1UXKA 3H9JA 3U4CA 4CUJA 3MOIA 3OA2A 2Q4BA 4EJ0A 5THQA 4GMFA 4BNHA 5AOVA 3NT2A 3N74A 2PY6A 2E82A 1GTMA 3INRA 3BTUA 5FI3A 4EUHA 2C20A 2VOEA 3SXPA 4RJTA 3T7CA 4CV0A 1E3IA 1ZEJA 1UDAA 1WLYA 4ILKA 4CM9D 1P33A 3UCXA 5KJEA 3GUCA 2X5KO 3K5PA 4WECA 5KVQA 1QORA 1EDOA 4RLSA 3V1YA 1LDNA 2JD0A 4J7XA 1ORRA 4OXYA 5KWEA 3KOUA 1W4ZA 4RPLA 4YAJA 2H6EA 1UP7A 3RUIA 2NVWA 5KCZA 4R5HA 2EKQA 3GGOA 1ID1A 1UH5A 4QO7A 5KNLA 3JD4A 4WUVA 1DFIA 2NU6A 1I30A 1N1EA 2W98A 2YQ4A 1YB4A 3K92A 4UUNA 3HHPA 2Y0CA 2PNFA 3OQ6A 1PZEA 1E7WA 3D3WA 1WWKA 3KHUA 1V3TA 2X0JA 3GGPA 3LLVA 3QLJA 3H5NA 1YGYA 4Y6PA 1QRRA 4U5QA 4GVXA 4JP2A 3GG2A 3SVTA 3GEGA 1BVRA 1PQWA 1JAYA 4NMHA 1L1FA 2CY0A 1ADCA 1EQ2A 2I99A 2NNLD 1DHRA 1U7HA 1YL5A 1VM6A 3QWAA 1QLJA 5T8KC 5DN9A 4IXTA 2JL1A 3T4XA 2NTVA 2DU8A 3GVPA 4WLOA 2ZTUA 4H7PA 2OBNA 5DULA 3HDJA 4Z9XA 3O4RA 3NDJA 4A10A 2NTNA 4PG8A 4D0SA 1YB5A 2ET6A 3NAQA 1PS0A 3T7EA 3D3WB 4XYGA 1BW9A 1SPXA 3V1UA 1JA9A 3Q0EA 5JCJD 2BLLA 4JROA 3N7UA 2Y1OA 4RV9A 3TJRA 3TQHA 3DBRB 5KJ6A 4YJDA 3OBBA 4J43A 1UDBA 5JDIC 1DC4A 4UVEA 4WEOA 4J1SA 4D7AA 2ZB3A 1LQTA 1PWXA 4D3DA 2NADA 4MKXA 1HDRA 1ONNA 1SOWA 1R66A 3DO5A 5IN4A 4KWIA 1KC1A 4KP7A 1NQTA 2PZKA 3MCVA 3TPCA 4OQYA 3JQCA 1LSOA 3ICPA 1XYGA 2LDBA 3U3XA 1KVTA 3Q1LA 1HYEA 3O9ZA 2NV6A 1HE3A 4NG5A 1YO6A 1TT5B 1YQGA 5AVOA 5CAEA 2GN9A 2Q1SA 1YXMA 1PZFA 4TVOA 2D59A 3CSDA 1H6CA 1CDOA 1RM5A 3VZQA 3NRCA 4IJVA 1HSOA 1I10A 3JQDA 2FHSA 3F5SA 3JYOA 3TOXA 2C59A 4YQYA 1Q7BA 1PQUA 1ZO8A 2ZK7A 2O3QA 5ILOA 4FB5A 3OICA 1ZJZA 1E6WA 1LC3A 3GAFA 4MKZA 4TROA 2D3TA 1ENPA 2AEJA 2PKQP 2CUKA 2DM6A 4DREA 3RAJA 4NIMA 1ARZA 4YYZA 2PLAA 1IZ9A 1BHSA 3MJTA 3RU7A 1LDBA 3FTNA 3E9QA 4RZHA 1UZMA 3JQ7B 4A73A 2J5QA 1GU7A 4R1SA 5EERA 4L76A 3H5AA 4YAIA 3PQDA 3R0IA 4BV9A 2OXIA 3H9GA 1UP6A 3TSCA 1NYTA 1DIHA 1ZFNA 3F1LA 1FK8A 1GQQA 3JQ7A 4Y67A 1E3LA 1EDZA 3LC2O 4CM6A 3NTOA 3RKRA 1AUPA 4ND3A 4R16A 1HDZA 3WBBA 3F47A 2UVDA 3PLNA 5BR7A 5HTOA 1FXSA 3UOGA 3UGKA 3PWSA 3IJRA 2IEDA 4F3YA 5I9LA 3VZPA 3HE3A 4YT5A 3VPXA 2O50A 3K2EA 4W9NC 2XXJA 3JQGB 4WNIA 4Z9YA 3I9OA 1H9AA 4OMUA 1Y7TA 3PJEA 3A1NA 3VDRA 2RAFA 3FNFA 1TA4A 1WP4A 1WMBA 2CF6A 2EP5A 2IDZA 3CUKA 4YJGA 5ADHA 3DOOA 3GFBA 1BWSA 4FJ0A 4CLRA 4MVJM 4OGWA 4YACA 2JJYA 2JAPA 3DEYX 3T4EA 4E5YA 3ZHYA 2C2XA 5JFOA 2H1SA 3ROKA 4XR9A 4GGOA 1YVEI 1LDGA 5I7VA 1ZBQA 4DVJA 4K6FA 5FI5A 1NM5A 2BFOA 2JHGA 3HDQA 4EBFA 4GH5A 5L7TA 4FC6A 1SEPA 3CH6A 1EUCA 3DHEA 2YY7A 3OETA 3E5RA 4PLVA 1ZVMA 3WTBA 4KZPA 1NWHA 1T2DA 4W7IA 5KTKA 2VRBA 4MVJF 4ZQHA 5ER6A 3HFGA 3ZZNA 4GX5A 2EIHA 3LT0A 4NJMA 4DPMA 4D46A 2GRAA 1AN9A 4U0KA 3ZWOA 1UXIA 1U3VA 2EGHA 5GZ3A 5JYEA 3GZNA 1DIGA 4CMEC 5JDIA 2JCXA 2OZPA 4CR6A 5G0TA 4HNHA 3ZCXA 4R9RA 2GN8A 2J6IA 4YCAA 4XZ3A 4XD2A 1QYXA 3IP1A 3O38A 4D41A 2GLXA 1YKFA 4NPCA 4CLXA 2ZKLA 5FFFA 1J4AA 1Q0LA 3QIVA 3ZU5A 5L9AA 3BMQB 4IDFA 4QEDA 4XGNA 4KMSA 3RUHA 1V6AA 5TF4A 2NQTA 3E18A 4PG4A 4MVJE 1C0KA 4KQXA 1XLTA 1U3TA 4CLOB 4P4NA 1IHYA 3MZ0A 4E4YA 4E2ZA 3IOYA 3D3EA 4DC1A 3LU1A 1NP3A 1EVJA 4BS9A 5TT1A 3PZRA 4BNWA 3QHAA 4YA6A 2PTGA 2C7GA 5L95A 3U9LA 2EP7A 1EVIA 2HLPA 2X6TA 2QIOA 3AU9A 3SLKA 1YDWA 3WNVA 1SCUA 1PIWA 2VHZA 4IIUA 5FEUA 3C7CB 5JC8A 4GX1A 2BGLA 4BGEA 1HZZA 5FYDA 1VL8A 1PJCA 2JAHA 4BNZA 2O7SA 4TVBA 3GAZA 4LMPA 4B8WA 1T25A 6ADHA 1E7RA 2HK7A 5F3RA 3LYLA 1J6UA 4WLNA 1Y81A 2NLOA 2P9EA 3NT4A 4BB6A 3FBGA 1NR7A 1LSUA 5BT9A 3OJ0A 1YOVB 2D0IA 3PDUA 4U6SA 4AJ1A 1FDTA 2NSDA 3NTRA 2O4UX 3B6ZA 1T2EA 1H94A 1Y8QB 5BSGA 5KIAA 3IP3A 2Q99A 2VWPA 3ONDA 4EEXA 1Z73A 3PGJA 3FN4A 1M66A 3RJ5A 1YBAA 1R4MB 2I76A 4RVUA 1E1NA 3AOEA 1ML3A 1VJ1A 5GY7A 1P77A 3PHJA 3TZHA 4ND5A 4MP8A 5ITWA 4EUEA 4RVSA 4EJMA 3UCFA 1X7HA 2X7HA 2ZJ1A 3CEAA 3QRWA 4FN4A 2FSVA 1PGOA 3LT4A 4GKBA 5G0SA 2PFGA 1T24A 3ANMA 2A92A 4ID9A 5JW6A 5CG1A 1XSEA 3DWFA 5TLSA 1NX6A 2Y0EA 1B7GO 1G0NA 2OO5A 1IL0A 5IDYA 4E5NA 4PLHA 3HB5X 3U4IA 3PGXA 2HK8A 1PJTA 1DOHA 2I5PO 4YB8A 4GI2A 4WNCA 3CPSA 4B8ZA 5IZ4A 5KOIA 4RQTA 4UEOA 5IXYA 1WZIA 1GUFA 1A5ZA 3GNSA 1BXKA 2C7VA 1TEHA 3FWNA 4NBRA 1I32A 1E6EA 3RCBA 4QFDA 4ALMA 3WR5A 1T4DA 1VRWA 4WEQA 3IUPA 1O94A 1Y8RA 2DC1A 5F21A 2UAGA 3WGHA 4A27A 1A7KA 1PEDA 2NQ8A 2I66A 3GZ4A 4BKOA 1I01A 1RYDA 3U5TA 3ASUA 1ZK1A 3PLRA 2VHXA 1HT0A 4RVDA 1BW9B 2V6FA 1U28A 4XB2A 3V8BA 2VOJA 1NWCA 3GMDA 2QG4A 1GUZA 1NFQA 1SMKA 4IQGA 3PXXA 3SBOA 3UUWA 1VC2A 3VH1A 4ZJUA 2H63A 4RVGA 1XCBA 1VE9A 5AYVA 4OL9A 5IDQA 1RPNA 5U1PA 3JQAB 3NJ4A 2EJWA 3DBHA 1NPDA 5K6AC 5U9CA 1MFZA 4E2XA 3V2GA 3Q2IA 3UW3A 4CMIA 1Y1PA 2EV9A 2GYYA 4GQAA 4J1TA 4J9UE 1A7AA 5B12A 1CJCA 4I5GA 4IMRA 1I3MA 5ICMA 2D8AA 1F12A 1H0KA 1W6UA 2FZWA 3KEQA 2NU8A 2VZ9A 3ONFA 1VI2A 2VYVD 1UXGA 2P91A 2W4QA 4YT8A 1CETA 2XOXA 4JXKA 1I36A 2I65A 3MJCA 2J3IA 4Q3NA 3PIIA 4ZVVA 1DBVO 3ROPA 4AJHA 5AQ1A 2WMDA 5BSEA 3TZKA 4MIYA 4E31A 4R4JA 3TZ6A 5L45A 2YV2A 4BGVA 3OQ1A 1SO8A 4Q3CA 4IZHA 1MFPA 3HNPA 3H4VA 1Q1NA 2XPCA 3WICA 3WGGA 3E9MA 1M76A 1JQBA 4CM3A 2AW5A 3U09A 1T2FA 3WLEA 1EBUA 3PJFA 4M86A 2OFPA 5CPBA 3UFXA 4EEZA 1F8GA 4PVDA 4XGIA 4CLRB 1DIBA 2NVUA 1PZHA 1Q7GA 2EJVA 1PJLA 3GK3A 3F46A 5A9SB 3BTOA 1J5PA 2VHYA 1PJ2A 1EK6A 4QXMA 2EGGA 4R01A 4D42A 2Y99A 1E1LA 3PHHA 4BHTA 5I7EA 1AXGA 4PRKA 4RZIA 1P74A 4LVUA 1JVBA 1A4UA 4AJ4A 5CDTA 1XDWA 4PLFA 2WYVA 3ZWMA 4BKUA 4WASA 5T8KA 1H2BA 3P7MA 1IZ0A 1I3KA 3AJRA 4PLCA 4B4UA 2VHWA 3ROQA 1DO8A 1E7YA 1HEUA 2BFPA 4U7WA 3WYEA 1JWBB 2XAAA 1NAHA 5TC4A 1KYQA 4YAEA 3RUDA 4Z3KA 3FNGA 1Z7EA 3AFNA 1NHWA 2J3KA 1OC2A 1TVEA 3FTPA 1E3JA 2QRJA 5TIIA 1ISGA 3RROA 3KV3O 3A28A 5A3VA 2J8ZA 1N9GA 2GF2A 1T4BA 1X15A 5TGDA 1DPGA 2V6BA 1B8UA 2BELA 2SCUA 4CODB 1X7GA 2OUIA 3DAFA 5L51A 4JQCA 5KJCA 2NTJA 5EESA 3LC1O 3V5NA 5I7FA 2ZCVA 4LISA 3BAZA 3BMNA 1YONA 3JQAD 4IIVA 1FJHA 3AUUA 2ZIZA 4A03A 1DDOA 2W2KA 3TWOA 4IJWA 5HBRA 3AI2A 3HJAA 3FPLA 4DIBA 5C3MA 4EITA 1HLDA 1NQOA 1QV6A 3EHEA 1MUUA 1UAGA 2WM3A 4WLUA 2FR8A 1LTHR 1PWZA 2JCYA 4X54A 4O5OA 3BYZA 2HMUA 1GV1A 5I9NA 3BZUA 2IZZA 2QQ5A 1TT5A 3WFJA 2UYYA 4U8GA 5JY6A 1D1SA 1OI7A 2H9IA 3LT2A 4BQRA 1ISMA 4FW8A 4LVCA 3KYDA 2O7QA 1WXDA 1XU9A 2P4HX 3P5SA 3GF4A 4G5HA 2DTXA 4EJ6A 3OP4A 2AQKA 2DBZA 3ZU3A 3H9QA 1H6BA 4UUMA 1BSVA 2GR9A 4EI2A 5AXDA 4I08A 3PPIA 5HM8A 1UZLA 5DNAA 1YOVA 1RYEA 5MGBA 1GYPA 3IC5A 3OJEA 5U4QA 4Q3EA 2FZEA 4KUEA 2VCYA 2PWZA 3QA9A 3EVNA 2D4AA 4D79A 5A04A 1E5LA 4AJ2A 3UXYA 4AJIA 4CMEA 2GD1O 3PWKA 3RC1A 4CM5A 3I1JA 1DRVA 2Q1WA 4AJPA 2Q50A 1XIVA 4BV8A 1XGKA 3H9EO 2UUPA 3TL3A 2F00A 5CDYA 4XCVA 3RFTA 1R4NB 1E7QA 1F14A 2C2YA 2DTDA 5L7WA 4OSOA 3LF1A 4QSMA 1LDMA 5F1OA 2OOSA 2X0IA 2HJRA 5CDUA 3DFZA 4LRTB 1MV8A 1DC3A 2OBYA 1V0JA 3B70A 4F45A 1AHIA 2HCTA 2PZMA 3W4KA 1E3EA 2GZ2A 4MVJH 1KEVA 3JQEA 4KDFA 2W8ZA 1LRJA 4OH1A 2IEBA 2YV1A 3SEFA 3JQFA 2QZ9A 4NBVA 2B83A 4QUKA 2W2LD 2DKNA 3GC6A 3FBTA 3HFSA 4YPOA 1XQ6A 2VTEA 4L9RA 1A9ZA 1EEHA 4ND4A 3EZLA 4P22A 1HYGA 1XQ1A 3A4VA 5HWSA 3OECA 3AM3A 3PYLA 1PGQA 3SLGA 1W0CA 3VKUA 1IYZA 2ZYGA 3I9JA 2E4AA 4PZEA 1AGNA 4E6PA 3GHHA 5AXBA 5A9SA 2EERA 4YEDA 1ZMTA 3B1FA 4GSKA 3DAPA 3UVEA 3R3JA 1IOLA 5JNLA 1KVRA 3VZSA 4OOEA 4BO6A 1LX6A 4YAGA 1GAEO 3WGOA 3UHAA 3WGIA 1MXFA 4BVAA 3I9LA 4FFMA 1L7DA 4DIOA 2UV8A 4MIEA 1FF9A 1PJQA 4FJ1A 3WNQA 4K26A 5A1TA 5DCWA 3RBXA 4CM1A 1KERA 3DONA 3M2PA 4TSKA 1ZH8A 5F1KA 3ZI0A 1ZK0A 5KJ1A 3HZZA 2P4QA 4ZQGA 1RM0A 3IKVA 2HQ1A 3AFMA 5B4TA 2DUWA 3DC2A 3PK0A 4EW6A 4MVJI 2FY8A 3GZNB 1LSJA 4PFJA 2UDPA 1LXCA 4D44A 4OSPA 5CG2A 3RC9A 5AXCA 3JV7A 3I4FA 4H3VA 3QE3A 4FDAA 2BMAA 3NJ8A 3PQFA 4L4XA 4PG6A 2NACA 3ZWVA 2RHRA 4E3ZA 4CLDA 4XQEA 1K6IA 1EMDA 1Z45A 4BKPA 3PEFA 4MKRA 2B36A 3WLFA 2VN8A 4URFA 3WG9A 4DUPA 1IPEA 3PFWO 5CDGA 1XKQA 1ZSNA 3GDFA 3INGA 4EUFA 3WWZA 4RVFA 3EY4A 4KUHA 1KETA 2YQ5A 2P5YA 3AWDA 4LSWA 2NM0A 4PLGA 1LA2A 5EN4A 5T5QA 4CQMB 1DSSG 3DXFA 4IXWA 3HDHA 4YJFA 3I9KA 4Y6RA 1EZ4A 3ZW8A 4ZU3A 3V2HA 3GH3A 1F06A 4E33A 3IJPA 3HADA 2Y1EA 4B7XA 1V3UA 2GGSA 2R2GA 1PL8A 1P3DA 5DBIA 3ZH2A 4R51A 1ZKMA 2HMTA 3PJGA 3GQVA 1DFHA 2BFMA 4HP8A 1ULSA 4QO8A 3EK2A 4Q9NA 4NFYA 3JQBC 1X7DA 4XQGA 1GCOA 4GAEA 1L7EA 7ADHA 3WIDA 4WCFC 4P4LA 1ZSYA 2W90A 3WXBA 5K0ZA 1P1HA 4IM7A 4TRRA 4CM4A 3UH1A 5JCXA 5JXWA 2FPGA 4Z6KA 3LVFO 4RF3A 5DOZA 3G49A 4FFLA 1U4SA 4OQZA 4R1UA 5A02A 1HTBA 2HO5A 4TZTA 1RKXA 4B7UA 5EIOA 2DQ4A 3COSA 2Y1FA 3I6IA 2Q2VA 4MP6A 4OM8A 3AY3A 5JCJA 3QVOA 4MO2A 4W99A 4TKLA 1R4MA 3GT0A 3RUFA 1P9LA 4PLPA 3WGZA 3WIEA 4UREA 5TJ9A 3X2EA 1GZ6A 4CQLA 3GEDA 1HDOA 4WCFB 1R0KA 3W1VA 3ZNQA 2ZQZA 2HKIA 4JP3A 3JYNA 4D43A 3ONEA 5KKAA 3NYWA 3O8QA 3JQ8A 4B4WA 4HWKA 3JQ9A 4J2HA 2O3SA 1GZ4A 2HDHA 4RORA 1BMDA 2ZQYA 3DR3A 3C1AA 4BO5A 5A5EA 4IDDA 1P1RA 3ZWPA 3M1LA 4FC7A 2EW2A 4KUGA 1TI7A 3W8EA 1PR9A 1YE3A 3STHA 1H93A 3K6JA 1ENOA 4J4HA 3IIEA 1ULUA 2BI8A 2BRUA 4NJOA 1N1GA 4A2CA 2AXQA 4E0BA 2AEMA 2QX7A 2VTDA 3OQBA 3WX0A 2B5WA 1M67A 4WLEA 1VJ0A 1KOLA 3RFVA 1I2ZA 4ZQFA 3Q9UA 2YW9A 4XEHA 4DPLA 1NFFA 4J16A 1ZSVA 3H7AA 2VYND 1X14A 3GUYA 4KDEA 4B4VA 4B7CA 4Z0TA 3DHNA 1ZCJA 4L75A 3GVHA 1MP0A 3JD0A 5TSDA 2LDXA 3OIGA 4D0RA 4CV3A 5T64A 5CP8A 3DQPA 2YUTA 3B1JA 3VHRA 1U9JA 3MJSA 3W4IA 1LU9A 4LSMA 3KYBA 1HDYA 3ENKA 1WVGA 5COAA 5DOVA 3RJ9A 1V8BA 4GWGA 4QECA 2AE2A 1O9BA 2Y0DA 1PU2A 3ABIA 1ENZA 3E1KA 5L3ZA 1QMGA 2ZB7A 1PL6A 3I5MA 1P0CA 3NT5A 4LRSB 2O4CA 4ZHSA 5JAMA 4DBVO 4ROSA 5COQA 4J49A 4ND1A 1ISJA 1E77A 5G0VA 4BO0A 4E30A 2A94A 2GSDA 2EXXA 2PGDA 4XYMA 2D5CA 5JMWA 3X2FA 1TLTA 3EVTA 4HUJA 3RASA 1OFGA 1NTOA 1WAMA 1W8DA 2EKLA 4JX8A 5HS6A 4CLEA 4BMNA 1RJWA 5KJFA 1KVSA 3D4NA 2EWMA 2WD7B 3HUDA 4MPDA 1A27A 1B8VA 1O95A 2QYSA 3Q3CA 3S8MA 2I3GA 1P0FA 1ONOA 4J91A 1OBFO 5H82A 3KXDA 4L74A 3TOZA 4CMIB 5F5NA 1FDWA 3LT1A 4RF5A 4YVFA 2OHXA 2I3AA 2OORA 3DBHB 4FCCA 4GX2A 3G3EA 1OC4A 2YV3A 3K8ZA 4CPDA 1GV0A 3D64A 4CMHA 4BNVA 1AHHA 1SB9A 2AQIA 5GMOA 4A7PA 3ZV4A 4DLAA 4FS3A 4WOJA 5FWNA 4YRBA 1SNYA 3D7LA 1GD1O 3Q9NA 3QP9A 4DQUA 3O26A 3OJLA 1CQIA 2RIRA 4OJNA 4R5MA 2Q2WA 3HSKA 4TMFA 3E82A 3QQPA 4WJZA 1PZGA 3MEQA 3VH3A 1DXYA 4ALLA 2P9CA 3OJFA 3WBFA 1HETA 5DBFA 1HYHA 5T57A 4BO7A 1U3UA 4WLVA 2W2LA 3TF5A 3WMWA 2WTBA 3I9NA 5C7LO 4E12A 2G1UA 2Y66A 2IXAA 1JU9A 2O3JA 4UEJA 1GEEA 5A03A 1U5AA 1UUFA 1YJQA 4ALKA 1P1JA 3KSUA 2O48X 3GFGA 4NFSA 3DBVO 4YBZA 3VAZA 2PZJA 4CL3A 3A9WA 3C1TA 3QWBA 3RUAA 1A72A 2CD9A 3HDYA 3ZWBA 4UVHA 2ZJ0A 3RIHA 1E1KA 1DJNA 1LNQA 1M6WA 1QKIA 3E8XA 3KSDO 3BTVA 3O03A 1Y9EA 2P2SA 3GA0A 2XF8A 4NK5A 4R54A 4JBGA 2BI7A 4D3SA 3I9MA 1Y5MA 4YDRA 5I9MA 5T67A 4N7RA 5IDXA 1D7OA 3V1TC 3GMSA 2VHVA 3QSGA 1NAIA 5ENVA 2ZTLA 3ZNOA 4CM7A 2HMWA 3INTA 2B37A 3D5TA 1WDKA 3R1IA 1K3TA 4N5MA 3AY6A 2JCVA 2YHIA 4F6CA 2FPPA 3AOEC 3U4DA 1B3BA 4UVGA 4R41A 1N2SA 1K89A 3WSVA 3JD1A 1EE9A 3RU9A 2HMVA 3BMCB 1XR3A 1B3RA 1DIRA 4CV1A 4RVHA 4DMMA 4M87A 2DBRA 1K5HA 3I52A 4RPHA 5EQDA 3SC4A 5JO9A 4MINA 1ZMOA 5G4KB 2WE7A 5L4LA 4EYEA 3BMQA 5A06A 3LC7O 1M6HA 3QWFA 2VYNA 3WJ7A 3U49A 3DTYA 3G17A 1OOEA 4BNLA 2FWMX 4I1IA 3E48A 3GVCA 3VPSA 3EZYA 3VH2A 1NVMB 5EPOA 1E3WB 1VSUA 4HNGA 2Y93A 3KETA 2JKVA 3JSAA 2BH9A 1D4FA 2Q49A 2FMUA 4HV4A 4HY3A 4IZIA 3ZDFA 3KB6A 1VLLA 4ALJA 3FR7A 1FDSA 3SJ7A 1BXZA 4CR8A 1C1XB 4DIFA 2CVZA 2NWQA 3JQ6A 2R00C 3DOJA 3GR6A 4HXYA 1EUDA 4TZKA 1SBYA 4IQ8A 1GYQA 5BSFA 3WOHA 2PA3A 3DZGA 3OA0A 4NBWA 3V2UA 4C7KA 3F4BA 3PHIA 2Q1TA 1P1FA 1C1XA 3EUWA 1GUYA 3MJ4A 3DMTC 1C1DB 5JBIA 1U5CA 4H15A 1O6ZA 1V9LA 5JY1A 4TKMA 1CWUA 5BNTA 2OMEA 4JJFA 2BGKA 4YQZA 4I5EA 1PJ3A 4BNFA 4GVLA 3PHLA 1I24A 1K0UA 5ENDA 3ROMA 3ADOA 4ND2A 1A71A 1BXGB 3OIFA 3JQGA 3GLQA 1PQPA 3IL2A 1RWBA 5EMHA 1O8CA 4BNNA 3HN7A 8ADHA 1MC5A 3R3SA 4XRRA 4RF2A 1DRUA 4DRYA 2G17A 4B4OA 1JN0A 2DVMA 3OM9A 2EHDA 2B4RO 3C1OA 4ONEA 4EDFA 2AEFA 4IJUA 1JWAB 3R6DA 3WQRA 4JK3A 3CZRA 5CPFA 3KLMX 4YRDA 3WJAA 4OKNA 2DPGA 4CV2A 1OAAA 2OP1A 2GNAA 3H3JA 2C0CA 2ZYDA 5CEJA 4PN3A 2YJZA 1O0SA 4MIOA 3C8MA 2RH4A 1BDMA 3ETEA 2OGUA 2WYWA 1BVUA 4NBTA 4U0JA 4YT2A 1LDEA 4KTTE 1U8XX 5JE8A 1N7HA 2Q3EA 4XDZA 1R15A 2BGMA 3PTZA 1KEUA 4B3IA 3NDRA 1DC5A 2DBVO 3RBVA 1HLPA 1FDUA 9LDTA 4N18A 4NR0A 3H2ZA 1HWYA 3VZRA 3KVOA 1TB4A 4FPXA 3ZN2A 2DAPA 4AJLA 3AW9A 1ONPA 1R6DA 1WMAA 4FD3A 3H2SA 5TNXA 4E2YA 3DAGA 4I9UA 1H9BA 3ON5A 1CF2O 3DHYA 4XYLA 1RM3A 1EBFA 4NNJA 2X9NA 1E6UA 1IULA 3ZWWA 3A14A 3TRIA 3FF4A 3SX2A 5CEFA 1EFKA 3AI1A 1TT7A 1EE2A 1OZAA 1KBZA 2CMDA 3E6AA 4KWHA 3UICA 1ZIDA 3RKUA 4J6FA 3I23A 1BDBA 4BNMA 4W4TA 3C7DB 5H81A 4CLHA 4HADA 2PGLA 1W73A 1T1SA 3OSUA 3QW2A 1PJBA 3RC7A 3K73O 3AK4A 2G0TA 4M49A 3RUEA 5FF9A 3NX4A 2QYTA 1DFGA 2FPIA 1Y5RA 2ILTA 4GSLA 4OXKA 2O3RA 2B0JA 3ADPA 3OMLA 2RBEA 3QVXA 5L53A 1QYVA 3KZVA 4CM9A 1KEWA 5IN5A 1Q2XA 1Z74A 3GN1A 2GERA 2JFGA 2XXBA 4INAA 5J23A 1E0DA 4A5OA 4E2WA 5IFLA 4NFHA 2JFHA 4PZDA 2WDZA 5C7OO 3NUGA 4CMKA 2TMDA 4PIVA 2O23A 4L73A 2AMFA 5TQVA 2I9PA 2E48A 3GHYA 1SOVA 2PR2A 3NDIA 2Z95A 3OHSX 4J3FA 2X58A 2JFFA 4CLOA 2YFHA 3EC7A 4CQMA 1YB1A 3Q6IA 1HXHA 5I8ZA 3LLSA 1C3VA 2QRLA 2DT5A 4J2OA 4FOSA 4FSHA 3DMTA 2WE8A 4O59O 1GPJA 1Y8QA 3ZGYA 1T26A 2QHXA 4BNUA 3VTZA 4ZRMA 5LDHA 2WWRA 2NUAA 3S2FA 1A9YA 3DZFA 3DMYA 1PS9A 2GO1A 1KS9A 4L8VA 5HS4A 5COBA 3L07A 3W8DA 3ITKA 4DL9A 2VYVA 3NEPX 2J3HA 1BXGA 2X9VA 4OXNA 1DAPA 4Q3DA 2GCGA 5JS6A 3BHMA 3WWYA 4FBGA 2A9FA 2C5EA 4DYVA 4YXFA 5JO0A 4UAGA 2WSBA 4Q39A 1GZ3A 1V3VA 4J1QA 2CZCA 3B1KA 1GPDG 4J1NA 5ER9A 1QLHA 4NBUA 2CFCA 3OFSA 3S2IA 4B3JA 1MA0A 3ZWYA 4YJHB 4IGFA 4BNGA 2RHCA 4NU6A 1J49A 3AM4A 4DBZA 5BQFA 3GY0A 3PYMA 3DBLA 3KYCA 5IF3A 5IJZA 5AXAA 3W6UA 1I33A 5L7YA 2PK3A 1YDEA 1UZNA 4BNTA 2NU7A 4HFNA 4E5PA 1NQ5A 1S6YA 1DIAA 1PX0A 1Z82A 3G79A 1E3SA 4ZA2A 3RD5A 1ZW1A 4IDBA 5BNFA 5ITVA 5IAAA 3VPFA 3KLPX 4WPGA 5G0WA 5B4UA 3JQ8B 3ICCA 5KVSA 2VT3A 4L4RA 3MJEA 4RL6A 2AG8A 2RH8A 4CL8A 4BMVA 1AE1A 2PV7A 4IINA 4AJJA 4YR9A 1B2LA 3BMOA 1LJ8A 4IDEA 5G4KA 3FNEA 1HDGO 1U4OA 3QVWA 2YZ7A 1UR5A 1UP4A 1JKFA 3P19A 4J4TA 4GLLA 1GQ2A 2C82A 3BMCA 4FFRA 3PYXA 3WFIA 3D5QA 1VKNA 4J7CA 1Z6ZA 3HWRA 1VJTA 3PHGA 3QV1A 2Q4EA 3CE6A 4PRLA 3PIDA 1IY8A 4Y9DA 4RPJA 1VKOA 3RBZA 1LC0A 3MTJA 3PWZA 4JBIA 3WSWA 3M6IA 1DLIA 5TT0A 1VPDA 3H6KA 3ZHXA 3GOHA 2Q46A 1SAYA 3IAHA 1JTVA 1YRLA 4J90A 4R3NA 4ZD6A 4IUYA 5CEEA 1UXJA 4UULA 2VWHA 1D3AA 4E21A 1Z75A 5IDWA 1K6JA 3S2GA 2GPTA 2PKQO 2PD4A 3QWHA 4UEKA 4BOYA 4JGBA 1X1EA 1ZK4A 1R37A 4PLZA 4KQWA 4CM4B 4HFMA 3CMCO 1LSSA 3GRKA 3VVCA 5TX7A 4ESOA 3H9UA 1KY4A 2DTEA 5IG2A 4IDAA 1GQYA 4MVJG 4Z0HO 5JYDA 5THKA 3ST7A 4J0FA 4IBOA 2WD7A 5A9TA 4ZICA 3LQFA 1XA0A 5L40A 4RDHA 4AFNA 3RFXA 2ZYAA 3IUSA 5I7SA 1IE3A 1LLDA 4R1NA 4BO3A 2IRWA 2PD6A 3CZMA 3ZHBA 5G2OA 1T1RA 4BB5A 1U7TA 1CERA 1I8TA 3CINA 2PD3A 1HSZA 1PTJA 3QVSA 3LF2A 4RF4A 4FFOA 4AVYA 4CQMD 5C7IO 1X0XA 3JYQA 4BNYA 1MXHA 2E37A 2Y1DA 4JJIA 1I2CA 3NV9A 3EW7A 4JIGA 4LCEA 4M8SA 1SZJG 5JPIA 3CTMA 1R16A 4BL5A 2IODA 5CFZA 4RCVA 3IKTA 3K2BA 3AI3A 4G2NA 1NQAO 4DMLA 1CYDA 3L0DA 4BO2A 1E1MA 2FP4A 4XJSA 4L0QA 3M1AA 3U62A 3H8VA 4QFCA 4K6CA 5DF1A 2Q1UA 4OOFA 1CQJA 1U2GA 3TNLA 1ADFA 1B8PA 2B4TO 1DC6A 3FHLA 3KYCB 4Y8VA 5IZCC 8LDHA 1DJQA 5GZ1A 4E13A 4N5LA 4P4GA 4Z3DA 3H65A 5JAQA 4FQ8A 3DBLB 1I2BA 3PFFA 2GDZA 1QR6A 4GPD1 1N5DA 4XIYA 2Z1MA 1PJSA 2D2IA 2VUSA 1N7GA 4UUPA 1B14A 3KRTA 4R68A 2YYYA 3DL2A 4OO3A 3TZCA 2VNAA 2CNBA 3GEMA 4XYEA 1VL0A 3RUCA 2EEZA 3JTMA 1HE2A 2ZATA 4ZQEA 1CRWG 4TRNA 3NKLA 2WD8A 5KKCA 3JQ9C 1ZEMA 4GGPA 5DCUA 2ZB8A 3FD8A 4GX0A 3U4HA 3ZU4A 2HMSA 4M55A 2PKRA 4P8RA 2QZZA 1YWGO 2DPHA 3N58A 1VL6A 2FRDA 4BNKA 4IDCA 4DTIA 1PJ4A 1NFRA 4TRMA 1GL3A 3I3OA 1ISHA 4WLFA 2QW8A 5K9ZA 9LDBA 1WDLA 1MGOA 4NJMB 3B20A 3W4JA 1C0LA 4RLHA 4IQ0A 1ZK2A 1LUAA 4N54A 2BFAA 5DDIP 2VZ8A 1HDCA 2EW8A 3QVTA 1O5IA 2YDYA 4OAQA 1X1TA 4Y6SA 3DZIA 3KTDA 3FR8A 3CMMA 2C07A 1HZJA 1HDXA 3MOGA 5JDCA 2ZTMA 1UAYA 4XDYA 3L77A 5B4VA 4IMPA 3WGTA 5L4SA 1F0YA 1JDJA 3L4BC 2HRBA 3UAGA 3ASVA 3WYBA 4GMGA 3ZV6A 4C7JA 1GEGA 1X13A 1QP8A 3Q11A 4I5FA 1NASA 4DYDA 3OEYA 4FJ2A 5F1PA 2DLDA 1KIFA 3JYPA 4PGFA 5G4LA 2JD1A 2YDXA 2X86A 1P45A 1N92A 4LK3A 4DWVA 3ZU2A 3F5QA 3WB9A 3C24A 3GVIA 1QYDA 3SJUA 1I5RA 4Z0PA 2GUGA 4BO8A 1OMOA 1XWFA 2I67A 1YBVA 4JJGA 1HKUA 6LDHA 5DCYA 1HRDA 1QYWA 1XHLA 1Z7BA 1IHXA 1NNUA 1PL7A 4G81A 1Y6JA 3E03A 3EAGA 4J0EA 4XQ9A 1WNTA 3VPHA 1WPQA 1YH3A 2PH5A 2X5JO 5JAZA 1C0PA 2B5VA 4JNKA 4H16A 4PLWA 1B15A 3GNTA 5KVVA 4NU5A 1D1TA 5IXSA 5MDHA 1ZJYA 3PQEA 5DT9A 1QG6A 2IXBA 1TXGA 4MVJD 4TWRA 1XELA 3VPGA 3C3XA 3GRPA 2V6MA 4LW8A 3HB4X 3F1KA 3MWEB 3ZV3A 1D8AA 3NGLA 4TRJA 4F6LA 1JLLA 1ZUD1 1DB3A 3HN2A 5K6AA 1I0ZA 3WYCA 1HL3A 3AM5A 1MX3A 1N9GB 2IZ0A 4I9NA 5LDGA 2X1HA 4O63O 3GPDG 3ZWCA 3EDMA 1R0LA 3L4BA 2YFQA 3I4CA 3RWBA 3ETDA 1GFSA 2NVUB 5A3JA 1PSDA 3FCOA 4Z9FA 3CIFA 4IS3A 5B1YA 2TMGA 4FOOA 3TFOA 1BGVA 1XG5A 3KEOA 4MJLA 4J9VA 3GPIA 3ANNA 2R6JA 4RGBA 1C14A 1QV7A 4J7UA 2BF7A 1BTOA 2AE1A 3TL2A 5G0UA 3BMNB 3PP8A 2HK9A 2BKAA 2W2KB 4MOWA 1UXHA 2C5AA 1E5QA 2P9GA 2JD2A 3P2OA 2HSDA 3OF2A 1LRKA 1IUKA 1ZXLA 3BMOB 3L6OO 3DBRA 1JKJA 3JQBA 2VZ0A 1N8KA 2FR1A 2J5KA 3BIOA 2RCYA 3WTCA 3JCZA 4D45A 2VNSA 1KVUA 2BD0A 2V6GA 1U8FO 3HQ4O 4IS2A 5DP2A 2Y05A 5HRUA 1DEHA 3QWIA 1U3WA 3AUSA 1F17A 1LRLA 3D0OA 4UVDA 4E5KA 3OH8A 1H5QA 5DP1A 3VOSA 4YJFB 1DHTA 4Q3BA 2POQX 2ZTVA 5EL0A 4DA9A 1LBEA 3C7AA 3UF0A 5JSFA 1BG6A 1YBMA 3TN7A 5CHEA 3ITDA 3UKOA 4FIZA 4W82A 4AL4A 2IYPA 1E3WA 2B4QA 4GKVA 4O0LA 3ZWXA 4PLYA 1PGPA 2E49A 3VKVA 3UCEA 3FNHA 1H2HA 4C4OA 2AHRA 4R1TA 3LSYA 2HRZA 1G0OA 4XKJA 1T2AA 5TS3A 3JD2A 2DUUA 4O1MA 1PGNA 2VRCD 4ZN6A 3KM0A 2X22A 3DZHA 3S55A 1I3LA 4FGSA 1NPTO 4QX6A 3F4LA 2GN4A 1IB6A 2O2SA 1B0AA 3E9NA 3ZNNA 4ZQBA 3GNQA 3L4SO 4I5DA 1MC4A 3QY9A 4HBGA 5C37A 2GZ1A 4E5MA 4WGGA 4PZCA 2J3JA 1B16A 4F46A 3ETGA 3IQDB 2OP0A 4R9SA 4XYBA 3BXXA 3K96A 5EJ2A 1P1IA 2CF5A 4CMBA 1LQUA 2E6UX 4YT4A 4L4SA 1LLQA 1KC3A 1SB8A 2JHFA 3NGXA 4JBHA 2Y68A 4CR7A 3DFUA 1M75A 3W6ZA 1EVZA 2EG9A 1CIVA 3MTGA 1JAXA 2PZLA 3F6YA 4J4BA 4O6VA 2GZ3A 4CM8B 3PI7A 4QT0A 1RM4A 4WCFA 4IGEA 4LN1A 4UVIA 4W7HA 2C29D 1BRMA 5TJHA 1Q0QA 2UUOA 4MP3A 5DZSA 3L6DA 2V65A 3DB2A 3G1UA 2CDBA 4NH4A 1GCUA 3OJOA 4P38A 1E7MA 4Q3AA 1P44A 3BHIA 1HF3A 2VUTA 2B35A 3KUXA 4RQUA 1LLCA 1R4NA 3WQSB 4W6ZA 2R00A 3SC6A 1KEPA 2J5RA 1T2CA 4GWKA 5JMPA 4BGUA 5BNIA 1GDHA 1WZEA 4B79A 4PCVA 2PH3A 5ES3A 4YAKA 2X0NA 4ALIA 2A4KA 1YJ8A 1X0VA 3K30A 4II3A 3DZKA 1ZXBA 4LCJA 1WDMA 4A26A 4AJEA 5A9RA 3VVBA 2Y1GA 3ULKA 1ISFA 1ZNQO 4AJNA 5I8WA 5ILGA 1CEQA 4S3MA 4LGVA 1MB4A 3GDOA 4CUKA 4M54A 1YQXA 1NR1A 3L9WA 5F5LA 1Y8RB 4NZ9A 5TRTA 3DZBA 4AJKA 4K9DA 4MVJA 3AOGA 1H6DA 3EYWA 3O8QB 1A4IA 2AG5A 3WDSA 1ENYA 3BHJA 3JQAA 3IS3A 4FFPA 4RO0A 4ZGWA 3AUTA 1FMCA 3BA1A 2FR0A 2Z1NA 4KOAA 2VUUA 4AJOA 4QTZA 3FI9A 3UN1A 4MVJP 4XB1A 3RVDA 3WMXA 3LZ6A 4A0SA 3G0OA 1E92A 2V7PA 3JYLA 4PG5A 3BTSA 5IZCA 3JD3A 1PS8A 3Q2KA 4CMGA 1ZZEA 3S1LA 1QXSA 1R0SA 2VQ3A 3EGOA 4PLTA 4BIIA 1ZK3A 2ZCUA 3I83A 4I8XA 2Q2QA 4XRGA 4II2A 4XJTA 5L4NA 1QYCA 1UDCA 4RDIA 5KVCA 1UJMA 3NTQA 3KO8A 4DC0A 1DRWA 1EVYA 4HX5A 4DLLA 4IY1A 3FSRA 2GASA 3DDNA 3E5MA 2O3TA 2PGJA 1F8FA 3P2YA 3D1LA 4FGWA 3OEWA 1HE5A 1AXEA 2VWQA 4BNXA 3VC7A 3AU8A 2DBQA 4XWYA 1K6XA 1XEAA 4XGKA 1PR3A 5A05A 3CXRA 4NQZA 7MDHA 2EF1A 3DOCA 1M2WA 4I9HA 3ZV5A 4BKRA 4DQXA 4ALNA 2HAEA 1G1AA 4R69A 2Y67A 1C1DA 3GG9A 3AUAA 3F3SA 3IMFA 1YS4A 3G1TA 3PJDA 4JCOA 3RC2A 1NBOA 2HJSA 3ENNA 2WJPA 3MWDB 3F9IA 3S2EA 3RQSA 3WS7A 1EUZA 1GADO 4IPTA 4CMAA 3C85A 4M1QA 4CMJA 4W9NA 2HUNA 3KSZO 1JW9B 2CVQA 4M89A 3ZWNA 1R12A 3H3FA 4PG7A 1MG0A
chains in the Genus database with same CATH superfamily
1SHUX 4D9FA 4F6RB 1F7VA 4P58A 1FNNA 1GLVA 1HE4A 2YHUA 3NYQA 1U2GC 2D2VA 2NZ2A 2VZLA 3N8IA 4WCDA 3Q8MA 3ZCTA 1JB1A 2VJPA 3HU2A 1UJ4A 1UJ5A 5CXUA 5TE9A 2LUOA 1NW9B 1P2SA 2NIPA 4DGSA 4JSYA 4NYIQ 1M2VA 1NNI1 2CZQA 1K2VN 4IIBA 2XGOA 1GY8A 5B37A 4BIMA 5E7MA 5C0OE 1B26A 2MT9A 4GL4A 4HRYA 4P0PB 3DXZA 4E15A 4F7WA 5DSTA 5GTDA 5IHXA 3D4PA 2RI1A 3C7KA 2QLFA 4XSVA 1GYRA 2C2ZA 4U2BA 3AH8A 1CE8A 3IESA 5M2QA 1H69A 3AR6A 3U61B 1E2MA 2VJOA 5C5IA 2B1RA 3BG5A 1LNZA 4MV3A 5DLPA 2JBWA 1JR3A 1K75A 1W49A 2LNDA 3HG7A 1P60A 4HFJA 2PPVA 4M9XA 2VRCA 1TMKA 2GCNA 3OKAA 3NBQA 4M9QA 4QSHA 2CTKA 1SC4A 3WGQA 3S2YA 3NDBB 3KKKA 4FBMA 3ZZ1A 4HAWA 5EZ6B 2XGGA 4B75A 3TFQA 2Q62A 2V55B 4ER6A 2H48A 3VBCA 4ES6A 2FYTA 1PHRA 1E0KA 5ARDA 5IKEA 5AM2A 3R3HA 5JCOC 3QA3E 2CDAA 3NC4A 1Y4ZA 3VDQA 3FW1A 1ZM7A 1W9MA 1V9SA 3SSMA 3IP5A 1II8A 1P75A 3BILA 7ABPA 1E1RD 1GIAA 3FPCA 4LZAA 3ZE1B 3TL6A 2O2EA 4I46A 1OI3A 1VRVA 3CRMA 2QXUA 2ZAMA 1QKKA 2NZ8A 2BAGA 3NBUA 2VBFA 3AEVB 2FOIA 1EQUA 5DXAA 3WE7A 3A9CA 2Y77A 3PDIA 4QKQA 3EIUA 4GPTA 1AH2A 5FBKA 3HACA 3TZQA 3CB2A 3OM8A 1MG5A 1AKUA 1KYYA 1D2MA 4WE3A 3TUZC 2ZYIA 2GN6A 3BX1A 1N6IA 3GMTA 2OC9A 4XIJA 3KQUA 4OHUA 4EZBA 5JDCC 2BHLA 3SF8B 2DLCX 4BUCA 1DT3A 2W2OA 2HD4A 5DPMA 1GQSA 3TIGA 2Q7OE 1NY5A 3L8FA 5HFJA 2IPLA 2B69A 4BO9A 3FVTA 3GRVA 3RSHA 4EGFA 1K8YB 3OU2A 1XXHA 3FJ1A 3EZFA 5K20A 1XQXA 1Z4LA 4XX0B 1QLWA 1LEHA 1P1KA 1S7CA 3T5DA 2Q3JA 3EMKA 4I4NA 5I51A 1O89A 1COWD 2EG5A 3I1YA 4GFDA 1VHLA 2J5XA 2YXPX 4UUOA 3GN2A 4XSHA 1PFVA 3ZHZA 4EABA 1JJFA 2QVYX 1WRBA 2ZYHA 3QKSA 2GETA 1BQ4A 3MTIA 3MUEA 2P7IA 4HPJB 4IJKA 3B85A 4PVCA 2DJ5A 1Z9BA 3RB8A 4QUBA 4Z54A 5DYGA 4U6QA 2G76A 3H1AA 3M5DA 3ORFA 1YIOA 5BURA 2ZRCA 1UJ6A 5LCXA 1MLDA 3SQLA 2W6IA 2VWGA 3QBDA 2O8FB 2FW9A 2WJWA 3JQQA 4XR4A 3L6EA 4IV0A 1GSAA 4LRUA 2F62A 1V35A 2EKDA 4Q7LA 1SEVA 1ZAKA 1L4EA 3QU2A 5DYIA 2Q3CA 2VPWA 3QY0A 5DBGA 4RMJA 5E4YA 3NWJA 5HTKA 2I1VB 1TZJA 3E4CA 1F2UB 3OPMA 4PYJA 2X4IA 2ST1A 1RXEA 2FK7A 5F9MA 4AG3A 4DMRA 3UW1A 2P2CA 1NVFA 3MD0A 3ACBA 4EUEA 4LJ9A 4WKGA 3KYDB 4WY8A 1R10A 4BFLA 2HA4A 3CXUA 1QQ7A 3LO5A 4ZAGA 5IASA 1U1IA 3WLRA 4DMHA 1LI4A 4QYWA 4D9MA 1E7SA 3UENA 4JXXA 3A6LA 1IVYA 1MJGA 1QIJA 1YQDA 2V5AA 2WFAA 4OYRA 4RCYA 3RTEA 4DIMA 1I3NA 3BMXA 4HVAA 4CM8A 5CLQA 3HXQA 4JLSA 1R8YA 4P92A 3E70C 4YRAA 2QRKA 1YZKA 1Q1BA 1D6JA 1LFDB 1NZFA 3ZCRA 4JJKA 2QQFA 2W0SA 3MOIA 3OA2A 1QP4A 1NYLA 2ZIXA 4PHFA 3IGFA 5AOVA 4WOBA 4IIEA 2PX0A 3DE0X 3FMIA 2QTAA 3KSMA 3N74A 5AKIA 3CX6A 4N47A 1GTMA 2G09A 4ND8A 3VTAA 4EUHA 2IBTA 2YIVX 1RI3A 5CNJA 1NXWA 1WQ3A 4AC9A 5LMNB 1Z06A 5F33A 5CK4A 4O33A 1ZEJA 2WHRA 1WLYA 3PQ4A 3ICVA 4IHAA 4LDZA 3QKRA 4XM1A 4YUAA 3DLBA 3IAM1 2YC4C 3SE0A 3WWPA 5KVQA 3K5PA 3KKEA 1QORA 1MRSA 5FUXA 4HEJA 5HKAA 3V1YA 1UAAA 5K3SA 3E9RA 1EP9A 4G0MA 2JD0A 4OXYA 1ORRA 3I53A 4RPLA 2PUBA 1RRKA 1OR8A 2WA2A 3D81A 1A95A 1EX6A 4R5HA 1JFLA 2HA3A 3GQBB 4LXGA 2R1UA 3GGOA 1SVMA 3N8KA 1XCMA 4FP9A 3JD4A 4JENA 3ACDA 1AHPA 1EJBA 2XCSB 1Q7EA 4O2BF 1O87A 2PZEA 5EIBC 3AP1A 3OQ6A 1H0SA 3NHLA 1PZEA 3HCNA 4QUAA 1E7WA 4QULA 4LFBB 1WWKA 4EMSA 3KHUA 2J6BA 3SHFA 1TM7E 3ABZA 3PUIA 4HZGA 5F77A 5J2UF 3G1WA 1EC6A 1L5SA 2ZJZA 1QRRA 2ZREA 1DX6A 4JP2A 4IOJA 1LPNA 1G38A 4TWIA 1JAYA 1VKHA 4X7RA 5DIZA 4ZGGA 1CP2A 1N6PA 1TYAE 3R3VA 4CFZA 3AGQA 1K7FB 4D02A 4I1OA 1LFAA 2VQSA 2VK8A 3CLHA 4DAOA 5KOHB 1L7OA 3RS3A 1VM6A 2DH5A 5L6LB 3ZGXA 1XRSB 2E2WA 2M6QA 5DN9A 1UOOA 4HR7A 2JL1A 2Q5IA 2NTVA 2DU8A 2RGDA 3DJFA 5KYYA 1G3UA 1NOJA 4WLOA 1E0SA 1E98A 3T5TA 2BMWA 3NAGA 3EVZA 4M8LA 3A8TA 2NTNA 1I7SB 2IYYA 5LD2C 3T7SA 1IUPA 4PQFA 4BFWA 2ET6A 3GV0A 4X8HA 2FG5A 1QZ3A 1RLOA 4FJSA 2YICA 3D3WB 3KDGA 2BMEA 4QOSA 3M5WA 5UKDA 5JCJD 2IITA 2BLLA 1IG3A 2FKNA 5KJ6A 4RTJA 2WM8A 3A37A 4YJDA 4CHGA 1GL7A 5F2EA 4S1PA 1IMJA 2VTBA 3NIDB 6REQA 5F9HA 1RAFA 2ZM6B 1DC4A 2O1SA 4FMPA 2PX2A 1YS7A 4D3DA 3CO0S 1CJSA 1TCVA 5FI0B 2NADA 3QYPA 1HDRA 2C42A 2PL3A 2Q9AA 4LWOA 1O96A 1R66A 4Y6QA 1W88B 2XTMA 2ZDQA 4C6TB 1W25A 1KC1A 4DCSA 2X0KA 3K32A 1ZYUA 3MCVA 1GKYA 5HDQA 3WADA 2PGIA 3ICPA 1HNWB 1KVTA 2C2GA 4BQPA 3G0GA 5AKGA 3OQVA 1IH8A 1YO6A 3CB4A 1YQGA 2Z2KA 3LP5A 5CAEA 2XKAA 3WO0A 2Q1SA 4K86A 2RGYA 2VAXA 2ORWA 2KQUA 3MWGA 3EWIA 1F3OA 1PZFA 4TVOA 1B41A 3K35A 1XP8A 2D59A 1G4HA 2HXSA 3QTBA 1RM5A 3VZQA 2A1UA 4IJVA 3TOXA 4K9RA 2HC9A 2AG1A 3MRSA 2BZ0A 5FKJA 3EXHB 1PDWA 4A0FA 4AF7A 2WD9A 3RIYA 1EXWA 2AK3A 1ZO8A 4GLJA 5ICCA 4G9BA 2QGNA 4F84A 1T9AA 4U9UA 4FONA 3AF1A 1E6WA 1EX7A 3GAFA 2WIBA 4MKZA 2IKSA 2JFQA 2AEJA 2CUKA 1Y1LA 2D3TA 2IPOA 2PKQP 1RP7A 1CNEA 2BVNA 3DLPX 2A59A 4IWYA 4RKQA 2PLAA 3DR5A 3RAJA 3TCNA 4CTKA 3RAFC 1QTRA 5B55A 3RU7A 1XXLA 1TX4B 3F2IA 4U00A 4ZPJA 1UZMA 3AYZB 3JQ7B 3GIWA 5EERA 1ZJ5A 3H5AA 4TLAA 2I2BA 1LB1B 3KTAB 1SCDA 4B8TA 1LPSA 2X13A 2OXIA 2ODEA 5KTMA 4XPIA 2NV0A 2WWFA 3REGA 1U0RA 2VUIB 3TTVA 1R2QA 3KTAA 3N0TA 2JEYA 1FTSA 1BU5A 4M0CA 1GQQA 1IY1A 1R0CA 3JQ7A 3FPBA 1IBSA 2H59A 3DNMA 3LC2O 3Q8XB 4FUQA 4R1MA 4Y67A 4ZVSA 3W7BA 1I6LA 3VRHA 4TN5A 4RPCA 4EI9A 2AYXA 4HDNB 3L41A 1EX9A 4GT1A 3WBBA 3R75A 2ACVA 4XPIB 4MRVA 3WWCA 2UVDA 3PLNA 5HTOA 1FPQA 1FXSA 4I50F 3UGKA 3UOGA 4DLPA 2V0GA 4F3YA 2IEDA 4AP6A 3VZPA 2WWGA 1N6LA 3O3MB 5AMXA 3VPXA 2O50A 2OGZA 2ZIWB 2UYQA 3A6DA 2Q0HA 2QBYA 3JQGB 5H1YA 2XDQB 4HDNA 3R3WA 3VNUA 2IHKA 1Y7TA 3D4BA 4KV9A 1CJKC 3HXPA 4O4IF 3GKUA 1P8AA 2G25A 2RAFA 3FNFA 3L7KA 2CF6A 5IT0A 1GZUA 3CUKA 1QGAA 2PGOA 5ADHA 4DV6H 1DRJA 4P53A 4QLBA 3P71T 3JR7A 1B23P 1NI4A 2A58A 1Z6GA 4UU7A 1NJ5A 1MX9A 1JR3E 1Z0IA 4IQ4A 1P6QA 3W5DA 2D54A 3EULA 4B3CA 4ZZ3A 3EZ7A 4CLRA 5CJ2A 2FQQA 1DUSA 3PQ3A 4FZJA 4KDRA 3T4EA 3ZHYA 2C2XA 2HA6A 2JJ1A 1TECE 4XR9A 5I9SA 5HM8A 1QX3A 1Y6FA 2BSAA 1ZBQA 1C3OA 1VKZA 4DVJA 3DF7A 3U1BA 5AK0A 3VO2A 2GEVA 5GINE 3UMCA 3IELA 4OJTA 3GLGA 1EDDA 3IXLA 3PR1A 3G23A 4B47A 2HNBA 4GH5A 4FC6A 1EUCA 4Q66C 3RQIA 3E5RA 3UAZA 1N3YA 5HG0A 3WTBA 3DEFA 5ERYA 1T2DA 4C06A 4W7IA 4IVPA 3KQTA 4EYKA 3B1XA 2AH5A 2IU6A 2GRUA 2YVUA 1FP6A 4G01B 1WV1A 4LPSA 3X44A 4XUEA 3ZZNA 1T5DX 2NYAA 4GC9A 2ZRBA 1C9DB 1KDOA 3KQYA 3L7OA 1AN9A 2V45A 4UU0A 3ROZA 4HDKB 4HX2A 1UXIA 1JA0A 4LXHA 4LGCA 1U3VA 4M37A 3PPYA 4C4YA 3UUFA 3GLUA 1XMPA 3DTVD 2JCXA 4FKMA 3SBXA 5BRAA 1TTHA 2BMFA 1GSHA 3VPCA 4QFBA 4TTJA 4X6YA 1QQ5A 2J6IA 4XZ3A 4XD2A 3IP1A 2YWBA 1DEAA 2I54A 4BUJA 4MHOA 2BFFB 3RVBA 1QBGA 3TQTA 4EHDA 3ZK7A 4MEBA 4UOZA 2ZKLA 5FFFA 1Q0LA 3QIVA 4L08A 4DS3A 3EDYA 3THXB 3C8ZA 2CMFA 4IDFA 2ODQA 5JROA 2Z3ZA 4XM0A 3RUHA 1I94H 1V6AA 2VKTA 5TF4A 2NQTA 1W47A 1XJCA 3SJBA 4LNUB 4FHDA 2OY0A 4MVJE 4KQXA 1JSLA 4ZOQI 1LTKA 1GILA 1CZRA 1IHYA 3B12A 1LF5A 3D0KA 4PQYA 4QLAA 3RGWS 3O7WA 3IQGX 2PUDA 2B82A 1ZM3A 3Q10A 4CRWB 4HAXA 5L8VA 4DC1A 3TIXB 1CY2A 3ZD6A 3WIOA 1MH9A 3FOAA 1JL3A 3IA2A 2FWBA 1A97A 4YHBA 3QHAA 4K9NA 1VFPA 3BSSA 1S1CA 2V7GA 2W6NA 4NE2A 4OBEA 5TS2A 1EVIA 3AU9A 2FXIA 4FQ5A 3W5IA 3WNVA 5IVKA 3GLIA 1GN9A 2FOXA 3T0FA 5JSZA 2XRYA 2ATIA 2YH2A 4YN3A 4IDHA 3SK0A 2FI1A 2ACKA 4CFSA 1Z63A 3RANA 1PJCA 4BNZA 5LP6A 1TYDE 1F8UA 1QGUA 3KOZA 4LZWA 5KNBD 3EEYA 3ISJA 1MOZA 1US8B 3IURA 3SHQA 4R8VA 2HK7A 1I14A 1BFDA 5F3RA 3OE5A 3R40A 4QC2A 5AW7A 2VP4A 5DX8A 5BW6B 2NLOA 3NT4A 3WHLA 3FBGA 2IHNA 2VATA 5BMVB 2GKSA 3E35A 1W36D 2V9CA 4H1WA 4U6SA 1NXTA 1P4AA 3GXOA 2QOEA 1KI9A 1XL1A 4E08A 1QUEA 4Z4IA 2FWJA 4D4GA 1Z47A 1CZKA 1JLLB 1T4CA 3W06A 2O4UX 2ZUUA 5AOAA 2ZSHA 4OTZA 4MS4B 3M6MD 2X42A 1N36B 4R8KA 1C8LA 5KX5F 3IP3A 5JHGB 4NICA 2VWPA 1ONSA 2XMGA 1G1MA 1YBAA 1E20A 1VDZA 4UDNA 1XNHA 3OZEA 4IDOA 1B00A 2Y6VA 1E2IA 1PZMA 3RIGA 3TPFA 3U7QB 3M7IA 3BCUA 2OLKA 3ED5A 3L1IA 1OJLA 3TZHA 1FDIA 3QLVA 3I5UA 4NE9A 4UM8B 1W36C 5F9FA 4DR7H 1R8SA 3AF5A 5EJIA 2X5NA 3UCFA 1NJ8A 1X7HA 3AIKA 2JDID 3MS2A 3LT4A 4GKBA 3OKPA 2L82A 2PFGA 2IZ7A 2A92A 2HIHA 1FKAH 3GT4A 1SURA 3DNFA 5KU7A 1FFAA 1E89A 3I2IA 3M5CA 3OTWA 1NX6A 3DUFA 3ILVA 5IDYA 2OO5A 3LYHA 1GXSA 2P9YA 3TLGB 4UQOA 3U4IA 3AWIA 2I5PO 4BNJA 3IIKA 5KOIA 2YZGA 3O3OB 1KU0A 4LDPA 5D51S 4A8JC 3GNSA 4KRGA 2QTCA 3W6OA 4UJ5A 4BMOB 3I6YA 4BCCA 1TEHA 2ONYA 4NBRA 4ILEA 3RCBA 3NC0C 3EUFA 3EGWA 3TVDA 4B82A 3IUPA 3LOQA 2FQ1A 1U8YA 2DC1A 2IHTA 3TOVA 3M4XA 2H0RA 2I66A 1J9EA 4KLNA 3D3KA 1RYDA 2PMBA 4XPZA 4BKOA 3U5TA 2Y1WA 2HLHA 4M9ZA 1LF0A 1YASA 2R751 4M1YA 1BW9B 3PXCX 1F1JA 1P5FA 4Z1OA 1U28A 3K8YA 4HAOA 3IP9A 1YZLA 3GMDA 2QG4A 3T99A 1T8YA 3HXOA 3SBOA 1X9GA 3MD9A 1VC2A 4G5GA 3G2OA 2H63A 4RVGA 1SA0B 2AJBA 3LXMA 2LBPA 3K4QA 5AYVA 3T9DA 4KK3A 1A5TA 4B32A 5U1PA 1Z13A 3JQAB 3NJ4A 2OYRA 1P9NA 2I55A 3DBHA 3MILA 1Q19A 7REQB 4F06A 5K6AC 2JLVA 3QLTA 3H1FA 2P0AA 3HB7A 1Y1PA 4U7DA 2NX2A 3N2IA 1YZTA 3E3LA 3B6JA 3UTCA 3S1SA 4GQAA 5KYTA 4JYZA 3TXYA 5BW8A 4QZVA 4LXYA 1U7DA 1L7AA 3B3FA 5JBNA 1Y6QA 4ZEWA 3WLKX 2PX6A 3ZLUA 8ABPA 1W6UA 3KEQA 4N03A 3HVJA 4PLPA 2XQIA 2VZ9A 2ACEA 5AJUA 3L5KA 4IJ5A 2VYVD 4P3NA 4BX3A 1M54A 2FAXA 5LB4A 5HP4A 4CKWB 3T7IA 1V45E 3D7RA 1TU0A 3UMMA 3UMYA 1ZC3A 4HEA6 3BPSA 3V2UA 4PAQA 3SJAA 3PIIA 1XCGB 1WP9A 4J8PA 5TGZA 5AQ1A 2WMDA 5BSEA 2GB4A 5HEKA 4FYKA 3R0ZA 1Y34E 2D0PB 2BHTA 1YTUA 1O9GA 2XVMA 2P69A 3UWOA 3SVLA 4PNEA 3KR0A 1MFPA 1J21A 3RVKA 1AF7A 1IOWA 2F3SA 4L3VA 3WICA 4JV5B 3E9MA 2FB9A 2AVDA 1AKMA 5AVZA 4CM3A 3W2GA 2UXCB 4BQNA 2IY9A 2F8MA 2UU9B 3U81A 1B74A 3UFXA 3T9BA 1VE6A 3T1YB 3SXJA 4PYLA 2NVUA 1JNYA 1BGWA 1NW6A 1PJLA 2DQZA 2ZT6A 4OYYA 1Z2IA 1WV0A 1H8EA 4P3YA 4QODA 5CH3A 1ZN8A 2F43B 4BZZA 5DHTA 3I0PA 1EK6A 1GITA 1TU4A 4G4SO 1DTSA 1N34B 2JLQA 1N0WA 1IM5A 3W90A 2O8EA 4CU5A 2GFIA 1CJUC 3DCIA 1E1LA 3PHHA 5I7EA 4PRKA 3FLMA 1E3TA 3N2GA 2ZS8A 1RIFA 1XCLA 1C30B 1ODJA 1X7YA 1XDWA 5I3ZA 5HFAA 1SVKA 2H3HA 4LJAA 2O5CA 4L5JA 1QYRA 5T8KA 2C5FA 2Q5OA 4EGCB 1IQRA 1JA1A 3Q7SA 3ZV7A 1E7YA 3WNBA 3PX3A 4Y9TA 1HEUA 1CZUA 4U7WA 1NAHA 1PLKA 2FN4A 3D2BA 1KYQA 1Y7HA 4H9GA 4HZUB 3CPJB 4YAEA 4DCPA 3FNGA 4Z3KA 1PV4A 1JIXA 3AFNA 5CT4A 5CDFA 1CF4A 4ECEA 1PQXA 1WR8A 3G59A 5B3KA 2C8JA 4G0YA 2QU8A 1EX1A 3DFIA 3Q12A 1E61A 1PEAA 1XFDA 3UAOA 3BS4A 2QRJA 4OV6B 5I7AA 6YASA 5TIIA 5T4EA 1I1NA 3KV3O 1ZRNA 4LBYA 5TB5A 3RROA 3TSYA 4E46A 1QTQA 2J8ZA 1N9GA 1P2VA 3EWAA 1BMFA 4N3CA 2VPZA 1II9A 3DVLA 2V6BA 4G0VA 3T12A 1H22A 2P0YA 1X7GA 2OUIA 3CLTD 2V4MA 4V0NA 5CD9A 3U0VA 3V5NA 5IS2A 2H7CA 3JQAD 3P97A 2ORIA 3LYAA 3A0UA 1AB6A 2IEZA 4FSXA 5IDVA 4M6WB 4PFKA 5HBRA 3VSAA 1JBKA 2J08A 3HJAA 2PMKA 3FPLA 2YXEA 4EITA 1NQOA 2X1VA 3NP9A 4RY8A 4ZO8A 1UAGA 3PJRA 4YRRA 2NU9B 3OP1A 1SWWA 2J5BA 2WM3A 4TS4A 2GFHA 3L6CA 2FR8A 1LTHR 3C6YA 4UCQA 2FKAA 4O5OA 2HQOA 4JBWA 4J29A 2VP3A 1NOKA 1IN7A 1J5KA 3G2KA 4QDUA 1X86B 2QQ5A 3MMXA 1TT5A 1DUIA 1MSZA 1OLSA 1TJ5A 3FNIA 3Q7PA 1RBMA 3GLSA 4R9NA 2QJTA 5FOWA 4MR8B 1S5PA 4LYEA 3LBHA 1JDZA 4Y2UA 5BWNA 3SQXA 2AIRA 1D1SA 1N6KA 2CPMA 1OI7A 2NO0A 4ZVLA 5LQDA 4MRAA 3RV3A 2O7QA 1DIOB 2RHTA 1DAHA 4G5HA 5FAXA 2OPHA 3ZLBA 1JMYA 2J9RA 2QMUA 3OP4A 5CB8A 3EFOA 1BGXT 3B53X 3NHYA 4M1EA 1KI4A 1NJ1A 1H6BA 4UFPA 3QUQA 3G8CA 3ZVNA 2EQBA 4E9JA 3CGWA 5AXDA 1F6BA 4PO1A 1UZLA 4N7BA 2JKYA 5DNAA 1YQQA 4DEVA 1KMMA 3W34A 1GYPA 1X1CA 3OJEA 3T7JA 3G2MA 1I1HA 4JYMA 4BYMA 4QEKA 1R0WA 1TZBA 4WINA 2YZNA 3EVNA 1AKVA 2D4AA 2TMKA 4YP5A 4LVOA 2GK7A 2ZS7A 4MI3A 4UTZA 5ELMA 2BFWA 2Z2IA 2ZIUB 2VO1A 5HYVA 3JWHA 4URVR 2X0FA 1DRVA 5IVPA 1EP3B 4KYTA 4OM7A 4BV8A 1VMEA 3TBKA 4O2LA 3H2KA 2I2AA 5U9CA 2L42A 1T1IA 2WT9A 3KJHA 3PKZA 4NLLA 1YA4A 3ESDA 2BH2A 3H11A 4V0OA 3REOA 4YMGA 1OZFA 4Z7NB 1J39A 1R4NB 1E7QA 4XE5A 1P5RA 2C2YA 4FKBA 1GT91 1ZH4A 3TGPA 1UQUA 3WGZA 2BR5A 5L7WA 3R5SA 3LC0A 4AZTA 1M1UA 5F1OA 5HK8A 3LGSA 2X0IA 2HWUA 5KEIA 3QVJA 1Y6ZA 3DFZA 3FGNA 3UBMA 4FW9A 1B6SA 1V0JA 3PEWA 4ESHA 1KH3A 2VG8A 3D8RA 1YC5A 1AHIA 1NC1A 1F4VA 3ABOB 1OYYA 2HCTA 3QMPA 2NO6A 4M8IA 3A2MA 5EXTA 4Q12A 3VR2A 3W4KA 2GZ2A 2RSLA 3QX3A 5EP2A 3JQEA 4M1WA 1K7YA 3LOUA 1JYEA 1LRJA 4KW7A 3KKMA 2PCJA 4LAFA 3JQFA 2QZ9A 4GR5A 2WIDA 4Y6OA 3SBDA 2G4VA 4NBVA 3F90A 4MWDA 4QUKA 4CDMA 2DKNA 5ALYA 1GP2A 1NIJA 4YPOA 2N9UA 4DUGD 3JAWB 1SIUA 2ZBGA 1IHDA 1R8QA 3J81A 3HCFA 3QX9A 4X62H 2F90A 2W83A 4P22A 3F5FA 3Q85A 3OLWA 4L6IA 2QX9A 3A4VA 5HWSA 5AVUA 1U02A 2XE8A 2XUFA 4FEAA 3SLGA 2FW1A 4F5DA 2J7PD 1V41E 1FFHA 2WUGA 3NZEA 1NURA 3QG5A 3TOCA 1AGNA 4E6PA 4LI3X 1SOAA 1TF2A 1W94A 2V7QD 3FIUA 1NTRA 2VDWA 1DKUA 4JOSA 4KQ2A 3GLFE 4NZRM 1IRXA 3RIMA 4YEDA 1OX6A 1QIMA 3DAPA 3BF7A 3UVEA 4QGHA 1XEFA 5JNLA 3BORA 2W00A 3UB4A 1KVRA 3HGQA 2C92A 5KYYB 2DE0X 2OSVA 2OGTA 1LX6A 3P9XA 3UHAA 5DW0A 3N9IA 3NHPA 4KQMA 3I9LA 1L7DA 1WXHA 2OWDA 2M6KA 2CFOA 3W5HA 4BJ6A 2ORED 4MIEA 4DWOA 4ERNA 5L3QB 2B1IA 2REXB 3PQ7A 3ENVA 4HS4A 4K26A 2OE2A 4OJMX 4ESEA 2ZFUA 3K1AA 3KE8A 4HC4A 1ZH8A 4JI0H 3GFPA 3ZI0A 5K2MA 2ZUEA 5ED4A 5BV7A 5D2CA 2CUTA 2HQ1A 5DYYA 1HQYE 1QH9A 3SEZA 4KI7A 3P9PA 3UJ9A 1I4WA 3DC2A 3HYRA 3PK0A 4DMKA 4EFNA 1LSJA 3LBFA 2HO4A 4IKPA 5AVYA 3FMFA 4PFJA 2I4IA 2UDPA 2BLNA 4DR3B 4DJEC 3UWSA 1YZ3A 4YAWA 2FK8A 1JAHA 4FE3A 2A7QA 2Q2OA 3A7EA 4KH1A 4OSPA 4UZFA 5E4FA 5E6SA 2Y0BA 4XI9A 4A2PA 3ZHSA 4YMHA 4RTLA 2IS2A 1P19A 5I9BA 3V7FA 1MOPA 2O8DB 1N2HA 1NDQA 2QRVA 1FSPA 2O06A 2AR9A 2MIIA 4CIXA 4PQRA 4CLDA 2VHEA 1PJZA 2R6ZA 3GJ8A 4XQEA 4EJFA 1T5HX 3PEFA 4ZYVA 3R7DA 4A5SA 4DHEA 2VN8A 5EKSA 4IILA 4Q1AA 4TV8F 3SZLA 4DV7H 3N75A 3GDFA 1T5IA 4P9NA 3WWZA 3EY4A 2XZTA 3SYKA 4FE7A 5KPDA 1QM5A 2OB1A 2P5YA 1VP3A 2P6UA 4U2CA 4EA6A 4GLBA 4EYOA 2ZWMA 1YFJA 3HJFA 2SNIE 1PTKA 4PLGA 1X7XA 5K7SA 3KKQA 4RH0A 4XB6B 4IXWA 3HDHA 1QGOA 1SCBA 3MAGA 5CFOA 4YJFA 1T2UA 1E60A 2OB2A 2W2QA 2BTQA 4DF3A 3E2MA 3O4FA 2DLNA 2OT3B 3TLBA 2H2WA 1OWPA 4EIWA 3EXEA 1EWQA 4E33A 3JALA 1DO0A 1CQIB 2W22A 1P8JA 4PRYA 1QFYA 4F4JA 1XMQB 5LMUB 5JQGB 2HMTA 2X4DA 4DG5A 1KKMA 4AM8A 4BFVA 3RSSA 3AVUA 2BFMA 3KOXA 4HP8A 5F7ZA 5FOVA 2QAGB 4GP9A 3SQNA 4YRNA 1ULSA 3K70D 1KJ8A 1Y1QA 1PJAA 1N5MA 1QFSA 5EJ5A 1KH1A 4N0QA 4GM4A 2QAGA 2O8FA 3V1NA 4AKGA 2NZUG 4QBHA 4XQGA 3WNCA 4GAEA 1ES9A 1T8RA 1AO0A 1BYIA 4ARCA 5AKYA 3GUZA 3I6ZA 1PT6A 4P4LA 1ZSYA 1ZIYA 2W90A 3LFHA 4L85A 1KAHA 5K0ZA 1GGVA 3LKDA 3VO8A 5B36A 2Z2XA 4KX5A 1JKXA 2HL6A 3GO4A 3II6X 4PZYA 4RF3A 4DANA 5DOZA 4UHFA 4EHFA 3PFKA 3LE8A 1AMNA 4BAZA 1U4SA 4R1OA 4TXJA 1CJVC 3PGA1 3PQ8A 4R1UA 3KAPA 3IE2A 1HTBA 2P5TB 4FXPA 5F51A 3AVVA 2CLCX 1HBJA 4HNTA 2VAPA 2ZE6A 3GFTA 3FTFA 2VH1A 1WF6A 2ZANA 5SY6A 3EDRA 2Q2VA 5HMMA 5JCJA 3GGSA 4IMJB 4PS1A 3M4NA 4Y1RA 2Z9BA 1EIWA 2J0UA 1R4MA 1SUEA 3GT0A 1VL1A 1EGMB 2ES4A 3FX2A 4OQMA 3AP3A 1UKZA 2DCUA 2WA1A 4HNRA 4LTMA 3SKYA 3TK1A 2GN0A 1GZ6A 1HKHA 1NM5C 1Y1SA 3GEDA 3MFQA 5ESXA 7AT1A 1DAIA 2AC4A 2XA9A 4JJ7A 4WCFB 1PYOA 2WAXA 4JLAA 5K6RA 2C8LA 3ZTYA 4REQA 1HK7A 2OECA 4NMMA 3ZNQA 1THGA 3VKGA 4O2RA 1E9AA 3ONEA 1YQ9A 4QVIA 3O8QA 3FM9A 2Y2UA 3HVIA 3JQ9A 4ZYLA 1D2HA 1C0EA 4J2HA 3MLAA 2QX4A 3MTDA 4MWZA 1JDTA 2HDHA 2G9VA 2F7SA 3ZCVA 5BYKA 1GN8A 4O4HB 3TGWA 5EFOA 4EAAA 1BMDA 4YV7A 1WVIA 3SMQA 3DS8A 5DTIA 4G56A 4K8OA 5F4BA 4EFDA 3C1AA 3CUEF 4QDJA 4BO5A 4BZQA 3PNSA 5A5EA 4YRQA 1P6XA 2OV1A 1P1RA 4RY9A 2XOKD 3M1LA 4KUGA 3DMRA 2YIJA 3VJRA 3W8EA 3MC1A 4RD1A 1H93A 2Q5FA 1ENOA 2I3BA 2VI5A 2BBSA 3O0TA 3A7DA 4JGIA 4NJOA 3OCXA 4BCDA 1N1GA 3A9VA 2AXQA 2IYTA 2XI4A 3AEXA 3S81A 2QG6A 2QX7A 3PRKE 5C31A 4JSTA 4ZALA 3WX0A 1LVHA 2GQ0A 3DV0A 2Z2ZA 3CZAA 3KB8A 1VJ0A 4KQJA 5GONA 1KOLA 1Z29A 1THZA 2XMCA 1Q92A 3GYBA 3QPCA 4XGQA 2YY6A 4DPLA 1ZSVA 2ILVA 1XZJA 4TT3D 1X14A 1XTKA 3UMVA 2EFEB 4B7CA 5JHHB 3DHNA 2ZM5A 2VDWB 3NOVA 2AX3A 4JUIA 3GVHA 1A7JA 1BS9A 1MP0A 4S2EA 5TSDA 3OIGA 3V4OA 2HMYB 4CV3A 1KK1A 2LCFA 3AUYA 5LMCA 1TM5E 2P2RA 1ADYA 1FVOA 2IXDA 2RGCA 2O8CB 1YFLA 2YMLA 3PA6A 1H2WA 1HDYA 3CHYA 4YQEA 1D2RA 1VG1A 3ENKA 5BOVA 4LF9H 3A4IA 5COAA 4AMYA 1V8BA 4CFYA 5JH7F 2AMYA 5JH7A 1H3FA 2AE2A 4H77A 2Y0DA 2AFIE 3D2AA 1PU2A 3ABIA 4B4DA 1ENZA 4CI0B 5AUNB 1P2TA 4YP9A 5L3ZA 4C87A 3NV7A 1P0CA 2HJ9A 2O4CA 3P2KA 2XBMA 1AKWA 2AUTA 2OFFA 4DBVO 2YWJA 2F3QA 2BGJA 4J49A 1ISJA 4RFSA 4OHRA 1ZW6A 4GNRA 5E95A 4YXWA 1MNAA 1VCMA 4EJSA 2JBHA 4BBJA 1BCSB 3PFCA 5F78A 3X2FA 4DN6A 1TLTA 4O4LF 4RK0A 2ZAOA 3QNMA 3LJKA 3OLQA 4TV8B 4Y2QA 3N2YA 2C9OA 2C4WA 3PUWA 3MQ4A 5DHAA 2VTVA 2PUCA 3NOXA 3QUBA 1A2QA 4R31A 2EWMA 5E4TA 1VIAA 2C84A 2HYDA 3GJ3A 1A27A 3EF3A 3L3BA 4NHOA 4BX2A 3SFTA 3ZTTA 3ABSB 3H9BA 3NALA 4J91A 3X2SA 4ZODA 2KWIA 1SHTX 3LUDA 5H82A 4UU8A 1ZD3A 3HCPA 3TOZA 1PFWA 1NJ6A 2NGRA 4CMIB 4EL5A 4KPGA 3W2IA 4ZI2A 5CA1B 1O1YA 2QTVB 2IT1A 4M0UA 3CZQA 4R3UC 4L5AA 3TNFA 1AT1A 2ZOSA 3AEUA 4OI0A 4ZCPA 3HCWA 2B4AA 4TUYA 1WXGA 3LWDA 2MJHA 3N0RA 2EIXA 4MA5A 1FS5A 5FOTA 3SOPA 5FPQA 3K8ZA 4GGMX 1H1TA 5FUBA 1NXPA 3W2TA 2XUJA 4H3SA 4Z86A 4DMGA 1DI0A 3IFSA 3V7YA 3G68A 1SBQA 1NF3A 4A7PA 4DDMA 4GC5A 1OE0A 3ZV4A 4DLAA 4IFDG 3DW1X 4DY6A 3TR5A 1SNYA 4X91A 4YO7A 3LGXA 3GFRA 3O26A 3RYHA 1YU6A 4JI3H 4N5IX 4HUQB 3HSKA 4QUGA 2QA5A 4AMZA 4MAMA 3DCNA 1PR0A 2CJFA 2I4MA 4JZKA 2ATVA 2J33A 2REQB 3ZJYA 2Z8XA 3OJFA 4EY7A 5DBFA 1HYHA 4QUEA 4YCJA 5T57A 1JIUA 1YSCA 4I55F 1U3UA 1WL8A 1J8YF 3T9CA 5KI6A 2YRXA 3FYHA 1HEYA 1M1YB 4FT4A 3OLXA 1YJCA 2OQ2A 1F6WA 4R7ZA 3I9NA 5EE9A 5C7LO 1VIHA 4UU1A 3N6XA 4ZC8A 4QJ5A 2O3JA 3HI4A 2DT8A 5HKLA 2JIRA 1W85A 1WMDA 1L5VA 1V6CA 3R5TA 2VLIA 1UUFA 1YDGA 3KTOA 1B0ZA 3F5MA 2FCAA 2O2DA 3QV2A 1P1JA 3GGCA 2O48X 1A76A 2JGKA 2BBOA 2Q3HA 2WTNA 5IM5A 1BHO1 3DAOA 4CDRA 3MWEA 1HQCA 4DZZA 3DKRA 4CL3A 4PTYA 3OFND 2JVIA 4Q3KA 1W96A 2ZJFA 3G5MA 2TYSB 2HWYA 5ALVA 4OXXA 5CJJA 3ZWBA 3A05A 3ER9A 2FHPA 121PA 2W4MA 4WZBE 4BTVA 1WXQA 1V7QA 3KSDO 3E8XA 3O03A 3OI7A 4R54A 5DV9A 1N32B 3GA0A 1XF1A 1U28C 2FPRA 3GJQA 5FORA 1G2OA 4D9JA 2BI7A 1SUSA 4UHCA 4YDRA 5I9MA 1RAIA 5BP7A 3LS2A 4JEMA 1T36A 4N7RA 4WDRA 3QHQA 2C03A 3QSGA 2QVLA 1NAIA 2W11A 2IX9A 4JR1A 4CCSA 3EPPA 3ZNOA 3IHWA 4KYVA 1Y3IA 3FUCA 3HXLA 4JJAA 5DXJA 4N5MA 1RWOA 1Z34A 2JCVA 2HM7A 4KH0A 3U4DA 1N2SA 2PSEA 3KXLA 1JIIA 3IQWA 1S8FA 4QNMA 1E32A 2J9FA 3ZZ0A 1E6KA 4R71A 4CE6A 1DIRA 2SBTA 3I2HA 2FFRA 1CQXA 3PKJA 4DVGA 5BVHB 4MAFA 4RVHA 5JWHA 4M87A 2DBRA 2G9UA 3SC4A 2IV2X 4ZHQF 1XVVA 1ZMOA 1TC2A 2MINA 1I4DD 3C98A 4K9MA 5IW8A 5KHOC 4CGZA 4AAYA 1XHFA 1KPHA 1Z18A 2DP4E 3PHBE 3C8HA 1XALA 4YAFA 3WJ7A 3IXQA 3VU1A 4KAAA 3DTYA 1OV4A 2D06A 3R9XA 4EKDA 1T9HA 1XKXA 2HEIA 2RB4A 2IOQA 4K6MA 2HIAA 2OQIA 4NATA 2EW1A 1Y6GA 4FHGA 2FWMX 1XD2A 4L0MA 3C6QA 3JRWA 1Y0BA 5DB4A 3VH2A 2HJWA 3VX3A 4CIBA 2Y93A 3KETA 2W6QA 1PR6A 3JSAA 1NI3A 3KKZA 3KG2A 5DTMA 3VFDA 5BSMA 2J9FB 2Q49A 3G89A 1A1VA 4QQNA 4I7EA 1N3IA 3FR7A 3HV0A 2IUTA 2W70A 3W0LB 4CR8A 4D9KA 2FMXA 1V8CA 1NF2A 5HJ7A 3OEHA 5ITZA 3IUQA 3PGKA 4WKCA 1GGKA 1H4TA 1NP6A 3DHVA 3JQ6A 5DI3A 4DCOA 3T95A 4MMZB 3T6KA 4EKYA 4TZKA 3MGGA 4BVFA 1E4EB 4K87A 4KIWA 1SA0A 1VJ5A 2DWOA 1J33A 2PA3A 3UZUA 1MNQA 2R7KA 2ZUTA 3NU1A 4PZ9A 5BMVF 1IAVA 3PXAA 1P1FA 4TMTA 4NCHA 5L3SB 1MVLA 1OSNA 4HOYA 1JR3D 3Q7IA 3MJ4A 3DMTC 1G21B 4D4JA 3KJEA 3OCJA 4BAGA 1Q77A 4FEEA 1C1DB 2PYDA 3EEFA 1EK0A 2MYNA 4NRDA 4Q37A 2QRHA 1O0BA 1G5PA 4JNCA 4NCXA 3HCDA 3QM1A 4XIFA 1WCIB 3RF2A 2OHJA 2E6KA 4BNFA 4WUTA 1PJ3A 3CLUD 1E4YA 1HQKA 2D1RA 3U3ZA 4ZCMA 4W8OA 1A71A 1BXGB 1FQOA 3A1VA 1GDDA 1ZXXA 3B82A 3NBAA 4TYWA 1PQPA 2ANBA 4JC4A 2H2GA 3GU3A 1FSSA 1QOZA 1W1WA 5LM3A 2W2MA 3F8SA 1IB0A 3BRWA 3HN7A 1YACA 1DCTA 5IFKA 4ZT4A 4BC0A 2GYUA 1KNQA 1FUKA 1M1ZA 1QIIA 2PGNA 4DRYA 1J25A 4YDHB 3V8VA 3AONB 3CKKA 2JGAA 3OM9A 3MT8A 3UT5A 4ONEA 1P0MA 3LX8A 1Y4AE 4IJUA 5F3WB 3R6DA 3WQRA 1Z38A 1XEWY 3D0QA 5LOVA 4L0CA 3CZRA 1S02A 4X6LA 3VC2A 2PBZA 4Z8XA 1NDUA 1U94A 2DPGA 2DH6A 2XMPA 4OKNA 1JT2A 1K5PA 4EY6A 3C8UA