2O4CA

Crystal structure of d-erythronate-4-phosphate dehydrogenase complexed with nad
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
380
structure length
380
Chain Sequence
MRILADENIPVVDAFFADQGSIRRLPGRAIDRAALAEVDVLLVRSVTEVSRAALAGSPVRFVGTCTIGTDHLDLDYFAEAGIAWSSAPGCNARGVVDYVLGCLLAMAEVRGADLAERTYGVVGAGQVGGRLVEVLRGLGWKVLVCDPPRQAREPDGEFVSLERLLAEADVISLHTPLNRDGEHPTRHLLDEPRLAALRPGTWLVNASRGAVVDNQALRRLLEGGADLEVALDVWEGEPQADPELAARCLIATPHIAGYSLEGKLRGTAQIYQAYCAWRGIAERVSLQDVLPETWLAGLQLNPGCDPAWALATLCRAVYDPRSDDAAFRRSLTGDSATRRAAFDALRKHYPPRREITGLRVATGGQAELQRVVRALGAQLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Erythronate-4-phosphate dehydrogenase
publication title Crystal Structure of d-Erythronate-4-phosphate Dehydrogenase Complexed with NAD
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 125
structure length 380
sequence length 380
chains with identical sequence B
ec nomenclature ec 1.1.1.290: 4-phosphoerythronate dehydrogenase.
pdb deposition date 2006-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00389 2-Hacid_dh D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain
A PF02826 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain
A PF11890 DUF3410 Domain of unknown function (DUF3410)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.170 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 2o4cA03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2o4cA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2o4cA01
1KVUA 2VRBA 4NDNE 3GGGA 4HNGA 1Q2XA 2YHIA 3GT0A 2W2KB 2P4HX 3K2BA 3QQPA 2C2XA 4U6QA 4CR8A 5C37A 1OMOA 3SC4A 4XKJA 1E1MA 4K1LA 1ZBQA 3BMCA 5JCJA 4Q9NA 3QE3A 1PJCA 1E3IA 3R3SA 1HYEA 4CJXA 4UREA 5COAA 3WMXA 3LC1O 3VTFA 1XR3A 1VSVA 1GFSA 2VHZA 4MKXA 1M67A 3RAJA 1YQXA 3UF0A 5FF9A 4CMGA 5A1TA 2B69A 2XXJA 3ITDA 4R9RA 4B79A 1EE9A 1R4MB 4INAA 3S2IA 4MVJE 5GZ3A 4OOFA 2Q45A 3WGGA 4B7UA 4BVAA 4B3IA 4DWVA 2J5RA 2VWPA 3Q9NA 1WPQA 2VNAA 3WDSA 3PHIA 1VPDA 3AY3A 3GNTA 5DP2A 1GYPA 3W8DA 3S2FA 3NX4A 2HMUA 1GV0A 3OETA 4HX5A 2ILTA 3DTYA 2NUAA 3WMWA 4XYEA 3OQ1A 4II2A 5EQDA 1E3JA 1PWXA 3DWFA 7MDHA 4MPDA 4WNIA 1MX3A 2OORA 4R16A 4Q3BA 2PR2A 3DAGA 3RFTA 4GMGA 2ZATA 3ZHZA 3CXRA 3AI3A 4KDFA 4KTTE 4XEHA 4E5PA 3PDJA 4HFMA 1UXGA 3CUKA 1PL6A 1UXHA 2A9FA 5A9RA 1A72A 1PGPA 1PJ4A 1UP4A 2C7GA 2HCTA 3W1VA 4HP8A 4LGVA 3IL2A 1J49A 1I8TA 2B0JA 4WNCA 4N5LA 3U3XA 4DBVO 4I5FA 3AU9A 3B1KA 3ROQA 3Q6IA 5CEFA 1PZHA 2XOXA 4JBIA 4YBZA 3UCXA 4RPGA 4XYLA 5IDXA 4OSPA 2NVUA 2IYOA 2FRDA 4AG3A 1H2BA 4BGEA 2BGKA 3NKLA 4LRTB 2E82A 1Y8RB 1X1EA 4OXKA 1C14A 4JIGA 4DGSA 3WWYA 3N58A 1N1GA 3A9WA 1B8VA 3L4SO 3ENNA 3D4PA 3VPXA 3I3OA 3QIVA 3QHAA 4EJ6A 4BO9A 3IUSA 4NBTA 1ZKMA 4B3HA 5IZCA 2O2YA 2X6TA 4JGBA 1T2CA 4BKQA 2WEKA 3IJPA 1UP6A 3WFIA 4CLDA 3T4XA 1EVZA 4URFA 1LSOA 3WGYA 1BXZA 1SOVA 4FFMA 4FFOA 4ITUA 3JQEA 4DMMA 1BW9B 4R1SA 5G4LA 3ZWWA 4PG6A 1WZEA 4IJKA 2YHUA 4DBZA 1KETA 1PJSA 2VHVA 2Y66A 4OYRA 2GNAA 3K2EA 3V2UA 1VRWA 3JYNA 1HLDA 1G6KA 1LSSA 1Z7BA 2O3UA 3EY4A 3SJ7A 4J2HA 4Z3KA 4WJZA 1FF9A 1VM6A 1J5PA 2WD7A 3PJGA 3BMQA 4RPKA 1HRDA 3GMSA 3JQAA 1WMAA 2Z1NA 3I4FA 1YBAA 4FC6A 4R4JA 4Y6SA 1KEVA 3EGOA 1BDMA 4LW8A 2OBNA 1U3UA 4DLLA 3H2ZA 4TMFA 1Z75A 3GOHA 3FI9A 4WLFA 1M76A 1CRWG 4E21A 1U5CA 3D5QA 4CLRB 1YONA 2AQ8A 4ZQEA 1D3AA 3FCOA 3UH1A 1H6BA 4LISA 1X7HA 2G0TA 1F06A 4ZQBA 4CUZA 3DMTC 4G81A 3H9QA 3JQ9A 3S8MA 5K6AA 5CDUA 1DIBA 3K31A 2DU8A 1TA4A 3PI7A 1BVRA 3UVEA 1HZJA 1VKNA 4XYMA 4BIIA 4WLNA 2BKAA 3QSGA 3SVTA 1HXHA 3KETA 3NTRA 1HDRA 4IM7A 1BXGB 4CMCA 1Z45A 3S1LA 5DNAA 5IF3A 4FQ8A 2DPGA 3DONA 2QG4A 2XXBA 2EXXA 3C85A 4IUYA 5DCYA 1ENYA 5FYDA 4NFSA 5A06A 2PH5A 3JYPA 1PZFA 1DBVO 2SCUA 3RWBA 3O4RA 5KJ1A 4YCAA 1B8PA 4YAGA 2DUWA 1WDLA 2VZ0A 1A4IA 2UAGA 4XYBA 4IJWA 2JFGA 5CEJA 2PKQP 1YWGO 2I9PA 4O63O 3BMNA 1B0AA 2JJYA 3ZV3A 1QORA 3AY7A 4W4TA 3BTSA 2V6BA 4BO2A 4F3YA 1E1NA 2OL4A 3OIDA 4H3VA 1KY4A 3JD3A 1Z82A 2XF8A 4YJHA 4YRBA 1SMKA 4Y8VA 2D8AA 1OAAA 2VHXA 4JNKA 2VUTA 4XJTA 1IL0A 1IB6A 3HFSA 1WDMA 4YRDA 4DPKA 3ZWOA 1BTOA 4U7WA 1YDWA 2QZ9A 3TQHA 2D59A 2VHWA 5IZCC 1EVJA 2CNBA 2X7HA 3JQFC 5G0SA 5L9AA 2CFCA 5GZ1A 3EUWA 1I24A 4OAQA 4ALNA 1R6DA 1YBMA 2RCYA 1DAPA 3QVSA 4Q39A 1ZIDA 3GG9A 1YOVA 2HO5A 4Q3NA 4DC1A 5A9SB 3L4BA 3UCFA 1R4NB 3KYCA 5C7OO 3NGLA 1M75A 5COBA 3MWEB 3IDSA 5JLAA 3BTVA 4BUCA 4NZ9A 3ZZNA 4B4WA 4DC0A 1LDEA 2P2SA 3ONEA 3WGHA 1AE1A 2FR8A 4H16A 4BO6A 2WMDA 4ESOA 4CMEC 4IS2A 1YKFA 3RJ9A 4ZVVA 4PVCA 2C54A 3GH3A 3NGXA 4A2CA 3NUGA 1E1KA 4R9SA 4DYVA 1DXYA 2I99A 2IZ1A 3OIGA 3L07A 4I9UA 3D3WA 4BNUA 4NHEA 4E12A 1MB4A 2OZPA 3OJLA 4MVJF 3E18A 3TDKA 4D0SA 3OQBA 1MGOA 4CLOA 4UUMA 1HDGO 4E32A 5B1YA 1YB4A 1OOEA 4Z9YA 2GN6A 4FGSA 2CDAA 3W8EA 4J91A 2Y99A 1C0KA 5JCJD 3OFSA 2WSBA 1UP7A 1O5IA 1LQTA 1F14A 4XR4A 1NQ5A 1DHRA 3MJSA 4HUJA 3JQ9C 3VVBA 4FIZA 4AJ4A 3T7EA 3ZWPA 4FJ1A 5JNLA 5T6BA 4GVLA 2GZ2A 4Q3EA 5HRUA 4MJLA 4CQMD 5H82A 3BHMA 1R15A 5DCUA 3NT5A 3NAQA 1I3KA 1DC4A 1V8BA 1HDYA 3FPCA 5CDGA 1EK6A 3KVOA 2HU2A 4WPGA 4AJ1A 1K6XA 3EK2A 3JQ8B 4RPJA 2GLXA 3DHEA 2W2LA 5JO9A 3DQPA 3F46A 3KHUA 1CWUA 5H81A 4BO4A 1DJNA 4M49A 1R16A 4IQ0A 1JWAB 1JWBB 5KCZA 1HT0A 4KOAA 2VUSA 4P4NA 3C7CB 4ZD6A 4BNYA 1NAHA 2PD4A 1ENPA 1EE2A 4JN6B 4RJTA 4EYEA 3TWOA 4YQYA 4R3WA 2V65A 2CUKA 4LK3A 4MVJD 4G2NA 3AUUA 4O59O 4PN3A 1EBFA 3ETEA 1EFLA 4Z0PA 3U9LA 4CLXA 4R41A 3HDQA 2J3IA 3WFJA 3TZHA 1H9AA 5C5IA 3VH3A 2PLAA 5COQA 4BMSA 3NT2A 3PFFA 5JMWA 4UVGA 3ZU4A 3GFGA 4OM8A 3H4VA 4QX6A 3MTJA 5IN5A 2CVQA 4L4XA 1O6ZA 1U5AA 5ENVA 3PGJA 5TQVA 3FD8A 4HBGA 3D64A 1QMGA 3Q0EA 1LDBA 1TT7A 1N92A 4L4RA 1YBVA 3I9LA 2Y1GA 4FC7A 3KYDA 2CZCA 3SC6A 1HE4A 3IKVA 1ISHA 4ALKA 3MJCA 5IXYA 3WNQA 2V6GA 2C59A 1B15A 1P3DA 2BFMA 1M66A 3GNSA 4CUKA 1LBEA 4GQAA 1EMDA 1ZNQO 2GRAA 3VH4A 3PRJA 2C5EA 2I3AA 3FWNA 4IZIA 3E8XA 5HS4A 1PWZA 1RM5A 1ZXLA 3PJDA 4OJNA 2R00A 1Q7CA 4XZ3A 1ZK0A 1C1XA 3JQGA 3ZU2A 2RH4A 3WQQA 3C1TA 1JVSA 4XA8A 2B4TO 1KEPA 4C7JA 1BVUA 4IINA 3H5RA 4RVFA 3VOSA 2NVBA 3QW2A 2YZ7A 4CM4B 4PLYA 3JQDA 3JQBA 5AXCA 3RQSA 5JW6A 4LCEA 4WLOA 4ILKA 1P1HA 1IHYA 4Z9FA 3PFWO 2YUTA 5B12A 1GV1A 1BGVA 3JQAD 1XDWA 4D3DA 3EVTA 4MP6A 3TRIA 3EW7A 1QKIA 2W2KA 3I9KA 1K89A 1WXDA 4UVIA 4Y67A 2HJRA 1NFRA 2NQTA 3GEDA 1AHHA 1ML3A 2Y1OA 3AOGA 5TJHA 3VDRA 4E31A 3WG9A 4CM3A 1MA0A 4I1IA 3KSDO 5TIIA 1QV6A 3K30A 3ZWBA 4CQLB 3UUWA 4FDAA 5DOZA 4BNNA 1WW8A 2G5CA 2GD1O 4CM1A 1NHGA 3WR5A 1HZZA 4YAIA 3BMOB 3GN2A 1ADFA 3LC7O 4Y9DA 5EN4A 5THKA 4PLCA 4O1MA 3HFGA 4J4BA 2B36A 5F5NA 3RU9A 3VH1A 5A4DA 4BQRA 3WLEA 4BS9A 1NXQA 2O7SA 2D3TA 5I9MA 1KIFA 3QWAA 1OBFO 5A3VA 4L76A 5B37A 4GPD1 1HF3A 3A4VA 3RBZA 1N7GA 3HDYA 5EERA 5ENDA 1ZH8A 1GPJA 4MVJM 4CLHA 4FW8A 1Q1NA 3JD1A 4B4OA 1KVRA 2IEDA 5I8ZA 2NV6A 2YYYA 3PHGA 3QY9A 4ZHSA 1V3TA 3KOUA 5IZ4A 3JSAA 3WGZA 4JBGA 1TB4A 1PZGA 2Q4EA 3JCZA 1DIAA 2RBEA 3ZHYA 5JMPA 4OMUA 3ZH2A 5KKAA 3RBVA 3PHLA 4FR5A 5KJFA 1HE2A 1GUZA 2Y68A 4XR9A 5A9TA 1ISMA 4DUPA 3GHHA 4EDFA 4QQRA 3GPDG 4CR7A 3I6IA 3OH8A 3BA1A 3LT0A 4KWHA 3V1TC 4H15A 2DQ4A 3K96A 3ZWYA 3OJ0A 4J4HA 4YJFB 4W82A 5FI5A 2PZMA 4NFHA 3RUIA 2IYPA 2EG9A 2H63A 1Q0QA 3ETGA 4WCFB 3K5PA 2R00C 2J5QA 3DZBA 3H9JA 2EIHA 2B5WA 1W73A 4RORA 2Q3EA 1MFZA 2FY8A 3PGXA 5T64A 1I3LA 3DAFA 3L0DA 4QO8A 1NAIA 3WS7A 2I6TA 2VYVD 4OQYA 1N1EA 4J7UA 1N5DA 4WLUA 3JQBC 3ANMA 1NNUA 4JX8A 3TSCA 2JAPA 4DPLA 1QLHA 5TC4A 3IP3A 4NBRA 3H3FA 3ICCA 3AI2A 2V7PA 5GZ6A 1PGQA 3UN1A 1BW9A 3HE3A 1HE3A 3FBTA 5EIOA 3W6UA 4WLVA 4XJSA 3FWZA 4M54A 3VZPA 5BNTA 5HWSA 1A7KA 5L40A 1RJWA 3L77A 5AXAA 4DRYA 4JBHA 2B37A 4EBFA 1DPGA 5T8KA 3R0IA 1ULSA 3LSYA 5IG2A 3GPIA 3BYZA 1Y5RA 4GX5A 4K6FA 4NBUA 3CIFA 1C1DB 1P33A 2VZ9A 3RCBA 4CM5A 2NNLD 3L6OO 2ZTUA 1EEHA 4WECA 4IBOA 1YE3A 3ROKA 1Y7TA 1UUFA 3ZV6A 1EUDA 2FZWA 3HDJA 1EVIA 1S7CA 2IEBA 3WYEA 1IULA 1LI4A 3WIEA 2NU6A 2P4QA 2IXBA 4YACA 2EGHA 3KYBA 1LRLA 4BNXA 3ZV5A 3D0OA 3HN7A 5TT0A 1UAGA 2BLLA 3GAZA 1ZCJA 2LDXA 4MVJH 2NSDA 1V35A 2ZTLA 2EGGA 1WNTA 4EEXA 1UH5A 4EJMA 3DBHB 1UDBA 3GZNB 3CMCO 1HTBA 2W2LD 4WLEA 4XB1A 3W4IA 2EF1A 4YQZA 3HB5X 4RQUA 1FMCA 1UXKA 2BI7A 4Q3CA 4F6LA 3WTCA 1GL3A 4GGOA 1ULUA 3ULKA 2EHDA 2Q46A 1EUCA 4J1NA 4XQCA 3GUCA 4W7HA 5IAAA 5G4KB 4Z6KA 1PEDA 3H3JA 1F0YA 5DOVA 1WVGA 4KUGA 1KYQA 3HSKA 3JQ6A 2O3JA 1U28A 1ZJYA 2VT2A 4WUVA 3F9IA 4FS3A 4RDHA 1LTHR 4K6CA 1XSEA 3A1NA 3OIFA 4D7AA 2W90A 5L4NA 1YB1A 1SZJG 3DZHA 3FTPA 4LN1A 1DDOA 1MXHA 4NJMA 3WWZA 3MZ0A 2X9GA 5G0UA 2H1SA 4BO0A 2OXIA 4ZN6A 1U1IA 1VKOA 5GMOA 2LDBA 3KSZO 3UXYA 3WJAA 3LT4A 3RKUA 5F3RA 3WBFA 3E9NA 2TMDA 2DC1A 4PG4A 1DIRA 2HMTA 1ZEJA 1V3VA 3QVWA 3V2HA 3M2TA 3F1LA 2HRZA 4GX0A 1RM3A 1YH3A 3PHJA 3H9UA 4N54A 1F17A 2C07A 3ROMA 4BMNA 1E3EA 3F6YA 4BOYA 1ZK4A 2G1UA 2I66A 3ICPA 5EPOA 4XX0A 5A9SA 1GUYA 1R4NA 3U0BA 2J3HA 2I67A 2FR1A 1V9LA 3WNVA 4E5KA 4RVUA 3OJFA 5CEEA 1IHXA 2AEMA 2HK8A 2D5CA 3K73O 4E5NA 1E6UA 1BMDA 5T8KC 5KJ6A 2GCGA 3KTDA 4HNHA 4L0QA 3ZNPA 3TL3A 5EQFA 2C82A 3DC2A 1HLPA 3DOOA 4A73A 5JFOA 1SC6A 1IUKA 4ZA2A 3RUDA 2GASA 4D3SA 4N5MA 4HXYA 1GCUA 4E5YA 1K2WA 4QFDA 4EW6A 4A03A 2QW8A 2YJZA 1ADBA 5ILGA 2P9CA 5A5EA 3F3SA 4P4LA 3ZU5A 1T2AA 2JD1A 4ND5A 1N8KA 3Q2KA 1DHTA 3WYCA 2ZIZA 3F1KA 3TOZA 2IXAA 1T25A 4CM9D 4NFYA 4R51A 4FFPA 2B4RO 2IE0A 3ZU3A 3B20A 2WD8A 1ONNA 2FMUA 4R1TA 4OGWA 4I08A 4RPHA 5A04A 3CKYA 1PIWA 2QIOA 1S6YA 3ZNQA 1PTJA 2PZJA 2X0IA 4TWRA 4W99A 1XLTA 4GBJA 4HV4A 2GF2A 4KWIA 2HKIA 2OMEA 3OMLA 3U09A 2WTBA 4XRGA 1H6CA 1UZLA 3WOHA 2AEJA 5L4LA 1E7MA 3DDNA 1CDOA 3F5SA 1A4UA 4I9NA 1MC5A 4WOJA 3OA0A 2Q1UA 4R1UA 4BNHA 5F21A 1N7HA 3DZJA 4EJ0A 5JDCA 3OECA 2OO5A 1GCOA 3MJVA 2VRCA 5G0WA 3SBOA 4R1NA 4CV0A 1Y8QB 3WTBA 4CL3A 3H6KA 4IDBA 4YR9A 3D1LA 1XU9A 3BTUA 5I7FA 3RI3A 3ZWNA 2EKLA 1FDWA 4CUJA 3FTNA 2Z5LA 2EW2A 4MVJP 1ZK3A 1D8AA 4CMAA 3CTMA 1NPYA 4B4UA 5JE8A 4BNLA 4CMBA 2OP0A 3V1UA 1EUZA 4J1QA 4MIEA 4PLVA 3KEQA 4ALJA 1MUUA 1YO6A 2D0IA 3U49A 1PJTA 4N7RA 2H6EA 3KLMX 3E48A 1BWSA 4D3FA 2FSSA 3JYOA 3PZRA 4HFJA 3FBGA 1LSUA 2CF6A 3DHNA 1XWFA 4NMHA 4GX2A 5TX7A 1PR9A 4JK3A 2NVWA 2Q50A 2XAAA 3V2GA 5MDHA 1GTMA 2BFPA 3JYLA 4FGWA 1QG6A 1DFIA 4ZJUA 3M1LA 2AMFA 3PDUA 2DAPA 4HFRA 4PGFA 5L7YA 2ZKLA 1HKUA 4IJVA 4BGUA 4OXYA 3ZWMA 1E3WB 3HJAA 3WLFA 5CG2A 5I7EA 1I3MA 4FB5A 1P1IA 1E3LA 3MCVA 3Q9UA 5EESA 1XKQA 4MINA 4J2OA 1OC2A 2NADA 4CR6A 3GVXA 4J1SA 3O38A 1B8UA 2ET6A 1JW9B 2JD0A 4ND2A 4CM4A 5G0VA 3WGQA 5L45A 1P74A 2IZ0A 1F8GA 4J49A 1UZMA 2X0NA 1VL8A 3LK7A 1B16A 4RGBA 5JAQA 4UEOA 5U4QA 4WKGA 3RJ5A 2G82A 1V3UA 4MP3A 3MOGA 3PLNA 3VZRA 5BT9A 4PG5A 3C3XA 1SAYA 4Y6PA 1ZFNA 3S2EA 4J1TA 5BNFA 3VVCA 1WAMA 1WDKA 4M8SA 1DAOA 4BKUA 3WSVA 2BMAA 4FN4A 1XA0A 2AQIA 3ZWVA 3DBLA 1TT5B 2GN9A 1L1FA 4IDAA 1DB3A 2VWQA 3GDGA 3PWSA 4EZBA 1MG5A 3JTMA 4L74A 5CDYA 2GUGA 3HNPA 4HKTA 2P68A 4CMJA 3IP1A 3ZW8A 4YAEA 3UFXA 3W8FA 3FPLA 3C7AA 1SEPA 5AYVA 2P5YA 2Q1WA 3CSDA 1Y9EA 3BHIA 3K6JA 5H83A 3WGIA 3DR3A 1JN0A 4M89A 4CL8A 2AE1A 4XGIA 3PYXA 4L8VA 2DTDA 3ZHBA 1U4OA 2EERA 3GZ4A 3B6ZA 4J3FA 3X2EA 2VYND 4K9DA 2B83A 2H9IA 3GFBA 3UGKA 4I5GA 1P45A 4NPCA 4NU5A 4IQ8A 3FF4A 3EDMA 3D5TA 1ISFA 4CMHA 4UVHA 4L9RA 1C0IA 1R0SA 1X7GA 2ZTMA 4I9HA 5DT9A 3HZZA 1CF2O 3G0OA 4NH4A 3OHSX 1B14A 4BNFA 1PJBA 2E4AA 2NQ8A 4TZTA 4Y98A 2IDZA 2C7VA 1LX6A 1U3VA 4NR0A 5DN9A 1G1AA 2PGLA 4WEOA 4PFJA 2WM3A 3JQCA 4IDCA 3PQEA 5A03A 4AJ2A 4CLEA 1UXIA 2A92A 5TT1A 5MGBA 2Y0EA 3MTGA 3VKVA 4CPDA 5U9CA 3ZW9A 1E3SA 1AGNA 1P0FA 3VPHA 2EJWA 2WE7A 4XQ9A 5FEUA 2PZLA 5I7SA 1V6AA 4TROA 4UVDA 4BGIA 3L9WA 3NRCA 1R12A 4EUEA 5L7WA 1P1JA 4WCFA 4CQMB 1LU9A 2NU8A 4RPLA 2JD2A 4MKRA 1AHIA 3F4LA 1LDYA 5F1PA 1LQUA 3PK0A 4BNKA 4QEDA 1E7SA 4D41A 2YY7A 2V6FA 1DRWA 4GSKA 2CSUA 3SLKA 5K6AC 3COSA 1Z7EA 2C29D 4YXFA 1EQUA 5CP8A 3GF4A 2W8ZA 3N74A 4QT0A 4A10A 4BKRA 3QWFA 1LUAA 2PV7A 1BDBA 1N9GB 3GLQA 3VHRA 3MJ4A 1P77A 4AFNA 3BTOA 3W4KA 3VH2A 4CV2A 1NQTA 3S55A 3DOJA 3JD4A 1SO8A 2O3QA 3N7UA 4Z0HO 3U4DA 1NFQA 3GVIA 3QWHA 1WMBA 1LLCA 2WYVA 3DMYA 3ZWCA 2VWGA 3AJRA 3I9JA 2WYWA 4GVXA 3DFZA 1SB9A 3H9EO 3FNEA 1T4DA 4XGNA 2PKRA 1I2CA 2PD6A 4D45A 4YT8A 2GZ1A 3IKTA 1WZIA 4ONEA 1I30A 1XG5A 4JJIA 1H0KA 4XDYA 2EEZA 1T2FA 1KY5A 3PZBA 5CFZA 1RM4A 1LC3A 4HWKA 1KVSA 2NM0A 2Z95A 4BHTA 1NVGA 3IS3A 2QRKA 2NVUB 4J4TA 4UAGA 3ROPA 4MP8A 2P9EA 5JBIA 2RH8A 1ADCA 3INRA 3Q3CA 1AXEA 2J8ZA 5ER9A 1FK8A 5LDGA 4ZQFA 4A7PA 2AG8A 1JU9A 1X1TA 4B8WA 4PZEA 4DL9A 5KVSA 1A7AA 3DBHA 1Q7BA 3GZNA 3R6DA 1U8XX 5KVVA 4XYGA 1K5HA 2HUNA 4E2ZA 2F1KA 5CPBA 4D43A 4G65A 3DB2A 4OKNA 3ANNA 3L4BC 1HWYA 2CMDA 3QWIA 2GERA 1EFKA 2W98A 1H94A 1M6WA 1IE3A 3EMKA 1DLIA 4QXMA 4BKOA 3E1KA 3CMMA 1KBZA 4GKVA 5JPIA 3U5TA 1OC4A 4E4YA 1JVBA 2Y1CA 3PYMA 4JROA 1P1FA 2Y67A 2F00A 3VPFA 4TSKA 2UYYA 3ADPA 4C4OA 3CZMA 1EDZA 1SEVA 1Y1PA 2BELA 3GVPA 4XIYA 4LSWA 3LZ6A 2WD7B 1UR5A 3JQAB 4J43A 1H6DA 4WCDA 1YRLA 4IQGA 4NBVA 4O6VA 4U8GA 3RC7A 2A94A 2X5JO 5I9NA 3M6IA 5ITVA 1JAXA 1QYVA 3KM0A 1IY8A 1IPFA 3TZKA 1OFGA 1NX6A 1ZVMA 2ZB8A 2FSVA 4R5MA 2WWRA 5TRTA 4DQVA 3ONDA 4IMPA 4U6SA 1PL7A 1U7HA 1ZXBA 1PS0A 4J16A 3WGTA 2JFHA 5F5LA 3ON5A 3I5MA 1I33A 4RVHA 5FWNA 1YQDA 4RCVA 4JLWA 4D79A 3TL2A 1QYWA 3MJEA 5BSFA 2OGUA 3GDOA 1LLDA 4B7XA 4Q3AA 4TVOA 4E2WA 2AE2A 2CDBA 2DLDA 4XB2A 1KC1A 2PH3A 2C20A 3PXXA 2FHSA 1JKIA 4PG8A 1XIVA 1VL0A 1KEUA 2Y0CA 1W6UA 4FD3A 3ZV4A 3JD0A 4BKPA 1LDGA 1AN9A 3E5RA 3FR7A 3P5SA 4CV3A 3SLGA 2HAEA 4BNWA 1E6WA 2DPHA 3AY6A 1Q7GA 1TI7A 5TSDA 4E2YA 3C8MA 1Y9AA 3WIDA 1C0PA 4PRLA 3GRKA 4DIBA 1R4MA 1O94A 1U2DA 2VN8A 4GX1A 4TVBA 2X23A 3LC2O 2Z1MA 4ZICA 1P31A 3AW9A 1XELA 1PR3A 5JC8A 1DC3A 2BGLA 3RBXA 2VTEA 1NVTA 4PVDA 2BFOA 1CERA 3A14A 2ZYGA 4BO1A 1HDOA 2O4CA 2BRUA 5JYEA 3PTZA 2QX7A 4YB8A 4A5OA 1Z6ZA 3BMNB 5AOVA 2HK7A 3C1AA 1ZO8A 3KBOA 3RC2A 1W8DA 1EQ2A 2R2GA 3Q11A 3HN2A 3UHAA 4YJHB 4GSLA 3GRPA 1CJCA 4YRAA 2YFHA 1X14A 3HDHA 1I2BA 3P2YA 4NK4A 3I9NA 3TNLA 4ALIA 5I8WA 2X5KO 5C3MA 2E49A 1GPDG 1T26A 3GGOA 3Q1LA 3DOCA 4QECA 2Q2QA 1ENZA 1QR6A 3BXXA 3ABIA 2BF7A 3LYLA 1YOVB 4O5OA 3FR8A 1J6UA 1YJQA 4IGEA 4PZCA 3I9MA 5JS6A 2FPGA 3LLSA 2DTXA 1Z74A 2J3KA 2ZCVA 3KYCB 2EWMA 4I8XA 4KUEA 4NJOA 4AJKA 2VTDA 3DZKA 4B7CA 1C3VA 3PIDA 1PJ2A 3CH6A 1UXJA 4ZGWA 1E7WA 4I5EA 2NTJA 1EZ4A 3G17A 3A28A 2ZJ0A 1Y8RA 2PGJA 5TS3A 2P5UA 3EAGA 2CD9A 4PRKA 5A5FA 8ADHA 1AUPA 1E1LA 1Y8QA 2VHYA 3DBRB 3GUYA 2EKQA 3PQDA 5JSFA 2X58A 5A02A 1JTVA 4GH5A 2X86A 4P8RA 1NVMB 3M2PA 4FFLA 1I10A 3RROA 3PIIA 1PGNA 1I36A 5JDIA 1DRVA 1GEEA 1R66A 2JAHA 1T24A 2UVDA 2IZZA 3HWRA 4BNVA 4FSHA 4NQZA 1Y6JA 1QYXA 2C2YA 5LC1A 4QO7A 2YV2A 4C7KA 4QTZA 3WBBA 1ZEMA 4J0EA 1YS4A 3PYLA 4II3A 2JL1A 3QRWA 3MEQA 3E82A 3NDJA 3B1JA 4YJGB 3WB9A 1NTOA 4DQXA 4E33A 2JHFA 3DO5A 4KUHA 2VNSA 4UEJA 1DFHA 1KOLA 3ST7A 1P1RA 4BB5A 3G79A 3ZHXA 1UDCA 5ADHA 4R01A 3K8ZA 1PS9A 4B8ZA 1YQGA 3LQFA 3DHYA 1E3WA 3O26A 4FJ2A 3OSUA 3VAZA 1IZ0A 2GO1A 1Q0LA 3ZNNA 4W6ZA 1LJ8A 2DVMA 2YV3A 3H7AA 3IJRA 4CM8B 4XD2A 4PLHA 4TKLA 4CLRA 1KVTA 1XEAA 3DFUA 4NI5A 1I01A 3NEPX 1FDUA 2GZ3A 3LF1A 3I9OA 2HLPA 3RFVA 4RQTA 3ZWXA 9LDBA 2WYUA 3V5NA 1VI2A 4ZQGA 4E13A 3T4EA 4RL6A 3QLJA 1R0LA 3O8QB 4GMFA 1HSZA 1P0CA 1LRKA 2G17A 3UAGA 2RAFA 2ZK7A 1A27A 4IXTA 1HDXA 1BXGA 4FFRA 4R3NA 2JCYA 4U5QA 4D46A 4BO7A 4MDHA 4LVUA 3EZLA 5EINA 2AQKA 3I23A 2VQ3A 1FJHA 1H9BA 3B1FA 3OM9A 4RF2A 3ZDFA 4BL5A 2Y1EA 5ILOA 4QSMA 4A27A 1U3WA 1EVYA 4OHUA 1YL6A 1HSOA 1M6HA 3OEYA 4TRMA 4GKBA 5CDSA 2OFPA 2VOJA 1DRUA 2FWMX 3CEAA 4O0LA 3AM5A 4M87A 3QP9A 3DZIA 5LDHA 4TRJA 2Q1SA 2AW5A 1QYDA 4GWKA 4IIVA 4TZKA 1TVEA 3BIOA 3GVCA 1E6EA 2EP7A 5IJZA 1B2LA 4CMIB 4PLPA 5JYDA 4FOOA 2PFGA 3O9ZA 1C1XB 4DIFA 4EEZA 5CG1A 4FPXA 4LSMA 2ZB3A 4AJPA 5JAIA 2ZJ1A 3KLPX 4IY1A 5L3ZA 2X0JA 4EITA 2GN8A 1LLQA 1F8FA 3NDIA 3RKRA 5ICSA 4ROSA 4KMSA 2HJSA 1HYGA 1QXSA 5KIAA 4NK5A 1MP0A 5B4VA 3E5MA 5KVQA 2O7QA 1T2EA 5U1PA 3GC6A 4AJLA 1DIHA 3U4IA 3FNFA 2AEFA 3DZGA 2YQ4A 3OF2A 4OOEA 4YAJA 4Q3DA 4YA6A 1T1SA 2PTGA 1YL7A 1X7DA 5C7LO 3HADA 4AVYA 1O9BA 4AL4A 5G2OA 1DC5A 1XQ1A 2D5AA 2O4UX 3WJ7A 2B4QA 3R3JA 2WE8A 1V0JA 2AXQA 3QVOA 2DKNA 4BO8A 2CVZA 1GADO 2GYYA 2P91A 4XDZA 3VKUA 4OQZA 1XHLA 2BI8A 4RZHA 1LA2A 4ND3A 2QZZA 4IMRA 1F12A 4XQGA 1IYZA 2AA3A 2GR9A 1DEHA 2VCYA 3IAHA 1SNYA 4CQMA 1VSUA 3UKOA 4PLZA 4GAEA 1K6JA 3DL2A 1ZMTA 1ISIA 1ADGA 5DP1A 3FNGA 2NU9A 3JV7A 4W7IA 3NTOA 4UVEA 3F5QA 2QYSA 5DF1A 4TRNA 1DLJA 5KWEA 4Z0TA 5AQ1A 3R1IA 3DMTA 4EGFA 5DBIA 2BFAA 1B3BA 1N9GA 3IQDB 2I3GA 4Z9XA 1NR1A 3IIEA 2PA3A 3AUSA 2CY0A 3GHYA 2EP5A 5KVCA 3IMFA 4MVJA 3UOGA 6ADHA 1GYRA 3WYBA 3JQ8A 3HUDA 2JFFA 4IS3A 1SCUA 3ZN2A 1E5QA 1NP3A 1ZW1A 1NASA 4OL9A 5BQFA 3AU8A 3LT1A 2HK9A 5TNXA 2NWQA 4JP3A 5KOIA 1H5QA 1XCBA 1TXGA 1XU7A 3G3EA 4UUNA 4YWJA 4OSOA 2DBRA 1E92A 3EZYA 3VZSA 3GY0A 1YXMA 2X5OA 3NJ4A 1L7EA 4P4GA 4YT2A 5ER6A 2X8LA 1FDSA 4XQEA 1PL8A 4DQUA 1QV7A 4BO3A 4E5MA 3PWZA 1RKXA 2O2SA 1MC4A 1YB5A 3EVNA 4MKZA 1G0NA 5L53A 1HEUA 1U9JA 2HRBA 1H6AA 1IZ9A 3T7CA 2GPTA 1R37A 4KQWA 1CEQA 5L95A 2XPCA 3U4HA 4CM7A 5I9LA 1YVEI 1ID1A 3GNQA 1VE9A 1GUFA 3FSRA 3ADOA 4RVDA 3I4CA 4ZRNA 3JQFA 5BSGA 1DC6A 5DBFA 4R54A 1QLJA 3C7DB 1MFPA 3MOIA 3PVZA 3KB6A 1PSDA 3F47A 1GQYA 2CDCA 2PZKA 3KEOA 3NYWA 3GK3A 1UZNA 3GVHA 3L6EA 4BB6A 4JP2A 2Y93A 4LVCA 2X0RA 3RUCA 3ENKA 4WK6A 3L6DA 4J90A 1GEGA 1GU7A 2I5PO 5T5QA 4RLHA 2I65A 4CODB 3PEFA 1Z73A 2ZYDA 4CMEA 1E7QA 4P38A 2O3RA 5TJ9A 1I3NA 3OBBA 3ANLA 2AQHA 1SB8A 3WQRA 3MJTA 2GSDA 3Q2IA 2D1YA 2OHXA 1WLYA 2VUUA 4E0BA 3HHPA 3QA9A 1NR7A 4PLFA 5TLSA 2CVOA 3EHEA 4AJEA 1GZ4A 4KQXA 1E7YA 3JQ7B 2VZ8A 4PLWA 2C5AA 1CETA 1E7RA 1DSSG 1EBUA 2VWHA 4NG5A 1ZJZA 3ETDA 4FCCA 5K0ZA 4XGKA 3WXBA 4YPOA 3HB4X 3K9QO 4DLAA 1BSVA 4J7XA 1Q0HA 4R68A 4AJIA 3GGPA 4IDDA 1ZK1A 4PLGA 4ID9A 4NBWA 3CZRA 4DLBA 1U8FO 1PGOA 5BSHA 5JXWA 1RM0A 5IDYA 5JO0A 4RDIA 3KRTA 4FOSA 4CQLA 3ZCXA 2Y05A 2E48A 5LCXA 4KDEA 1ARZA 3QV1A 2DBZA 2OUIA 5JDCC 3BMOA 1PJLA 2PD3A 4GLLA 5A3JA 1GD1O 1YDEA 1GZ6A 4DMLA 4BQPA 1O0SA 3DZFA 1A71A 1X0VA 5CDTA 2UUOA 2JCXA 1I2ZA 4P22A 4IDEA 4YT5A 3TF5A 3DEYX 4S3MA 2FP4A 5DZSA 3AUAA 4M55A 2JKVA 5ICMA 1X15A 5EMHA 1ZZEA 1I32A 1WP4A 1LDMA 2JHGA 4GI2A 3JD2A 4NJMB 1KS9A 3RFXA 2O48X 2Q2VA 4BNJA 4IIUA 4OIMA 3AK4A 3VTZA 3ZWAA 2HMVA 3PPIA 1NPTO 4KP7A 1T1RA 2G76A 3IC5A 4L73A 1NWCA 1TEHA 2VT3A 2PK3A 5HBRA 4A26A 1XQ6A 3GN1A 3SEFA 3X2FA 4AJOA 4J6FA 4CM6A 4AJJA 5A05A 3DXFA 2E37A 3TJRA 4FBGA 3P7MA 2YHIB 4LMPA 1DO8A 3OICA 2PNFA 1YGYA 4PZDA 4QFCA 4A0SA 3BMCB 4E3ZA 4OH1A 1NBOA 4F45A 5IN4A 3TOXA 2ZTVA 3KO8A 1SBYA 4YJFA 3VDQA 1IOLA 2VYVA 2P9GA 2QRJA 2RIRA 1NQOA 3G1UA 3AFNA 3L9XA 4I5DA 4MIYA 3AFMA 1D1TA 2QYTA 1RYDA 1LC0A 3V1YA 1Y81A 3U62A 1BHSA 2FPIA 1R0KA 2FZEA 3H2SA 1FDTA 5BSEA 2X4GA 2YDXA 3A06A 2EV9A 2X9NA 3DBRA 1VJTA 3RUFA 1H2HA 2OBYA 2BH9A 1O95A 4TQGA 4LRSB 4YEDA 3PLRA 4BNMA 1OI7A 5C7IO 1X13A 2B5VA 3D3EA 3ZNOA 5HM8A 1CYDA 4JQCA 4TKMA 2WJPA 3E03A 4IZHA 4L4SA 2J5KA 2Y1FA 4HY3A 4EI2A 2HDHA 4Y6RA 4WOKA 2NTNA 1JQBA 4IGFA 1LDNA 1VJ0A 2HMSA 4ZU3A 2W4QA 4GLOA 1M2WA 2CF5A 5F1OA 1PQWA 2FR0A 3WSWA 1ZSNA 2BHLA 4DPMA 1PU2A 3C1OA 5T57A 3TN7A 1ZUD1 4PLTA 1U2GA 4RF3A 4YJGA 2H5LA 4BGVA 4RF4A 2UV8A 1C1DA 1ONPA 2OOSA 3D7LA 1GQQA 1D1SA 3HG7A 3KUXA 3EYWA 1SOWA 1U4SA 1N2SA 1NFFA 2Q99A 3LF2A 1NQAO 4NU6A 2QQ5A 4WEQA 2O23A 1HDCA 2PKQO 1DOHA 2BD0A 6LDHA 1HL3A 5KKCA 3BHJA 1QP8A 4GGPA 4YJDA 3M1AA 1EDOA 1PGJA 8LDHA 4CM8A 2ZQYA 1TLTA 3TPCA 4CMKA 1ISGA 1OZAA 1K6IA 1AXGA 1BG6A 1UDAA 2AHRA 3VZQA 3GQVA 5L4SA 1T4BA 4J9VA 5KNLA 5FI3A 5IDQA 1ISJA 5JAMA 1ZSVA 3FHLA 3PP8A 2DBVO 5I7VA 3AWDA 3O8QA 2D2IA 3GMDA 3O03A 5HS6A 3H5AA 3MWDB 2X9VA 3QVTA 2VRCD 4J0FA 4TRRA 1GDHA 2DFDA 3CPSA 1W0CA 1E5LA 3LDHA 2Y1DA 5K9ZA 5G4KA 5IDWA 3ZGYA 2ZB7A 1HE5A 2O3TA 2Q2WA 1DJQA 2UUPA 4YAKA 1NYTA 3H8VA 4JXKA 3V8BA 4M86A 1XYGA 2OP1A 4ND4A 3FRJA 5BR7A 1MG0A 4DREA 4WGGA 5T67A 3FNHA 4F6CA 2Q4BA 5G0TA 3W6ZA 5B4TA 1JDJA 3BMQB 4IJUA 1PJ3A 4M1QA 3AUTA 3U4CA 4WCFC 2YV1A 3NDRA 3PJEA 4B4VA 3INTA 5JC1A 2DFVA 1HETA 1RYEA 1J0XO 5DDIP 1HDZA 2DTEA 4CMIA 3BAZA 5JY6A 4AICA 3QVXA 5TGDA 3KZVA 2DBQA 3E6AA 4K28A 4RLSA 1VJ1A 4BNTA 1JAYA 4YVFA 1HYHA 3C24A 3ASUA 3RASA 4BNGA 1CIVA 4OKIA 3VC7A 3TZQA 3I6QA 4OXNA 2B35A 3GG2A 3AOEA 5HTOA 3WX0A 1XGKA 4GWGA 4JJFA 1ZSYA 1NWHA 2C0CA 2FPPA 3VPSA 4IDFA 3WICA 2EKPA 4EUFA 1NPDA 5DCWA 3E9QA 3PHHA 5HA5A 1B7GO 2D4AA 1RWBA 4DA9A 1FDVA 3BZUA 1A9YA 3KV3O 3CE6A 3SXPA 1PJQA 3D4OA 3NT4A 4JCOA 3GAFA 1B26A 3RD5A 2QRLA 3UW3A 3G49A 3LVFO 2WDZA 3AI1A 1VLLA 4WE3A 5KTKA 4ZQHA 4Z3DA 4LMRA 3KSUA 4CM9A 3LU1A 3TZCA 2Q49A 1PQUA 3IUPA 1FXSA 1GZ3A 3S2GA 1KC3A 4RVGA 1JKJA 4DYDA 5CPFA 3DBLB 1PS8A 5KJEA 1IPEA 3AM3A 4HFNA 2ZB4A 3W4JA 2O3SA 5IFLA 4BNIA 3ASVA 4S1VA 3ORFA 1VC2A 4KZPA 5DULA 5BNIA 2R6JA 1WWKA 3IOYA 5GY7A 3RIHA 4DVJA 3STHA 4FJ0A 1LEHA 2I76A 4IPTA 3B70A 4QUKA 1L7DA 1D7OA 3DTTA 3SX2A 5L7TA 4LCJA 1I5RA 1G0OA 2E6UX 2ZYAA 4XRRA 3RC9A 1JA9A 4J7CA 3WGOA 2VOEA 2EW8A 1T2DA 3P2OA 2Q1TA 1Y5MA 4UULA 1CQJA 4NIMA 5F1KA 3RU7A 1KERA 4YT4A 3OEWA 4FFNA 3RUAA 1CQIA 4W9NA 1K0UA 4D0RA 2HMWA 1A5ZA 1NHWA 2FOIA 2EJVA 5DBGA 4CV1A 1ZMOA 5CAEA 1U7TA 1SPXA 2X22A 1QRRA 3INGA 2PY6A 4F46A 2X1HA 4YTEA 3JYQA 5AXBA 2GN4A 3RSHA 4BV9A 1A9ZA 3GA0A 4N5NA 4U0JA 3VPGA 4AJHA 4UUPA 7ADHA 3UICA 3ONFA 3RC1A 1BRMA 1NM5A 3D3WB 1GY8A 1ZK2A 1P1KA 2NU7A 3QJ5A 4MVJG 2BGMA 4B3JA 4CLOB 4MVJI 2DT5A 3RUEA 4YYZA 5L51A 3ITKA 1EK5A 5ITWA 2J3JA 2RHRA 4ZRMA 4JJGA 3AOEC 3OJOA 1X0XA 4ND1A 1DIGA 3UCEA 4BV8A 1KEWA 2NLOA 1JLLA 3HQ4O 3I1JA 4N18A 4X54A 5CHEA 3QWBA 3AM4A 1VL6A 3GEMA 4PCVA 4MIOA 4K26A 2FN7A 2DUUA 2V6MA 2QHXA 4XWYA 1LRJA 2GGSA 5B4UA 4RZIA 3OJEA 1ENOA 2DM6A 3E9MA 4PG7A 1C0LA 4WASA 9LDTA 3RVDA 2AG5A 3LT2A 3OA2A 3H9GA 4AJNA 1PX0A 1GQ2A 1LXCA 2IODA 4NNJA 2NACA 4MOWA 4RF5A 4E6PA 1H93A 4BNZA 5J23A 5AVOA 1KVQA 1U3TA 5THQA 1I0ZA 3D4NA 1DFGA 4BMVA 2RHCA 1O8CA 3H5NA 5IXSA 4RVSA 3PQFA 4YDRA 4RV9A 2JCVA 3KXDA 2TMGA 3SJUA 4E2XA 3P19A 2YFQA 4D44A 1YL5A 3FN4A 2J6IA 4H7PA 2UDPA 5FFFA 5KJCA 1MXFA 3DAPA 4R69A 2GDZA 3DBVO 4GL4A 1LLUA 1LNQA 2IRWA 4U0KA 2HSDA 3JQ7A 5TF4A 4MO2A 5JCXA 1E77A 2A35A 4D42A 3TFQA 5JY1A 1D4FA 4KTVE 2POQX 1J4AA 4R5HA 2ZQZA 1YJ8A 3NTQA 2PWZA 1RPNA 5EJ2A 3TZ6A 2A4KA 4IXWA 3WQSB 3KYDB 4J9UE 2PGDA 3NJ8A 3LLVA 3OQ6A 1UJMA 2YQ5A 2YW9A 4DXHA 3GR6A 1QSGA 1TT5A 1ORRA 1E0DA 4W9NC 1B3RA 3OP4A 4UEKA 1MLDA 3CINA 1P44A 1UAYA 1W4ZA 2VYNA 5AXDA 2NTVA 1GYQA 4ALLA 4EUHA 1P9LA 1BXKA 3F4BA 3ZI0A 1JKFA 2YDYA 4L75A 4G5HA 4RO0A 1ONOA 5JAZA 3GEGA 3PJFA 3JQGB 4PIVA 3NV9A 4XCVA 4ALMA 1GAEO 2Y0DA 4XIJA 5ES3A 4DTIA 1PQPA 3K92A 5JDIC 3PWKA 4OO3A 3RUHA 1O89A 3EC7A 1LSJA 2O50A 4E30A 3I83A 5EL0A 1MV8A 4DIOA 4IDGA 1PZEA 2HQ1A 2ZCUA 1K3TA 1QYCA 3G1TA 3I52A 1GR0A 4BO5A 4UUOA 3GDFA 4HADA 3H65A 3TFOA
chains in the Genus database with same CATH superfamily
1YUBA 2QN8A 3HVRA 1KVUA 4HAOA 3H86A 3FVVA 5LUAA 3GGGA 3U44A 3GT0A 2W2KB 4KR7A 1UXOA 3QG5A 2P4HX 2F67A 2C2XA 3QQPA 3QY0A 3N2KB 4UCWA 4CR8A 4TUYF 2I4TA 3BGDA 4XKJA 3UW1A 1E1MA 5J2UA 4F0JA 2A1SA 1U6KA 1T4CB 4DV0H 1Q16A 4TQUS 1PK8A 2IYSA 4UKDA 3SU8A 2DJIA 1WF6A 5BSVA 2PA0A 3QXHA 5CTJA 4CJXA 2WUGA 3LOUA 3ELBA 1DG1G 2O7VA 3LC1O 5IVHA 3VTFA 3CA8A 1Q74A 1GFSA 1XPOA 3ZHSA 3IGFA 1M67A 3REGA 3RAJA 4F6RB 2NYUA 1XNGA 2XQFA 3MBKA 4G5GA 5ALVA 2C57A 1RBQA 1B0UA 3ITDA 5FTKA 1AO0A 4KQ6A 2NPFA 3EJWA 3FYDA 2ECOA 4OXQA 3FCXA 4B7UA 4GRDA 2F90A 4DWVA 2J5RA 2VWPA 3UT6A 1VG8A 2G4LA 2VC2B 2VNAA 1XE3A 3JRNA 4HDQB 3B9QA 5JZ9A 3LLMA 3PHIA 3OTOH 3BDVA 1K98A 1OYVA 5DP2A 4EHNA 4BXOB 1CHNA 2VDLB 5ERGB 2OK8A 3VJRA 4ARZA 1IVNA 4KIWA 5T4BA 1XD2B 3CZCA 3OFVA 3VYVA 2J3MA 4GRAA 2HGZA 2NUAA 3WMWA 4E5VA 4UARA 3H11A 4II2A 1SCDA 5EQDA 4B8CD 3SOZA 4G0MA 1EFVB 4MPDA 5A71A 1XTKA 2D13A 1C3LA 1BU5A 1T8PA 2IYNA 3DAGA 4GMGA 4ZT3A 4YCCA 1ZR4A 3E58A 3ZHZA 1Y3CE 3KCNA 3VBCA 4ZI7A 3AI3A 1T9KA 1KQGA 4XEHA 1GGFA 4QUHA 2PUCA 5I48A 1UXGA 3CR3C 1UXHA 3CUKA 4HTFB 2KW5A 1MZVA 2A9FA 3M1YA 1ORIA 5I8PA 5HJ7A 1VKZA 2XUOA 1FTQA 1FB5A 1HMPA 1SXIA 2A2ZA 3GJ6A 1II0A 1J49A 1I8TA 1KO4A 1QFZA 3RS3A 5IJ0B 3AI7A 1Z38A 2FNAA 2GZMA 1P2SA 1YNSA 4R8MA 4QBIA 4EECA 1KI8A 3ESYA 3B1KA 2H92A 4JC5A 2A5GA 2ORWA 4I1VA 3ROQA 5CB8A 1PZHA 1VE1A 2XOXA 3X1WA 4BEWA 3SKYA 4OSPA 4UNPA 1R10A 4X66H 2FRDA 1Y3FE 5EP4A 3L7LA 4BLUA 2WAYA 2UU9H 3KSRA 1M0TA 1Z8FA 1Y8RB 3N0WA 4UHCA 3TR6A 3WWYA 1VRCA 5CNKA 3ZVMA 4A0HA 2XUJA 3LGAA 5LQAA 3D4PA 4WZBE 1VG1A 4ENVA 3M6MD 1N6RA 2X0EA 1ISRA 5DNCA 1P3JA 3KJQA 1REQB 5DV9A 2J4CA 1ODCA 1OLUA 4W7SA 4AS3A 1ACLA 1Y9DA 3UXEA 3WAJA 2OB1A 3JAKB 2O2YA 2X6TA 2ZJ2A 1TQ8A 1VFNA 4C1BA 2Z8YA 3M0EA 4CLDA 3T4XA 3KWFA 4Q66C 2OV1A 1JQLB 4NULA 1YZKA 1SOVA 4GI5A 4AO7A 3NNDA 4CE6A 2JATA 3T61A 4R1SA 4XVCA 1A9PA 1XZBA 2XEXA 2XAUA 4ND8B 3WL5A 1OZFA 3NHKA 4KSYA 4DBZA 1KETA 4YRSA 2RHTA 1KAMA 1DELA 1KXJA 2J48A 2O0MA 2GA8A 3EDCA 3MGBA 3V7UA 2A7QA 1G6KA 3A1EA 1Z7BA 4ZTUB 1XAIA 2WU4A 5K0BA 2WUWE 3RK4A 3AR8A 2QRPA 2DWCA 3UH0A 4DQDA 1J5PA 1FNMA 2FJ0A 1NVUQ 3NLLA 5DRTA 3R8CA 3JQAA 4Z1MD 2B94A 1L6IA 1QYRA 2CV1A 2H4WA 3HKEB 1XALA 5B53A 2JVZA 2C1ZA 4PBTA 3DDOA 2CE2X 2HSEA 2MMCA 4P54A 3KDAA 3EMBA 4LW8A 2OBNA 1E2GA 1XTTA 2NU6B 1RXUA 4TMFA 1QKKA 3ZD8A 3FI9A 5DI9A 1J5EB 1NUTA 1W1UA 1Z9BA 5JCOC 2V98A 3CR7A 1CRWG 4A2QA 2A9JA 4CLRB 1YONA 1JLHA 2V6JA 3NHAA 1L1QA 3UANA 5KAMA 2GZDA 3OOJA 2DETA 2G0TA 3COPA 4RZ2A 2PUTA 3HN6A 3QBDA 5AMXA 5FR2A 2QX8A 1E8MA 3U81A 13PKA 1BD3A 3JQ9A 4PQEA 5EIBC 5K6AA 2BTQA 3BIFA 3OCCA 1H8HD 1W1IA 5CDUA 4ERXA 3ZZ1A 1TA4A 1BVRA 4YIHA 4WLNA 1A8SA 3E7XA 5F3WB 1QP4A 4QBFA 2OORC 1UINA 3ND9A 4BLVA 4DLKA 1E20A 3W8RA 1EUCB 1GTG1 3EVEA 2Z43A 3IMGA 4LZWA 5FAXA 1SIWA 1Z83A 3D6NB 5K3SA 5IX8A 4RMJA 3DONA 4N1AA 2ACKA 4BGDA 3ESCA 3C85A 2BL4A 4HEJA 5FO0A 1UM9B 3QFTA 1LW6E 4EGCB 4DB2A 2N47A 1KE1A 3DFIA 2PH5A 5M3BA 3WRWA 4JVOA 4UXJA 3EXFB 4HHEA 1DXHA 2SCUA 1LPAB 2BP7B 3KR1A 2CNWD 3RWBA 3O4RA 3RHSA 2XB9A 3P9KA 3AVXA 2Z30A 3WAKA 2VZ0A 3Q8WA 3RIGA 5FEMA 2UAGA 4U00A 4XYBA 5BOSB 2H18A 2DFPA 2VHUA 3BMNA 4ROTA 3ZV3A 3LQKA 2MJLA 2PGAA 3IEXA 3ZXIA 1ACMA 3U19A 4NFLA 2XZOA 3EGXB 4Q6WA 4EPTA 4F3YA 1E1NA 2J6BA 2OL4A 4IIFA 1KY4A 4HX9A 2XF8A 1JJAA 1HOXA 3AQIA 4X6XA 4YJHA 4CWAA 1ZICA 3P0EA 3H16A 4FFBB 4C88A 4XJTA 3JZFA 4Z99A 3RC3A 1IL0A 1P5ZB 1WE8A 4YRDA 1XZAA 2ZT6A 2JGKA 2QZ9A 3B7PA 3L0YA 2CL5A 3JX9A 2VHWA 2CNBA 3JQFC 3IVRA 3U7GA 5GZ1A 3IXLA 5BV8A 1A2OA 1R6DA 1YBMA 3NYIA 4QDZA 2JLWA 1ZIDA 5FBKA 4WJLA 2HO5A 3Q5DA 5SYNA 1NV8A 2GFQA 4H31A 4RYLA 2AN1A 3T3GA 4DC1A 1OTXA 3FMGA 4PHCA 1G5QA 2ZI9A 3CKKA 3NGLA 5CM8B 1M75A 2NNWB 2WU3A 2AOTA 3HCPA 1L4GA 4OHPA 3EXEB 1FZTA 2DPYA 4Y0VA 2QRNA 4NZ9A 3DMFA 4F60A 5HM6A 4B4WA 2WFZA 3I3SR 3ONEA 4H16A 1VLHA 4EHLA 1QU2A 4IS2A 4FE7A 1PFVA 4FR2A 4RCZA 4ZVVA 3RJ9A 2HDOA 1O58A 1IVSA 5FD8A 4MGYR 4ZTBA 3CV3A 3LOQA 4JOQA 1P2BA 1BROA 1OYYA 4DYVA 1DXYA 2IZ1A 1RAFA 3L07A 3LL4A 2WNHA 4BNUA 1NQUA 2WJJA 3D7NA 1T9DA 2GXQA 3GCXA 4MVJF 3E18A 4AIMA 1OPRA 4ZZIA 2IS4A 2CEAA 2PBLA 2QXTA 4JP1A 2WF7A 3UAWA 2D7DA 1YB4A 1OOEA 3AR5A 4Z9YA 1NLZA 4UFPA 1BDHA 1N6NA 4RSMA 3EVFA 2OAEA 3EB9A 1WMFA 1C0KA 1J8MF 4TV8B 1AHPA 1DCTA 4ZCPA 2QTBA 2WSBA 5CA0B 1SU7A 3R7SA 1F14A 1C5KA 1PFKA 1DHRA 4XR4A 3UJ6A 3AVOA 4G97A 4BTLA 3QI7A 2PG3A 5INTA 1XMOB 5C4IA 2XVAA 1L2TA 2H5EA 1SWVA 2D1SA 1DDGA 4FIZA 4KO8A 4AJ4A 1ZHOA 2WIBA 4KH1A 1CY0A 2YBEA 2GZ2A 4GVLA 5T6BA 3VAZA 4DHEA 4QDXA 5KYNA 1AV6A 3WIUA 2WJHA 4CQMD 1O3YA 5H82A 3GRAA 4HVLA 1N1MA 1R15A 3NT5A 3LTEA 2JIDA 4P92A 1I3KA 1OPXA 3GX1A 1Z5WA 2HU2A 4FMDF 4O4JF 4WPGA 1K6XA 3EK2A 1CZLA 3JQ8B 5JO9A 2J3EA 2W2LA 3DHEA 1Z08A 1SCUB 3GBVA 3G7NA 5J2TA 2VJMB 1MIOA 1O9GA 1CWUA 4QYIA 4OREX 2JFPA 1DJNA 4TM7A 1EINA 1AKEA 4WZAA 2GARA 1JWBB 1KFCB 3TD9A 4O4HA 4C7BA 1H2WA 4U7JA 5AKLA 2JF0A 2BFFA 3C7CB 4RVNA 5AW7A 4B6OA 1NAHA 2PD4A 3GGDA 2C9ZA 4YJ2B 4EYEA 1LW7A 4DDMA 3L1UA 1G19A 2V65A 4O59O 3TJMA 4PN3A 1D2EA 1KOJA 1SQSA 1UMCB 2OGSA 5F78A 3THXB 1VBKA 4CLXA 1R4AA 4KWTA 5G40A 2B2NA 2FQ1A 2PMFA 3HDQA 2YWDA 1JAHA 1WS6A 4NCAA 4URHA 2C9OA 4C1NA 1H9AA 1NVBA 3U7IA 1UC4B 5TY0A 3VH3A 5L6LB 2PLAA 2DY0A 1QRSA 3HWWA 1AT1A 4AQYB 3NT2A 2UUBB 2FEWB 4JI7H 2NUPA 5AVSA 3ACCA 1TDJA 3GFGA 2D2VA 1ZZGA 3E2PA 3P9XA 4OM8A 4L9WA 1FMTA 4KXVA 3L02A 5CVEA 3PQ2A 5H8WA 1O6ZA 1U5AA 3DFFA 5ENVA 1O4WA 3KYJB 4KXNA 3F97A 3RVJA 3ZBPA 5A7FA 1NXUA 4HXGA 2ZBRA 2ASVA 1LFAA 4TSRA 4HB3A 1LDBA 4OYYA 1N92A 2AXEA 4MW1A 4B3XA 3ROZA 4NBNA 5K51A 1CEXA 4L0CA 2Z0MA 3ZR4B 4E3WA 1BOOA 3IBFA 1VSTA 4PCAA 3SC6A 1DINA 3O83A 4LE2A 4CU5A 5HIKA 4DEXA 1ISHA 2OM6A 4ALKA 5IXYA 2YQRA 4JYAH 1QIIA 1VA5A 5M34A 4DIUA 4LF5B 2C59A 1B15A 1P3DA 2WJWA 3AVQA 1M66A 1U3GA 1ZOIA 5DJ5A 4CFSA 2B8EA 3NIDB 5L3SA 3DMNA 4DUGA 3VNVA 1ZNQO 4QGFA 1USVA 2C5EA 3PRJA 2W42A 1E6LA 2C2GA 3FWNA 2HMYB 2Y27A 4HBZA 4NEGA 1CJUC 1PD0A 1N1DA 3Q9SA 1TQDA 5KOYA 3L2OB 1PWZA 2EX4A 1ZXLA 1GG5A 2WUEA 3MAJA 4M76B 3PE4A 2PUWA 1TVKA 1RBYA 2C3YA 3EGWA 1Q7CA 1RQ2A 4XZ3A 3OC0A 4O4LF 3UPDA 1DZIA 2F48A 1JVSA 2MYTA 1DTWA 1KEPA 3G5TA 4JEUA 5CLFA 2JLVA 4NCJA 4BJ1A 4S2EA 1N33B 4G0NA 4PX5A 2JLBA 1JBQA 3I9FA 1NBEA 2J7PD 3VOSA 3DD1A 3JQDA 2Z6UA 1KI4A 1Y5IA 4H9GA 3SEQA 1XDZA 4QMFB 4ZAXA 3ANSA 4ILKA 3MAAC 3LCJA 4N3NA 1IHYA 1S7GA 4M9ZA 4Z9FA 2G36A 2IP4A 3C4QA 5KAPA 5TQJA 1L5KA 3TQIA 3KT3A 5AVTA 2DLCX 4DV5H 4DR1H 2OD7A 1GV1A 4S1TA 1VGQA 3OT1B 2UYGA 1M1YB 1P2VA 1UPXA 1Z15A 1J4WA 1A1VA 1NU8A 1W0KD 4LXQA 4YMUA 2Z9BA 5E4TA 4MCIA 2YMPA 4MICA 2TMKA 1MQAA 3F73A 1NFRA 1ML3A 2Y1OA 5TJHA 1Y1QA 2PT9A 3EPPA 3PPVA 3A1DA 3H1FA 5HF8A 1MA0A 4CKZA 2H7YA 4JWTA 1IDN1 3EBLA 1QV6A 3PC8A 5TIIA 3A6EA 2RGYA 3ZDXB 3QLUC 2X2FA 4G23A 3H1BA 1FTSA 4FDAA 4ZO8A 5KX5F 2G5CA 4ISCA 2GD1O 2H4HA 2O1XA 1M1ZA 1NHGA 3WR5A 1YGPA 3GJ4A 1HZZA 2ILVA 3V1KA 4C4PA 3RSGA 3OPYI 1I4LD 2QL5A 3GN2A 1RMTA 5EN4A 1Q7RA 3HFGA 3ZI7A 2IU6A 2AXPA 4U02A 4YR7A 3PDIA 5F5NA 1ZCAA 1JMKC 2PCJA 2Q5EA 1XMJA 3DULA 4G8BA 2JGDA 3TTSA 4L07A 3H1GA 1DMRA 2FP4B 3N2NA 3KPYA 5A3VA 1YQQA 5EWJB 4L76A 1L5QA 5B37A 1I4OA 3QPCA 2XBUA 1N7GA 2Q3CA 2YIVX 5ENDA 5HK8A 4G84A 4NY1A 1R5NA 1U0NA 4XFJA 2FDRA 2M1ZA 2UZ1B 2M6LA 5CB4A 4W5OA 1Q1NA 3OJXA 2GCNA 4LJAA 3DPUA 4FZ5A 5I5GA 2JLCA 4EG8A 3SI7A 1EZZA 5F98A 3QY9A 1A82A 2GJ4A 1ZN7A 1K7YA 3MMSA 4JWKA 2BM9A 1YJCA 4JUFA 1AV7A 4RKFA 1FFHA 1OF1A 1NXVA 3JCZA 1V2HE 4ABYA 2IOFK 5HKKA 3L43A 4AP5A 2XOKA 5LD2B 4KK4A 2QUHA 4YP9A 1OUMA 4OMUA 5ISMA 1ZG3A 1N3IA 3PHLA 4C3OB 2AJTA 3PE6A 4K40A 1UWCA 1X70A 2FW6A 3KEFA 3NHZA 2AFHE 1PUJA 3EXHA 3FRIA 4MRMB 4KN9S 4NOKA 2LCIA 4U7PB 4DUPA 4QQ8A 3KUCA 1C2TA 3GPDG 4FKBA 3K9FC 3IE0A 1KF0A 4QYXA 4Y0NA 4CHGA 4UHEA 3LT0A 3HI6A 5FJIA 4G5OA 2CTLA 4BZWA 4D8XA 1ZQ1A 1HT1E 3ZWYA 5CIWA 3TQRA 4YJFB 2G9QA 1IIBA 3D7KA 5IM4F 4US0R 3U6KA 1VMDA 2C4HA 2EG9A 3GLFE 1KDPA 1DV1A 3DZBA 5JTTA 5LQCA 1H4TA 2I29A 4HJXA 1XZLA 3IIIA 1DAIA 2Q3EA 1W5SA 1Z47A 2FY8A 1PG0A 3QUBA 5G02A 3WLKX 4PSVA 5T64A 1UOOA 3M3DA 2ZYVX 5DHSA 3VX3A 2ROQA 2JFZA 2BR3A 3WS7A 3BIWA 2NUBA 3T1OA 5EJ6A 2C5SA 3HCWA 3FNIA 4D92A 4RU1A 2BW0A 1CC1S 1KORA 1N1EA 3HYRA 5JASA 3HLKA 4OIFA 4WLUA 1IC6A 1DTSA 1FFBA 4ICIA 3TSCA 4WINA 1JDTA 2QG6A 2RI6A 2RG1A 4I4TB 2GXSA 5LDDC 1P9WA 2D1RA 2MSKA 3DE6X 3IP3A 3PDCA 1FRNA 4R1OA 5F7OA 3DQQA 1VDZA 4OK6A 2QTZA 4MS3B 1EYZA 5IK2A 2PFSA 1AQLA 1HE3A 3V4ZA 2P6RA 5EIOA 3W6UA 1O95D 1OXSC 4WLVA 3TQHA 3FWZA 3G9QA 3R4CA 5HMMA 3QJGA 1L4HA 4AM3A 2BKVA 2AOVA 3BD8A 1A7KA 3G23A 4FOTA 3TAXA 3KKQA 4B6FA 4WGFA 1J8QA 2AC7A 4G0PA 1DPGA 5H4GA 5T8KA 3OZSA 2X3YA 5KEIA 3LBIA 3R0IA 4FDVA 4B6GA 4AB1A 1KAHA 4K6FA 4NV0A 3NMUF 3BBPA 1C1DB 1JFTA 3RCBA 5C32A 4CM5A 1XWWA 1TX4B 3D81A 3DM9B 1KFKB 3KC2A 4ZT4A 3IPLA 4MYDA 1CIJA 5AWFC 2F64A 4MSUA 1QRDA 4L5BA 3RS9A 2BFDB 4A8JA 1AZLA 4P3YA 1YKSA 4I1YA 3ZV6A 1G64A 3BB4A 3ESDA 2IEBA 1IULA 4DM4A 2O5EA 2P4QA 3RSFA 1N34H 1NUHA 1RTTA 1J99A 2OOKA 1RLTA 3UM9A 3HN7A 3UYLA 2RGWA 3CCCA 1GLNA 1YIAA 2H08A 2MSDB 1G3IA 3DPSA 2W83A 2BLLA 3TE6A 1GP2A 3WVNA 4UJ3A 3ZK7A 2II6A 4MVJH 2YHSA 3O8OB 4MITA 2NSDA 2GTPA 2LXNA 4MMZB 1J39A 3VNSA 4LFAB 1AZTA 2P6UA 2EZUA 5LJIA 3EPHA 1CY1A 2EGGA 1KO8A 2ZFUA 3DBHB 1UDBA 3B1WA 4JL8A 2E18A 3GZNB 3CMCO 1XTBA 3PT9A 4XB1A 4Y0AA 4RD0A 3WMEA 1CY7A 2BM8A 1KK0A 2F9MA 1OFHA 1NKSA 1UXKA 2BI7A 1O2DA 3R5HA 3FKQA 4UM5A 5F52A 1RLUA 1C4WA 1GL3A 3ULKA 3N0TA 4IV5A 4J1NA 5K8UA 4U2FA 5JUWA 1WPRA 4HB0A 3TH5A 3ZKAA 3JALA 3K9CA 5KU1A 5EYPB 2OLEA 2PL5A 4Q7LA 1PEDA 4HO1X 4QU9A 5C8DA 3B3QA 3S7TA 3VHXA 3T4PA 1K7XB 2C0QA 4TVSA 5C0OE 2IXTA 2JAUA 3QU7A 4KV7A 2GEUA 1TKBA 3Q9LA 2C7RA 1K6EA 1U9CA 2CUTA 2QTGA 2OO3A 2JHCA 4YFVA 4WBNF 3ER8A 1X3SA 1ZJYA 1QPGA 2LKCA 4WUVA 5HP4A 1O54A 5BN3B 2PO5A 4D7AA 1C1HA 2W90A 1H2FA 1SXGA 3FTPA 4HLNA 3NC4A 4ER0A 1E0AA 1H4QA 1FYEA 1MXHA 3WWZA 7GPBA 4MQBA 1EGVB 3U7EB 4RW0A 5FWDA 1W0JD 1VKOA 4EB0A 1Z62A 3F2IA 5GMOA 1YRYE 2C92A 3KSZO 3N1UA 3WJAA 1B41A 1YQ9A 2H48A 1P4SA 4B5LA 2W22A 3JVDA 4WVFA 2XRFA 1GSAA 1DAMA 4WXMA 3Q98A 4AG6A 2DC1A 4UNNA 2G5GX 2W6JA 5CVTA 5DO9A 2HMTA 1ZEJA 5DHRA 3LA8A 1Q1AA 3QVWA 3A1WA 3AF3A 1YFKA 3M2TA 2H8GA 3TRHA 4X7RA 3EDYA 5IASA 3O4IA 5ES4B 1FQKA 4RLFA 1VB3A 1F17A 4ZQIA 4YUWA 2GXAA 4BMNA 3TCXB 2FPPB 2F1IA 2XEDA 3COYA 2JFNA 3F6YA 4COKA 3STYA 3N0XA 1I7SB 2BEVB 3ICPA 4MW7A 1LPSA 1ND6A 4OLHA 4Q00A 5EPOA 3TLCA 4A0FA 1ILEA 4ZC1A 3BORA 4DLPA 2FR1A 2OBFA 4GD3Q 1V9LA 1R8JA 4E5KA 1M9NA 5EUCA 3IVXA 3E8SA 1W85B 3K73O 3BQMB 1HG1A 2GCGA 4L0QA 4C21A 1T0BA 5JVDA 3CG4A 1HLPA 2ECQA 3QYPA 4MEJA 4PSUA 2AF4C 2IEYA 4MUMA 1VCIA 2XECA 5EMNA 5GQSA 2PIDA 4A73A 4HT3B 5MFZA 5AR1A 1BE6A 4QPDA 3OTHA 2DGRA 3F6PA 4LDZA 2YZNA 4E5YA 3DW3X 1K2WA 2B6HA 4QFDA 4EW6A 4A03A 2QW8A 4FE4A 1ADBA 1FVXA 2P9CA 5ILGA 2Q3BA 5LBTA 1FL9A 2B9EA 1L5LA 3R7WB 4ETIA 5A5EA 4U2DA 4ND5A 1E2EA 3MRXA 4ZVKA 1DEOA 1D2GA 1SC4A 1SZPA 1GWNA 1N8KA 1Y82A 3EAQA 5EHIA 2YH2A 2WC1A 2FU5C 3HUEA 3ZJYA 1SN7A 3F1KA 3QMWA 1JDPA 2YRXA 3RYHA 3T94A 4DAEA 3L1IA 2CTEA 3HYCA 3NHPA 4PWZA 4AN1A 4BTEA 4G01B 2OXFA 4R51A 4UCQA 3M6VA 1KKUA 2GZRA 1GNTA 3ZU3A 3M82A 3PD0A 2YZ2A 1ONNA 3O94A 4R1TA 4I08A 2IUFA 4ZKEA 2FSFA 2EBFX 2ZIVB 5LZ7A 4N8EA 4W99A 4C4XA 4DT1B 1FFXA 3OHMA 2Q6IA 2LW7A 4DR7H 3NATA 3QIAA 2ZI7A 1G2OA 1PR4A 4MAFA 4UM9D 2C99A 4EL5A 3QE0A 1HNXB 1VYVA 3U09A 1TOAA 1FDRA 3LUCA 3V69A 1YDFA 1L4EA 3Q7TA 4H1TA 2R7AA 2ZBVA 4IVRA 1E7MA 2NO0A 1G2PA 3IPCA 1HC7A 3CURA 5IT0A 1SIUA 5E7IA 3SM9A 5MN4A 2FPGB 1Z6PA 1ACJA 5CK5A 3SJBA 4RPIA 2IIBA 4KRFA 2FQXA 5BN1A 1VHTA 1MC5A 2GLTA 3IUEA 2ZSHA 2UYCA 2ISQA 5F21A 1N7HA 1VBMA 4PGGA 3B9BA 4XWGA 2VSXA 1GCOA 2Q5JA 3PNQA 1XXHE 5P8WA 1M6YA 3LUDA 3NVMB 3IEKA 2ISSD 1TUEA 4DDWA 1UJ5A 1G291 3H6KA 3CRMA 1T0HB 2REXB 4Q01A 2FEXA 3BTUA 4RK1A 5TE9A 3RI3A 2EKLA 2NO9A 3FTNA 1SXHA 3O21A 3GP8A 2Z5LA 3ZBQA 1D8AA 2ES4A 4YONB 5JSZB 3TPFA 2D1QA 1KS2A 2YR0A 4QUDA 1YZFA 2A84A 4ZCSA 1NPYA 1Z16A 2ZKIA 4B4UA 4BNLA 2OP0A 4CMBA 3R5FA 3DD5A 2RI1A 4OP1A 4F2WA 4MIEA 4EJSC 5B1EA 1NMQA 3KEQA 3TB6A 1SC9A 1YO6A 5FUBA 3ZNOA 2PKXA 2PL1A 3R41A 3U49A 3NKVA 3U4GA 4D9BA 2WW8A 5FWAA 4AKIA 5KYYA 3RO7A 2H6EA 3KLMX 1FP2A 2QM7A 4P0TA 3KQWA 4QJIA 2M6RA 1X1BA 2FSSA 2XE6A 1NLYA 4XB6B 6AT1A 1CR6A 2BCEA 4WK0B 4Y3UA 3CNBA 4GZ5A 3MF4A 4JQSA 4L50A 4PZAA 4TQAA 4GX2A 4ZYTA 3NBXX 2NVWA 5LJLA 5CYPA 1V9SA 3GIWA 3DNFA 3C3BA 4XWOA 5MDHA 4Q9KA 2IPNA 2XJ4A 1LTQA 2VH5R 4X64H 2FW9A 5FA8A 1HV8A 3RS8A 1G21B 1VHWA 3GLRA 2VK8A 2WSSD 2ZR9A 2PV0A 1XDGA 3EC2A 5E9QA 2ZKLA 3IVCA 5LMZA 4OYHA 1VP9A 1ZD9A 2CHGA 3IEIA 4OXYA 2P8SA 4IOLA 4BGUA 3HJAA 4TLBA 1IJFA 3OJCA 3L1KA 5I7EA 2IH5A 1I3MA 3TLXA 2UYQA 5HXAA 4TLDA 2C31A 4J29A 5IF9A 4EPRA 2OV3A 4U2EA 1Y3AA 2FUCA 1FUUA 1K2VN 2ZRNA 3DXYA 3BWCA 5HDQA 5JNUA 3Q9UA 4NEQA 4U8HA 1E2IA 1FP1D 3PQ4A 3QUTA 2ANNA 1CUJA 1RCTE 3EGDA 4LE1A 1D1PA 4XXHA 1B8UA 1RJ9A 1SURA 2C0PA 4PX3A 1JW9B 2QVCA 3ELYA 2JFOA 4ND2A 2I3ZA 5IVIA 4CM4A 5CLQA 3FHTA 2V7BA 2XIJA 4GOJA 3A10A 3W05A 1ZN2A 5E8JA 1CHDA 1F2TB 4A6XA 3LOPA 1M10A 5D3KA 2X0NA 2IYLD 3ODPA 1VL8A 3BGVA 3DAOA 3NXSA 4GZLA 5E7MA 4UQOA 1X6VA 5KNBH 2QUIA 2F4NA 4UEOA 4DR5B 4HWRA 4UAJA 1DCKA 4WKGA 2VP6A 3RJ5A 5DX8A 1F1JA 5CVUA 1XZGA 2BY4A 1CFJA 2GD2A 3MOGA 3PLNA 4W5JA 3ZIAD 4BAGA 1EFDN 3VSEA 5KNCD 2LE0A 5EAIA 2FPWA 2EP8A 2PLRA 3AJ9A 3ABOB 1Y98A 2G8YA 1K5PA 2PZAA 2C2HA 5DWVA 5EHQA 3R5SA 4C43A 1X7ZB 3PUYA 4G56A 3A58B 3UA4A 2HLNA 3T1YB 2ZYIA 1XA0A 2ZZMA 2CT8A 4WKPA 2QRUA 3ZWVA 2AZMA 4DV5B 2XKAA 4IDAA 1DB3A 2VWQA 4DLRA 2E55A 2JEOA 2YVLA 3GDGA 2ZRMA 3WRVA 4HEQA 4DOMA 3RYFB 5DGXA 2D06A 3JTMA 1ZDMA 4L74A 5DEOA 5AO9A 4W5WA 4PYKA 1RR6A 3RHFA 1MSZA 3HSSA 2GYWA 2P68A 2ID8A 2QTTA 3NVDA 1PNRA 4CMJA 1XKLA 4FYVA 2NX2A 4MJXA 1KH2A 5TPWB 3TLBA 1N8NA 4JA0A 3FVWA 4M1WA 2P5YA 3QJYA 4XI9A 3CSDA 3O93A 1E0KA 2BBSA 1CQZA 1X7WB 1U63A 3DR3A 4M89A 2HNKA 4NBSA 3EVCA 4X85A 1K3FA 4R2JA 2VQEH 5F2EA 4A5SA 3SXUB 2AE1A 4LF6H 4EP1A 3ASYA 4RTQA 4WANA 1MTOA 4HQ0A 1CNEA 1K7FB 2P2ZA 5AUQA 1ECJA 3GZ4A 4DNQA 3FOBA 2VYND 4EF6A 3L41A 2B83A 2FETA 1JR4A 3C6YA 3GFBA 4HVAA 3RVBA 4D9JA 5EIFA 4NU5A 3C2QA 3JR7A 2ST1A 3LZCA 1RPZA 1DU4A 4N12A 1T1GA 3LWBA 3TQOA 2VAXA 2VF5X 3IT2A 1CRLA 1ZESA 2WPNA 1ZNYA 3PF9A 5ECDA 4F9EA 3USZA 4YASA 4R0MA 4B35A 3WQHA 1R0BA 4REQA 3HPQA 2COUA 3KDSE 2A5YB 1B1CA 1RWOA 1SM4A 1RJFA 3O4VA 4NH4A 5JFTA 2E4AA 4DE5A 4TZTA 2GBIA 2WG2A 1OXVA 4NR0A 1U7ZA 1G1AA 3ROTA 4PFJA 5GM1A 4HGNA 4XVQA 7REQB 3LQ2A 4WW0A 3MK31 4JFAA 4CLEA 4R71A 2Y0EA 3MTGA 1TM5E 4LOAA 2V96A 4HQLA 1E3SA 1NVXQ 3GCGA 5TQ0B 1TK2A 1P0FA 4E22A 5DHUA 3RFUA 2WWVD 4KAFA 2WIGA 2A9RA 5FEUA 1WUIS 3L8MA 2HIMA 3AF6A 1I7PA 4M0PA 2RHBA 1G4UR 5EUQB 4TROA 4UVDA 4EUEA 1OTYA 1FX1A 1P1JA 3CZ9A 1QH1B 4WCFA 1BCSB 2R751 5LZ5A 2RAUA 4HNTA 3KOMA 5FORA 4EBBA 1EWRA 1LU9A 1MENA 2JK0A 5JIBA 1XAGA 5F1PA 3WHKA 2FZ4A 5DVZA 1LQUA 2BGGA 1RHMA 3W5IA 1G9TA 3S68A 3UBTA 4JYMA 1H9CA 1QC5B 3MD0A 4ZO4A 4C5BA 5B4TA 5K6AC 3WYNA 4WN9B 2WG0A 5JPDA 1EQUA 5FOXA 3RVMA 2W8ZA 1R8QA 3CPEA 2Q1XA 4FI3C 4R2KA 3WLMA 4QT0A 4A10A 3QWFA 2PV7A 2C7OA 4OMDA 3UMYA 1BDBA 1F6BA 3VHRA 3RK0A 2NW6A 1GSOA 3JRWA 3MJ4A 2Z98A 3GPLA 2IKQA 1RAIA 2MR6A 3DOJA 3V2HA 1SO8A 2O3QA 4Z0HO 3GVIA 4ESHA 3DV0A 4GPEA 4KQIA 4KHPB 3DMYA 3AJRA 4J75A 3VNRA 4KNWA 5CDFE 1OAOA 1V37A 2MSCB 2YIMA 3UYKA 1Z17A 3DFZA 3H9EO 5F76A 3FNEA 2WDPA 3GUZA 2VKCA 5C4GB 1I2CA 1SUWA 2F1HA 2H1RA 4UBKA 3WA6A 2H1HA 2QTAA 3NIWA 1UWLA 3FYHA 4BKMA 2F8SA 4JVMA 4TTRA 2GZ1A 3Q7RA 3QKUA 3Q40A 1LD3A 1I30A 2WIFA 2D9IA 4JJIA 4XDYA 4UHDA 4Y9UA 1T2FA 4LNAA 5JLJA 1XRPA 3PZBA 1QQ7A 1CPYA 4HWKA 3TAHA 2ZBPA 2O52A 4BX8A 2NM0A 2SKCA 3R40A 3HA3A 5FBZA 3IS3A 2IF2A 4J4TA 4PZYA 4UAGA 2BC9A 4YI3A 1GGMA 3PQ6A 1I4DD 5K0LA 3ROPA 1OD6A 4RA9A 2E9SA 2ID7A 3NIBA 5LDGA 5T6MA 2QTNA 1WXGA 3SHVA 3U9TA 4L8LA 2VA9A 2FEMA 2QR5A 1DTEA 1YZLA 1WD7A 2FPKA 2IITA 2EYUA 1K4KA 3KKPA 1A7AA 1CG6A 3RU2A 1SZCA 4QOSA 4RIHA 2I4RA 1BRTA 1Q7BA 1WW2A 1EVKA 1U8XX 3MD9A 1JHPA 1F3LA 4ISBA 1I2AA 1NN5A 3HJUA 1H1LB 1U2ZA 4GLBA 3DUFA 3AHDA 1IHOA 2LTLA 2CMDA 1N6OA 4G25A 3WIVA 1ADJA 1N3BA 3WIOA 1X9HA 4KL8S 2GERA 2G9RA 2Z3WA 2J3DA 2XQKA 1EFKA 3EC1A 2QN7A 4M38A 2HU7A 3WLTA 5CD9A 1RYZA 3A9CA 2MWMA 5DNEA 1JB1A 4G4SO 2RHHA 2JRCA 2OV8A 1Y80A 3EPRA 1B00A 2HLDA 4WZBB 5K0NA 2P0AA 2OQVA 1HK7A 1OC4A 1I9GA 1ZW6A 2DWUA 2YXBA 1OJ7A 3PYMA 2XBMA 1P1FA 2NTYC 5H3LA 1P2UA 2Y67A 1MJFA 2BBWA 3NUQA 4CDNA 2F00A 1OXTA 3VPFA 4WN3A 3EEOA 3Q7SA 4TSKA 2EJUA 4HS9A 4XPIA 3IAM6 4UZEA 3VO8A 5KB3A 3GVPA 3C7KA 4US1R 3HCNA 2YYSA 1PG2A 2O2XA 3T1TA 1XTPA 2QJOA 2ZM5A 2YWFA 1RXSA 1AS3A 1PT9A 2ZAMA 4NBVA 2XUFA 5K09A 4O6VA 3RC7A 1FFEA 2AH5A 2A94A 2I6UA 2ZR7A 2QVGA 2X5JO 4H7HA 1EHIA 5EVCA 3ZYCA 1XVVA 1E9FA 3BS4A 4UBOA 1VECA 1O97D 2MCFA 4PZLA 1JAXA 1QYVA 3F96A 1IPFA 3O3CA 4RKEA 1BQEA 4DCTA 4F72A 4R5MA 1PR0A 1M72A 2WWRA 1A50B 2H11A 5TRTA 4U6SA 4OX9H 1UMBB 3IBSA 4GWLA 4DB4A 1GTZA 1A97A 1GPUA 3U9SA 2PQMA 1NVKA 4RK7A 3E61A 2M6KA 3WGTA 2BONA 5C51B 1I33A 1YQDA 1GNPA 2VATA 1YVRA 5BW4A 4D79A 1QYWA 5SICE 3IFSA 5FTNA 2COKA 5BSFA 4F06A 1U3CA 2OVFA 1LLDA 4H6VA 3AFGA 4Q3AA 4EG5A 2AE2A 3OEHA 4QTYA 2BEWB 3PXXA 4OHOA 5ALZA 3HJRA 1XIVA 4Z4QA 1LZLA 1DQNA 2FMKA 4XH9B 3CLSC 3JD0A 3QVVA 3E5RA 1LK0A 4H0CA 4Z7OB 3KSBC 1GZHB 3RAEC 1F7UA 1TJYA 4NZTM 1P17A 2V3WA 2X41A 1Z0DA 1XZPA 1I3OA 2AC4A 2DPHA 2ZE8A 1TI7A 4B3MH 1ABFA 4BNWA 2IHNA 3C8MA 5BMVB 3DQZA 2BEUA 1Y4UA 4MHOA 1WXHA 4BMYA 4IIEA 1JDBC 3EFEA 3TX6A 2VN8A 5DMHA 4Q5IA 2C98A 2IPOA 2OECA 2X23A 4FXPA 4B3FX 4ZICA 2PUBA 5SY9A 3AW9A 3COWA 4YUZA 4UEWA 1G42A 5IABA 4W8HA 1IBLB 1NVTA 2TECE 5C81A 1X1DA 3UG6A 5C1PA 1AN0A 3II6X 2J9YB 1PAUA 1HDOA 3H5LA 2B8JA 1QHIA 1XQWA 4TUYA 1VMAA 1Q5PA 4HAZA 3GUUA 1JQKA 4A5OA 4CL2A 1Z6ZA 3BZBA 5AOVA 1YR2A 4LWOA 2IOFA 3KBOA 4OXIA 5KDLA 2G25A 1ZWKA 3E9ZA 4TS9A 4F86A 2JFQA 2V0CA 2MSLA 4DJTA 1IAQA 4E09A 5FV4A 3N8DA 3GRPA 3CNQS 1N5OX 2IBMA 4RYDA 3G6WA 3HDHA 3H18A 3P2YA 3I9NA 3MT8A 1NRXA 1KU0A 2A58A 2E49A 3QOWA 1RQLA 3K20A 2G63A 3VDXA 3GGOA 3DOCA 1LLFA 1DJOA 1VJCA 2AI3A 1M7GA 1QCCA 1TYZA 1HFWA 1DUSA 3ZIUA 5JNVA 3C15C 4AROA 1FQWA 1Y3HA 1O6FA 3DNPA 3OZBA 1BVHA 2Q8QA 4NECA 2BF7A 3LYLA 4B3DA 2IS2A 3UT0A 3FR8A 4GXTA 2X8JB 5TQ2B 2INGX 3EZGA 2A9QA 2NT4A 3LLSA 4R9NA 1YA6A 1E2BA 1U7WA 2ZCVA 5K3FA 3TTTA 4RD4A 2HHCA 3UBMA 5AVXA 1WTCA 3DVRX 1E89A 3X1DA 1QZ3A 5FB3A 1C3VA 2G3YA 1TJ3A 4PW0A 3RG8A 2D5BA 5DB4A 5FQOA 1E7WA 1T9GS 1Y33E 1NMXA 1GCAA 2FPIB 1QVRA 3ESAA 4FFVA 2FPOA 4TGLA 5TS3A 4ARSA 4EA7A 2DFNA 3EAGA 4EFLA 3KB8A 2P2LA 8ADHA 1E1LA 1H0SA 5BRNA 3GUYA 2REQA 3KQNA 4FDTA 5A02A 1E9AA 4ZMBA 5ALEA 1KJYA 1R9GA 3GFTA 5K0GA 1NVMB 1HOTA 4HB2A 5BUSA 5DX1A 2FMXA 1WTAA 3W2HA 4KQJA 4EKGA 4Z7NB 1IVYA 1QH9A 5CA1A 3GLIA 1ZL2A 4FCWA 1XA4A 3NW9A 1PGNA 4DUGD 4CXMA 1S3FA 3ADBA 3D8NA 1RMQA 3B3AA 2G1AA 2QZ4A 3WK9A 1V16B 3AV3A 3AJDA 3T1HB 3OE5A 4FSHA 3HXPA 5H16A 4LYAA 4C14A 4HOYA 1ILWA 1F51E 1Y6JA 4IFDG 2AOWA 3CSUA 1RWMA 2BKXA 2P40A 4K9QA 1IU9A 2I78A 3B8HA 1QZTA 4J16C 4QO7A 5HGJA 5TEWA 1IM5A 1RT9A 3T7AA 1JSCA 2PGXA 3VR5D 2CPMA 2H4ZA 4HQKA 1JYFA 2JL1A 3CW9A 5HRCA 2VCEA 1TUBB 5JJIA 3NDJA 3FRHA 1DBSA 3RM3A 4IGIA 4OHXA 4R81A 3PC8C 3WB9A 1MAUA 3AHHA 3KXKA 1ZGZA 3GJ8A 2VNSA 1I9CA 3JWPA 3NHYA 5G3ZA 2Q7OE 3HBFA 5BN5A 5ARBA 2YN2A 4TMXA 4BB5A 3V42A 3SCZA 1U0GA 1UF9A 4JZYA 4B7ZA 5ADHA 2C4KA 4P1ZA 4KK3A 4BX2A 5JQGB 1JILA 2C9BA 4Q4HA 1E3WA 3VRHA 1ZLXA 3OSUA 4FJ2A 1L5HB 1IZ0A 4QFBA 3WLHA 4EY5A 5IHPA 2AYZA 1GCIA 4F4HA 1PV1A 2DVMA 3VU9A 4CG1A 4CM8B 4L0MA 1F38A 2O0KA 2Y7