2O4CA

Crystal structure of d-erythronate-4-phosphate dehydrogenase complexed with nad
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
380
structure length
380
Chain Sequence
MRILADENIPVVDAFFADQGSIRRLPGRAIDRAALAEVDVLLVRSVTEVSRAALAGSPVRFVGTCTIGTDHLDLDYFAEAGIAWSSAPGCNARGVVDYVLGCLLAMAEVRGADLAERTYGVVGAGQVGGRLVEVLRGLGWKVLVCDPPRQAREPDGEFVSLERLLAEADVISLHTPLNRDGEHPTRHLLDEPRLAALRPGTWLVNASRGAVVDNQALRRLLEGGADLEVALDVWEGEPQADPELAARCLIATPHIAGYSLEGKLRGTAQIYQAYCAWRGIAERVSLQDVLPETWLAGLQLNPGCDPAWALATLCRAVYDPRSDDAAFRRSLTGDSATRRAAFDALRKHYPPRREITGLRVATGGQAELQRVVRALGAQLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Erythronate-4-phosphate dehydrogenase
publication title Crystal Structure of d-Erythronate-4-phosphate Dehydrogenase Complexed with NAD
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Oxidoreductase
total genus 125
structure length 380
sequence length 380
chains with identical sequence B
ec nomenclature ec 1.1.1.290: 4-phosphoerythronate dehydrogenase.
pdb deposition date 2006-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00389 2-Hacid_dh D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain
A PF02826 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain
A PF11890 DUF3410 Domain of unknown function (DUF3410)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.170 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 2o4cA03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2o4cA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2o4cA01
3I9KA 2O23A 1I10A 2H63A 2GSDA 4DREA 5I9MA 2G76A 4LCEA 3JQ7B 1LLQA 4CLOB 3ZNQA 2BGLA 5A03A 4II3A 3JQ7A 4CLOA 1JAXA 1WWKA 4M86A 5A5EA 4I5EA 2JAHA 3VTZA 1T4DA 1DC5A 1HZJA 3H8VA 2ZTMA 3DOCA 2CDAA 5TX7A 2PZJA 3VVCA 1I0ZA 3UF0A 4B7XA 4XYGA 3ZDFA 4GX0A 4W9NA 4NK4A 3DEYX 4R1UA 5AXBA 4DYVA 2CD9A 1MGOA 3QA9A 1JKIA 2O50A 1LNQA 3I6IA 4N18A 4XEHA 5CDGA 1ORRA 4DMMA 2W98A 1K2WA 2AA3A 4M8SA 1MC4A 1PJQA 2ZCUA 2E37A 3V2GA 1DFIA 1Y9AA 1HSZA 2D3TA 4X54A 1DC3A 4Y98A 1KBZA 4BGVA 1G0OA 2YDXA 3A06A 2C59A 1IHXA 2EXXA 5C7IO 1WZIA 3JD4A 4IQ0A 4MVJE 4K26A 3AUTA 3JQ6A 1ONPA 4CUZA 1WLYA 2PD4A 1E7RA 1G6KA 5J23A 1W4ZA 2NU7A 2DLDA 1IYZA 3ZW9A 4ZHSA 3C85A 1SAYA 4FC7A 3TL2A 5TC4A 4XGNA 2AEMA 3OA2A 3KRTA 3VPXA 3H9UA 2NVWA 4Z9YA 1Q7GA 3AM5A 2EJWA 1NQ5A 3HE3A 5CPFA 4DPKA 4GH5A 4HFJA 4B79A 3GG9A 5A9RA 1PSDA 4R9RA 3QY9A 4G5HA 4UVDA 3TPCA 4WPGA 3KLMX 4QUKA 3IKTA 2JD0A 5BR7A 3DBRB 1UAGA 1A4UA 3Q11A 2Q2QA 3DBRA 2PGLA 3ZNNA 1LTHR 5IN4A 4IDEA 1VJ1A 3RBVA 2IXAA 5G0WA 1LDEA 3C7DB 4GGOA 2FZEA 2PFGA 1CJCA 1HYHA 3H4VA 4XQ9A 4TRNA 1ZEMA 1ZMTA 2QYSA 5DULA 3UHAA 4NU6A 4XJSA 4L8VA 1NASA 1WZEA 3K2BA 3L0DA 4CM9A 4Z6KA 1EDOA 3NTRA 3H9GA 4IBOA 2CVQA 4IDFA 4HV4A 4JBGA 4IIVA 4J90A 4K6FA 4QO8A 4JBHA 1ZFNA 2UDPA 2I6TA 2FOIA 4P4GA 3GY0A 4I5GA 4U6QA 4N5NA 4CV3A 3HFSA 3M2PA 2ZB3A 2FY8A 3JYPA 2GNAA 2O7QA 1NAHA 3RC1A 1GPDG 5FI5A 1PEDA 4XDZA 4B7UA 1NVMB 4CMHA 3E5MA 1D8AA 4ND1A 5TS3A 4W82A 5I8WA 3E03A 2PK3A 2Y05A 4RDIA 3TSCA 4YJDA 4I8XA 2YHUA 4IQ8A 3TQHA 1LRKA 1U1IA 4KWHA 1E0DA 3ZV6A 1PGQA 1HLPA 2B36A 4GX1A 2VYNA 2HDHA 3ZGYA 1PJ4A 1L7DA 3GVCA 3M1LA 1UDAA 3I9MA 4FFNA 3PQFA 2GR9A 2RBEA 4IY1A 1LRLA 2CDBA 1H93A 4RPKA 4YTEA 1LQUA 2PNFA 4K28A 4PZCA 4XQEA 4FJ0A 1HEUA 3H7AA 1SEVA 3ZU5A 3PP8A 5L7TA 1KS9A 2YW9A 3DL2A 2YV3A 3N74A 3GDOA 1RKXA 3HJAA 4HY3A 1P1FA 3AFNA 3BTVA 1ISFA 2JKVA 3U5TA 2BGKA 3VHRA 5FF9A 3UAGA 1IY8A 3PHHA 1DC4A 2VTEA 3FRJA 1PTJA 3DZHA 5LDHA 4E2YA 4BKQA 2D2IA 4FR5A 1EEHA 3AUSA 3GNSA 3I4CA 5DP2A 2Y93A 3LQFA 3P2YA 5ILOA 4IDGA 1I01A 3S2FA 1Y5MA 4FC6A 3LC7O 1GUZA 1M76A 3FPLA 1U4SA 3ANMA 1QORA 4LISA 1T2EA 2XXJA 3FSRA 1VL6A 1EE9A 1X7GA 3ICCA 3R3SA 1DFHA 2VN8A 2PLAA 4R1SA 1PJCA 3ZI0A 1GZ4A 2B83A 1L1FA 5F5NA 1YRLA 5CDYA 1HSOA 3EGOA 1N8KA 3WMWA 2GN8A 3A9WA 3OQ6A 3EK2A 5JDIA 3W8EA 1GCOA 3I1JA 3UKOA 4UUOA 2NADA 3UOGA 4IM7A 8ADHA 4IQGA 2G1UA 3OF2A 3GLQA 5EESA 1FF9A 4BO1A 1NWCA 4UREA 4Q3NA 4RPLA 5DOVA 3OMLA 4DIFA 4Y6PA 1YKFA 3R1IA 4IZIA 1K0UA 6LDHA 1BDMA 1WW8A 3R6DA 1EVJA 1T4BA 3HN7A 2B4QA 4OXKA 5AXDA 2CFCA 4YAIA 4RL6A 2HQ1A 4MVJF 4Z9FA 1CYDA 4INAA 1HE2A 3O9ZA 1GL3A 3JD1A 3QHAA 4XX0A 4GX2A 5L9AA 1JKFA 1Q7BA 5KOIA 1PGPA 4ND3A 5IFLA 1MC5A 1YL6A 2J3HA 4DGSA 1DBVO 4PG8A 2YJZA 3KZVA 2EP5A 4FSHA 3VPHA 2OXIA 4A10A 1M2WA 1XA0A 3IMFA 2WYUA 1F0YA 4PLGA 1A7KA 1JN0A 3JYQA 4WJZA 3NYWA 4U6SA 2JHFA 2E6UX 1NVTA 4GLOA 1ZCJA 1YB4A 1UXIA 1PJTA 1GD1O 1CQJA 2PGDA 2C54A 4CJXA 3RCBA 3U49A 1GV1A 1Z6ZA 1X0XA 3IKVA 3EVNA 4JP2A 1BXGB 3QVXA 2W2LD 4GBJA 4L4XA 4MVJA 4RV9A 4NU5A 1YO6A 2P9GA 2EJVA 4NMHA 3I4FA 2I3GA 2WMDA 4Y8VA 2X23A 4ROSA 1AN9A 2VHXA 3GAFA 1E7MA 3WBFA 3IJPA 4CLRB 5T67A 2QQ5A 2Y1OA 2OOSA 3BTOA 3IC5A 4CLRA 1UP7A 4KDEA 4O6VA 3T7CA 5KJ1A 3TOZA 1PR3A 1XEAA 3HADA 4XR9A 1Y7TA 4YJHA 1E3WA 1ONNA 2F00A 5COQA 1P9LA 1WXDA 1VRWA 1YH3A 3LT2A 4BB6A 4O5OA 5C7LO 2WTBA 5IXSA 1B26A 2E49A 2J6IA 4Z0HO 1DLIA 1RPNA 1ONOA 3OA0A 4E5PA 3VZQA 2JFFA 5KNLA 3GGGA 1HF3A 4LMRA 3KVOA 1LI4A 2DKNA 1IUKA 1PQUA 5A05A 4YT8A 4B4UA 4CLXA 1HE3A 4OXYA 2UUPA 3WQQA 3COSA 1H2HA 2DVMA 2DTDA 2WYWA 4RGBA 3D3EA 1U28A 4HFNA 2VWHA 3OEWA 4AG3A 1EK6A 4WK6A 3AI2A 3OFSA 4CR7A 2C20A 3U62A 4MKRA 3AY7A 3PYXA 3F47A 2ILTA 1WP4A 1UH5A 1B8UA 3GH3A 3V2UA 1I36A 2IZZA 2UVDA 2X9VA 4BQRA 1F06A 3IP3A 1WAMA 4CMGA 1R0KA 4GL4A 3Q1LA 3MCVA 4IDBA 4Q39A 5G4KB 1IPFA 2OO5A 1NP3A 3GN2A 3L4BC 1BTOA 4CPDA 5G4KA 5G4LA 2QRKA 1ZZEA 3GUYA 3U3XA 1DJQA 2IODA 3O4RA 1HE4A 3RJ9A 1QYVA 2VNSA 4OKIA 4TRJA 3R0IA 1PJ2A 4A0SA 1F8FA 2HJRA 4QX6A 4BS9A 1DFGA 3RUAA 3VTFA 3NAQA 1XHLA 2CMDA 4JK3A 4XYLA 4BNKA 4C4OA 1A5ZA 1C0IA 3H5NA 3NDRA 4UEJA 1U3UA 2EP7A 4DTIA 4YBZA 5BQFA 1RM3A 1OFGA 3ENKA 5ENVA 3ROKA 3CINA 1DRWA 3CMMA 4BNUA 3AOEC 2NUAA 3FHLA 1QV7A 3ZWAA 4BKPA 1WMBA 3GGOA 5B1YA 3GFBA 3WQRA 1KETA 2B5WA 2X9GA 2FR1A 5ER9A 7ADHA 3C3XA 3A1NA 3EDMA 1NQTA 4YWJA 2Q45A 5BSFA 3I3OA 2JFGA 1FMCA 1HDOA 3ONEA 3RQSA 1KY5A 5CHEA 1I2CA 3RKRA 4AJIA 1FDSA 1NHWA 3FNEA 4WEQA 1PU2A 2Y1EA 5EMHA 1W0CA 5JMWA 2X9NA 3DDNA 3W4KA 1W73A 3DB2A 1QYCA 4JN6B 1WDMA 4CV2A 1ZH8A 2BD0A 3SLKA 1ZXBA 4BKRA 4OMUA 1LQTA 1KY4A 3BAZA 4ALJA 1SZJG 4RF2A 4B3IA 1YONA 2NACA 4EZBA 4GMGA 4OSOA 3RUEA 3ONDA 2ZJ1A 1N92A 1DLJA 5DBIA 2EWMA 4YRBA 2HMTA 4DIOA 4BO7A 2Q46A 3UCEA 1DJNA 3DZBA 4IXTA 2X8LA 1J6UA 1KC1A 4JCOA 4A27A 1MP0A 2HAEA 4NBRA 4O1MA 1MUUA 3WTCA 2WD7B 4BOYA 3AI3A 4ZD6A 2VWQA 2BHLA 2WD7A 5L4LA 4BNIA 1I2BA 2RAFA 1PJLA 1X13A 4RPGA 3WYEA 1QR6A 4ZQGA 4XCVA 4CM4B 3CPSA 3KM0A 1R4NA 1HRDA 5L3ZA 2V6GA 3I6QA 4LN1A 4CM4A 1NFQA 4QECA 5L51A 4RZIA 4GGPA 1TXGA 3BXXA 3MJSA 4YAJA 4GPD1 2VT2A 3WGTA 3UN1A 3VPSA 4YAKA 1H6DA 1Y8RB 3WJ7A 2VWPA 3PJEA 2QZZA 3SC6A 2O2YA 1KERA 1Y8RA 1YB1A 4EGFA 1SB8A 1Z45A 3VH2A 3I9OA 5F3RA 2AE2A 3PI7A 4B7CA 1F17A 2NTJA 3JQGB 4P38A 4PLTA 5F1PA 3ZW8A 3DTTA 3IQDB 3JQGA 3WS7A 5FFFA 4NR0A 5A1TA 4A26A 1DRUA 1KIFA 4MO2A 1DC6A 3KSUA 4TQGA 3E82A 3BYZA 3L4SO 3KTDA 1E5QA 3OJ0A 2PV7A 4KOAA 4IINA 4XRGA 5H83A 3RAJA 1B16A 1T2DA 3F6YA 5T6BA 3HZZA 1P74A 3FWZA 3NRCA 4L9RA 3CMCO 2AQHA 2LDXA 1V3VA 1ADCA 4GKBA 1U7HA 4RQTA 4DPMA 3SEFA 4GX5A 2Q1SA 3F1LA 4EBFA 2G82A 4EJ6A 2CF5A 2Q4BA 4RO0A 1UXJA 2Y1FA 4TSKA 3RI3A 1BRMA 3VPGA 2VUTA 3DFZA 4CMEA 3TFOA 3PWSA 3AM4A 1XIVA 1G1AA 3E1KA 5L4NA 2GD1O 4RVUA 3EW7A 1UZMA 3MEQA 5COBA 3L6DA 3ZWXA 4ZA2A 1D4FA 3F5SA 1YJ8A 5ES3A 2GPTA 4XB1A 4NHEA 3TZCA 1HDXA 1O94A 2C0CA 4XA8A 4CMIA 1XDWA 3GZ4A 3H5AA 4BB5A 3F5QA 4FN4A 1YL5A 3IJRA 1HDRA 1PZGA 3HDYA 3EUWA 4LRTB 1B2LA 1EUZA 4FFMA 6ADHA 5HWSA 1RJWA 5A06A 3BMOB 3M1AA 5KVVA 2FN7A 2EW2A 4FFRA 2EHDA 4AJOA 5DT9A 3DZFA 3GZNB 3GNQA 2BH9A 1YL7A 4GAEA 1DO8A 2RH8A 4I9NA 3GZNA 1GDHA 1MA0A 5K6AA 2YQ4A 1JAYA 4D0SA 1ISHA 2Y68A 4BNZA 1DAOA 1NR1A 4XRRA 1LDNA 1UXKA 4HKTA 2ZCVA 3AUUA 1ULSA 3QWIA 3OQ1A 4WLFA 4L76A 2EKQA 3GEDA 3EAGA 3KYDB 2NVUB 3JQAD 1QLJA 2NVUA 3KO8A 3KYDA 3L9WA 4XYMA 4EI2A 4II2A 1R66A 1Q0HA 3P19A 2WD8A 3NDJA 4KDFA 2I67A 4CMEC 4BNMA 1EFKA 3ROQA 4HNGA 1HETA 1X1TA 1GQQA 4YVFA 1C3VA 3WGQA 1E3JA 3DO5A 4HUJA 3T7EA 4YT2A 1XCBA 4H3VA 1U8FO 2X4GA 4LVCA 1F12A 4N5LA 4MVJM 2E48A 2V7PA 3FPCA 3INGA 3NX4A 3U09A 4NFYA 1PL7A 2JCXA 2JCYA 4R01A 5DCYA 2C2XA 5DOZA 4TKMA 1E1LA 4AJ4A 3LYLA 4FW8A 3V1TC 4E31A 3Q9NA 1LUAA 1OBFO 3QJ5A 3TN7A 1DEHA 1H94A 3Q3CA 3WQSB 1YGYA 3FNGA 2NQ8A 4M89A 3B70A 4A7PA 3PGXA 3UFXA 1IULA 2ZIZA 1P1RA 4M54A 4UVGA 3GMDA 1T2FA 4U5QA 4EITA 4TRMA 3S8MA 1Q2XA 3WBBA 2HO5A 3KOUA 3K6JA 3E6AA 3TWOA 5JFOA 3V1YA 2EW8A 3QVWA 1ID1A 3OJFA 3PLNA 1LDGA 4CMCA 1GFSA 4R69A 4AICA 4BO2A 1PQWA 5CEEA 2VNAA 1D3AA 2Y99A 3NJ8A 1RM0A 3UCFA 3UH1A 3JD2A 4XGIA 4RVDA 1VE9A 3BTUA 3VDRA 5KVSA 5DCWA 2G0TA 1PIWA 3TFQA 1VC2A 1ISMA 3PJDA 3L6OO 2J3IA 3ZH2A 3LDHA 1XU9A 4J9VA 2HU2A 1J0XO 2HMWA 3TJRA 4N5MA 1E1NA 1VSVA 3GAZA 3UUWA 4BQPA 3BMCB 3ETDA 4MVJI 3FTPA 4JLWA 1H6BA 1YQGA 4XKJA 1T1RA 4JP3A 4J1SA 2DPGA 5FEUA 4XWYA 4WLEA 3JCZA 4OOEA 1SBYA 2IEDA 4A2CA 3VVBA 3JD3A 2HCTA 3AUAA 4E13A 4I9UA 4ALKA 1DXYA 2HLPA 3KB6A 4CM7A 3DOOA 3WDSA 4FD3A 4QFDA 4J1TA 1CIVA 2OFPA 3WXBA 3WLFA 3CUKA 4BV9A 1SB9A 1U7TA 2EEZA 1V8BA 4BO0A 4IGEA 4BNJA 4BKOA 2VRBA 5EERA 3KHUA 3VZSA 1JTVA 1ISJA 3H3JA 2QG4A 4DLBA 5JXWA 4ZU3A 1HDGO 2FPPA 4N7RA 4CM5A 2X22A 3VOSA 2DFVA 1OC4A 1KEWA 3ULKA 2I66A 2FHSA 3JYNA 3S2EA 5IZ4A 2QRLA 1GADO 3H9EO 3Q6IA 1XLTA 1Q7CA 2A92A 2YHIB 3RD5A 4EUHA 1Y9EA 2H9IA 3I9LA 3V5NA 4L0QA 2OL4A 4J1NA 1KVTA 2IRWA 3UICA 2POQX 3RIHA 5C7OO 3FNFA 4DA9A 3K96A 1W6UA 5JW6A 4YQZA 1HDZA 2Z95A 4NBUA 4BNHA 3GT0A 3TF5A 5THQA 4RVSA 4IJUA 3S2GA 3CTMA 4NPCA 4W9NC 1PL8A 1EVIA 3LF2A 3HQ4O 1MFPA 5I9LA 4YCAA 3OIFA 4YAEA 3MWEB 4CMKA 4OGWA 1U4OA 3ZN2A 5KTKA 3NV9A 5ADHA 2BFOA 3GOHA 1ADFA 2AG5A 1NBOA 3WOHA 4PLCA 1Z74A 1YVEI 1PJSA 3ANLA 4DQXA 1C0PA 3V8BA 3UW3A 5GMOA 4DVJA 2RCYA 4F6LA 3ZV4A 1TA4A 1V6AA 2ZTVA 1T25A 2BI7A 4U0KA 3JTMA 3AWDA 4C7JA 2O7SA 4Y6RA 3O03A 1M67A 1RWBA 2P9EA 4HFRA 5GZ3A 2NU9A 4OQYA 3N7UA 1P1KA 3E9NA 4ZQHA 2CUKA 4FGSA 4W7IA 1IHYA 3PVZA 1K6IA 2CVZA 4EDFA 3DMTA 4ZVVA 3EY4A 3W6UA 1BVUA 3ETEA 1YOVB 3G1TA 1SO8A 4NG5A 3CSDA 4W4TA 1NWHA 3G3EA 1YOVA 1I3NA 4ALNA 4PLYA 5GZ1A 1KEUA 1GAEO 2X6TA 2NSDA 1T26A 1GU7A 4WLNA 2O3RA 2RH4A 2WE8A 3PHJA 1HZZA 4Q9NA 4CL3A 4PLHA 4ALLA 3AOGA 5CDSA 5L7YA 2ZJ0A 2Y67A 4WCFB 1ZO8A 2QIOA 3F1KA 4WCFA 5F5LA 5JAMA 2X7HA 3UGKA 4E5MA 4JXKA 3GEMA 2QZ9A 1SEPA 3KV3O 2HSDA 1DIBA 4PVDA 5JYDA 5TRTA 3D4PA 2VRCD 3HWRA 4MIOA 5AXAA 1LJ8A 4GKVA 4UUPA 2BI8A 3D5TA 3MJ4A 4Z9XA 1Z82A 2DBZA 3FF4A 3FR8A 2HMVA 3DHEA 3IUSA 4L74A 3HDQA 2DTEA 4FFOA 4Z0TA 3WFJA 5C3MA 4JJFA 3W8FA 3GEGA 2I3AA 2WM3A 4IDCA 1QLHA 4XQCA 3WGIA 5IZCA 1CEQA 2W2LA 4D41A 4XDYA 3HN2A 3RUIA 3NGLA 4PN3A 1U5AA 4B3HA 4ZRMA 4O59O 1BW9B 2EERA 4CMJA 2NU6A 1AGNA 2VCYA 2X0JA 5L7WA 4M87A 1MFZA 1UXGA 4MJLA 4YAGA 1PZFA 1WNTA 2HK8A 1QMGA 1BHSA 1HT0A 3DOJA 3EVTA 5U4QA 5ITWA 5JE8A 2CNBA 3ZNOA 3I5MA 3H2ZA 1KEPA 4Z3DA 1EBFA 4XD2A 2Q99A 1KYQA 4RVHA 1E6WA 3NGXA 4A73A 4WCFC 4PVCA 4NFSA 1DSSG 2CF6A 3PQEA 2E82A 4AJKA 5CEJA 2JD2A 1GCUA 4EEZA 1LXCA 4E2ZA 4Z3KA 4UEKA 4UVHA 4OL9A 2W2KB 5A02A 2X5OA 3OQBA 2XPCA 3DAFA 2W2KA 3ON5A 3DHYA 3PYMA 3GPDG 1K89A 1EMDA 5IZCC 3ROMA 1YB5A 2DBQA 3FNHA 1ENYA 4Q3BA 1I5RA 2B4RO 4FJ1A 5L4SA 2EGGA 2X0IA 3EMKA 5T8KA 1IPEA 3JQ9A 1FDWA 3ZWCA 1NQOA 1F8GA 5TQVA 2A94A 5DCUA 3BTSA 1R6DA 3RUHA 3OM9A 3ZWOA 4J2OA 4PCVA 3E9QA 2AW5A 2C7VA 3GPIA 2I65A 4D3FA 4A03A 3ZWVA 3I83A 1ZXLA 3TDKA 4J1QA 3C8MA 5JAZA 4D44A 1R15A 4J7UA 1GTMA 1ZKMA 1AE1A 4I9HA 3RFXA 4PG4A 4RF3A 1E77A 3PIDA 4FB5A 1A72A 3EZYA 1B15A 3Q9UA 5JDIC 2D5AA 5KVQA 1B3RA 1B0AA 3TZKA 3LLSA 3ZWWA 2VYND 5I7FA 2JD1A 3ITDA 5FYDA 1R16A 4FPXA 1MLDA 3INTA 4AJPA 4PIVA 4J0EA 1BXGA 4AJEA 4RVFA 2I99A 1LC0A 2OBYA 5TLSA 1NYTA 2I76A 5G0VA 4ZJUA 8LDHA 2Y0EA 4CQMD 2E4AA 1I32A 2OP0A 3BMNB 4NBVA 1FK8A 4B3JA 3HB5X 1P1IA 3BMNA 3WWZA 1Y81A 3JQ9C 3GDFA 1E3SA 1JWAB 5EINA 1LBEA 5L53A 1HE5A 1R37A 2GLXA 2PKQO 1IE3A 2GERA 3E48A 5CG1A 3ZHBA 2WDZA 1JVBA 1Y5RA 3PDJA 5B4VA 2PKQP 2UYYA 4NIMA 4GWGA 1JU9A 2CVOA 3DHNA 3DZJA 4AVYA 3R3JA 3CE6A 4P4NA 3OJOA 4XR4A 3LF1A 3A4VA 4K9DA 4NDNE 3VKVA 3P2OA 1R12A 3O8QB 1GUFA 1B3BA 4DLAA 4PRLA 3O8QA 1U9JA 5GZ6A 2GDZA 1NX6A 2FP4A 3P5SA 3RC7A 5JAQA 4OIMA 1FXSA 3GA0A 1IL0A 4RLSA 1K5HA 2Y1DA 2Z1MA 4FOSA 4PLWA 1V9LA 4GQAA 5TT0A 3W8DA 1O89A 4EUFA 5KJ6A 1O9BA 5JAIA 5DBFA 1P31A 4HWKA 1LEHA 4LSMA 3SJUA 4YEDA 4YPOA 1A71A 3AU8A 4RCVA 4YYZA 5KJCA 4OSPA 1BG6A 4KQXA 4CQLB 3JYOA 1ZK0A 4FDAA 2OORA 2GASA 4KUHA 4UUMA 3QWFA 3KYCB 2GYYA 2AMFA 4CQLA 5C5IA 3KYCA 2D1YA 1GV0A 4ND4A 1P45A 4RZHA 1TEHA 1XELA 4JJIA 3STHA 3QSGA 4FFLA 4R5HA 1XWFA 1NR7A 3VAZA 4OHUA 4MOWA 3ZWYA 5LCXA 4CMAA 1DIRA 5LDGA 1MB4A 2OZPA 1T2AA 2A4KA 3PQDA 2GRAA 4J4TA 1ARZA 3WIEA 1A27A 3DC2A 4XYEA 4QTZA 3DBVO 3RBZA 1QG6A 1X7HA 2CSUA 4J4HA 2GN9A 2AQKA 2YUTA 4HFMA 1U2DA 2DC1A 1X15A 1NPTO 1N7GA 4MDHA 5TNXA 4BNTA 1BSVA 1U3WA 2VUSA 5A3VA 4WKGA 5DN9A 4YB8A 2IYPA 2ZQYA 3W4JA 1EQUA 1U8XX 3HDJA 4RQUA 2PY6A 1PWZA 3HNPA 9LDBA 1GEGA 4D3DA 3VZRA 3U9LA 2EKLA 5HS4A 4GMFA 1NPDA 3WGHA 2WWRA 4S1VA 1PR9A 5JYEA 4I08A 3B1KA 3AW9A 5CFZA 4YA6A 3WGYA 1EBUA 3I23A 4DQVA 4NBWA 3ONFA 1I3LA 2VOEA 2D59A 1TT5B 2ZYGA 1LSOA 3MJEA 2YZ7A 3Q2IA 4FQ8A 3T4XA 4MPDA 3U4HA 1EUDA 1TT5A 1ZSNA 3PEFA 1LRJA 1YBMA 2YV1A 4WNCA 3C1OA 4TWRA 4FS3A 5CG2A 5EN4A 3RJ5A 1VJTA 1HYGA 5KCZA 4F46A 4JNKA 4OKNA 1XKQA 3MJVA 4D45A 1ZSVA 2VUUA 2ZTUA 5DDIP 4IMPA 2YY7A 3OEYA 1QXSA 4GSKA 3WFIA 3JQAB 4B4WA 2JFHA 4DIBA 1KC3A 3JQAA 1HDYA 1ENZA 1HL3A 3TNLA 2YV2A 1QKIA 3K9QO 5FWNA 3QW2A 4CM8B 1ZNQO 4E12A 2PKRA 3D4NA 3LK7A 5DZSA 1XGKA 4H16A 4CM8A 2X5KO 3DQPA 4IZHA 1Q0QA 2IDZA 3CZRA 2AG8A 2YDYA 2VYVD 3Q0EA 4LRSB 5A9TA 2P4QA 3H3FA 2HUNA 3GR6A 4DUPA 3D5QA 4DRYA 3VC7A 1J5PA 4R9SA 4J9UE 1PS9A 1E3EA 4JQCA 4QSMA 1GY8A 2DPHA 3NJ4A 2HK7A 3ST7A 3TZ6A 1E3IA 2V6BA 3S1LA 4XQGA 4ND2A 4R4JA 3B1FA 3PJFA 1N1EA 3PLRA 4OH1A 4Q3AA 4R3WA 3WWYA 4DL9A 3EYWA 3L9XA 2OMEA 3ZV3A 4F45A 4DWVA 4YDRA 4Y9DA 2DBVO 4EJ0A 3GK3A 1CWUA 3RUDA 2IZ0A 4CLDA 3GQVA 4GVXA 2JL1A 3WSWA 5EPOA 5AQ1A 3BHIA 5AOVA 3NEPX 4MKZA 2QYTA 5TGDA 4DC1A 5JPIA 1M6WA 3ZWBA 1X7DA 2HKIA 3ITKA 5A3JA 4K6CA 1NTOA 2C5EA 3OBBA 4B8ZA 4HADA 1AHIA 1D7OA 3OHSX 4N54A 3G1UA 3KEQA 1IZ9A 4AJLA 5JDCA 4L4SA 4Q3EA 1HXHA 2V65A 2Q49A 3FCOA 4IGFA 4P8RA 1U5CA 3RFTA 5IDWA 4L75A 4NNJA 3BMOA 3DAGA 3ZU2A 4PG7A 5DP1A 1LLDA 5IDQA 1LA2A 4YQYA 4O63O 4RLHA 1LDYA 3FBTA 2Q4EA 4KTVE 1H5QA 1FDUA 4KUEA 2H1SA 5IDYA 3ZHXA 4WLVA 2QX7A 4YACA 2AQ8A 3UVEA 1JA9A 1CQIA 1UAYA 2C29D 5F1OA 3ORFA 2C07A 3QV1A 5G0SA 3ZU3A 4PLZA 3S55A 3IL2A 3ZU4A 5I7EA 1WPQA 3BHJA 2WYVA 2NNLD 3MOIA 3KBOA 4NZ9A 1XYGA 1D1TA 1L7EA 1O6ZA 4HXYA 4MIEA 5TJ9A 2PD3A 5L95A 4IMRA 2O3UA 1A9ZA 2W8ZA 5H82A 4C7KA 3W6ZA 1A7AA 2NM0A 1QYXA 2VT3A 1YBAA 2BRUA 1SOWA 4G2NA 1FDVA 3B1JA 4MP6A 4CV1A 1P77A 5EQFA 3E9MA 4IJKA 3MOGA 1E1MA 4BVAA 1EUCA 3V2HA 3TZQA 5IJZA 3PWKA 3VPFA 4YRAA 4DLLA 2PR2A 1GYQA 4BO6A 3FTNA 4U0JA 2IE0A 2XOXA 3E8XA 1I24A 3ADOA 4MVJG 5THKA 2PZMA 2BLLA 4RF5A 5JDCC 3AFMA 1Y1PA 3AJRA 3UXYA 1VL0A 3KLPX 4R51A 2NWQA 4NJMB 1BXKA 2B69A 2EGHA 3P7MA 4W99A 1YXMA 1WDKA 3OECA 3QWBA 1UP6A 4NJMA 5K6AC 3O38A 1I33A 4E2WA 4MP3A 5HA5A 5LC1A 3V1UA 3GNTA 4WUVA 4HNHA 5TSDA 2ZYAA 1K6JA 1B8PA 2BELA 4E5YA 4IJWA 3WICA 4ZICA 5JCJD 1E3LA 1GYPA 2I5PO 2A9FA 1CETA 1Z75A 4E5KA 2V6FA 3BA1A 1I3KA 1IB6A 1VSUA 3H5RA 3PXXA 3K31A 3RFVA 3DONA 1N7HA 4DMLA 3GC6A 5ER6A 5IF3A 2PA3A 4QO7A 1E92A 2GGSA 1R4MB 4QEDA 4OJNA 1ZJYA 4J0FA 1YDWA 2F1KA 4AJ2A 1R4MA 2ZTLA 1Y6JA 3DBLB 1MXFA 1UR5A 2BFMA 5CP8A 3DBLA 1LDBA 2OHXA 1OMOA 3D4OA 4R54A 1EK5A 3GG2A 4D43A 2O3TA 1E6EA 1O8CA 4CUJA 3PJGA 3ASUA 1TB4A 3KSZO 2Y66A 2DM6A 2ZATA 1ADBA 1OI7A 3BMCA 3KEOA 1DB3A 2WJPA 3ROPA 5JCXA 3GRPA 2EV9A 1A9YA 4I1IA 2CY0A 2PGJA 4KWIA 3DBHB 1ZJZA 3DBHA 4YJFB 5HTOA 1SC6A 1FDTA 4YJFA 1E7YA 1I3MA 2WSBA 3TOXA 5KJFA 3LZ6A 4BMSA 1S7CA 1HKUA 3WGGA 1PZEA 1YQDA 4RPJA 2DQ4A 3WG9A 5F21A 2AE1A 2BF7A 1UDCA 2NV6A 4WOJA 1KVSA 3ZWPA 1U2GA 3AU9A 2GZ3A 3FBGA 1PS8A 2X86A 1ZMOA 2Y1CA 2X0NA 3GN1A 1QYDA 1UZLA 3SX2A 4J91A 5L45A 5ILGA 1T24A 3GGPA 2G17A 2HJSA 3QP9A 5K0ZA 4W6ZA 3VZPA 3LU1A 3FN4A 2Q2VA 1JQBA 2O4UX 2Z5LA 4FOOA 1ZUD1 1B7GO 4AL4A 2O2SA 2VRCA 5ENDA 4E0BA 3WSVA 1OZAA 2NTVA 4GSLA 3VKUA 1PGOA 3CKYA 4PLFA 5JBIA 2YHIA 1NXQA 2FR8A 3H2SA 5A4DA 5T64A 3H9QA 3K8ZA 3NT2A 2XAAA 4LVUA 1J4AA 3ANNA 5L40A 1BMDA 4MVJH 5CAEA 4OM8A 4TZKA 3ICPA 3IDSA 1QRRA 3LSYA 1NFRA 4Q3DA 3QRWA 5TJHA 1SNYA 5JS6A 4E5NA 4R1NA 1H0KA 1HYEA 3WNQA 1MXHA 1EQ2A 2UAGA 3CH6A 3RROA 5B4UA 4CV0A 2ZKLA 5DF1A 4AJHA 3WJAA 5TIIA 1NAIA 4GWKA 3F4BA 2X1HA 4MP8A 4NJOA 2C2YA 2P9CA 2XXBA 2WEKA 1ZK2A 3HB4X 4TZTA 3DXFA 3DFUA 3K73O 3GRKA 2C5AA 1VJ0A 1LSJA 3PYLA 2QRJA 3QQPA 2GCGA 3JSAA 4AJJA 3FWNA 2FZWA 2YFHA 1KOLA 1T1SA 1JWBB 2X5JO 2J5QA 5KWEA 1SPXA 2PH5A 3C1TA 2P68A 5MGBA 4UEOA 1T2CA 4AJNA 3KETA 1DAPA 1H9BA 2BKAA 1MX3A 4E32A 2IZ1A 1VKOA 2VZ8A 2GZ1A 2NTNA 1JKJA 5I8ZA 3IS3A 3G79A 4BO5A 4J16A 3RC2A 3TRIA 1JW9B 4ILKA 5EL0A 3WB9A 1M6HA 4ALMA 1SCUA 1JLLA 5TF4A 3MWDB 3WYCA 3X2FA 5IG2A 2FPIA 1AHHA 2GF2A 1WVGA 3PZRA 4ZRNA 5JO9A 2A35A 5KKAA 2AQIA 4BO9A 2J3JA 2VZ0A 2OGUA 4I5FA 4BNGA 4GLLA 2O48X 3NUGA 1RYDA 2QW8A 4JGBA 4WE3A 5G0UA 2VTDA 3BIOA 3MJCA 2AXQA 1EE2A 4YR9A 1C0LA 4BMNA 3G17A 3QWAA 1P3DA 2OUIA 4BL5A 4IDAA 3B20A 2P4HX 4LK3A 1E1KA 4PRKA 4EW6A 1YBVA 4CM3A 4CQMB 4EYEA 3DMTC 1PGJA 1DHRA 1BW9A 4CQMA 3JQCA 4RJTA 1BDBA 4ZGWA 4AFNA 3JQFA 4BNVA 5JNLA 1FJHA 1Q0LA 3WX0A 5KIAA 3JV7A 2JAPA 3MJTA 4H15A 5U9CA 1Y8QB 1ADGA 1DIAA 2Q1WA 3WMXA 1Y8QA 2Y1GA 3X2EA 5K9ZA 1QSGA 2Q50A 4ID9A 2EIHA 3RU7A 3F4LA 3K92A 4F6CA 3K30A 3UCXA 4D7AA 4WASA 4PFJA 1Z7EA 2BFPA 1ISGA 2Y0DA 1VKNA 3AY3A 1WDLA 2RIRA 2PZLA 1RYEA 3JQEA 5EIOA 4TRRA 2P5YA 4IDDA 4JIGA 4EEXA 2B4TO 3Q2KA 3AK4A 3W4IA 3PRJA 2ZB8A 5BNFA 3K2EA 2DT5A 2RHRA 4CM9D 4OYRA 3KUXA 4BUCA 4L73A 3RBXA 2R6JA 4XJTA 4Z0PA 4DQUA 2W4QA 3M6IA 4BV8A 1S6YA 5FI3A 2PD6A 4XB2A 1GYRA 1Z7BA 1VL8A 1ENPA 2DUUA 3JQFC 3E5RA 3WLEA 1DIGA 2JCVA 2FSVA 4QT0A 2DTXA 1NFFA 4MVJP 1H6AA 3ZCXA 4B8WA 2VHVA 5A9SB 2IEBA 1J49A 2PTGA 2FR0A 5A9SA 1E7WA 1HTBA 1LC3A 3D1LA 1DIHA 1AUPA 4E4YA 4B4VA 1RM4A 1KVQA 3PHGA 4R1TA 4YT4A 1ZVMA 1MG0A 2HMSA 1GUYA 3ZHZA 5AYVA 2W90A 3AM3A 3IOYA 2EKPA 2O3JA 4QXMA 4ZN6A 1QV6A 2OBNA 4IS2A 1GZ6A 2UV8A 2R00A 4CR8A 4M55A 5JO0A 4KUGA 3VH1A 1E7QA 4ITUA 1E6UA 3QVOA 4E3ZA 2VWGA 3D64A 2I9PA 3H6KA 3U4CA 3RC9A 3H9JA 1CDOA 5EJ2A 5HRUA 5T8KC 1EVYA 1GPJA 2DU8A 2Y0CA 4W7HA 4PLPA 2HK9A 3DMYA 3ZV5A 4BNNA 3IP1A 1O5IA 1GZ3A 4NFHA 3G0OA 1Q1NA 5T5QA 4GI2A 2NU8A 3PGJA 4KTTE 1ZEJA 5B37A 4FCCA 3ZZNA 2G5CA 1JVSA 4R3NA 5G0TA 2BMAA 1B14A 2R2GA 3DR3A 4PG6A 4TVBA 3WGZA 1NQAO 1P0CA 3L4BA 1OAAA 1BWSA 4FFPA 3PFFA 2ET6A 1N1GA 4YJHB 5ICMA 1E3WB 4CMBA 3QWHA 3QVSA 3K5PA 3RKUA 1CRWG 1NNUA 1WMAA 4HP8A 3ETGA 4ALIA 1LDMA 3JD0A 1LLCA 3SVTA 1UJMA 2TMDA 2C7GA 1P1HA 1SOVA 4CLHA 2CZCA 4DBZA 2FWMX 2PWZA 3I52A 3OH8A 3CIFA 2GN4A 4BGUA 2XF8A 4R5MA 2TMGA 4XIJA 4BO3A 3H65A 4BO8A 3DZKA 4PZDA 2OP1A 2R00C 5KJEA 3PHLA 5IN5A 4XIYA 1DHTA 5I7SA 5HM8A 5TT1A 3AOEA 4XGKA 3EHEA 1JDJA 4RPHA 1YQXA 4CLEA 4BGIA 1YDEA 4KQWA 1O95A 3RU9A 1NM5A 4K1LA 5I9NA 4NI5A 2C82A 3ZHYA 2YFQA 4UULA 3GVPA 3KYBA 3RUCA 2Q1TA 3OIGA 4J2HA 3RUFA 1QYWA 4J6FA 1ZK3A 3PHIA 3FR7A 3ZNPA 4J7XA 1H6CA 1V3UA 3N58A 1CERA 4U7WA 4TROA 2JHGA 1D1SA 3JQ8B 4UVEA 2VYVA 3IIEA 1KVRA 3JQ8A 1E7SA 5EQDA 1PGNA 2B37A 1C1DB 1V35A 2EF1A 3MTJA 4ZQBA 3LLVA 1NPYA 1DRVA 4KZPA 1C1DA 3C7AA 3WGOA 2ZQZA 4J4BA 5B4TA 4LW8A 4TMFA 2D4AA 4S3MA 4U8GA 3DWFA 1ZSYA 1UUFA 2O3SA 4RVGA 1GQ2A 4AJ1A 2PZKA 1GEEA 3GDGA 3GHYA 4DYDA 2P91A 4BNXA 4PGFA 3NTQA 4M1QA 2AEFA 4MVJD 4WCDA 5AXCA 1MV8A 3MZ0A 2QHXA 1HDCA 3RSHA 5U1PA 1YJQA 1BGVA 3NT5A 4EJMA 2AEJA 2J3KA 1X1EA 2IYOA 1AXGA 3CXRA 3QIVA 2UUOA 3QVTA 4J43A 2D8AA 2D5CA 2X0RA 3KSDO 3WR5A 1XG5A 2LDBA 3D3WB 3AY6A 3A14A 5IXYA 1XSEA 2ZYDA 4E6PA 1QP8A 3D3WA 3PFWO 5ICSA 1UP4A 2X58A 2AHRA 2ZB4A 3M2TA 3OP4A 3ZWMA 5GY7A 3JYLA 2P5UA 5A5FA 4ZQFA 4G65A 4RDHA 4CM1A 2DFDA 2RHCA 4ZQEA 3FD8A 4CL8A 4TKLA 1P44A 3E18A 1DPGA 1ENOA 1UZNA 4E30A 1R0LA 3OICA 3BMQB 4OQZA 4NBTA 5IAAA 3SJ7A 3GVXA 3BMQA 4G81A 2HMUA 1X0VA 3EC7A 2GO1A 1U3VA 1V0JA 4KMSA 1XR3A 4IPTA 4EUEA 1BXZA 5DNAA 3HDHA 4IJVA 3IUPA 4NH4A 2Q3EA 1PWXA 1PJ3A 5JMPA 1EFLA 1LX6A 1P1JA 3ADPA 3JQBA 1XQ1A 1C0KA 5BSGA 5JLAA 1N2SA 4WLUA 3BHMA 1NVGA 5JY6A 1ZK1A 1R4NB 4PLVA 2GZ2A 4D42A 1VI2A 4H7PA 3OJLA 2EG9A 2J5RA 3OJEA 4OXNA 1ULUA 4R41A 2V6MA 3VH3A 4NQZA 2D0IA 4P4LA 3EZLA 4HBGA 1ZK4A 4IUYA 3SLGA 1PX0A 1IOLA 3F46A 3WTBA 5DBGA 1PQPA 1YWGO 2VQ3A 1TI7A 1H2BA 4ND5A 5BSHA 4FIZA 2B35A 1HLDA 3HSKA 2SCUA 4JROA 5CDUA 9LDTA 2FSSA 3PWZA 2FRDA 4CUKA 1ISIA 3I9JA 1M66A 2IXBA 4BNWA 3BZUA 1AXEA 1PZHA 4M49A 1I30A 3WIDA 4ESOA 1BVRA 1ML3A 4E21A 3U0BA 1VPDA 3GVHA 5IDXA 5JCJA 3L77A 3VDQA 2NLOA 3JQBC 3C7CB 3GVIA 4MINA 4YXFA 1ZIDA 3LC1O 4URFA 4D3SA 3NTOA 2YYYA 3LT1A 1GQYA 4R16A 3OSUA 3TZHA 1LSUA 3MTGA 1PJBA 5JSFA 2BGMA 4BNLA 3WNVA 1G0NA 1A4IA 1C14A 4DBVO 1KEVA 4UUNA 3NT4A 5HBRA 5B12A 2DBRA 3ASVA 2J5KA 1O0SA 2H6EA 4Y67A 3RASA 4RF4A 4LGVA 4BNYA 1MG5A 2HRZA 1UXHA 3DZIA 7MDHA 3LC2O 2ZB7A 1K6XA 2DAPA 3QE3A 2NVBA 2BFAA 1PS0A 2YQ5A 3HFGA 4CMIB 1W8DA 4BMVA 1P0FA 2Z1NA 4QFCA 1OC2A 3HHPA 3LT0A 5A04A 2J8ZA 3SC4A 3B6ZA 1R0SA 3AI1A 3ZWNA 3DZGA 1SMKA 3NKLA 3OIDA 1EZ4A 3PZBA 4D46A 3GF4A 1N5DA 3IAHA 1B8VA 2P2SA 1LLUA 4MKXA 1HWYA 4DXHA 3T4EA 2VOJA 4LSWA 5JY1A 5KVCA 4J7CA 3OETA 3DTYA 4O0LA 1TVEA 1DDOA 5AVOA 1I8TA 3DAPA 1P33A 4B4OA 3VH4A 4F3YA 1EVZA 4WGGA 1YE3A 3O26A 4FBGA 4XZ3A 1K3TA 3PPIA 3ABIA 1CF2O 1VLLA 2HRBA 3SXPA 4D79A 4JJGA 4JX8A 3FI9A 5C37A 3LT4A 5CDTA 5MDHA 2B5VA 1YS4A 4ONEA 3D0OA 3GUCA 3C24A 3PIIA 1GR0A 4PZEA 4LMPA 1C1XB 1XQ6A 3U4DA 3JQDA 4CODB 1RM5A 2WE7A 3GFGA 2O4CA 1C1XA 4WOKA 4MIYA 3D7LA 3U4IA 3CEAA 1ZW1A 2Q2WA 2Q1UA 4LCJA 4A5OA 1XU7A 2DUWA 4J49A 4JBIA 4WECA 2CDCA 1Z73A 2VZ9A 5HS6A 4NK5A 4BKUA 2B0JA 1NHGA 4OOFA 1PL6A 1DOHA 2FPGA 4Y6SA 5F1KA 5BT9A 4E2XA 4UAGA 3L6EA 4BO4A 3W1VA 3RWBA 1M75A 4CR6A 3L07A 2PH3A 4R68A 2VHWA 2FMUA 3F9IA 4QQRA 5JC1A 4XYBA 3NDIA 3HUDA 4DC0A 1OOEA 5BNIA 5G2OA 1ZBQA 1KVUA 5T57A 4HX5A 4OAQA 4YT5A 5CEFA 5I7VA 3ENNA 4YJGB 2GUGA 3GHHA 3S2IA 4IIUA 4YJGA 4P22A 4RORA 1VM6A 1LU9A 4FJ2A 1X14A 2GN6A 3INRA 3PTZA 4BGEA 4IS3A 4IXWA 1EDZA 1N9GB 4OO3A 4D0RA 4CM6A 3PK0A 5ITVA 4WNIA 1V3TA 4J3FA 1N9GA 4WEOA 1U3TA 5H81A 3RVDA 2VHYA 1UDBA 3GMSA 4GVLA 4L4RA 2H5LA 3I9NA 4PG5A 1TT7A 2JJYA 3G49A 4KP7A 5BSEA 4I5DA 2O3QA 4TVOA 4BIIA 4BHTA 4E33A 4BNFA 1IZ0A 1I2ZA 4Q3CA 5CPBA 3PDUA 3F3SA 3SBOA 5KKCA 1TLTA 1F14A 1E5LA 1H9AA 4FGWA 1LSSA 3QLJA 3LVFO 3TL3A 3HG7A 3A28A 4WLOA 2NQTA 3CZMA 2ZK7A 4UVIA 5COAA 4DPLA 3WYBA 4YRDA 5JC8A 3C1AA 5BNTA 3KXDA 2VHZA
chains in the Genus database with same CATH superfamily
5E6RB 2FN3A 2O23A 1XPRA 1I10A 2H63A 4JLJA 2OHJA 2IQIA 1W36C 1IBKB 2G76A 3NG1A 1RI1A 5ELMA 1IJEA 4XB6B 3DDUA 3LQKA 3TH5A 5A03A 2J32A 3CRW1 3JQ7A 4YRLA 4BB9A 2DGDA 1R0ZA 1U3FA 1YB7A 3RS0A 5YASA 5FDFA 2H9AA 4M86A 1KZ1A 3FAUA 4L8LA 1H2WA 4YK7A 3EFHA 3H8VA 5GIOE 2J1LA 3I12A 3T3GA 3TM5A 4R8KA 3VVCA 3TOCA 2OEPA 1X9ZA 2R25B 4WKBA 3PFHA 4XYGA 1FFDA 3ZDFA 5F2NA 2FOLA 1BYUA 2Q5FA 5AXBA 1JP7A 1NQVA 3Q1KA 4W1PA 1Y0BA 2XGSA 2UZ1B 3QA9A 1EB9A 1XU4A 5EIHA 3CLTD 1UPCA 4X90A 3DCIA 4N18A 3TDMA 1BHQ1 1F38A 2HDNB 1KMHA 1ORRA 5FTJA 5TGTA 3FIUA 3A04A 4HQ6A 2J85A 1TVKB 1MC4A 1DWOA 2O2JA 2E37A 1VBMA 2WAOA 3ORQA 4I81A 1DFIA 3RLIA 5KYXB 4X54A 4Y98A 5BW4A 2QR5A 3UENA 3A06A 2H1IA 2C59A 1QZTA 1ETUA 3FPGA 4IQ0A 2IEGA 4K26A 3EC2A 5DT2A 5GJVC 2DY0A 2W7TA 4CUZA 3P9CA 1SFRA 2PD4A 4EY8A 2K7FA 2QN7A 1G6KA 3NEAA 3LPLA 3PIRA 2BF4A 4MA0A 4ARVA 2GJ8A 4DR4H 3K6KA 1RPAA 3C85A 3AJDA 4RKYA 2VDQB 3OLCX 3E2IA 3SJZA 4FC7A 5GPBA 4LGMA 2Y76A 2R66A 2C3YA 4XGNA 4JI8B 3T1YH 3RVLA 1ZD9A 5AW1A 1PVDA 1NMEA 4ZAVA 2AVDA 1QU3A 2MYUA 4K8RB 1ZCAA 3OIVA 1HY3A 3H9UA 1RACA 3K3PA 2CDRA 2EJWA 2ZOSA 3HE3A 3I45A 3R5XA 5CPFA 5JH7B 4GH5A 3S5UA 1SUBA 1PSDA 1NXVA 3IIKA 1VL1A 3KV1A 2G8YA 1G21E 1I14A 2NO4A 3DYBA 1QFMA 1JZSA 4OMDA 4QUKA 4MWZA 5BR7A 4MA4A 1Q74A 4WERA 4L3WA 2B99A 1V5GA 3CG0A 5CA1B 1LI7A 2UUBH 4JBXA 3RSOA 2EIXA 3ZNNA 5AVWA 4YLYA 3RBVA 4V1CB 4GXRA 4DUGA 3D3KA 3M83A 3U3OA 1GPMA 3L93A 1OWMA 3CKKA 3UOAB 4JEHA 5T4EA 2GETA 4E1VA 1CJCA 3KAPA 4KNVA 1WBBA 3PPXA 4TRNA 2QYSA 1YFJA 3UXMA 1NL3A 2R7LA 5D6NA 5DULA 4P33A 5A6SB 1YF3A 2V7GA 1E1CA 1JG7A 4GPAA 4KFUA 1WZEA 4PV7A 1XHFA 1V9NA 4GMHA 4W5OA 4M38A 3CV3A 3TE7A 5LP6F 1EDOA 3NTRA 2WINI 4P3YA 4IBOA 1W9HA 2CVQA 2C4MA 5LMUB 5I9TA 4XPZA 1P9NA 4K6FA 1LY1A 4W1QA 1KAGA 1SBHA 4MLZA 5EKSA 2GBCA 5ECDA 2E87A 5JD3A 4AKSA 3DLIA 4P4GA 4U6QA 1XROA 3M2PA 4UW9A 4F7DA 1J8YF 1U5BB 3RC1A 1P81A 4XDZA 4KWEA 2O8NA 4CMHA 1UEIA 1L5VA 3W2FA 4EF6A 1JIUA 2IYAA 1IQPA 3OM1A 3E22A 4G4GA 2Y05A 4GBMA 2C1EA 3K5WA 4IX1A 2H0AA 4I8XA 4YRZA 1LRKA 1E0DA 2R79A 3K0CA 4EHFA 4TLCA 5J58A 2VPZA 1HLPA 2MIIA 1P6XA 3M0EA 2WJZB 1L7DA 4IY1A 3I9MA 2JFXA 4LJSA 3PQFA 4P86A 3D2AA 2RGRA 1LRLA 3EY9A 1H93A 1OH6A 4K28A 2PNFA 4Q4HA 1VDMA 3WDLA 4LEIA 5U4XA 1ZH6A 4C0WA 5LP6A 1W9MA 3A3OA 1WY5A 2WFZA 4QLBA 3DXZA 5IVDA 4HQKA 1VSBA 2GKSA 5IAOA 5MFZA 3O8CA 4C4YA 3FOEC 3DL2A 4BAZA 3N74A 1CIJA 4YJ2B 2AJTA 4AURA 1L7XA 3EG5A 3EVCA 3D4IA 2J9XB 4NPHA 1E9AA 5HEKA 2WHPA 3QG5A 4DG9A 5IC5A 3BH7A 3P96A 4QUEA 2PT9A 3ICOA 2GJSA 2HWXA 3FMOB 1DC4A 3FRJA 1DWQA 3QIAA 4XWAA 4BKQA 3PWTA 3MNFA 3EGXB 1LBIA 4DR5H 1BGWA 2VP3A 1HFEL 3LUKA 3MCTA 3NIWA 4J1TA 4M9SA 1J00A 3E84A 5ALOA 5ILOA 4GQBA 2BKEA 4N6OA 1Y5MA 1IN6A 1ZH2A 4FC6A 5EXXA 3T9DA 2D8MA 2RB5A 3HGQA 2I80A 1U4SA 1A9TA 1OPXA 3P2JA 1VL6A 3C39A 3K35A 1OXBB 3P9YA 3UJHA 2W2MA 3CO5A 5ERXA 5IKOA 1G42A 1DFHA 2PLAA 1M2EA 1E2PA 1TADA 3DOEA 3ZI0A 2GM4A 2OV8A 1L1FA 5L6MB 4LF9B 5CDYA 1KS2A 2J7PD 3ZZ1A 2CHUA 5FBVB 2NSLA 4IKEA 1OY1A 5TMDA 4JYAB 2HT6A 4H3HB 2GN8A 4IIYA 3DHVA 3SXUA 4CIDA 1O96B 2JCSA 3H0KA 2I3DA 4X8MA 5JDIA 3D5EA 4RACA 3SJBA 4UUOA 3DWIA 4YJ3B 4IM7A 8ADHA 4DEVA 4IQGA 2JFOA 1SCJA 3Q7SA 3W3ZB 5IS2A 2O8DA 1NWCA 1LV8A 2KWIA 4N6NA 4NJEB 2ZJ7A 4Q03A 4Z4QA 3DBIA 3KSMA 4W5HA 5BSRA 4Y6PA 5JEEA 1X77A 4LVOA 3R1IA 3L1VA 3U7QB 1KTVA 5FOVA 1TU0A 1YQUA 1XJ0A 3U3DA 4QYTA 1MC8A 4BLTA 1T4BA 4UNSA 4B32A 2QRQA 1UINA 2AUNA 2XMRA 4RL6A 2RKWA 3KKOA 2PQUA 1NU6A 4KNYA 4XX0B 4NXNH 1CYDA 2UYCA 2WUVA 4ZOEA 1QRUA 3C8DA 5L9AA 3AM1A 3TNFA 1M2KA 2CYBA 3GKUA 1JKFA 4Z51A 5IJWA 5KOIA 3V4PB 4DJ5X 3IOEA 2AF4C 2QEQA 2QLFA 2J3HA 2MSWA 1E1YA 2EC5A 3HEMA 4M0EA 1D4AA 1H65A 1TAGA 4JH0A 4MRNA 3KZVA 4EG0A 5LQDA 3DTNA 4O4HF 3I32A 4A10A 4DLPA 4GS5A 4L0DA 2VDMB 3K9LA 4UHDA 2I55A 1F0YA 4FHDA 5E7QA 3AEKA 3QUQA 2JCGA 3FMVA 1COZA 1NNI1 3NYWA 2HPHA 2I78A 2JHFA 3TQSA 2Z2JA 3GARA 4ARAA 1CQJB 5JTTA 4FFWA 5EEHA 2D74A 2QTFA 1MU0A 3BIFA 3R3XA 4PCUA 2XOKD 2A5GA 3WK9A 3U49A 3G2QA 1T9HA 2AG0A 5INTA 4HAXA 5IK2D 4B73A 4ENPA 3EVNA 2ECFA 4LV6A 2AFIB 3LXXA 3QVXA 3K2QA 1DBPA 1ZNYA 3R77A 4NU5A 2AJDA 4RV9A 4RK0A 1F3LA 4U2DA 2LPMA 5J2UF 6AT1A 2I3GA 3EGCA 3P9PA 2BCJQ 2VDLB 3WBFA 2AXEA 1E7MA 3IJPA 3QEKA 4G9GA 3MRVA 5CB6A 2OOSA 2DEUA 2H08A 1PDVA 3FPSA 1ZZJA 2EBWA 3F3YA 1PT6A 4BJ1A 4CLRA 1HNWB 3A1SA 3C7KA 1RJDA 5DE3A 3I5XA 5AVTA 4KDEA 5IJ9A 4F8JA 4FXPA 1CVIA 4O4HA 3TOZA 4OO1G 1PR3A 1EHIA 3LUBA 3BL6A 2R6R1 3GJZA 4FFSA 4BZXA 1ONNA 2H2HA 1X7WA 3UA4A 3B60A 4AKTA 4PQGA 1CQWA 1VRWA 4UBJA 4I9FA 4BB6A 3UWOA 3L7MA 3DZDA 1G21A 2ZBRA 3Q3IA 4GF5A 1R9NA 4CIWA 4YO7A 1K4KA 2E49A 4B3DA 2J6IA 2XKAA 2G9NA 3LCVB 1RPNA 1ONOA 1R8JA 2QTVB 3VZQA 3R9IA 4KC0A 3WGNA 2I6GA 3V42A 1TA9A 4LMRA 1A8UA 1TUGA 3NNDA 5J2UA 1ZMRA 2PS1A 1VBIA 2OTCA 3CU5A 3FNQA 1KJZA 4NYJQ 3VR6H 2HGZA 3KKMA 1XVVA 3D1VA 4OATA 1GSOA 6NULA 2QVYX 2WYWA 2XNDD 3OZSA 4AZTA 5L3QA 3PEWA 2XA9A 3BWEA 1Y33E 2EP8A 5LXTF 1M9NA 1E9DA 2WIBA 3ACBA 3DW3X 4QGHA 3T0FA 3DT6A 3UHFA 1FJXA 3AQ4A 3KAQA 4CR7A 2E55A 5LKAA 3V69A 1QIIA 3HY4A 4LWZA 3TB6A 3HY3A 1YVRA 4FKMA 3FOFC 1ACMA 1UH5A 1B8UA 3GH3A 4LNAA 1XJWA 2GMWA 4M7OA 2AZDA 2P3QA 4CMGA 4PN7A 2UZ3A 2EYUA 3MCVA 1FVOA 1S8AA 3BL5A 2OO5A 3L4BC 5AUPB 3RB8A 3WLSA 5IH7A 4N0DA 1PNOA 5G4LA 2QRKA 1ZZEA 1II8B 3N8NA 2VAWA 3GUYA 3ZE9A 3OCJA 4Y6QA 2GAFA 3U3XA 1EEXB 2DWPA 2V6JA 3FNIA 2LGJA 2PUTA 1WY7A 4Y3UA 1MVLA 4TRJA 1AOXA 1TYEB 5H7XA 2IOFA 4CF4A 4JSYA 4RMJA 1P3Y1 2E5LB 2ZIXB 2B6NA 2PGAA 5DLQC 3VR5A 4QX6A 3VKGA 4DLTA 2XDQA 4EFMA 1NLMA 5CUQA 5LXTA 2P90A 3FFAA 3EQ7A 2H2WA 3NDRA 3OO0A 4B2IA 3WNZA 1U3UA 2EP7A 2WOOA 4DTIA 4GKAA 1L9XA 1NBIA 1W76A 2QZJA 3CN9A 1XVUA 4QUJA 5JWHA 5ENVA 4BNDA 3TCNA 3ROKA 2GO7A 3CINA 3MMZA 1E1RA 4N9WA 3EH2A 1S3IA 1EX9A 4HRYA 5G41A 4QC2A 1NVDA 3NBUA 4K7JA 3UC9A 1NMQA 1RR6A 1U28C 2WJIA 3L7OA 3GGOA 1RABA 1G4HA 4OY3A 5GV7A 3ZWDA 4EKNB 3VR4A 5BWBA 3QKRB 3ZXXA 4DLZA 2Z4SA 4CTMA 1OSNA 3MW8A 1NT4A 1ZZKA 4M2LA 4KLNA 5JQGF 3HJBA 3F2IA 1NQTA 2QI9C 2A9KA 3L0OA 3OCCA 4HEHA 4KO2S 1Q7RA 4MQFA 2JFGA 1ULTA 2A30A 2M9MA 1KY5A 1QJCA 2WZBA 1Z6QA 4A15A 1I4TD 4LF6H 4FHCA 4TKUB 2Q8NA 1CJKC 3MLEA 4NHOA 2JE6I 1PU2A 2Y1EA 4QAQA 1S96A 1A76A 3AYZB 1ZUHA 3F49S 4UDYX 3BA6A 4A16A 1W0CA 2GEBA 4ZIRB 1T4CB 1OKKD 2F1JA 4RK4A 1KE2A 3BWBA 3KJIA 2O7RA 5KAPA 3BSSA 4DR6B 1ZCFA 3DOHA 3OCWA 1ZXBA 2FSHA 2BJWA 3QYJA 4R2WA 1LH0A 5EWMA 1JU4A 2XVMA 3RVJA 3NC1C 1WQ1R 1ZN2A 3S2UA 2ZJ1A 5IKXA 3DQQA 2EWMA 4WACA 4JZYA 3TVYA 2Q46A 2CLSA 1SIWA 5I9BA 4DRXB 1D2GA 4I7EA 5K0JA 2PXXA 2SKCA 3EPPA 4IXTA 1KRHA 5FHQA 1J6UA 4JCOA 4IUBS 5JQGA 4O1MA 3A1TA 2OXCA 5LYYA 2H85A 2RHGB 5SY9A 3BXHA 3T3DA 3WTCA 5FADA 1K6MA 1T3ZA 4FEAA 3AI3A 4A6EA 2L18A 2WD7A 2I6XA 5L4LA 4BNIA 1I2BA 1O1YA 3A6FA 2RAFA 3TRFA 1E5XA 1X13A 4RPGA 4GRAA 4EJMA 1KI4A 2FW7A 2NXEA 3LBHA 1N3IA 5L3ZA 1HRDA 5D2CA 2V6GA 1F6WA 1QVRA 4KBGA 4MUMA 2ZXFA 1F9EA 5DHAA 5D51S 3W5CA 4F60A 5ALSA 4DR1B 3IPRA 2X9QA 3ZY6A 4AP5A 4H0FA 3LPDA 4N0QA 2NG1A 4PAMA 4R2KA 4H1WA 1F5SA 4GPD1 4YALA 3UN1A 3ECSA 1RYZA 1QX4A 2YWGA 2OHIA 3CLHA 3LUAA 1Y8RB 3VDXA 2VH5R 1VPTA 2VWPA 3PJEA 3W9UA 1SG0A 3WJ7A 3RV3A 5IXJA 5KTYA 5FOQA 2YJ4A 2KW5A 4W6QA 2QKYA 1U8AA 2FG6C 4MWTA 3T7JA 3EFOA 2AE2A 1EP3B 2Q5HA 4ZVMA 3CSSA 2M8WA 5K0NA 1TA0A 3JQGB 3ZW8A 4U9HS 1LVGA 3GLIE 2GXAA 2XSZA 4V1CI 4B9EA 1W5TA 1YDMA 5ENZA 2DSNA 3LHSA 1UMCA 4EATA 5FFFA 1DE0A 4NR0A 5A1TA 2WWGA 1W2HA 4A26A 3C3JA 1KIFA 1E3QA 1DC6A 3O93A 1GRVA 2C3MA 3DGEC 4PW0A 4LXQA 2HXSA 3OJ0A 4MK4A 4Y2SA 4CFZA 4BECA 1T3TA 5H83A 4J8PA 2VQFH 1VJDA 5T6BA 1ONSA 4C1NA 4TSFA 4D8WA 3NRCA 4OHKA 2LDXA 1ADCA 3G0BA 4DPMA 4KJZA 5HZGA 2HYIC 3C87A 4GX5A 3WO0A 4TLMB 1JQDA 1RWQA 4P3NA 3SI7A 5EJEA 3RANA 1DWUA 4EJ6A 2ZI9A 3MBOA 4LF5H 1FP4B 4IZOA 2Y1FA 3I05A 1XD8A 2N9UA 2ZYRA 1XCLA 3RI3A 3VPGA 2VUTA 3MTIA 5BV1A 2HHHB 4ZTBA 1UOEA 4R9NA 4WXRA 4CMEA 5A71A 4G8CA 4EAAA 3H9BA 3I28A 3E1KA 2FDCA 5KTRA 5B1HA 4CRWB 2WF8A 1DINA 4JL6A 4I4TF 5ALZA 3K0AA 1FLVA 3G85A 3L6DA 4F8YA 4ZA2A 1X1RA 1D4FA 3F5SA 1YJ8A 4JI8H 5A5VA 4XB1A 1L5LA 2YN4A 4LOLA 4NYIR 2XQVA 3K2IA 1K7SN 3TZCA 4J7AA 4HVAA 2VDKB 3AKCA 3O4FA 4MKGA 4ADSG 4DDUA 1P4JA 5SZIA 4P34A 5LP1A 2IHKA 1U7XA 5EWLB 1AHPA 3HLTA 5KSYA 3A9RA 3SNHA 3ZZNA 3QPCA 4GMKA 4E09A 3M1AA 1JYFA 2IJGX 2EW2A 1I7LA 1R9GA 4AJOA 3EXIA 4A2QA 4FB4A 1J5EH 5CMLA 3R7LA 3DZFA 3OTGA 4G4SP 1NJ2A 2OQIA 5EI5A 4GAEA 3ZK8A 1KMNA 1DO8A 4TV9F 3WI7A 4H0NA 3PR3A 3OZRA 3GZNA 3R7WB 1MA0A 2H5EA 5K6AA 2QTGA 1FMJA 1EB8A 1X4NA 2PT7G 1ISHA 2ON6A 4M1YA 4BNZA 1DAOA 3EAFA 3LCCA 1OYOA 3HXLA 2CXUA 3EZJA 3B3QA 3AZPA 3MIIA 1GVNB 1E3DA 4I4TA 3Q3GE 3UAXA 2ZCVA 1OLXB 1ULSA 3AUUA 4D1YA 1RRPA 1J9EA 2NVUB 1N25A 5FNZA 3JQAD 1QLJA 5EIEA 4AMGA 3ZDXB 4PCAA 1CSEE 4I50B 4C30A 2IA5A 3ZK7A 1Z38A 3FWYA 4DCPA 4EI2A 3OOWA 3T7RA 1Q0HA 4TMZA 2FSUA 1M54A 4UAUA 1DIOB 1X8XA 5LMUH 5FNVB 1QH1A 4KR9A 5HVNA 1FNCA 5G1NA 1ODSA 4LOHA 1HETA 2X1VA 2YRWA 3HXOA 1C3VA 1ZHFA 2FSIA 2XZPA 1OVGA 3CLUC 4F2GA 3NXKA 4HUJA 1N2HA 2VJCA 1G8SA 2F1RA 4PHFA 2NYUA 1XCBA 2EEPA 2XCIA 4Q34A 4JU8A 4U02A 4LWOA 3K9BA 4N7BA 2X4GA 3U6KA 1F12A 4DCMA 3H6GA 3CR3C 3MPOA 4KHZA 1C1YA 4IOMA 4TV9A 1IZYA 1OAOC 3AUFA 1UDWA 4G26A 1EWVA 4NFYA 1PL7A 2JCXA 1YHYA 1JAIA 1ZNZA 2Z4RA 3FZEA 2GEDA 3H2HA 4JBYA 3UNXA 4EGQA 5C46F 5JNRA 5DOZA 3WGUA 1WR8A 2DPYA 1GVHA 2OK8A 2XUGA 3LYLA 3R09A 4HDMB 1SOMA 4AJ4A 4E31A 3Q9NA 2B6HA 1XMPA 1N9KA 2AL7A 5ALKA 2PWPA 1OBFO 1AUQA 2BAGA 1XTVA 2PRSA 2JH3A 3EZFA 4RIIA 3MRXA 3ZIDA 2BEVA 2YXNA 3QU4A 4UCQA 1W4AA 3BQ9A 1K06A 1RXYA 3NH6A 4A7PA 5BV2P 2VBIA 2ZT5A 1DKNA 1I1OA 2DG2A 2XNSA 3PGXA 1ZAKA 4N41A 4EQ6A 2GNOA 3O1LA 3CZCA 3GMDA 1T2FA 3IBGA 4JQOA 1PR6A 1JQLB 1OYYA 3AI7A 3S8MA 1Q2XA 3RS7A 2ZETA 3NEYA 2PO5A 2Z8YM 3KOUA 4G5OA 3E6AA 1TQDA 3KR9A 1YZNA 2Q2NA 3OEED 3JU3A 2PM8A 1B8OA 1Z0KA 3HN6A 5HZHA 1E9VA 1L4UA 1SUEA 3PLNA 4N4AA 3E3LA 5JVDB 4MYUA 4IF4A 3QUAA 5CNKA 3I6YA 1J33A 3F6SA 5TPWA 4C04A 5JLJA 1GFSA 1WPGA 4OUKX 4AICA 4BQOA 2IZ5A 3ZDCA 3BJRA 2FVYA 2VZLA 3SB1A 3E61A 1P9OA 5HQTA 3R5FA 4MR7B 4KPEC 1RM0A 2QYOA 2Y2UA 1ML4A 3HK2A 4XGIA 3AF4A 2JAOA 4LY9A 2Z1DA 2BL5A 2G9UA 4HOYA 3ROGA 3GABA 1VDZA 2WHQA 2R5NA 1VC2A 4MW5A 2BSQA 4LFBH 4U8HA 1UBUS 3RVMA 4BFUA 5FTLA 2R68A 2AFVA 1ACLA 2YQZA 3BSFA 3VR6D 4C4XA 2ODNA 2HU2A 2P27A 3G2NA 4IJ5A 1E1NA 4QOIA 4BQPA 1Z0DA 1FZTA 3BCUA 3KOMA 3LLMA 4JP3A 1HQCA 3BWCA 2DPGA 2A6PA 1TYZA 2XCQA 1KQGA 1EFRD 4ZARA 1QF7A 4E6EA 1RRKA 2UYGA 3JCZA 4OOEA 1T10A 1E8DA 2IEDA 3QENA 3WLHA 1AMOA 3VVBA 3TNDA 3GXOA 1SULA 1ZD4A 2L42A 4M9UA 3OQOA 2NZVG 1U9IC 3AUAA 2VPXA 3T34A 1RYHA 1M8KA 2HOQA 4PO8A 4CM7A 3DOOA 2XWPA 4FD3A 1D8TA 1RPTA 1Y4ZA 1CIVA 1OILA 2G70A 1VA4A 1GGVA 1NVWQ 1WHSB 2IHJA 2QJWA 3BK2A 4JJKA 2W6JD 4GZ5A 3S1AB 1M3SA 2APJA 3NQ41 2FFHA 4BV9A 4PYOA 1U7TA 1KI8A 1V4VA 2JCBA 3DD5A 3RF6A 2N75A 4BO0A 4IGEA 1SPBS 5CNJA 5AKHA 2GBLA 3BWDD 3Q5EA 5EERA 5KOHB 2XXAB 3BHNA 2BIFA 3KHUA 1JTVA 4E5VA 2ATCA 2P2YA 5EAIA 3GFPA 4ZU3A 3GLIA 2O5EA 3RFFA 3QTBA 3N8GA 1Q6YA 1Z7GA 3GAAA 2CLMB 1KAOA 2GNPA 2OBMA 3GEHA 3JYNA 1PDOA 4QPPA 3ULKA 1M2VA 4NF2A 4QBTA 5E3JA 5AVJA 2ZQ5A 2PRIA 1AIPA 1XLTA 5H9VA 3KSRA 2AJ8A 5DSTA 1O2DA 2YHIB 3RD5A 4BEWA 4EUHA 4HHEA 4J94A 1CDDA 3FLEA 4DSAA 4US1R 1AM4D 3EVFA 1NBMD 2OL4A 1IB0A 1P7WA 4W1RA 1KVTA 3PDWA 4F5DA 3L43A 2C97A 3PQCA 3BD8A 1JHAA 3ESQA 1QE3A 4PSCA 1N0HA 4DA9A 5BR4A 5JW6A 1YTLA 4Y1RB 3DMDA 3JRWA 3DEKA 4BNHA 3GT0A 5EIWA 2DE0X 3SWWA 5J1SB 4RVSA 2O5CA 1FU8A 3HCCA 3HCDA 2XYHA 4NPCA 4W9NC 3UJPA 4ZCRA 1ISSA 4YRGA 2FN4A 5JPDA 5I9LA 3JWHA 2A5YB 4YUVA 3W7AA 5EUMA 2AW3A 2L69A 4CMKA 3PQ6A 4HDRA 3L4KA 3ZN2A 1G55A 2JZCA 3TPZA 1QH8B 1U94A 1XQ9A 5KTKA 1V48A 2IYTA 4IR7A 1Q14A 1SCBA 2V03A 5ADHA 5J4VA 1CEEA 4OJMX 2J7PA 4PLCA 1YVEI 1PJSA 2BZ0A 1OXKB 1LI5A 4JWTA 3UW3A 1SN7A 4OG2A 3ZDDA 1ZY2A 1KYZA 1TFRA 1MTOA 2Q8PA 3LYUA 4PINA 3ZV4A 2IE8A 2ZTVA 4GC9A 3AUKA 5BN5B 4IIXA 2XUDA 5SY6A 3RRNA 2HBQA 4X6XA 2GAJA 3ZU6A 4QU5A 4C7JA 3I8OA 1D2HA 2NU9B 4WHMA 1JNYA 3C6KA 2PXCA 1JMVA 1J24A 1OA0A 4IOLA 3M6LA 1FFWA 1TE2A 4OQYA 1GQFA 2PH1A 3U4QB 3E9NA 3HHEA 2BM8A 1P1BA 1IHYA 1ZGAA 2QSJA 3UUEA 2QNDA 2PJDA 3CPHA 5CNIA 1NVVQ 4P2BA 5JAPA 4FYWA 4MPPA 3NHSA 5AOAA 5FBRB 4ALNA 1T36B 3G5AA 3THYA 1JT2A 3EAQA 4B3BA 1GU7A 2WE8A 1PJ8A 2PLWA 2RH4A 2GVZC 3EZ2A 3IHWA 3N5KA 3AVXA 2LXNA 1HZZA 4CL3A 1VPVA 3A11A 2XMCA 4Z1MD 2IGTA 3PEUA 2QIOA 1QC5B 4Q47A 4A0GA 3N0WA 1ZUWA 4S0ZA 1CUDA 3CNQS 2X7HA 5CXQA 1NE7A 3FSGD 2FN8A 4JXKA 3GEMA 5I9SA 1SEPA 2HSDA 1DIBA 1T29A 5KQRA 1NVUQ 4N3BA 4RH1A 5DGDA 1GILA 4MIOA 4OUDA 1LJ8A 4UMDA 4F9EA 5KINB 1ORIA 1GN8A 2WICA 3KR1A 3ZHTA 4DUZB 2VPWA 2C8VA 2X1MA 4Z9XA 4TKVA 1NQUA 3EVBA 1QH0A 3GRAA 1J2UA 3KM0A 4Z8YA 2PY9A 1K8RA 2ZSJA 3FR8A 4NY1A 3FYUB 4Z0TA 1IBSA 2PQ0A 2R8ZA 3CNBA 4FFOA 2XOKA 3MUFA 4KO4S 2HT1A 3DVRX 5JU6A 2QNIA 1CDEA 1MENA 2I3AA 5IK2A 4FMCF 1V8FA 3QK7A 1CEQA 1G20E 2ETXA 3CF4G 1L5MA 2P0YA 3IQGX 4U00A 1WE2A 4XD7D 4OYLA 3RUIA 2W48A 2FX3A 1EK2A 4M9CA 1UPTA 3KCQA 3R2JA 2G3YA 1X6VA 2TRSB 5ARDA 4O59O 3AQIA 3GEIA 2V3CC 2EERA 1WSAA 1YUBA 2CBGA 4OBEA 5AHXA 1TVCA 3LNTA 5CDFA 3TLJA 3WK6A 4DCTA 1NW6A 4DKJA 4RULA 4LXGA 2WD9A 3DFIA 3DG9A 2IWHA 3THSA 3KP1A 2HK8A 1EWYA 1QMGA 1HT0A 2WTMA 3DOJA 3KS9A 2XY4A 1J2TA 3NYQA 1XFDA 4NEGA 1G19A 1HUQA 3NHYA 1DOZA 1QRAA 3LH5A 1KP9A 5A4FS 1KEPA 1T8SA 3B5IA 2IS6A 3NUQA 2QYHA 1EBFA 1ZOPA 2YWHA 2JEAI 2Q99A 2HWUA 3L18A 4GYWA 4NENA 4PSVA 3BWMA 4B4KA 5AQEA 2Y4NA 4IFEA 1AB6A 3MBKA 3UATA 3SZMA 4JYMA 1AV6A 3DM9B 1Y1LA 4L8GA 1HL7A 2E82A 5C32A 4DR6H 7REQB 1Q0SA 3STYA 2WWXA 5FPPA 4EEZA 4S35A 1SD5A 3VJRA 1ORTA 2M1ZA 2FFBA 5FBLB 2CTJA 1CUEA 1XEWX 2QT0A 4OL9A 3R0ZA 1J7JA 2AI3A 2HV9A 2XNDA 3OQBA 1UADA 2ZR8A 3GT3A 3HRHA 5JEAG 1YS9A 4RIFA 1YK0A 1AZWA 2CZGA 3DHYA 4N40A 3TDNA 1OF1A 3FYUC 1XEWY 5FO1A 2H18A 3IXLA 4LJYA 3L8FA 1KO1A 3ROMA 2CMHA 3REQA 3ZY5A 1GTG1 2QRHA 1P2FA 3FNHA 4RW0A 1I5RA 2B4RO 3T7IA 4EJFA 5JI3E 5DM60 2W2QA 3EMKA 5KAMA 5I4BA 4TM8A 3ZWCA 1F8GA 1UAAA 2P77A 5DCUA 1DELA 3W2TA 2FZLA 4KO8A 4R81A 3RUHA 1NVEA 2RFLA 2XDYA 2I65A 1D6MA 1KE1A 1KO5A 1XCJA 2E9SA 1PLKA 2GJ9A 3C70A 4UHEA 4D3FA 1JJVA 1MEOA 1PFVA 2WMNB 3L46A 3O1JC 4A03A 2R751 2YWFA 1OE0A 3FWHA 3RRXA 3N0VA 3C8MA 4J1QA 3IYLW 5JAZA 1XP5A 4DR1H 4L4UA 4QYWA 1NZFA 1QVAA 3HCBA 1R15A 2ILVA 1ETHA 1SU7A 4ZT2A 1N6RA 1ZKMA 1W5AA 4PG4A 2PTHA 3FFWA 4U7GA 5IAEA 1JYSA 3H8JA 5B53A 3EXHA 2D5AA 2WUWE 3ND7A 3C6YA 2BSAA 1B3RA 4H35A 3M6MD 3QVMA 5B3JA 1L7OA 3TZKA 4EY4A 2VYND 2X3FA 2C9MA 2JD1A 2P62A 3GJSA 5FYDA 2M6KA 3ZV7A 4EG5A 2FMRA 3INTA 1S9DA 2QL7A 2WJVA 4MR8A 4PIVA 5K3FB 4HWOA 3QKUA 1S9HA 1QHSA 1XZNA 1T8YA 1SVKA 3I64A 2QGZA 2P7IA 2G1JA 2O2CA 2FG5A 4JI6B 2C4VA 5TLSA 1NYTA 2ABWA 3O2JA 3WIVA 4RUKA 2ODAA 2HBYA 5DHUA 1ZH0A 2ASVA 4DDVA 3I2HA 3LPAA 4YMLA 1BDIA 3IJEB 4JVNA 1I32A 2DERA 2FCAA 4NBVA 4QUBA 1BD4A 1N2OA 3HB5X 3BMNA 4D26A 1Y81A 2HO4A 4EMSA 1H2AS 2D00A 3JQ9C 1E3SA 2IXFA 4M1SA 2DSTA 2GF9A 1C9NA 2GAIA 4X44A 1R37A 4RHFA 1S4MA 3GDHA 3OJXA 5CG1A 3UJDA 3ZHBA 2CL7X 1TQ8A 1Y5RA 5F9MA 4U2KA 1UKVY 1OKKA 5K3CA 2PKQP 3LCJA 5GADl 3DZJA 5KHLB 2X19A 4MULA 4C0SA 3CE6A 1I7DA 5FBWB 1KMQA 3A4VA 4K9DA 4NOJA 3VKVA 5IMSA 1K68A 1I7QB 1OWNA 4TGLA 1R12A 4U7PB 1QO9A 5JNSA 2A33A 3O31A 1B3BA 5F2OA 2JBAA 3O8QA 1CZUA 3PFGA 1U9JA 2PMDA 2X2FA 4LI3X 3AVUA 1ABBA 4AI6A 2LTMA 2FP4B 3PU6A 4PC1A 2WWYA 3LL4A 4GE3A 3U37A 1NX6A 4HGQA 4QEZA 3EDYA 4LBYA 5KYKA 4TN1A 5EHIA 1CY2A 1UOPA 5MN6A 3S8EA 4EOGA 4RLSA 4PBSA 2Z1MA 5D1NA 1MHPA 4PLWA 5C1BA 1RXWA 3IB3A 3PUVA 1QHXA 5TT0A 1O9BA 2XB4A 4Y9TA 1QFJA 5DBFA 2EBHX 1P31A 3ESXA 1YVDA 4YEDA 4YPOA 1KJJA 5KJCA 4OU5A 4OSPA 1VHTA 1RBZA 4PS0A 4CT0A 1ZGGA 4D0LB 2WM8A 4FDAA 1ZK0A 3KJZA 3GCZA 2XYQA 3T1HB 4IGAA 1CZRA 4DCVA 2AMFA 2HY7A 1Z8DA 4UM7A 1L2TA 4L72A 1WEKA 4K2HA 7MHTA 2D1YA 1T34A 4ND4A 3JARA 2IW1A 4JA0A 2NXWA 1Y48E 4ZCPA 1XELA 4J0QA 2AWOA 3RYHA 1UM8A 3C6BA 4H17A 4RLQA 1XWFA 5FAXA 3DWGA 5AVQA 1PK8A 3OWXA 4CMAA 4B3SH 3H8WA 1DIRA 5EEGA 3HXMA 1MB4A 1GGEA 1I4DD 1ABFA 2OXRA 4OSEA 1T2AA 1VHLA 1XYYA 2A4KA 2HA4A 3IAEA 3QVTA 1EYZA 4J4TA 4Q4DA 1ARZA 4K3VA 4TS9A 2XJ4A 1SUAA 2J6HA 1R8XA 3AH8A 3N2GB 1IONA 3BRQA 1VJRA 2AQKA 4G5YA 3ZHCA 4KGVA 4HYTA 1RLTA 2QTZA 3B8EA 4HFMA 2OYSA 1KY3A 1WU7A 3AF0A 4JT2A 3O3CA 3ZH9B 2KS6A 3DL4A 4B76A 3FVQA 2W83A 3H17A 3X1YA 3SG0A 4B7AA 3SSAA 4CI9A 1N7GA 5TNXA 3WADA 3D59A 4BNTA 4MMXB 5M2QA 1NBME 1EWRA 5FWAA 5A3VA 1A9OA 4B83A 1MD9A 3OTIA 1CPYA 1GL6A 2P3OA 2R6ZA 3UQZA 5J40A 3V34A 1O8BA 4WN9A 1SRRA 1HO3A 2RHTA 1T3HA 5K99A 4RQUA 4OM7A 2PY6A 3DV9A 3GJ0A 1NZJA 2QN2A 3B1VA 1HX7A 3HNPA 9LDBA 1GEGA 2VRNA 1D2CA 4Y2HA 1P2GA 1XFAA 2GJ4A 4CNBA 2QXUA 3DBOB 2PKWA 5EE5B 3WV5A 1IRIA 4XWWA 3WGHA 5DW0A 4RWEA 1GL9B 2B34A 2QMYA 2QUZA 2XJ9A 3QJGA 4NATA 4XTRA 1MJGM 2LCQA 1PR9A 3IBSA 5JYEA 2P1RA 2PMWB 2DPMA 2H7XA 3B1KA 4PAQA 1EBUA 2D1QA 3DEIA 4RHYA 5M3BA 5BUCA 3C4VA 4NBWA 2C92A 3SDSA 1GLVA 1JR6A 3B6IA 3OUUA 1NQWA 2D59A 4OBWA 2ZYGA 2X2EA 3SZGA 5GWXA 2YZ7A 2PSFA 4B6JA 4MPDA 1T1EA 3QKWA 3ZE1B 3E35A 2CHEA 2OILA 2PUGA 1AKVA 4ZQIA 1BS1A 2VHQA 1JG3A 4FS3A 1Q91A 4JD5A 5CG2A 3RTAA 2DRIA 1F48A 1NATA 3CLKA 4XUCA 2VJPA 5KCZA 1YCGA 1IDN1 4JS0A 1Z13A 2B8JA 2A14A 1AGYA 1VPEA 3RG2A 2B7CA 1K3UB 3TZEA 3ELUA 2XDWA 2FUG6 5DDIP 4OX9B 2PBRA 3ZE7A 1FRQA 4E22A 3NDBB 1S02A 2V7TA 2W5UA 2UVPB 3OEYA 1H3EA 1QXSA 3WFIA 3HUTA 4MRMB 2C5FA 1TYCA 4B4WA 2ZI4A 2CGEA 2JFHA 2JI8A 5LQMA 5M29A 3JQAA 1DJOA 1IJFA 1HL3A 1X2EA 2I29A 2P40A 3KTOA 3PPWA 2PJRA 1QKIA 2AVNA 5H0IA 4A6PA 5FWNA 2UKDA 2XKBA 1K5DA 1Q7EA 4FIDA 4DIKA 1ZNQO 3N2LA 4QG7A 1IOZA 1QB8A 2PKRA 3M4XA 5CJJA 2IT1A 2OE2A 4H16A 2W4IA 1YR2A 1Q0QA 3ZLVA 4DG8A 4OHWA 3GA7A 3ZKWA 2VYVD 4LRSB 3A2LA 1QLWA 3JSXA 3ES9A 2AX3A 4KAJA 4ZAWA 4MW6A 3UH0A 4XAQA 4N3GA 4DMFA 4ZCMA 4CXMA 3UO8B 2KBEA 2LR0A 3O7WA 2UYOA 3R7FA 2FK8A 2FKNA 4R9SA 4MUHA 4UDNA 1E3EA 1OREA 2P4SA 4MMYB 2QW1A 3NJ4A 4YHHB 1CV2A 2V6BA 1DKMA 4MUFA 4JUFA 1TRKA 3GT4A 4OH7A 4RD3A 5CT4A 3DV0B 4WQMA 3HO8A 4ND2A 2VP4A 4UMEA 5DBHX 4ZVUA 1KY2A 4F72A 4Q4JA 1FVHA 1N1EA 1XDUA 3CF6R 3WL4A 3PLRA 4OH1A 1N2GA 2WG0A 2DR2A 3CPJB 2WIGA 2G9RA 2I22A 3UKDA 1FVFA 1N4DA 5CK5A 4DL9A 4Q9AA 1X42A 2A9VA 2XQKA 2GPYA 3E4CA 4IFTA 3ZV3A 3C3KA 4UOEA 3ET4A 3A3YA 4GLJA 1WHRA 2DBVO 2YJ3A 2F90A 2Z83A 4G1UC 3RUDA 3V4LA 4BEBA 2IZ0A 2PUFA 1NUSA 1XYVA 2EFCB 1N2CB 5I7FA 3TW4A 5EPOA 3BHIA 2C4NA 4L8WB 5DNDA 1Z0UA 4NPAA 1RHMA 4BDSA 2BYTA 3OEEA 3T7DA 1AGXA 3TTUA 1ZDMA 3LY5A 3ZWBA 5HR5A 3B48A 5ED0A 1AY0A 1PNTA 1THMA 4X93A 5A3JA 1SOUA 5CGQB 2HEGA 5KSWB 4RVNA 3VBCA 5F52A 1YZLA 1KYXA 1D7OA 2CHVA 4P4SA 3IEXA 3G1UA 4M1MA 4M8LA 1AKRA 4KXNA 5FP0A 5JDCA 2A3NA 4L4SA 2KLBA 3R4CA 2Q49A 4P8RA 4Q3EA 4UBOA 3RFTA 4RGQA 4C08A 3C14C 4DHEA 3SHQA 4ZK6A 5IDWA 5LM3A 4JI0B 4NNJA 1U9ZA 1W85A 5TGZA 2LUOA 3EYAA 4UARA 1FRVA 5DP1A 3LUGA 1LLDA 1RQPA 4DDMA 1DTJA 1IDOA 2BE9A 4KXVA 4RLHA 1U7PA 1TF2A 3RRFA 1LDYA 3FBTA 1FE8A 4QWMA 3VR6A 4BLPA 1H5QA 3B3AA 4PGAA 1PWHA 3QELA 2QX7A 1CQIA 1JPNA 3BXEA 2WYOA 3ORFA 2C07A 2D5BA 3QV1A 4G07A 2QZPA 4TL8A 4PR0A 5G0SA 1L9KA 3S55A 2A86A 4PO1A 1CJSA 1WPQA 3BHJA 2WYVA 2YN2A 4U63A 3ZU4A 5I7EA 1DKLA 1W0KD 1R3UA 1EFRA 1OX4A 2VF8A 1L7EA 4ZVNA 4BEVA 3OAAD 4MIEA 5TJ9A 4UXHA 3ELDA 4MB6A 2Q7DA 1SQFA 1NLUA 3L3BA 2W8ZA 3Q7PA 1YR8A 4Q9JA 3IR6A 1JQ5A 2VT3A 1YBAA 1QE0A 3B1JA 3ZCTA 4C4PA 1DG9A 4CV1A 4D56A 4D8VA 5K7SA 3MMNA 3Q15C 2PZ8A 1EUCB 3OSZA 4FOLA 3AR8A 4FGKA 4N12A 3HWSA 1E1MA 5EQFA 4NV1A 5BV0A 5JRZA 5IJZA 2ID7A 3VPFA 4PAWA 1GDTA 2W6JA 1RADA 1ZQ9A 2PUJA 4WD3A 4OF4A 1HDIA 2GEFA 3OY7A<