2O4CA

Crystal structure of d-erythronate-4-phosphate dehydrogenase complexed with nad
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
380
structure length
380
Chain Sequence
b'MRILADENIPVVDAFFADQGSIRRLPGRAIDRAALAEVDVLLVRSVTEVSRAALAGSPVRFVGTCTIGTDHLDLDYFAEAGIAWSSAPGCNARGVVDYVLGCLLAMAEVRGADLAERTYGVVGAGQVGGRLVEVLRGLGWKVLVCDPPRQAREPDGEFVSLERLLAEADVISLHTPLNRDGEHPTRHLLDEPRLAALRPGTWLVNASRGAVVDNQALRRLLEGGADLEVALDVWEGEPQADPELAARCLIATPHIAGYSLEGKLRGTAQIYQAYCAWRGIAERVSLQDVLPETWLAGLQLNPGCDPAWALATLCRAVYDPRSDDAAFRRSLTGDSATRRAAFDALRKHYPPRREITGLRVATGGQAELQRVVRALGAQLV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Erythronate-4-phosphate dehydrogenase
publication title Crystal Structure of d-Erythronate-4-phosphate Dehydrogenase Complexed with NAD
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Oxidoreductase
total genus 125
structure length 380
sequence length 380
chains with identical sequence B
ec nomenclature ec 1.1.1.290: 4-phosphoerythronate dehydrogenase.
pdb deposition date 2006-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00389 2-Hacid_dh D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain
A PF02826 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain
A PF11890 DUF3410 Domain of unknown function (DUF3410)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.170 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 2o4cA03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2o4cA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2o4cA01
3KEQA 1P0FA 4JJFA 3KVOA 4GLLA 4PG4A 4URFA 1PJQA 3PQEA 3WMWA 1HE3A 4GX1A 5LDHA 3RU9A 1BXGB 3BTVA 4D7AA 1LRJA 3F3SA 4D41A 1BW9B 4YXFA 1VKOA 1KYQA 2FSVA 3GMSA 4DQUA 1HSOA 4R54A 4NHEA 4IS3A 1BRMA 1K6JA 5B4VA 4HWKA 1LDYA 2PFGA 2HRBA 2XF8A 4W4TA 2O3RA 4GBJA 1UUFA 5FYDA 3BHJA 2EGHA 3AFMA 4GGPA 3GR6A 5CFZA 4PRLA 1H6CA 4IJUA 3ZCXA 3QP9A 4CV1A 4OSPA 4PG7A 4PLWA 3LT2A 5DULA 3JQ7B 4CQMD 1LA2A 3GHYA 1MC4A 3TWOA 4K9DA 5AYVA 5IZCC 2EG9A 3AM5A 3RWBA 4MP8A 4XCVA 2C5EA 4ID9A 3QVOA 4DGSA 4JBIA 5JDCC 3K92A 3IKTA 3VVCA 3R3SA 3GGOA 3TZKA 2OGUA 3UCFA 1LX6A 3NTRA 3MZ0A 3BMCB 1U3UA 1WPQA 3KLMX 4FGWA 1I3MA 3K6JA 1JW9B 4Y6SA 4A27A 4HY3A 2NU8A 3FR8A 3OETA 4NG5A 3GGGA 1DB3A 2VZ8A 3CMCO 3S2FA 3ETEA 4FJ2A 3JQBC 3JQGA 3QV1A 1GU7A 1RM3A 1N92A 5CEEA 4LVCA 4RZHA 1CETA 3DOOA 3FF4A 3RD5A 3WFJA 4E2ZA 1GFSA 2GERA 4IM7A 5KJ1A 5BT9A 1KETA 4CR7A 3JD2A 5I9NA 3KYBA 1NHGA 3PDJA 5I7SA 1NVTA 5EMHA 3ZV4A 2JCXA 3AUAA 3RASA 4YJFB 3WS7A 4HXYA 4R3WA 3RFTA 3TZHA 1L1FA 3LT0A 4QEDA 4KDEA 4J1NA 4DYDA 2PZMA 3K5PA 2BFMA 5ES3A 2CD9A 3MJEA 1M67A 4HADA 3OJLA 2X9GA 4BNZA 1HDYA 2GRAA 3AUTA 3E1KA 2QW8A 4OXKA 5JSFA 2XOXA 1I2CA 6ADHA 2HJSA 1M6HA 3FNFA 1GL3A 1QYVA 3GUYA 2Y99A 1GV0A 3ZNQA 3AI3A 1LDNA 1A9YA 2O7QA 3OF2A 4KQWA 3WJAA 3LF1A 1LQUA 1RPNA 1SC6A 1NVGA 4ZICA 1T2CA 3TSCA 5BNFA 2OUIA 4ALNA 3AI2A 1AHHA 2X5JO 1C0KA 2WYUA 4FFNA 3SVTA 4NU5A 4Z0HO 1G6KA 3GHHA 1GR0A 4CJXA 1YL6A 4TZTA 1GPJA 4NIMA 3E9MA 4LMRA 2Z95A 1PJ4A 1KVQA 3AOEC 3GVHA 3RUFA 1YKFA 3WYBA 4IZHA 2Y1GA 1HDRA 1XU9A 1ZK0A 5KTKA 3HFSA 2NM0A 2OHXA 2X6TA 1U5AA 1SCUA 4LW8A 5KJCA 4LK3A 3U09A 1VL8A 1HZZA 2O50A 4I9HA 2Y93A 7ADHA 1JAXA 1QV6A 2Q45A 2EGGA 2VNSA 2O3SA 3ASVA 3FTPA 3DBLB 4NFSA 1IE3A 3KHUA 4BS9A 2JD0A 5CAEA 4JQCA 3LT4A 4II3A 4FFOA 3CEAA 3HSKA 1ISHA 4Q3NA 3HN2A 2R00A 1XR3A 3DO5A 3ZWBA 3NX4A 4M8SA 2I6TA 2Q2WA 2IODA 3KM0A 1UP6A 1V3UA 3X2FA 3EK2A 4YJDA 4B8WA 2LDBA 3G49A 4YA6A 4QO8A 3GG2A 3IIEA 5JYDA 2C2XA 8ADHA 1QG6A 2QZ9A 3T4EA 1KVRA 3VPFA 3HDJA 5DCUA 4A5OA 3VZRA 3GZNB 2IDZA 4M87A 3S1LA 4NI5A 4DBVO 2AG8A 1E6WA 1BG6A 4C4OA 1I33A 3L0DA 1PJLA 3QWFA 1A71A 5EL0A 1WP4A 2QYTA 4R1SA 1NVMB 4JK3A 3I6QA 1P31A 2JHFA 3I4CA 2XXJA 2DAPA 3R0IA 5F5NA 3ZNOA 2ET6A 4AJLA 3ZWWA 5C3MA 5A9SB 2VHXA 1A5ZA 4E12A 3HHPA 1I3KA 4WCFA 2XXBA 4RL6A 3DFZA 1KC3A 4YT8A 1SBYA 1VSUA 1LNQA 2IE0A 3OM9A 4E31A 3H2ZA 1K6XA 3DB2A 3TRIA 5L40A 1D7OA 2I65A 5T64A 2YV2A 5TT0A 1LU9A 5HS4A 1I5RA 2BI7A 3S8MA 1GEGA 1GTMA 5C7OO 1YQGA 3LC7O 5TQVA 1NAIA 2ZQZA 1F0YA 1I3LA 4XR9A 2VHVA 2VNAA 1HSZA 5H81A 4CMJA 1HDOA 2Q4BA 4W7IA 2HK7A 3LC2O 3OP4A 2AMFA 4YPOA 1Q7BA 5U9CA 2TMDA 4AJ1A 3W8FA 3ZV6A 3E8XA 2I5PO 4EUEA 5COQA 5JMWA 3ZHYA 1LLUA 2ZB7A 1JTVA 1XU7A 3ZDFA 3MJTA 5U4QA 5TLSA 2Q1UA 3E6AA 1EEHA 4ITUA 1HYGA 3L6DA 4JIGA 4KUGA 5DF1A 1U4OA 1MP0A 1PGOA 4S1VA 5BSHA 3RQSA 2JL1A 2IEDA 2D2IA 1DJQA 5H82A 2VT3A 1WAMA 4UEKA 1SOVA 1XELA 3ZHBA 4WCDA 1GV1A 4OYRA 4BNYA 4AJNA 1I36A 4LN1A 3JYPA 1LDBA 1LJ8A 3RJ9A 3EW7A 4OGWA 4UAGA 1DC3A 3DZFA 3OJOA 3OEYA 4RVFA 1GADO 3ZV3A 2E37A 4M49A 5T6BA 1KVTA 4KMSA 3RI3A 3WGTA 3V2GA 1LDEA 2UAGA 5G0VA 3FPCA 3GVXA 4XB1A 2Q3EA 4PG5A 4TWRA 4UUMA 2HO5A 3V1UA 3UHAA 3CINA 2JCVA 2OO5A 4RO0A 4FBGA 2YQ4A 1PGPA 2VYNA 2E82A 3KRTA 1NQ5A 2VRBA 1Y7TA 3AU8A 3H9JA 4QT0A 4WK6A 1XCBA 3DDNA 3INRA 4Y6PA 3RVDA 5JE8A 2C20A 1UXKA 4BGIA 1FDTA 5K9ZA 2X86A 3BMOA 4L0QA 3IP3A 1M2WA 3TZ6A 4QFCA 3PLNA 2BD0A 5JO0A 3VAZA 4ZQHA 2CY0A 1T4DA 3D3WB 4F46A 3BXXA 2EHDA 2X0IA 3IAHA 1B8VA 3QVXA 1Q0HA 5DP1A 4L74A 4RQUA 3AK4A 5JXWA 4BGUA 1BXKA 3GVIA 3RC9A 2PLAA 2Q1TA 1XEAA 1TT5A 3QVWA 3RFXA 4EJMA 4FW8A 2HDHA 4F6LA 4OJNA 1HKUA 3K9QO 2B4TO 4EZBA 1T26A 3HB5X 3AW9A 3OFSA 4NK5A 2AEFA 3LU1A 4E3ZA 1Y6JA 1BTOA 4IIVA 4IJWA 3UKOA 2NACA 3VHRA 4BNGA 3EZLA 3FWZA 1T24A 3I83A 1X15A 1PZFA 5JC1A 1W4ZA 3U3XA 3OA0A 2GD1O 3I9MA 3D4PA 3W4JA 3I3OA 1L7DA 2NU7A 3VTZA 1QYCA 2CDAA 4D3DA 1J0XO 1J6UA 4L73A 1GUYA 1AUPA 3UH1A 2HKIA 3VPHA 3PYXA 1LBEA 1KY4A 3CPSA 1Y9EA 4R1TA 2OFPA 2WEKA 4R01A 4B4WA 1ZKMA 4OH1A 3AM4A 3HNPA 2Y1FA 3KOUA 2NVUB 3T7CA 5KVQA 2C7GA 1EQUA 1YB1A 2PKRA 4IZIA 2DLDA 1NFRA 1I32A 2NTVA 2P9EA 2BGMA 5B1YA 2OZPA 3NDIA 3R3JA 4WPGA 3WIEA 3JYQA 2HK9A 4CMBA 2HAEA 1NASA 3JQDA 3I5MA 5T67A 1JN0A 4AJPA 1HE5A 1GQ2A 2O3UA 5A3VA 5HWSA 2P4HX 2FRDA 4YRAA 5JAMA 3PHLA 4CQMA 4FIZA 3L07A 2P68A 1QR6A 3DWFA 4J3FA 2CDCA 2AXQA 3C85A 3GNQA 1E7MA 1DIBA 1WDLA 4LCJA 2B36A 3WB9A 3GFGA 3RUEA 1ADCA 2DBVO 2RH4A 4N5MA 2NQTA 4UVDA 1TI7A 5KOIA 1PL8A 4XGIA 1T2FA 1E92A 3ZI0A 3SLGA 3FI9A 1DRWA 1U8XX 2G82A 1PQUA 4YYZA 3ZWMA 2J3IA 1RM0A 2RHRA 2JCYA 9LDTA 2HMWA 1VKNA 4GKBA 5A06A 2ZJ1A 5GY7A 4BNJA 1ENZA 3ORFA 1E7QA 4Z3KA 1W73A 4HFNA 5K6AA 4U0KA 3KLPX 4CM8B 3I9KA 2FOIA 3KYDB 4G5HA 1QSGA 4AJKA 2Q1WA 1M6WA 2GGSA 4YCAA 4R1NA 4CLOA 5BSEA 3F9IA 3JQ6A 5A5EA 1C1XB 4BO4A 4B3HA 2CVQA 3H5AA 1YOVA 1E7SA 1FDSA 3I9JA 1S6YA 5BNTA 5ER9A 1GAEO 3AU9A 3DQPA 3RSHA 2CVOA 5JPIA 4CM4A 2VTDA 2C82A 1R4MA 1NPDA 4DA9A 2GR9A 5B4UA 1HDXA 4GSLA 4Z9FA 3JCZA 1U2GA 1YVEI 2JAHA 4Y6RA 4D79A 1CDOA 1W6UA 4OKNA 2HMVA 5I9LA 4XGKA 1DSSG 3OHSX 1KEVA 2Q49A 2CF5A 4ESOA 2GPTA 4XD2A 1TB4A 4F45A 4GMGA 1UP7A 1DFIA 2D8AA 4YAEA 4JXKA 3DR3A 4BVAA 1GYPA 4EITA 1RWBA 2ILTA 1BMDA 4R9SA 1SOWA 5F5LA 4L76A 1DC6A 5ILOA 1MXFA 3EY4A 4QSMA 4ZA2A 5JLAA 3OICA 4PG8A 5DZSA 2Q2QA 3ZH2A 4I5FA 4Q3BA 4LRSB 1IOLA 4FC7A 3E18A 1VE9A 4I5EA 4AJJA 1ZEMA 3PTZA 1GQQA 3GNTA 4I08A 2DBQA 4R16A 3TQHA 3ENNA 1ENYA 4B4UA 3TL2A 5JAQA 1F8FA 4EUHA 4NFHA 1WZIA 4GH5A 4HP8A 4QXMA 1R0SA 2EWMA 1IYZA 1EQ2A 1C0PA 1YRLA 3DC2A 4RF4A 3GH3A 4DBZA 1Q1NA 5TS3A 1DXYA 1LRLA 3NGXA 4IDFA 2EERA 4OAQA 5ENDA 3GY0A 3PXXA 4PVCA 2Y0DA 4H16A 3BTOA 3BMCA 4CMGA 3B1KA 1QKIA 2ZCUA 2G17A 4ZRMA 3SC4A 2RCYA 1PR3A 3I9LA 3ROQA 1DIHA 1VL0A 1ZK3A 2NSDA 4Y98A 3MWEB 2DBRA 4E2YA 5EIOA 5A9RA 1ISIA 2X58A 4BNLA 4D0RA 4BGEA 1R4NB 1ZJYA 3JQAB 5CG1A 3F5SA 5DCWA 4IXTA 5IZ4A 4ND4A 1AHIA 4J7UA 3VZPA 2NQ8A 2PNFA 1IB6A 4NPCA 3PHHA 3L9WA 2O2SA 4BKPA 4P4GA 1YS4A 1QYXA 4RORA 1Q0QA 1UXHA 1SEPA 2R00C 3QWHA 5THQA 3IDSA 3ICPA 1T4BA 1OC4A 2YW9A 4Z0PA 2VHZA 2CFCA 1A7AA 1U7HA 1HDZA 1LLQA 4WKGA 2AE1A 3MCVA 5AXDA 1LDMA 2Y67A 5DNAA 1PQPA 2ZQYA 1ZNQO 2B5WA 4CMHA 5JY1A 3W4IA 5DBIA 3GDFA 2BGLA 1XQ1A 5JY6A 4MP6A 4YR9A 1I3NA 3F1LA 1UR5A 2DFDA 2I3GA 5JCJA 3V2HA 4BNWA 2P2SA 3JYOA 4U7WA 1N7HA 1EUDA 2VHWA 3GF4A 3WBFA 5B4TA 2D4AA 1ZBQA 1B3RA 3A14A 1EE2A 3IC5A 4M86A 4QECA 5TIIA 4TMFA 3VPGA 5FFFA 1O95A 2HMSA 3E5MA 4FD3A 2JD1A 5GMOA 4NBWA 3DMTC 2IRWA 5COAA 3L4BA 1HRDA 1QLJA 3W6ZA 1DHRA 3DAPA 4JBHA 4WOKA 1CYDA 3R1IA 1HYEA 3F5QA 3O8QB 4IY1A 3VDRA 2X1HA 2A4KA 1GZ4A 1B0AA 2Y0EA 5CG2A 1YBMA 2C7VA 3SBOA 2GO1A 3T4XA 4CR6A 2FSSA 1IPFA 2RIRA 2UV8A 3GT0A 4R51A 1O9BA 4PLHA 3DAGA 5TC4A 2WD7A 5EN4A 2QYSA 1WNTA 4CLEA 1SO8A 1N2SA 4NQZA 2FY8A 2W2KB 3ITKA 1LSSA 3ONEA 3P2OA 4ND1A 3JYNA 1U3WA 1I2ZA 3DZIA 4DPMA 1DRVA 4G2NA 5KVVA 1DFGA 1E1MA 3ONDA 1NWCA 2YDYA 3U49A 4J2HA 4YDRA 1ML3A 1VLLA 3VC7A 4Y67A 5BSFA 3UGKA 2YDXA 3OECA 2PGDA 3PLRA 3F1KA 3UCXA 1MA0A 1ZMTA 1RYDA 2HQ1A 2EIHA 3BAZA 4YAKA 5L45A 1PJTA 3Q3CA 4K1LA 4CLRB 1K5HA 3TFOA 5J23A 1J5PA 5L7WA 3AFNA 3RJ5A 1IPEA 1E3JA 4DMMA 4FS3A 4WLOA 4CMCA 1YDEA 1UDCA 3L6EA 2DC1A 4DMLA 1EE9A 3AY6A 5EJ2A 2PD4A 1V35A 1I30A 4XYLA 1N9GA 1JU9A 1Y8RB 2WE8A 2CMDA 5CPFA 4RV9A 3QVTA 3I52A 1Q0LA 4R41A 1EVZA 4FJ1A 3OA2A 1D4FA 4BNXA 4N5NA 4RVGA 3SX2A 4E4YA 2BH9A 1OAAA 3NJ8A 1IZ0A 1H6DA 1XLTA 4CLDA 4IPTA 2G1UA 2WSBA 4W6ZA 5I7VA 4BB5A 3F4LA 2G0TA 4BO7A 4O6VA 2BLLA 4Q39A 4BL5A 3JQ8B 3IKVA 4NU6A 3DBHA 3FBGA 1LSOA 1Z75A 2JJYA 3ZW8A 2YHIB 1ZVMA 4JLWA 2FMUA 3AOGA 3BMNA 4N5LA 5JS6A 3OQ6A 1K0UA 1DIRA 1NFFA 2VWGA 3AY7A 1PEDA 5EESA 1IULA 1GQYA 4Y8VA 4KTTE 5TJHA 2A94A 2AEJA 1Y5MA 2I67A 3ENKA 3H9GA 3N58A 4IDBA 4CUKA 4P4LA 3RU7A 4E5NA 3K30A 3H2SA 2NTNA 4FFPA 3AM3A 3MTGA 3ZU3A 2EW2A 1HE4A 4B3JA 3KZVA 1T1RA 2OP0A 4FGSA 1K2WA 1Z6ZA 5JBIA 4CLHA 1M66A 3S2EA 4CR8A 3WGGA 3AWDA 1E1NA 1VC2A 2A9FA 5I8ZA 2BFAA 4NJMB 1V0JA 1E1LA 5CDTA 1DAOA 4NZ9A 3GLQA 4A26A 3HUDA 3IP1A 5L51A 3UCEA 2VHYA 5I7FA 5CDYA 4YB8A 3Q9NA 4D3FA 1PJSA 3RCBA 4DIOA 1GY8A 2WYWA 3P7MA 1HLPA 3F47A 4M54A 3DBRA 3K8ZA 1RYEA 3ADOA 1Q2XA 1RM4A 1E7YA 2EJWA 5FI5A 2HLPA 1OI7A 3H9EO 4XYGA 1ZK2A 3W8EA 1NAHA 4DC1A 1D3AA 2JFFA 2FR0A 3DL2A 1I10A 3RUCA 4L75A 3WBBA 1PX0A 1D8AA 2Q1SA 2Q50A 4NFYA 2FN7A 4DXHA 2O3JA 4BKQA 1QXSA 3C24A 2WM3A 5GZ1A 4JN6B 2WE7A 1NFQA 2GUGA 3HDYA 3PQFA 4GVXA 5I7EA 5JFOA 1NYTA 4FR5A 1MG5A 2PGLA 1E3WB 1OBFO 1C0LA 4OQZA 2NU6A 2DKNA 2O23A 4MVJH 3ABIA 2CSUA 1UDBA 4OM8A 1ORRA 3CZRA 1H2HA 2X4GA 2DTEA 2VOJA 3QY9A 3LK7A 1SMKA 1PS9A 3PYMA 3SXPA 4ZU3A 4CM9D 4D45A 3UN1A 1QRRA 4GKVA 1CWUA 2W8ZA 1Z82A 2ZK7A 3V8BA 2GN6A 4EJ6A 4L4RA 1HLDA 3B1JA 3O26A 4JP2A 3TL3A 3V1TC 3RC2A 5L95A 3GAFA 4ND3A 2J8ZA 5KKAA 2WMDA 4ZGWA 5F1KA 2I9PA 1BSVA 3ICCA 4AJHA 4HFMA 5BR7A 1NM5A 2F1KA 2EV9A 3MOGA 1DFHA 3RBVA 4UULA 5EQFA 4FPXA 3WOHA 3NDRA 1SAYA 1FMCA 2Q2VA 1H2BA 1JA9A 3PHGA 1LTHR 1EVYA 1YE3A 3EVTA 4NH4A 2YUTA 1HDCA 3D3WA 4HFJA 4BMSA 3F6YA 4ZQBA 2NADA 2VOEA 1VSVA 2OBNA 3FCOA 4PLZA 3HB4X 4MVJG 1QYWA 4BIIA 2P9CA 4P38A 1E5QA 2B35A 1ZK1A 3SLKA 4MJLA 4BV9A 4FFRA 3DZHA 3JQ9A 3WGHA 2Y1CA 3JQGB 1GZ3A 5GZ6A 2IZ1A 1ISJA 1GZ6A 2GZ3A 3DZKA 4HUJA 3OJEA 4OKIA 4XIJA 1NQTA 3IUSA 1P9LA 3WNQA 3P5SA 2VYVD 3GZ4A 2PV7A 5TT1A 4AFNA 1LI4A 1ONOA 3MJVA 4TVBA 3RBZA 4GVLA 2QRLA 4A73A 3VZQA 4OO3A 3SJ7A 1E0DA 5K6AC 4XDYA 1UZMA 1XYGA 2Q46A 4XQGA 5G2OA 2FR8A 1C1DA 3RIHA 1F14A 4RPGA 2V65A 2EEZA 4YAIA 4L4XA 4OXYA 4TRNA 3DAFA 1KVUA 3EDMA 1DLJA 1NR1A 2I66A 4D0SA 4RPKA 2P5YA 4PLCA 1MLDA 3E5RA 2Z5LA 1H6AA 4GX5A 1WMBA 2WDZA 2NUAA 4YT4A 3WXBA 4CV2A 1E3SA 4O59O 4BO0A 2PK3A 4R68A 2YFHA 5MGBA 1GEEA 1LUAA 3VZSA 5JDIA 4J4TA 3QLJA 3UVEA 5JNLA 4IINA 1ONPA 1GYQA 1QLHA 4IXWA 1YH3A 4FC6A 5C37A 2AW5A 1ARZA 3GVCA 2FPGA 3I9OA 4U6SA 4KZPA 2VRCD 3EZYA 1ADGA 3CXRA 5JMPA 4B79A 3C1AA 1G0NA 3Q6IA 3NEPX 1YO6A 5AXBA 4Z3DA 1LRKA 2X8LA 1GDHA 3KB6A 1T2EA 2AG5A 1E6UA 2YYYA 4DVJA 3W1VA 3LQFA 2BHLA 4R3NA 2DUUA 4BNKA 2BELA 5C7IO 3WX0A 3JQCA 1TVEA 3FR7A 5L4NA 4UUPA 4Z6KA 1ZSVA 4Z9XA 2ZKLA 1R6DA 1YJQA 1M76A 3WGZA 3KYCA 4CODB 2O4CA 5JC8A 1KEWA 3NGLA 4KQXA 5L4LA 3BTUA 2YY7A 1V3TA 1NWHA 3MTJA 2V6GA 4HFRA 4PLVA 3JQEA 1B8UA 3G1TA 3F4BA 3WWZA 1HXHA 3DZGA 5LCXA 1VRWA 4BO5A 3HWRA 2EP7A 4DLAA 1XIVA 5G0SA 4J91A 3C7CB 1H94A 2OXIA 3ZWAA 2AA3A 2NNLD 2NTJA 2PD3A 3IUPA 5DT9A 7MDHA 4D44A 1OOEA 4UUNA 2PKQP 3P19A 1PJ2A 4J0FA 4EYEA 1X7GA 2FPPA 3ZU2A 1VJ0A 4E30A 2AQ8A 4PG6A 1R37A 2YV1A 2NV6A 1HEUA 3RUAA 5G0WA 2V6BA 4BNNA 2Y1OA 4BNVA 4HKTA 2RAFA 3BIOA 4RCVA 4CV0A 2ZIZA 4J2OA 3BMQB 5IN5A 2CDBA 1ZMOA 4CMEA 4FN4A 3IMFA 4OXNA 4P8RA 3NT2A 4JNKA 3UW3A 2O3TA 4IBOA 4BNIA 4IDCA 2NVWA 2HK8A 2D59A 3TJRA 3WYEA 4GQAA 5A03A 3MJSA 1O89A 3PRJA 2H5LA 3QRWA 5A4DA 1U8FO 4B7XA 1P3DA 1QYDA 2D5CA 3E82A 3B20A 4RPLA 5DOVA 3TF5A 1PGNA 3UF0A 3ROPA 5ITVA 4RGBA 4W9NC 3B6ZA 4DYVA 4IUYA 4UVHA 4IIUA 4JJIA 2ZB3A 2C54A 3UAGA 5ER6A 1UZNA 3PI7A 2VTEA 2GN9A 4R9RA 5EINA 3LDHA 1A72A 4BKOA 4CQLA 2HU2A 1EUZA 1HT0A 4BV8A 2GN8A 1A9ZA 1YJ8A 2H6EA 3DBVO 1HL3A 2J5KA 4WCFB 4BGVA 1XGKA 3CZMA 2IEBA 2YQ5A 4FOOA 4MVJE 3ZZNA 1LXCA 2GNAA 4BHTA 3I6IA 1JWAB 1KERA 1PZGA 2F00A 1B26A 3LLVA 3VH2A 4YAJA 4YQYA 1E3LA 3E03A 5L3ZA 3PVZA 1A7KA 4DTIA 1XSEA 4PGFA 4WASA 4B3IA 3ZHXA 1PQWA 1DHTA 3PWZA 4FDAA 4EUFA 1FJHA 3L6OO 1HTBA 4J1QA 2XAAA 3K73O 4PRKA 1IZ9A 1Y8QA 1PGJA 3PJEA 5ICSA 3JD3A 2I76A 2B4QA 3VKVA 4BOYA 5DOZA 5IN4A 3ANMA 5LDGA 3S55A 1RKXA 1ZZEA 3IJRA 5CEFA 3HFGA 3OBBA 4LSWA 4O63O 4AJ2A 2P5UA 2EKQA 1X13A 1N5DA 4NMHA 1KVSA 1C14A 2ZJ0A 5KJ6A 3D0OA 3U4HA 2C29D 2FR1A 2H63A 3FSRA 4YJGA 3INTA 5C7LO 5DN9A 4A10A 1C3VA 5CPBA 4CL3A 1B7GO 4RVDA 1U28A 1X7DA 4WEOA 4QUKA 1EVIA 1E1KA 1HETA 1K6IA 1N7GA 4E2XA 1XDWA 1I2BA 4YAGA 1LC0A 2Z1MA 3ZWOA 4R5MA 5FF9A 4BO6A 4BO9A 3KEOA 1CEQA 1KS9A 4PLFA 4Y9DA 1T25A 4MIYA 5KJEA 3LSYA 4EGFA 4R5HA 4PZCA 1V6AA 4YBZA 3TFQA 5EERA 4O0LA 1K3TA 4MDHA 5G4KB 2PH3A 3RKUA 3B70A 3ZU4A 5L9AA 3FNGA 1NX6A 2CZCA 1BVRA 3FN4A 3WG9A 4NR0A 1ULSA 4TRJA 2O2YA 3EVNA 4YEDA 2E49A 3FRJA 5KWEA 3DHYA 2Q4EA 1R16A 4H7PA 1NHWA 1MV8A 1H9AA 1F8GA 4FSHA 2NU9A 1MFPA 1DPGA 4YQZA 1TLTA 2HCTA 4R69A 4TRRA 3HE3A 1KY5A 1WDKA 3QSGA 3PZRA 4BNUA 1EVJA 2O4UX 2YHUA 3LZ6A 3BMOB 4XRGA 5ICMA 1JQBA 1UXGA 1DAPA 1IHXA 1YQDA 3I1JA 4XYMA 3O8QA 3JQFA 4RLSA 3HDQA 3WR5A 2HSDA 2FHSA 2OL4A 3GK3A 1EMDA 4IS2A 2Y68A 4WLVA 4DL9A 1DEHA 5CDGA 3ZWNA 5IDQA 1LSUA 5ILGA 4C7KA 4NBUA 3H65A 4XQEA 3HJAA 1ZW1A 1KC1A 1FDVA 4WNCA 1EBUA 3VVBA 1BXGA 3Q2IA 3RC7A 3D5TA 1EK5A 1TT5B 1YXMA 1BW9A 4WECA 1MFZA 3H3JA 4PZEA 3STHA 1XQ6A 5KCZA 3LYLA 2X23A 3GOHA 2W90A 3GDOA 2X22A 3KO8A 4I8XA 2IZ0A 4BO3A 3KBOA 5C5IA 1MB4A 3DHNA 3JQ7A 1RJWA 1JKJA 1L7EA 4MIEA 1U3VA 1HZJA 5GZ3A 4NBTA 4I5DA 3KSZO 4U5QA 1WW8A 4IGEA 3CUKA 3G79A 3QJ5A 4YTEA 4TQGA 4Q3DA 4NBRA 1PZHA 3GGPA 1NPYA 5KIAA 5HRUA 1XA0A 2EP5A 2IZZA 1KEPA 2J3HA 1IL0A 1U5CA 4J7CA 1DBVO 4U6QA 1B3BA 3GPDG 3VPXA 4DLBA 4J0EA 4GAEA 2PZKA 1SEVA 3QIVA 4RJTA 1P77A 4WUVA 4CM9A 3ETDA 3WQQA 2AHRA 2V6MA 1JLLA 1CERA 1FXSA 1ID1A 5DP2A 1VL6A 5HA5A 3ZGYA 4AICA 1UAYA 3RC1A 2JFHA 3NT4A 3WWYA 3OJFA 4IDEA 4EEXA 2DU8A 2RHCA 3VTFA 4RVUA 2VUSA 2X0RA 3JQ8A 4OOFA 4E2WA 1PJBA 5CP8A 4D43A 1JVSA 5JO9A 1GCOA 4J43A 4DREA 3VKUA 4YJFA 2H1SA 1PS8A 5MDHA 3WTBA 4ZVVA 2DFVA 3ONFA 4QO7A 3WYCA 5HM8A 4UVEA 2PR2A 4N18A 2WJPA 3RBXA 3D1LA 4Q3AA 3RKRA 1CF2O 3RUIA 4XEHA 2W2LD 3X2EA 4ZJUA 4MKZA 5A1TA 4PIVA 2Y0CA 4B7UA 5G4LA 2CUKA 2HMTA 4OMUA 1EK6A 3OH8A 4NDNE 2X9NA 3W8DA 5K0ZA 1U3TA 2X5KO 3ANLA 3TDKA 5ENVA 1CRWG 2I3AA 1M75A 4TKMA 4YRBA 4E5PA 1P1KA 1H5QA 3D7LA 4BO1A 5IDWA 1YB4A 4FB5A 4B7CA 2VYVA 3UFXA 4CM5A 1W8DA 4CUZA 5AXAA 3IOYA 1ZH8A 3H5NA 1E7RA 5L53A 4IMPA 1XHLA 4PFJA 4E5YA 5T5QA 1E6EA 1YOVB 1EZ4A 2IXBA 3M1LA 1AXGA 3PJFA 2X0NA 4BNHA 3KV3O 5AQ1A 1E3EA 5LC1A 4WCFC 4HNGA 4PZDA 3HG7A 5T57A 3H3FA 4CM4B 1R4MB 1SPXA 4J49A 1DIAA 1MUUA 2CF6A 2ZTMA 4U0JA 4CM6A 3D4NA 4BUCA 5KKCA 3Q2KA 4GWKA 4RVHA 4MO2A 2ZTUA 2JD2A 8LDHA 4HX5A 2E4AA 5TNXA 3WSVA 2FZWA 4GGOA 4J9VA 4LSMA 5F3RA 1BHSA 3PJGA 5AXCA 4ZQFA 3HADA 3QVSA 2D0IA 3DOCA 1E3WA 3DBLA 4CL8A 4CV3A 1O5IA 1UXIA 1DC5A 1DDOA 4NK4A 3WGYA 3RFVA 3JD0A 5BNIA 2W4QA 5DBFA 5EQDA 1Y81A 3O4RA 4CMKA 4GX0A 1AN9A 2PKQO 1A4IA 4WLUA 4CM7A 5COBA 2VRCA 3QE3A 2CNBA 5FI3A 3JQAD 1R0LA 4BQRA 5JDIC 1P1IA 3GEMA 1QORA 3PHJA 3BHMA 4FQ8A 3CE6A 3WLFA 4FJ0A 4PLYA 2QG4A 2JHGA 3LT1A 4TKLA 3EHEA 4TZKA 4KTVE 1P1FA 4IJKA 3QWBA 2SCUA 4PN3A 4LRTB 2PA3A 2C0CA 1Z74A 1NBOA 4XWYA 4RPHA 2B69A 3PHIA 3NYWA 1IHYA 3GZNA 3N7UA 1ZO8A 3E48A 3T7EA 4BKUA 2ZYGA 3JSAA 3QQPA 2BI8A 5G0UA 1BVUA 2HUNA 1JDJA 1DOHA 2DUWA 4BMNA 5CDSA 2WD8A 4G65A 3U9LA 5JAZA 1WDMA 4HBGA 1PJCA 4XR4A 4BO8A 1B15A 1P1RA 3GRKA 5DCYA 4EBFA 4J16A 4XZ3A 1XKQA 2G76A 2VUUA 4OL9A 4RF5A 3M1AA 2ZTVA 2B83A 4KP7A 4MVJF 3GEGA 3WNVA 2A35A 4XYBA 5I8WA 5AVOA 2ZTLA 4CMIB 5A9SA 2QIOA 1OC2A 5F1OA 4WEQA 3VH4A 2X5OA 1F06A 1WMAA 3ZNNA 6LDHA 4U8GA 4RDIA 4YJHB 2UYYA 1O8CA 4TSKA 4ZHSA 3RUHA 5KVCA 1LLCA 4YRDA 4YVFA 2PH5A 4OQYA 3WJ7A 3D64A 1MG0A 4IDGA 5IFLA 2AQIA 3ZU5A 4CMEC 2OP1A 4WNIA 3M6IA 4B4OA 4E6PA 3GPIA 4J4HA 2DPGA 3C7AA 9LDBA 3C3XA 2IYPA 3PWKA 1O94A 4AJEA 4ZD6A 3MJ4A 1X7HA 4R1UA 2WTBA 2BKAA 2B37A 1D1TA 2JFGA 3V1YA 3QWAA 3OMLA 3A9WA 4MKRA 1BWSA 4EJ0A 3OQBA 5AOVA 4M89A 3GC6A 1GUZA 3H6KA 2PTGA 3GG9A 3WDSA 5L7TA 1SZJG 3O38A 3S2IA 1P1JA 5F21A 4QFDA 1WXDA 5KNLA 2Y66A 1OZAA 1U9JA 3PEFA 4E13A 1KBZA 4CM3A 3OJ0A 4N7RA 4BO2A 3EUWA 4LVUA 1ZXBA 5G0TA 5THKA 5CDUA 4JX8A 3QA9A 2VZ0A 1VI2A 3K96A 1LEHA 1B14A 2DT5A 2WD7B 2Y1EA 3CTMA 4FFLA 1HE2A 1WWKA 1A27A 4AG3A 3RUDA 4RF2A 2VCYA 3EGOA 4JROA 3TPCA 3OSUA 2J3JA 3WIDA 4D42A 1ZXLA 5FWNA 3CMMA 1UAGA 1W0CA 1N1EA 1QP8A 2P9GA 3VH3A 2J6IA 2FWMX 2GLXA 2O3QA 4GLOA 4OOEA 3U4DA 3BHIA 2EXXA 4LISA 5JAIA 1ZK4A 3FTNA 3V5NA 2DM6A 3WGOA 3DHEA 1BGVA 3JV7A 3DEYX 3K31A 3ETGA 1ISMA 1YQXA 4MVJD 3NDJA 3VPSA 2O7SA 2Y05A 4II2A 4TRMA 4XQCA 4J7XA 3BMQA 4BMVA 4CMAA 1DC4A 4KUEA 1I0ZA 4MVJI 1FF9A 2ZCVA 2OORA 1GD1O 3PPIA 2ZATA 4IDAA 4I5GA 1N9GB 3IQDB 3MEQA 3PJDA 3TN7A 1PIWA 2UUPA 4A0SA 3ASUA 2IXAA 5TX7A 4MIOA 4MVJP 2HRZA 4UEOA 3Q11A 4J4BA 3LF2A 4P4NA 1U1IA 1QV7A 4OIMA 2GASA 4O1MA 4AJ4A 5T8KA 1C0IA 4A7PA 1KEUA 1PTJA 1PU2A 1UH5A 2NWQA 3ULKA 4P22A 5JCJD 1YONA 2NVBA 3M2PA 1PJ3A 4INAA 3DMTA 2JAPA 3DBHB 1ZUD1 3WTCA 4GWGA 3QWIA 3BMNB 2VUTA 2DQ4A 3G1UA 2WYVA 4GX2A 4K26A 1MGOA 3GN1A 4I9NA 4E0BA 1F12A 1X14A 1EBFA 1AGNA 1JWBB 4K6CA 1ADBA 1P45A 1PZEA 4OHUA 4RVSA 3O03A 3A4VA 4CM1A 2VWHA 3RAJA 1O6ZA 1NQAO 2NVUA 3SJUA 1OMOA 4QTZA 1EDZA 2EKPA 1PWXA 2DTDA 1PL6A 2GN4A 2YFQA 5DDIP 3GAZA 2FP4A 2PD6A 4L4SA 1LQTA 2DBZA 3JQFC 1CQIA 3CH6A 1WLYA 4Q3CA 1T2AA 1Z7BA 2D1YA 2IYOA 2OOSA 1DLIA 1AE1A 2GZ2A 1UJMA 3GEDA 4MOWA 3ANNA 5IZCA 3FHLA 3TOXA 5TRTA 3LLSA 3AUUA 1DO8A 1NQOA 3DBRB 4DUPA 5JDCA 2BMAA 3UICA 1FDWA 2ZB4A 3HDHA 4DC0A 3A06A 1CJCA 4XKJA 1H6BA 4Q3EA 3WLEA 4DPLA 4AVYA 3LC1O 2HJRA 2W98A 3G3EA 3KTDA 3L9XA 3I23A 3PP8A 2G5CA 1R0KA 1X1TA 3GNSA 3KSUA 3NRCA 3MWDB 3PK0A 3DFUA 1JAYA 4Q9NA 3UUWA 4CLXA 2D3TA 2OMEA 5HBRA 1DRUA 1RM5A 3E9NA 4BNMA 3JQBA 3IL2A 4YT5A 2YV3A 3ADPA 1T1SA 1PGQA 4B4VA 2QRKA 1E7WA 2AQKA 3KETA 2VWQA 4ZQGA 1H0KA 2ZYAA 4MP3A 4DIBA 1GPDG 5DBGA 5G4KA 4I9UA 4XGNA 2PWZA 2X9VA 4CM8A 1E77A 2BFPA 3KYDA 2UVDA 5H83A 1F17A 4E32A 2B5VA 5CHEA 2E6UX 1P33A 1X0VA 1EDOA 1R66A 1C1XA 3OIDA 3WMXA 4I1IA 3KUXA 3CKYA 4ROSA 3ZWVA 3U5TA 3QHAA 3L77A 2UDPA 3A1NA 2H9IA 3I4FA 4EW6A 3H9UA 2EKLA 1TA4A 2GCGA 4TVOA 1X0XA 4E5KA 3C8MA 3IJPA 2QHXA 1XWFA 3EAGA 5JW6A 1YGYA 3H4VA 3ZWCA 4JCOA 1TEHA 2VT2A 1VM6A 1E5LA 4YACA 3NV9A 5BQFA 3P2YA 2VN8A 2W2LA 4WGGA 3PGXA 4XJTA 3NJ4A 4ZRNA 4MVJM 3M2TA 3H8VA 1J4AA 5A05A 5TJ9A 3KXDA 4JGBA 3H9QA 5TF4A 2BF7A 2P4QA 1E3IA 1V8BA 1WZEA 4ND5A 4XYEA 3DZBA 5I9MA 4DQVA 3H5RA 2EF1A 4WE3A 3SC6A 2QX7A 4EEZA 1EFKA 3AY3A 2P91A 5B12A 4PLTA 4F6CA 4KOAA 5KVSA 2R2GA 1P1HA 3BTSA 3DTYA 4PLPA 2PGJA 3C1OA 1DIGA 2C59A 3AOEA 3ZWYA 5ADHA 4WJZA 3VOSA 1NP3A 3TOZA 1ADFA 1G1AA 1YL7A 3ITDA 5TSDA 4ZN6A 2PZLA 4FCCA 1IUKA 3GUCA 5IF3A 1YDWA 3AUSA 3EYWA 3HN7A 4F3YA 1C1DB 3L4BC 4UVIA 4C7JA 4WLEA 2E48A 1ISFA 4IQ8A 1HYHA 4K6FA 3G0OA 4CPDA 1CQJA 1B8PA 2C5AA 2NLOA 3LVFO 3U4IA 4K28A 3V2UA 3WQSB 2C2YA 1NPTO 1PWZA 5IJZA 4MKXA 1U7TA 4XB2A 3B1FA 2V7PA 1ENPA 4UREA 1MXHA 1V9LA 3Q0EA 3GN2A 1CIVA 1K89A 3Q1LA 4J9UE 4GPD1 5FEUA 3PZBA 4J90A 4ONEA 3H7AA 3MOIA 3NTOA 4IGFA 3N74A 4DWVA 3PIDA 1Z45A 3EMKA 2UUOA 2QZZA 3DZJA 3ON5A 4WLFA 5B37A 1SB9A 2GF2A 1R4NA 4W7HA 3JQAA 4RQTA 3BZUA 1GYRA 4RLHA 1HDGO 2FZEA 1Y9AA 2R6JA 4GSKA 1P0CA 3BYZA 3E9QA 4RF3A 4W82A 4XQ9A 5U1PA 1EUCA 1ZFNA 5ITWA 1SB8A 1KOLA 5L4SA 1H9BA 4FOSA 1Y5RA 2WWRA 4ILKA 4UVGA 3AJRA 3ZN2A 5CEJA 2GZ1A 4PVDA 1N1GA 4ALJA 2HMUA 3K2BA 1TXGA 3AI1A 2DVMA 4GL4A 4ALKA 3KYCB 3PYLA 2QRJA 3GQVA 3F46A 3G17A 3JTMA 4RZIA 1ZIDA 1GUFA 1MC5A 2D5AA 3HQ4O 4NJOA 3ROKA 2BRUA 2JKVA 1SNYA 2O48X 2RH8A 1J49A 3C7DB 4G81A 4X54A 2OBYA 2VWPA 4BNFA 5A5FA 1MX3A 1EFLA 4PLGA 1Q7GA 1ENOA 1NXQA 4XDZA 5A9TA 4AJOA 2C07A 3OEWA 1JVBA 2GYYA 4E33A 5KJFA 4XX0A 4LGVA 1Y1PA 3TZQA 3ZHZA 4QQRA 3COSA 4KWIA 3GRPA 3FNHA 3W6UA 4E5MA 2Z1NA 2DTXA 1FDUA 3INGA 3NUGA 4KWHA 4LCEA 4DLLA 1FK8A 4O5OA 4FFMA 3FBTA 3WICA 3WQRA 3FNEA 4Z0TA 3GFBA 3D5QA 3GDGA 1JKIA 4J6FA 3L4SO 5L7YA 1I01A 4MINA 4PCVA 1Z73A 3IS3A 3FWNA 3ZW9A 4D46A 5A02A 1P74A 2LDXA 2AQHA 1HWYA 4WLNA 2TMGA 4HNHA 2CVZA 1PSDA 3NAQA 3ROMA 4XA8A 4S3MA 3WGQA 1WVGA 3OQ1A 3JD1A 4OSOA 1BDMA 2W2KA 4N54A 1B16A 1ULUA 2A92A 1ZJZA 1I24A 1BDBA 3GA0A 4XIYA 3UOGA 1N8KA 1YWGO 1YL5A 3GVPA 1S7CA 3C1TA 4GI2A 5BSGA 3PWSA 2DPHA 3EC7A 4YT2A 1GCUA 5IG2A 4ALIA 3K2EA 5A04A 2GDZA 2BFOA 4A03A 1NTOA 1T2DA 3KSDO 4CQLB 2I99A 4W99A 1NR7A 1PS0A 5HS6A 4AL4A 1KIFA 1I8TA 4CLRA 2B0JA 1ISGA 1UP4A 4GMFA 2J5RA 4D3SA 2J5QA 3DMYA 4B8ZA 1D1SA 1P44A 3FPLA 2XPCA 4L8VA 4NBVA 1YB5A 1O0SA 4BNTA 1UZLA 3QW2A 4DIFA 4UEJA 4DRYA 1R15A 3S2GA 5IXSA 1H93A 1ZEJA 4ALMA 1NNUA 4H15A 1V3VA 3MJCA 1Y8RA 4IDDA 2VZ9A 1Z7EA 3NT5A 3ZV5A 2J3KA 3U4CA 2EW8A 1Q7CA 4EDFA 4KDFA 4L9RA 1ZCJA 1LLDA 1Y8QB 2GSDA 3JYLA 3SEFA 2YZ7A 2VQ3A 1IY8A 4IJVA 4BQPA 3PQDA 3VH1A 4ND2A 3FD8A 2POQX 5JYEA 2VYND 1XG5A 3CSDA 4IMRA 3UXYA 2YJZA 4ALLA 2EJVA 3ZWXA 2Q99A 4CQMB 4YWJA 3VDQA 3R6DA 3D4OA 4RPJA 4XRRA 2FPIA 2YHIA 3ST7A 3WFIA 3HZZA 4YJGB 3ZNPA 2PZJA 4EI2A 1A4UA 2V6FA 3NTQA 3DONA 4CMIA 1PR9A 3TZCA 4MVJA 1LDGA 4R4JA 1UDAA 1ONNA 1JKFA 5F1PA 2BGKA 1AXEA 1B2LA 5IAAA 4YJHA 2ZYDA 3I9NA 4Z9YA 1TT7A 4E21A 3ZWPA 4NNJA 5IDYA 4M55A 3DTTA 3O9ZA 3OIGA 1QMGA 4M1QA 4MPDA 4DPKA 5EPOA 4J1SA 3OIFA 3U62A 1U2DA 4XJSA 4JBGA 4A2CA 4BB6A 3PIIA 1UXJA 4BKRA 1G0OA 4J1TA 2AE2A 3PDUA 2QQ5A 4AJIA 4H3VA 4ZQEA 4IQGA 1LC3A 1HF3A 4W9NA 4UUOA 3TNLA 5IXYA 1OFGA 2B4RO 3WSWA 1ZSNA 4KUHA 4NJMA 4JJGA 2AEMA 5JCXA 3JD4A 2X0JA 3JQ9C 4IQ0A 3D3EA 3DOJA 3RROA 4CLOB 2ZB8A 1R12A 5IDXA 2RBEA 3CIFA 4HV4A 1VJ1A 1YBVA 3A28A 3BA1A 3DXFA 4LMPA 2PY6A 1BXZA 1X1EA 5TGDA 2Y1DA 3Q9UA 3GMDA 3PFFA 3U0BA 4CUJA 3PGJA 5T8KC 4QX6A 4JP3A 2X7HA 1YBAA 1U4SA 3WGIA 1LSJA 3PFWO 1DJNA 1ZSYA 4RDHA 3W4KA 4WOJA 4DQXA 1VPDA 5HTOA 1PL7A 5A3JA 3NKLA 4TROA 1VJTA
chains in the Genus database with same CATH superfamily
5BWMA 1X8KA 1FSFA 1G5TA 4L08A 1E9EA 2BR3A 5GQSA 3C6BA 5A3RA 1P0FA 3BC1A 1XCJA 2XMSA 3KVOA 4GLLA 3T38A 4UQLA 3OAAA 4UARA 2C58A 1RFLA 3UAZA 3PU6A 3RVMA 1X8XA 4DR2H 4EUNA 2PG3A 5HYVA 3D3JA 2G09A 3DP7A 5ALRA 1QIEA 2D3WA 2G88A 1OI2A 2RGAA 3PXEA 4KJZA 4KXLA 2D2XA 3EE6A 3O4IA 3RU9A 1DQZA 4RM3A 2YVUA 3EG9A 5KI6A 4D7AA 4LA4A 3AIKA 1B93A 1ESCA 4D41A 4DLUA 4FS8A 2F8TA 1Z56C 3RTBA 2HA4A 3M6XA 1RI4A 5DHTA 4FXOA 1BRMA 1K6JA 4I14A 4IS3A 2C1EA 2PFGA 3AVYA 1UUFA 4IFEA 4Z9AA 3BHJA 4FINA 5ALUA 3AFMA 2NZUG 3URKA 1CZOA 1E2DA 1MB3A 2XIJA 1H6CA 4HBZA 3ZCXA 2FDXA 3RTEA 4DT1A 4PG7A 5I4IA 1Z17A 2BFFA 2IELA 2E21A 4D5GA 1STOA 4CQMD 2B4YA 2H17A 1JKJB 1MC4A 3JS5A 2OGTA 4K9DA 2CVFA 1E9DA 2XKJE 2EG9A 4GUAA 2VS1A 3LO8A 2HU7A 4HLUC 4M9RA 4MV6A 2C5EA 2YCBA 4JBIA 2RD2A 5TQJA 1J1IA 2CK3D 4GLFA 2QV7A 2IV2X 1WHTB 2W6JD 3FJ1A 1M5UA 4OU5A 2OGUA 4YI3A 1UBTS 3TZKA 1Z0KA 4UZSA 1U3UA 1WPQA 3TSOA 2QLNA 4FGWA 5FOVA 1I3MA 3K6JA 1T9BA 4A27A 2CXRA 5IPFA 1KF0A 2GXSA 1X9ZA 1UADA 2AOUA 4O5AA 4GSYA 2VXYA 4ISCA 4BJHB 4R6WA 3Q7TA 1OFUX 3GGGA 4P0QB 4GKKH 2L82A 4FZRA 1I7LA 3I1FA 4JL8A 3CMCO 2ZXUA 3RADC 4M1MA 3S2FA 3WNZA 2WB4A 2R8OA 2ZJ7A 1TUEA 2CLCX 2WT8A 4AZSA 1U0HC 1Y98A 4ZV9A 1KYVA 3F5FA 1XZIA 4D98A 4PC2A 4RZHA 5ITZB 3H87A 4ND8A 1F4VA 2JBAA 3R7LA 2HLHA 2QRUA 2FPSA 1GFSA 2GERA 4MIKA 4OHOA 5EI5A 2F48A 5KJ1A 1E1YA 1P4RA 4UCXA 2FOLA 3JD2A 3KYBA 3LM8A 1KDTA 4O1IA 3WOVA 3RVJA 3W34A 3ZV4A 2EOAA 1CE8B 5FDFA 2D00A 1Y3BE 5D51S 4R3WA 1J2YA 4KDEA 2JAWA 4C6TB 3LP5A 2JKZA 2YNMA 4DYDA 1ZYUA 2WDPA 3EULA 3PR3A 3WGNA 3GJYA 1XZDA 2CD9A 3MJEA 4MW0A 4F8JA 3U7EB 1HFEL 4L28A 3R5FA 2AYXA 3RSGA 2IHTA 1KO4A 1XRSB 2GRAA 4I2VA 4IV8A 1RVV1 3E1KA 4IIBA 5JSFA 3Q41A 2A30A 1CUJA 3N0WA 1VP3A 4DM3A 4IH4A 4ON9A 3O73A 3CGGA 4MQ5A 3RS5A 6ADHA 4MAFA 2FJ0A 4J2TA 3HJBA 5IJ0B 1BE6A 3IKLA 1GV0A 5LB4A 4URXR 2II6A 4KQMA 4WV3A 3SIRA 3ZNQA 5HZMA 3BWXA 1FRQA 1LDNA 1A9YA 1TMYA 4REQA 2X7JA 5DNWA 1QZUA 2P9YA 1NNLA 1W1IA 4F4JA 3SFTA 2WA2A 1SWVA 2XMPA 1JGTA 1Y3DE 1Z06A 2IVZA 4FHEA 3DLIA 3ZWKA 3K70C 3ZDCA 1WY5A 2C3YA 2QRPA 1JS1X 5DW3A 2WYUA 3MINB 1TZJA 1E6KA 1HA3A 3DTNA 3I01A 3K2QA 4NU5A 1YS9A 3GHHA 5ALNA 5EE0A 4DG9A 4TZTA 1IAQA 1H42A 3EVEA 4CDGA 4XH9B 4LF7H 4EATA 1JEOA 4YGYA 3MSCA 4JHXA 3QMVA 4QKQA 1WCIB 4NZYA 5B3JC 3G59A 2A33A 3AOEC 2PCJA 3RUFA 3RS0A 5HF9A 5IJAA 3EGXA 4NV1A 4M9SA 3DOFA 2YBDA 1VXOA 5JH7F 3QLVC 4U6NA 5TQ2A 2WA1A 3ICQB 2RGNC 5JS1A 3INNA 3AC0A 4MRAA 4R2MA 5D01A 3CRMA 1VL8A 4K3VA 3PRYA 3T1QA 1HZZA 1WBJB 6PFKA 4PTLA 4ESVA 7ADHA 2FUCA 3THWA 3AVWA 5DGTA 2EGGA 4PV7A 4X1KB 6NULA 3E4CA 3RYIB 3KQQA 4AWXA 4WVLA 4JUAA 5AHRA 3LT4A 6CHYA 1IQRA 1LBTA 1FNDA 2R85A 1ZD5A 3HSKA 1ISHA 5IVPA 3NM4A 5CVCA 3HN2A 4YCCA 2G9VA 4FFDA 2HSZA 1XR3A 1PI3A 2FCAA 2LV8A 3DO5A 3I2IA 3NHFA 4Q9DA 3ZWBA 4M8SA 2I6TA 5JRZA 3M5PA 1JF8A 2Z4TA 4DS3A 1W47A 4FGUA 1UP6A 1V3UA 4EGQA 1FSZA 4H0NA 5CDFA 3LPNA 2AKEA 2NP6A 2G9QA 3G49A 5ISMA 2OC4A 3T1YH 3MBKA 2BMDA 1J2RA 1KZGB 2ZIAA 3L1JA 2W11A 4BBPA 2C7PA 1I3OA 2B2XA 4PZUA 4EVIA 4M1TA 1KJYA 4I1RA 2D6FA 3K5WA 1ZVQA 4UD2A 1XA4A 4A5OA 4ZVTA 2B5OA 3MWKA 3MQ2A 5JNRA 2N75A 3C8ZA 3S1AB 4M87A 2I8CA 5CXUA 2QTVB 3D6AA 4OATA 2LR0A 5E4FA 4BIMA 5FUBA 1MH1A 1SQ6A 2HFJA 5D3KA 5DN6D 2MOKA 5JVDA 2Z30A 1A71A 4HDSB 3BSWA 5C18A 3SSAA 5LWQA 5ALGA 1BROA 3VFDA 3ROFA 3QQ5A 4R1SA 3OI7A 3VTAA 4UBJA 2V74B 2VF4X 2WWWA 1D6NA 1P31A 2JHFA 5DYIA 1G42A 2HIGA 4QU8A 5LYJF 3GRFA 3BE5A 3CISA 2EIXA 2FPXA 2J9FA 2ATCA 3R0IA 5F5NA 4EKEA 1QTIA 4M1EA 5ILQA 3ZWWA 1R6AA 1YR8A 4JB2A 4QU0A 3G9UA 1KDPA 1EG2A 4EA8A 4A8TA 1QK4A 2Q1XA 2VHXA 3IEIA 3DMHA 3WRYA 4BLTA 1PV1A 2BFEB 1KC3A 3DFZA 4S1PA 2H57A 5J1TB 4OG2A 4BMPB 4YT8A 1P9OA 2JDIA 3U17A 2IE0A 3OM9A 4E31A 1LV8A 3VSBA 1K6XA 3DB2A 3TRIA 1D7OA 3JX9A 4JIMA 2OK8A 2YY6A 1QTNA 4MRSA 4LXXA 5TT0A 3UJ9A 4M21A 3BXEA 1I5RA 3ILVA 3ZQ6A 1GTMA 3D6UA 1E64A 2J9RA 4RKWA 3PD0A 4HT3B 1YQGA 4I9GA 3IOMA 2G0AA 3FOZA 4NBNA 4IIJF 2B6HA 1F0YA 4U7PB 5HOQA 3LOPA 3W5CA 2DSTA 4G0WA 4MLZA 2F3TA 3OHPA 4CMJA 4GOOD 1EI9A 2BPOA 1LTQA 4W7IA 1AV6A 4V3CA 2ENWA 2ZCJA 3N2NA 4GMKA 5I3ZA 3HYTA 3OP4A 1N2CB 1NZFA 5U9CA 1YJXA 1BH2A 1BMQA 2TMDA 3V4FA 4AJ1A 1BNCA 3CVWA 2KYRA 2N47A 4MRRA 5EMKA 5CBKA 2GHRA 5BN1A 2ZB7A 2J6BA 1G38A 3WLIA 1LI7A 1G8MA 1TU0A 4LWQA 4X66B 1Z29A 3VTKA 3ED1A 2BEKA 1HYGA 3AW8A 1JSXA 4MHSA 4PGAA 4FKBA 5I7RA 1MP0A 2WKRA 3KQPA 1EJ2A 1RP7A 4QGBA 2C8VA 4G4GA 4S1VA 4X85A 5LP1A 5HQ3B 1AS3A 5FT9A 4LFBH 2Q5FA 1U90A 3I2HA 2C8JA 2WOJA 4R9UC 3TI7A 4JI8H 4KE8A 5A62A 2BV3A 4TL8A 1TD9A 3TIGA 1FDIA 1D09A 1GL9B 4B6FA 2LE0A 3ZHBA 4RIIA 1KH1A 2XUJA 1U9ZA 3G88A 3IPCA 4F0JA 3SN6A 1B76A 3VR4H 4AJNA 3A9CA 4HNTA 3O47A 3WRXA 4DMUB 1TZMA 4KK3A 1KI4A 2ZGVA 3EW7A 4OGWA 3DZFA 4UAGA 3OJOA 3TUJC 2PUWA 4RVFA 1GADO 4RWEA 8ABPA 4WX2B 5T6BA 3ZDBA 3FPHA 3WGTA 5G0VA 5LLSA 4Z4EA 3UB4A 3OESA 4Z1OA 3HCAA 1CUEA 3EFHA 1EP2B 5A6VA 1JPJA 4TWRA 2P9QA 1MDFA 3LL7A 4KQ9A 2OO5A 2YQ4A 3QF4B 4JXZA 4UE6A 1PGPA 4HS4A 1RACA 2CEAA 2VYNA 2E82A 3ES9A 2QMHA 1KJIA 1NQ5A 1OBCA 4BFXA 1OJLA 1E0KA 4RLFA 3AV0B 3H9JA 2XDWA 1B1CA 3U3DA 3TW6A 4Y6LA 1Z39A 4F21A 5C5DA 2PT7A 2OO3A 4HI0E 2I91A 1TJNA 4R8LA 3VO8A 5K9ZA 2FP3A 1HX7A 2FQWA 4M9QA 4B17A 4X7RA 5CB4F 2ZT6A 4TKUA 1M2WA 1IZ8A 2AWOA 3B89A 4ATNA 1GOTA 4MAMA 1GJRA 2QX9A 1WUHS 2REOA 4O4IA 4UEWA 4ZQHA 4TWAA 1M2NA 2CVPA 4DM4A 1UK7A 2EHDA 1FNBA 2X0IA 4F46A 4MLDA 1B8VA 1VFPA 3SZMA 5JIBA 3GL9A 3QVXA 4R1LA 2VLBA 3FTCA 4EL5A 4L74A 4RQUA 3F0TA 4ARIA 2KQUA 2KMLA 4Q7EA 5JQGB 2BGRA 2H1CA 2PLAA 3PFGA 2F4NA 1USGA 1TT5A 3QVWA 4LXYA 2PNJA 3SSOA 2C7RA 2ZUVA 3ERCA 4M9XA 4EMTA 1KZ4A 1ZIXA 1V16A 1E8NA 4OJNA 4XIIA 3D31A 3VU1A 1G7RA 4WXHA 1T26A 3PUKA 1ZS9A 4HDQB 4KHPH 1Q3KA 2AEFA 4KX5A 5H5JA 4IJWA 3Q72A 4D81A 3WWOA 4PHCA 4BNGA 3P45A 1QGOA 3EZLA 3DKIA 4JI7B 1H8EA 3OHMA 1X15A 3CVUA 1QPZA 1W4ZA 4N6OA 1RYYA 3B8EA 3OA0A 2R8BA 1ACMA 3QMWA 4DDMA 1JALA 4LWPA 3FWPA 1TF7A 4NSNA 4JI6H 4LRYA 4ZPJA 3KPVA 1JHOA 2AIRA 2O57A 5SZHB 3U61B 1BGXT 2NU7A 3VTZA 4UTRA 4I8DA 4FCTA 1NIJA 2HV9A 3UT5A 1JSLA 5MHTA 3IDOA 4D3DA 3FFWA 3AUYA 3D3KA 4J0JA 2CN1A 1MH9A 1IY2A 2GT1A 2XMRA 4L73A 2OZLA 3W5SA 2PXCA 5AVXA 3PYXA 4I55A 1UMBB 3HBMA 2NUAB 2X2EA 2CL6X 2J08A 4Z7NB 2HSWA 3CPSA 4R1TA 4UFNA 5IP5A 2HU8A 5GAJA 2IIPA 1KSJA 3DOIA 1IUOA 3C3CA 5EJFA 4P7JA 3PGKA 3T7CA 3EA5A 5KTNA 4N5HX 2FFAA 1YB1A 2LKDA 4FOPA 2OGZA 4IZIA 4D80A 3I6ZA 4KO2S 2BGMA 4MR7A 3NDIA 3R3JA 2NYRA 3G8BA 3FROA 1FJGB 1LBIA 4AS2A 2HK9A 3MHTA 4B35A 1U1EA 1Q17A 3WL7A 1M7GA 5E7IA 3I5MA 5T67A 1OXUA 1W76A 5A7HA 2P4HX 3EUFA 2IXFA 4BFSA 3O6VA 5JAMA 3PHLA 4G8DA 2RGYA 1JJBA 3G0GA 3L6CA 4OUKX 4ZPXA 4ZVKA 2H31A 2P68A 3GZTB 2IT1A 2ZAIA 4J3FA 2B4KA 1Y0BA 3GNQA 3H4TA 3HK2A 5TF0A 5FBKA 1DIBA 1WDLA 1XK7A 3Q88A 4L2IB 3DE0X 3QLUC 4EW3A 3JASA 3AF1A 1QRDA 2DHCA 5HKKD 2CK3A 1TI7A 3AZQA 5DRTA 1T2FA 5B5SA 1ZR4A 4Q15A 1E1QD 2ZR8A 1L5ZA 2PSFA 2G82A 3AR5A 4L72A 2G4CA 5CB4A 3H9CA 1RM0A 3NORA 1YQEA 1R0ZA 1Z13A 1A9QA 3VGJA 4O3FA 3FMOB 2H65A 2ZJ1A 5GY7A 4EAQA 3HABA 4UBOA 3HR4A 4KIFA 3ORFA 1XJ5A 2VYQA 2I03A 2OD2A 2OPBA 4LAFA 4CM8B 3HXQA 1OX4B 4LZJA 2EQBA 3G9ZA 4AJKA 4FNOA 4M1YA 4INOA 4A6DA 5H80A 3PC8C 2GGSA 3KCNA 3T3EA 5K3OA 4YCAA 5FR2A 1QOPB 1ZVJA 5BSEA 3K6RA 4G09A 2XCSB 3NBMA 3LTNC 3CHYA 3PT5A 3H5AA 2RI1A 1TM3E 3EDQA 1UK8A 3RSSA 3V6LA 3R20A 5BOSA 1S6YA 4QUIA 5BNTA 1XPUA 3FOBA 3V42A 2ZAYA 3CX7A 1BWQA 3FNIA 2VTDA 1E2FA 2HQOA 1NPDA 3R3VA 4DA9A 4TLCA 3AFOA 3THYA 5HJEA 1F6BA 3D9QX 3JCZA 3VA7A 5AK0A 1G1MA 2FVXA 3TKAA 1PSWA 1V6SA 4C2AA 4C3UA 5E8JA 3D2LA 3DEJA 1L5MA 1QZXA 2P6UA 5LMZA 4YY3B 1DSSG 5A5VA 4PBRA 2IPXA 4R8SA 6Q21A 3UGJA 4LFCB 5IVDA 2CHQA 2GPTA 4XD2A 4GMGA 2WAMA 4KFSA 1X3SA 2D8AA 1KL7A 4LX0A 1QVZA 5ARDA 5F33A 1REQB 3W5VA 4BMOB 5K0GA 1YRWA 3G6WA 2UZ1A 3NIGB 4B6GA 2BTQA 3I0ZA 4ENQA 1Y6QA 4DQKA 1FQWA 3EXEB 1MXFA 5ILOA 1N36B 1H2RS 1HOTA 3EY4A 4QSMA 2PH1A 3C6KA 3DWGA 4ZA2A 3SE7A 4PG8A 2M8WA 2Q2QA 4DOMA 3HVIA 4I5FA 4LGYA 4RVCA 3FZQA 3PTZA 1K9VF 4L22A 1ZGAA 4ML3A 4D4MA 1O6BA 3M6VA 4FCWA 4QU9A 1O0CA 5KDLA 3ENNA 2GETA 1F8FA 3N7TA 3NVMB 3PLAE 1MJNA 1OZGA 1R5NA 2E4ZA 1TZBA 1OUMA 1WZIA 1PE0A 2WICA 4G6ZA 3BSFA 3UWMA 2EWMA 5FPSA 1U2ZA 1NDHA 1YRLA 3DC2A 2WK1A 2TYSB 3QKTA 5BSWA 1ZD8A 5K3CA 3GH3A 3M82A 1GZVA 2DY0A 2XB4A 1Q1NA 3PRKE 4GLBA 3ZH9B 5AFSA 3NHKA 4ZI5A 3EPRA 1DXYA 5BVHB 4HCJA 1RKQA 4NPHA 1KWGA 2AJLI 2ZVJA 2UUCB 4Q9LA 4IAOA 3KJEA 4PVCA 5KYXA 1W94A 2JAOA 1XAHA 3IP9A 3OUTA 1WF3A 4GEGA 5LN1A 2XB6A 1BFKA 2PANA 3A1DA 4N6NA 1B8NA 4HQRA 4RQBA 4CMGA 2FPOA 2BZ1A 3UK6A 3GBPA 3RIYA 3F74A 4L9WA 4ZRMA 2WVAA 2N1MA 3IO3A 3SF8A 2ZTSA 4KO8A 5IFKA 3UMMA 4RD4A 1UM9B 4Y98A 3FZGA 3PC2A 1ZRNA 5EIOA 5DT2A 3CH7A 4WMLA 3STXA 1OCEA 1L7NA 1QZZA 1R4NB 2A8YA 2C0QA 3HWWA 3UAVA 4MEAA 2B8WA 3SX4A 2AH5A 4IXTA 3X1ZA 1NC1A 5TV2A 3GP3A 3KELA 3CVJA 3PNBA 5AKKA 1IB6A 4JQSA 2XGOA 3PHHA 4NPCA 1NZDA 1Y9JA 3TFWA 1J2TA 4X62B 3W9SA 4P4GA 1HNXH 1QYXA 1V2HE 1Y3HA 4QWMA 3RYHA 2R00C 1YE8A 2EZUA 3EXIA 2JI7A 3QWHA 1OAOA 2Q5QA 4KLZA 2YW9A 2GDJA 4DEYA 2ZBDA 3IV7A 3K16A 1EU1A 1U7HA 1A7AA 1SR8A 4G2TA 3A3KA 3T99A 3V7YA 1IY0A 1NL3A 3WLJA 2C7QA 4WKGA 1HC7A 2XSZD 2AE1A 2RGUA 1NKVA 5AXDA 2CTJA 1LDMA 2W83A 2Y67A 1TCCA 1PQPA 3F2VA 4Y18A 4EG8A 1P6XA 1JHMA 5FEMA 2CNDA 5AM4A 3SIXA 3PC6A 1BCRA 2ZUCA 1WA5A 5FWAA 5JD4A 3W4IA 2ASVA 5AW1A 2BGLA 2CMFA 5JY6A 1UIRA 2EKBA 4MP6A 5DN6A 4GNKA 3V2HA 1P2BA 2ODBA 1NA5A 1KO5A 3FYUC 4KXFB 3U4MA 1SRRA 3JYOA 1N7HA 2A0UA 5JASA 4H4EA 4HGPA 3GF4A 4XX0B 2GOYA 1U8EA 5HFAA 5B4TA 2VPYA 4G0ZA 4AMBA 3TBFA 2WWVD 4PBTA 1T9HA 4DEVA 3AUJB 3A14A 3ESBA 4D8TA 1NATA 1VIYA 4HQ6A 5FFFA 3TI9A 3ZE6A 5BW8A 4US1R 1PTJC 1MX5A 3G85A 1RRFA 1KA9H 4X90A 4WW0A 4E9JA 8ATCA 4YRTA 4EC5A 1IWBB 1XP5A 1VIVA 2JD1A 3B1VA 2G67A 5GMOA 3DMTC 3ACCA 3IIMA 4CKWA 3TQFA 3ZE1B 4OLAA 3PF9A 4NENB 1VB5A 2Q29A 2AFHB 2A6PA 2QUHA 4Y9RA 2AOXA 1N2HA 3VDRA 3OMWA 3F2IA 4Y1FA 4LQDA 1U04A 3N75A 4BAZA 1DTWB 2YCLA 2YMPA 2FSSA 4FFBB 4I8IA 3RG2A 3NS7A 3RWMB 3GT0A 1CJUC 3IQHX 2YFKA 1IN1A 4CKEB 3NBQA 2O8BB 2AKYA 3EWNA 5EN4A 2AV6A 1QM5A 2QYSA 3CLRC 5HMLA 4CLEA 2SKEA 1NGSA 2WHEA 1MB9A 4IFDG 2W2KB 2ZIUB 3AEQB 4LEIA 3TVDA 1RXIA 5B1HA 4WK0B 3L8CA 3JYNA 4KGZA 4ND1A 1V71A 3NOOA 2AZDA 5EJGA 3UKJA 4B4DA 5AM0A 4ZOLF 3ZCSA 1I2ZA 1WQ1R 2GZRA 3SFZA 4MS3A 5FWXB 2PT9A 2N42A 2VJMA 4RH0A 1DFGA 3ONDA 1XRHA 2YDYA 4YP0A 1DZIA 4E1AA 1ML3A 1V8PA 1VLLA 3RR2A 3VC7A 4EGCB 2WZDA 1H4QA 1UJNA 3HY3A 1WCYA 2XUGA 2Z9BA 3UGKA 3L0CA 3OE4A 1Y1TA 3OECA 3PLRA 3UCXA 1MA0A 4AWBA 2LRRA 5ERXA 1WMEA 3LKZA 2WB2A 3KU1A 5L45A 1NUSA 3FVWA 3O93A 4LYJA 4A82A 4ZU1X 1DJOA 3OX4A 1J4WA 4HWPA 2VPTA 4IWXA 3KTAA 3CWQA 3LDFA 3WHKA 2IPLA 1WB4A 3AFNA 3PNKA 1YFJA 1IPEA 3B13B 4CT0A 3RYFA 1DXQA 1SXGA 2H8KA 2I4LA 4TTTS 5CFOA 1Y7IA 3PR2B 1HR0H 1UDCA 3NAMA 4MV9A 2XDAA 3S3TA 2ADFA 4EKIA 5DNCA 3CSUA 3AY6A 2FWAA 3K9BA 4EB6B 2OG2A 1V35A 5D1NA 1I30A 4O0MA 1HV8A 1N9GA 1RQPA 1E2JA 1NQVA 4YRSA 2CMDA 3M5CA 2CB9A 5JXJA 1R88A 3ZBQA 1FVOA 1P6QA 2BUCA 1P4JA 4LF7B 3T1HH 2QROA 4FJ1A 4QD3A 1HUQA 1KHTA 4DR5H 2CUZA 221PA 4XWTA 4KPEC 4J6EA 4CLDA 1DXOA 2BKVA 4E4YA 1QIDA 3R5TA 1IZ0A 3AR9A 1H4TA 4PYKA 4OB8A 3W2HA 1L4FA 1QIFA 2G1UA 2WSBA 2XVXA 1U0FA 4IPTA 4N0QA 3F4LA 2WJZB 1A98A 5DGCA 4BB5A 1TF2A 1RCUA 4O6VA 3NGMA 4M9CA 1ZD1A 4B40A 4BL5A 2X19A 3PQEA 4ZI7F 4G1FA 5HF5A 2GN1A 4AQ7A 3IKVA 2NZYA 4BFZA 4Q9KA 1DBIA 2YVKA 4ZDWA 4NP6A 1Z75A 4OJYA 2FPIB 3K15A 1H1DA 5DLDA 1VYUA 5CCDA 2W5UA 3L7LA 3AOGA 1PUXA 4N5LA 4A8PA 3BD8A 1K0UA 4IRXA 1DIRA 3SYKA 1AGRA 5IJXA 1TOAA 3UJAA 1PEDA 3O8CA 4Z1MA 3LWBA 4TVKA 2QR2A 1QDEA 3I1YA 1K86A 4CL0A 4ENWA 4P2GA 5CIYA 2OBXA 3C74A 2GFQA 3M9WA 4OKSA 2G9ZA 4EPTA 1QGUB 2I67A 2IEIA 2WU0A 3CLKA 3QPVA 4CUKA 3DHWC 4P4LA 4KSBA 4FBMA 5H4HA 4E5NA 4EM6A 1APBA 3H2SA 1RXCA 4Y0VA 3B12A 4FFPA 4DJFC 4LZOA 5AKEA 2DLNA 2OY0A 2BE7A 4FE4A 1J0DA 1RQRA 1T1RA 2OP0A 4C6RA 2G4LA 3ZVKA 5KYWA 1K2WA 2QJRA 1Z6ZA 3T3OA 3KD2A 4B76A 4M9ZA 3S2EA 4H6PA 4L78A 3DDWA 3PNMA 1OWNA 4BQEA 2HDOA 4ERNA 4YUWA 3H97A 4K81B 4ESHA 1G18A 1SHJA 3IEXA 4CF3A 3OX2A 3OLCX 1TCUA 3OD5A 3HUDA 1M1NB 4RM2A 3UCEA 3MA0A 3V4SA 4O08A 3IXLA 4D3FA 5AICA 3RCBA 2R8PA 1GY8A 2VP9A 2WYWA 2ZLBA 1HLPA 3DTVB 3P7MA 3PUIA 4UBLA 4N1AA 4ZCQA 5EHXA 3UMJA 3ADOA 1OX5A 1ID8A 1C81A 5FI5A 1P60A 3C6YA 1ESNA 2Q6KA 4DC1A 3NTUA 3BE6A 2IHVA 4OY3A 3C43A 2GTIA 4RTOA 2RJ3A 3I8SA 2AR7A 3RUCA 4L75A 4DR3B 2HFKA 2CZGA 4RWZA 2FOXA 2Q1SA 2VDWA 2FN7A 2IDMA 2O3JA 3ITNA 4JOQA 2WV9A 4KIWA 9MHTA 3A36A 4JN6B 4UM7A 2CL0X 1RRKA 2WJVA 3TM4A 2BEUA 1IQPA 1NYTA 1P7WA 4GBMA 4FR5A 4O4LF 4TT3D 4BV3A 5DGHA 4LXTA 1BS2A 2XE6A 1EGAA 3LBYA 2JHCA 3U6BA 3BB1A 3GLIA 4MVJH 4X0EA 2IP1A 4OM8A 4U2EA 2DTEA 2ZR0A 1SMKA 1T1IA 3PYMA 2OBBA 4KLAA 3FPJA 1K97A 3ELDA 1JEEA 4IOLA 3G9QA 2W8ZA 5IT5A 3EXAA 3MCZA 4ZJZA 5SICE 3KUDA 3KVYA 5TMEA 4HZUB 1S96A 1E9BA 3OM1A 3ER6A 4L4RA 1GILA 1L4NA 2DUNA 4FNAA 4NCKA 4PAQA 4ZEWA 3WP1B 1U6JA 4WK2B 2E1PA 2HWUA 3GAFA 5L95A 2J8ZA 3Q87B 3SQWA 3H3XA 3KNZA 2JW5A 4R8RA 1U7OA 1YZTA 1SURA 3D2AA 4AJHA 4C0SA 4PZZA 5BR7A 4PQRA 2G5TA 3A4IA 1NM5A 3MOGA 1WS6A 1OXMA 2PSSA 4OP1A 4RHCA 3RBVA 4LPSA 2O1EA 5HKAA 3D3QA 4FPXA 3UQZA 4K9QA 3WOHA 4D9HA 1SAYA 2XE8A 4ZOQI 1WHSA 5HKKA 2JRCA 2J0UB 3PEVA 1H2BA 1BJKA 1YU6A 4YRPA 3PHGA 2GJSA 1V45E 5LP6F 3BIFA 3FYDA 4TSFA 2GLTA 3BCRA 1E1QA 1XZNA 2AFRA 2F8MA 2MYTA 4TGLA 4BVEA 3EVTA 3D3WA 3OEED 4HFJA 3LFTA 2ZJ6A 1EJ0A 1UANA 1VSVA 4EYSA 4MVJG 4JFRA 1BHO1 1QYWA 1C30B 3NQ41 4ZMRA 3VJMA 1NOIA 4LFBB 3MTBA 4KIUA 4WK4B 4JI8B 2QZJA 3GU3A 3SLKA 1WKVA 3DM5A 5HEKA 3T3DA 4ZAXA 2FDCA 3JQ9A 3VSAA 4HAUA 4KQGA 1GGHA 4MYTA 1ISJA 3PNSA 5GZ6A 1JFTA 2GZ3A 2RONA 1QIIA 2OSVA 4HUJA 3OJEA 5GV8A 5IDXA 4XIJA 2OV1A 5T41A 4OK6A 4G25A 2GBIA 4KVGA 4CBVA 4R31A 5LXTB 1SBIA 4P93A 4AFNA 2BCGY 2GA9A 3QELB 4POAA 1OU4A 5H0IA 4A73A 3M6LA 2Q1YA 2XUDA 1CIPA 4Y2QA 2H59A 2CTLA 2PQ6A 4E22A 5C5EA 4Z7QB 4MVXA 2XB2A 2Q46A 3I2YX 3K6SB 4EJSA 2MIIA 5G2OA 2L69A 4EHDA 2FR8A 3NOVA 1XTUA 3RIHA 4LDJA 4RPGA 2EEZA 3V80A 1W44A 1E4VA 5ALOA 5HBGA 5F7OA 2RK4A 1SHUX 1WVMA 2V45A 1KVUA 1JSCA 2ZJYA 1DLJA 4B3CA 4EKGA 3MT0A 2IUEA 2K7FA 2I66A 1FQJA 1KSFX 2HJVA 5LMCA 2BP7A 2QLTA 3CPEA 1BN6A 1G9XA 2Z5LA 3E5RA 1H6AA 3ONVA 1WMBA 4RZUA 3K0CA 4WY8A 1DQNA 1FFXB 3S2YA 1DQYA 2M6RA 1KE1A 3T5BA 4ER0A 1DKNA 5IHPA 4CV2A 4E51A 4B46A 4BO0A 3EPPA 4HDNB 5J3JA 4Q82A 2NV2B 5AJHA 3FETA 3L7DA 1ZW6A 5JDIA 3MAJA 4J4TA 1IB0A 5B7NA 4LF5H 1Y4SA 1NN5A 3QLJA 1PR1A 3CB4A 2EX0A 4H6WA 4LJ6A 4EECA 5JNLA 1ONPA 3H1GA 4IXWA 1JA1A 2CHFA 3EB9A 4IH9A 2C2ZA 5C37A 5DW0A 1SXPA 2GVZC 3S6JA 1NW6A 1ARZA 1BFUA 2AW5A 2FPGA 3GVCA 2Q7XA 3H4MA 4U6SA 1P6UA 1VGQA 4KFTA 3EZYA 4TMZA 4ZYUA 5CFRA 3CR7A 3CXRA 3EDRA 5FV4A 1H3FA 1MO2A 4P54A 3NIWA 1Y9ZA 3OZ7A 4I5IA 3LQ4A 4MWEA 3THXA 1QH8A 1TADA 1E6UA 2CFOA 1VIAA 2C42A 1QC5B 1ZM9A 2H0AA 1O1YA 2BELA 4PQYA 3KQMA 2ZBUA 3OLYA 3JQCA 2F1HA 4HF7A 2YN4A 4O4HF 5BMVA 4KHPB 3UAXA 5AKLA 3ZE0B 2GCEA 3KYCA 3SB1A 4K6MA 4X41A 1PWYE 1NE2A 5EIFA 4ZEXA 3D8HA 3OT4A 2OXTA 4CODB 3PC3A 4KQXA 5JC8A 5L4LA 1Z4QA 1G60A 1V3TA 1DTJA 4PLVA 3UXMA 4G1VA 1B8UA 1D7AA 2J3DA 3MUOA 5D6NA 2ZAGA 2QR5A 1VRWA 2DOKA 1OGIA 2I1LA 1GO2A 4JI6B 2EP7A 1I4WA 4BO5A 1JQKA 1YC2A 4XWWA 3W9YA 4J91A 3C7CB 1H94A 2CBGA 2OXIA 1D5CA 2TS1A 3QEMB 5DM1A 3ZWAA 4GPZA 4QYWA 4HH3C 3MTDA 3NBYC 5DT9A 1JKXA 3E27A 1RRCA 2D0DA 1ZUWA 1OOEA 5KREA 2FCRA 1JR3E 3BGWA 2FUG1 2CHUA 4PR3A 3QFSA 5IULC 2HC9A 1KEEA 5DTJA 1WPXA 2FPPA 2OBLA 2Z2ZA 3X44A 5E0KB 3KQOA 3UG7A 3RTGA 2J1LA 1EKXA 4QOEA 4FW9A 4XX1A 2NV6A 4QYIB 4HN2A 4IWNA 1I5EA 1KJWA 1HEUA 2G06A 3RUAA 1DMRA 1OIVA 1Q1EA 2Y1OA 5JJIA 2KLHA 1SRQA 3PFKA 4HKTA 2RAFA 4NFLA 3V8MA 4D4HA 1T15A 2QM0A 1U7WA 2WQZA 4D25A 3BZBA 2PUTA 4TXMA 2NO1A 1JFFB 1YZHA 2CDBA 4L02A 1N2EA 4HS9A 2OCDA 4MYSA 2CNNA 3IMFA 4MWSA 3IPRA 4OV6B 1QWOA 4OXNA 4P8RA 1GTG1 4L8YA 3W5JA 5JWRA 3HO8A 2YWXA 4BNIA 2I4MA 3L0PA 4EO9A 5CA1A 5KNDD 1V11A 2YJ5A 3JY6A 5G1NA 1AA6A 4JVHA 2XSZA 5FI0B 4FQ5A 2ZXEA 2FW1A 3WYEA 1NMXA 2H2AA 4LOIA 4D82A 2LIPA 1SKQA 1YD7A 3C16C 3FYUB 3K8OE 1O89A 4OHYA 3GAAA 2GK6A 3UATA 1COWA 4YCSA 2UZ4A 4U8HA 1DC7A 4OO1G 1XQXA 3EIXA 3HXTA 1YZ3A 3FLMA 3JZFA 4UNIA 4C5BA 3AHHA 4MQEA 2XUHA 5ALHA 3TNFA 4IMIB 2NW6A 2PHZA 5A2QW 3WK9A 2P62A 4RMHA 1JDPA 1NXPA 1R5JA 1Z7WA 2CCKA 2F67A 3HBAA 3DYIA 4RHFA 2JLVA 2GAIA 4MR9A 3H5LA 4AIIA 1PQYA 3DMNA 4MRMA 4UVHA 1Z5OA 4JJIA 3HKBA 3UV6A 1L5VA 3A6HA 5AM3A 3UAGA 1UJ2A 2VTEA 1JV2B 3A9VA 1J22A 1MOQA 5EINA 1S3IA 4OHWA 1SVWA 3R5HA 4BV8A 2V5AA 1A9ZA 1DKUA 3MWYW 3KXKA 3V7UA 2LW7A 4HRAA 4WCFB 5DXFA 3CLTC 2CZQA 2P11A 1ZOOA 2XF2A 4ZANA 3RARA 1LH0A 3WLOA 4FOOA 5JCZA 1W2GA 3ZVNA 2XXAA 1LXCA 3TSYA 3EOAI 1R8QA 3H05A 3HWX1 5JJKA 1KFCB 2GNAA 1WM1A 2CC2A 3I6IA 4N3GA 1V5IA 4OLFA 4C7OB 1E5DA 2ZIFA 2F6RA 3ORQA 4C4YA 4DDTA 4YAJA 3PJRA 4JB0A 1ZLYA 2WMNB 2LZ0A 3LPMA 4BCCA 3PVZA 4PO9A 4RJLA 1TF5A 4WASA 1L4BA 3ZHXA 5K0JA 3ED5A 1RBZA 1DQSA 2A2ZA 4WN9A 3ETNA 4CGYA 3K73O 3B3GA 3A1WA 1DS6A 5ERGB 1KK1A 2GBLA 2W71A 4ZIRA 2I76A 2B4QA 1E2PA 3SHVA 3E5NA 3AIMA 4BOYA 1M2VB 3DDOA 1Y4DE 2AX4A 3I9V6 3W78A 5LDGA 1WG8A 1SM4A 5SYNA 3S55A 5ITSA 4HHEA 3DXZA 1C7RA 3C5HA 3EOZA 1MIOB 2DRIA 5CEFA 3OBBA 4HMOA 2EKQA 1UQRA 4N65A 2QBYA 1C14A 4QOIA 5FBHA 4QXOA 1FLAA 2FPWA 2FR1A 2GTHA 2B1JA 3QU2A 2M98A 3FLEA 2YXEA 4M6WA 5IW8A 4GZ5A 5AHOA 2QVGA 4C0KA 5C1BA 4B6OA 3KWLA 1XVAA 3BD7A 3TR0A 1F2TB 2UXCH 1B7GO 1PJRA 1XX6A 3UMCA 2XGJA 3GB9A 3CZCA 3P0JA 2V4UA 4QUKA 1EVIA 1K6IA 1HETA 1N7GA 1S7GA 1RWKA 3CO0S 1XDWA 1ESMA 1I2BA 4Q01A 2IS2A 1LY1A 2Z1MA 3BF7A 4MVWA 3AWIA 3E23A 1GQSA 1XCGB 4JV5H 2DQZA 4FR0A 4G36A 3R6LA 4IMJB 1DAHA 5FF9A 5FOXA 4BO6A 4YV2A 3I53A 5EJ7A 1L4YA 3R0JA 1GNRA 3NH9A 5ERYA 2Z6UA 1PNQA 1JZTA 2YFYA 4X6XA 1T3GA 5AO9A 4X20B 4CTKA 3KT3A 4ZCPA 1VHTA 1ZY2A 3P9ZA 4W9MC 2DE0X 2ODNA 3PNYA 4J94A 3NKFA 4OYLA 16PKA 4P34A 1ZQ1A 4BA1I 4MDHA 5G4KB 2PH3A 4ENPA 5A2GA 1OYYA 2ONYA 3T1TA 1KFJB 3R7WB 1D2GA 3B70A 4HD8A 2IPOA 3FNGA 3JYHA 3TR6A 1WL8A 1DT5A 2VUHB 2PEYA 3IE1A 1EIWA 1OZFA 1L3IA 4EJFA 2YXLA 2E49A 4DSZA 3D7SA 1UKZA 5BY2A 2P0EA 3BXPA 3PSHA 5GJVC 2Q4EA 1R16A 2RAUA 3ZHVA 4F8EA 2ZSKA 4NV0A 3AHGA 4X8MA 4HAOA 2PJRA 1F8GA 2P1DA 4FSHA 4HO1X 1IJFA 2PKWA 1XTBA 3GNLA 1Y6GA 4CEIB 1DRJA 1B8OA 2DR3A 3A26A 4BNUA 1WDKA 3ZY6A 1QOZA 4BRSA 4B73A 1RJ9B 2OD7A 1KEKA 2YHUA 2JIOA 1N8SA 3JVUA 3DMRA 2JIDA 3HP1A 1Z7GA 2AVNA 4AW9A 3L7CA 4F9FA 5D5HA 4MZXA 4Z4GA 4MICA 3TTYA 3VBCA 4HLNA 1TO2E 3I1JA 4C0QC 3KX2A 1V8FA 2JEAI 4XYMA 5L3SB 1J24A 1M6VA 1ZN7A 3GBSA 3O8QA 3QY0A 4MMYB 2BZGA 4RLSA 3N2EA 2YNMC 3HDQA 4IX1A 1MSZA 1AKEA 1QHHA 5BSMA 5KQMA 4IS2A 1DEHA 1ZU4A 1CR4A 4TKVB 1HNXB 2CTKA 1XCPA 4C6HA 1MTOA 4JXJA 3TTTA 1OD6A 3H65A 1LNSA 4LNAA 4XQEA 1KC1A 4WNCA 3OTQA 4LMBA 4RMGA 3D5TA 1BW9A 1X92A 1T36A 2GNPA 4YH1A 4D8WA 2JVZA 2DFTA 2A9QA 1F9AA 1O2DA 1XAGA 3H3JA 4PZEA 1XQ6A 2ACEA 1IMOA 4EYGA 3GOHA 1ZD3A 1Y5LA 1P7ZA 4RUKA 4FKZA 2W90A 4US0R 3GDOA 2X22A 2F1RA 2H0QA 5C5IA 3EMVA 4FM9A 4YLGA 4QJIA 3WK4A 3OQPA 2QBYB 4YRCA 2JIMA 3RV4A 2HPHA 1X8LA 3WNDA 4QJ4A 3OCWA 3A1CA 4URVR 1TVCA 2HNAA 2AJDA 3X1DA 1N2GA 5IKPA 1Y7PA 3KSZO 4J29A 4U5QA 1BEZA 1MRSA 1CUBA 4IGEA 3TLKA 3CUKA 3QJ5A 1MIHA 3EMDA 3GO4A 2UZ3A 3OFVA 4LJ5A 2XJ4A 3KEGA 1F7VA 2FDRA 4Q3DA 1KEZA 5ALTA 3QYJA 4LBYA 1G5QA 1NPYA 5KIAA 5HRUA 3WMRA 1XF1A 4TT3A 4JMLA 1KJ9A 1U5CA 4K40A 4RACA 4U6QA 3EZJA 1B3BA 2ZDQA 3GPDG 1CY1A 4K2HA 4NOLA 2J3LA 4COOA 2YXPX 4J0EA 3K7EA 1VPVA 3FPEA 5REQB 2YHSA 2I4TA 2XNSA 4DV5H 3WGVA 2C88A 2RKBA 4LDPA 1P77A 1QE3A 3A1SA 3Q3IA 1TUAA 4YCL