2O4CA

Crystal structure of d-erythronate-4-phosphate dehydrogenase complexed with nad
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
380
structure length
380
Chain Sequence
MRILADENIPVVDAFFADQGSIRRLPGRAIDRAALAEVDVLLVRSVTEVSRAALAGSPVRFVGTCTIGTDHLDLDYFAEAGIAWSSAPGCNARGVVDYVLGCLLAMAEVRGADLAERTYGVVGAGQVGGRLVEVLRGLGWKVLVCDPPRQAREPDGEFVSLERLLAEADVISLHTPLNRDGEHPTRHLLDEPRLAALRPGTWLVNASRGAVVDNQALRRLLEGGADLEVALDVWEGEPQADPELAARCLIATPHIAGYSLEGKLRGTAQIYQAYCAWRGIAERVSLQDVLPETWLAGLQLNPGCDPAWALATLCRAVYDPRSDDAAFRRSLTGDSATRRAAFDALRKHYPPRREITGLRVATGGQAELQRVVRALGAQLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Erythronate-4-phosphate dehydrogenase
publication title Crystal Structure of d-Erythronate-4-phosphate Dehydrogenase Complexed with NAD
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Oxidoreductase
total genus 125
structure length 380
sequence length 380
chains with identical sequence B
ec nomenclature ec 1.1.1.290: 4-phosphoerythronate dehydrogenase.
pdb deposition date 2006-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00389 2-Hacid_dh D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain
A PF02826 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain
A PF11890 DUF3410 Domain of unknown function (DUF3410)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.170 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 2o4cA03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2o4cA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2o4cA01
3AOGA 3DZGA 3WJ7A 1NQ5A 3SBOA 2GN8A 3OA0A 1KEUA 1DSSG 3I9LA 4NJMB 1BVUA 1E3JA 1R6DA 1DEHA 3F4BA 1PJLA 2XXJA 1D8AA 4D45A 1DRWA 5HWSA 2A35A 4DLLA 2BKAA 4Z6KA 3FBTA 1VSVA 1GPDG 2AQKA 3ITKA 1EQ2A 3KETA 3HDHA 3NKLA 3OSUA 3QLJA 4IPTA 4ZD6A 3DHEA 4R16A 2QRLA 4LK3A 4IDGA 3F9IA 1MB4A 1YB5A 1KVRA 2C20A 2PZKA 3T7EA 2QW8A 2JD2A 5JPIA 3MTGA 3DMTA 4NR0A 1SNYA 2C5EA 2POQX 2YUTA 4PLTA 4A26A 4BKQA 3ENKA 3RBVA 5IXSA 2AMFA 2RH4A 4TROA 3WJAA 4LSMA 4E5YA 2J3KA 2WD7A 3JYQA 4R69A 3W6UA 4IDDA 1CETA 4E32A 1VJTA 3RAJA 4B3IA 3RUCA 4GWGA 5AQ1A 4J43A 3HNPA 1DRVA 1NP3A 4XCVA 2X8LA 2O3JA 3E82A 5BSHA 2JAHA 1UH5A 1ARZA 3I4CA 4BMNA 3GDOA 1N1EA 3JQ8A 1O89A 3M1AA 3WMXA 1P0FA 5MDHA 5F5LA 5LDGA 2HK8A 2JD1A 5F3RA 2G76A 3T7CA 3I6QA 4WLFA 4RPGA 4WECA 4I5FA 3NUGA 4BNVA 2HMVA 2DFDA 3WXBA 7ADHA 2B35A 5BSGA 4PLPA 1YDWA 1N9GB 4GL4A 2O7QA 1HDYA 2JFGA 3AY7A 1B16A 3K6JA 4J1TA 1HDGO 1XG5A 3VHRA 1ZJZA 4BO5A 3TN7A 3VTZA 1QLHA 3MCVA 4EZBA 5HS4A 3F4LA 2B5WA 2WSBA 1CEQA 1HF3A 2A4KA 3P5SA 4NFYA 5KJEA 4PLYA 2FZWA 4G2NA 1PX0A 1EZ4A 4R51A 3ETGA 3RCBA 4RGBA 2PD3A 5KVQA 1T4DA 3I9MA 1LU9A 1NWHA 1YOVA 1U2DA 5TF4A 3GDFA 4P8RA 3JQEA 4YAIA 3Q9UA 2QG4A 1OI7A 2EWMA 1TT5B 1I36A 1ZMTA 3A14A 4CMEC 1GQYA 3WMWA 5CFZA 4Z3DA 3JQ9A 3JYOA 5L4SA 3H4VA 4F3YA 3FR8A 1PS8A 1FDSA 2CUKA 3KHUA 2ZB3A 4FFMA 4FD3A 1R4MA 1ENZA 3OBBA 5JE8A 4ND2A 4OYRA 4H3VA 3ZU3A 3R1IA 3GDGA 4DL9A 2DTEA 4DC1A 4W9NC 3PI7A 2EW2A 3C1TA 4GMGA 3EAGA 2VWQA 1RJWA 2Y1CA 3OJ0A 2R2GA 5F1OA 4I1IA 4Z0PA 1SEPA 4MINA 1C0KA 3EYWA 2GO1A 2Q1SA 5JDIA 5GMOA 3BMNB 4ZGWA 4YQZA 1GV1A 1MV8A 4H16A 4EUEA 4RVGA 5JY6A 3BIOA 4AJHA 3DBVO 3QQPA 2QIOA 4KWIA 1KETA 4AJOA 5L40A 4M55A 2O2SA 4WE3A 1BSVA 1W4ZA 3TZCA 2UYYA 1MGOA 1M76A 1T4BA 2VT2A 3ZWWA 5CDYA 3AI2A 1P1JA 1YDEA 3IAHA 7MDHA 4HNHA 5BSFA 1MLDA 3E03A 3BMOB 4B4VA 2IYPA 3QWIA 1Y8QA 4MOWA 4R3WA 3TWOA 1V6AA 5TT0A 1KYQA 1LSOA 3ROPA 3TF5A 2O4UX 3MJEA 4CMGA 3JQBA 3LQFA 4WCFC 5JW6A 3HB5X 4OGWA 3PWKA 4K6FA 3UXYA 4U7WA 1Z6ZA 1WDLA 4PZDA 4I9HA 3SX2A 1TB4A 2CDAA 3WICA 4E13A 3I23A 4OAQA 1PJ4A 1I10A 3CTMA 4CLRB 3K96A 2NU8A 1R4NA 3JQDA 2PZLA 3OH8A 1DJNA 4IGFA 4ITUA 5T64A 1ISMA 1PJBA 1NR7A 2NTVA 3KOUA 5DBIA 2Q2WA 3OF2A 1ZSVA 2FSVA 4CUJA 4ZICA 3JCZA 3VPXA 5AXCA 5I7EA 3VOSA 1R37A 1K5HA 3DBLB 3OEWA 4NHEA 1GEEA 4ID9A 5CDSA 4BL5A 4G81A 1RYDA 1QORA 1JA9A 3G1UA 5DNAA 1QR6A 2E37A 1J49A 1DDOA 4MDHA 2HMSA 2RIRA 3BYZA 4K9DA 5AYVA 1NFFA 1PJTA 4MVJE 2Q46A 3FPCA 4PRLA 1MUUA 2FY8A 3ULKA 5IDYA 1Z7BA 3G3EA 4HNGA 3WS7A 1AN9A 2WMDA 2AXQA 3VVBA 5TJ9A 5KNLA 2JCXA 2GR9A 5JFOA 1JKFA 1P31A 2Q50A 3W1VA 4GGOA 3Q1LA 4J90A 4BO6A 1VL6A 4WJZA 1VJ0A 2DBVO 3V1YA 1XEAA 2B4QA 1UP7A 2NU7A 4Q3DA 2HAEA 5CDTA 3ZWCA 1GZ6A 3E9MA 3VZRA 3ZWOA 3TZ6A 1ONOA 1WMBA 4IQ8A 4XGIA 4RV9A 4NK4A 3IP1A 3OQBA 4BNKA 2AHRA 2YHUA 4CM1A 1SB9A 4EITA 4CQLA 4FSHA 4BNNA 4OXKA 1W73A 1LLCA 2JFFA 1GZ4A 4D42A 3LSYA 2Q45A 3B6ZA 2NVWA 4DWVA 5HTOA 2FOIA 3O8QB 3OEYA 1E6UA 1H2HA 4MVJM 4UUOA 1NBOA 1N5DA 4AJKA 3ZHBA 5KJ1A 1P1IA 2QYSA 2HRBA 1ML3A 2DM6A 2PKRA 4WNCA 4B8WA 4RJTA 3HADA 1I3LA 5FI5A 4DMLA 4EJ6A 1HKUA 5DOZA 5DN9A 1N7GA 1SCUA 4M89A 1AGNA 5A9SA 2Y1GA 5I7VA 2C5AA 4MVJF 3GFGA 4BO4A 1XHLA 1H6BA 2AE1A 2NV6A 4J4HA 4EEZA 4F45A 1E7WA 4GAEA 2C7VA 3NYWA 1U3WA 3CMCO 2BRUA 4R5MA 1AHHA 4YJGA 3TRIA 3ZI0A 2VOJA 2EJWA 1IL0A 4DQVA 4QSMA 2WD7B 4WKGA 5IZCC 1E7SA 5THKA 1CJCA 3KSZO 1ENPA 3G49A 1C14A 1UZNA 2HK9A 2H6EA 3LK7A 3OMLA 3P2YA 4GI2A 4OJNA 4TRRA 1DC6A 4JX8A 4YAEA 2J3IA 4IJKA 4PG6A 4AJ2A 5L51A 4NMHA 4Q3EA 3L07A 1V3UA 1UAYA 2AQ8A 1I2BA 2PH3A 3GOHA 3IUSA 4OQYA 4Y6RA 2WM3A 5IFLA 1E77A 1LSSA 3L4BC 3CXRA 3JQ8B 2PD4A 4I5EA 2BLLA 1E3LA 3VAZA 1JAYA 4E5NA 1XSEA 2ZB7A 4EUFA 2B69A 1PWXA 4ALIA 3PFFA 1VI2A 4BNTA 1GPJA 1X0XA 5C37A 1MFPA 1B2LA 1KC1A 4L74A 1TA4A 3DTYA 4CLHA 3H6KA 4W6ZA 1A72A 1SPXA 4R1TA 3OECA 2A9FA 3I1JA 4DQUA 3GGPA 1IHXA 4BGVA 4AVYA 1P44A 3LF1A 4FJ2A 4PFJA 1ZH8A 2X0JA 1R16A 5AXBA 2PR2A 3TJRA 4X54A 4FQ8A 3D5TA 2NVUA 4PZEA 4AJJA 2X7HA 3H9QA 1I0ZA 3IJRA 4XGKA 3LLSA 3KEQA 1LUAA 3RBZA 5JC8A 5K9ZA 1E1NA 3UICA 1YOVB 2I76A 4AJ1A 1BXKA 4JJIA 3GQVA 1JKIA 1TXGA 2FPPA 2VT3A 1ZK0A 4BNGA 5JS6A 3RUIA 4WLNA 1YBMA 1UDBA 2JCVA 1CDOA 3GC6A 4NJMA 3F47A 1QLJA 3U3XA 4AFNA 4J2OA 4YDRA 2HO5A 3P2OA 4S1VA 2D5AA 3QVWA 3BZUA 2DLDA 1Y81A 4Z9FA 3EW7A 3L6DA 1WWKA 4NG5A 4HWKA 3NDIA 3GGOA 3ZW8A 2GRAA 3GNQA 4OOFA 1DIRA 4AL4A 3P19A 2QHXA 1LQTA 2ZTLA 4JP3A 2DPHA 4XKJA 5JNLA 4Y6SA 1L1FA 1OZAA 2ZYGA 4A0SA 1LLUA 2YJZA 1JN0A 2E6UX 1UJMA 3MJTA 2E49A 4HBGA 4CM9D 4EDFA 4UEKA 4H7PA 4CLOB 2CD9A 4KOAA 4FFPA 4YB8A 5IDXA 4DUPA 1E3SA 1OMOA 3FNFA 3GK3A 4CL3A 1GUFA 2C07A 3PZRA 2IODA 2DVMA 4GLOA 1C3VA 4E30A 5FEUA 2XF8A 1EK6A 1VLLA 2OL4A 4BMSA 1YE3A 5K0ZA 1N7HA 3JQ6A 4LW8A 4LCEA 3W8FA 4R1UA 3AI1A 2C7GA 3Q6IA 2WE7A 2VZ8A 4UVHA 1NQTA 5FFFA 4BNWA 4G65A 3O38A 2YW9A 3GN2A 3JQFC 5L7WA 3FD8A 4CM6A 2I6TA 2R00C 1E7QA 2QRJA 1EE2A 1S6YA 2XOXA 3MOIA 2PWZA 3H3FA 4LRSB 5L9AA 2CY0A 1W0CA 3ROMA 3DZJA 3SVTA 2F1KA 1N9GA 3GA0A 1JQBA 1RM0A 3PIIA 4NFSA 1XLTA 1KC3A 1ZCJA 3GAFA 4NBTA 1FDVA 2QRKA 1XU7A 1ZNQO 3QY9A 2GGSA 1R4NB 1PQUA 4IBOA 4WEOA 5DF1A 1ADBA 1MX3A 1D7OA 3C7CB 2TMGA 3KYDA 4IZIA 5I9NA 4OO3A 3ZWPA 3T4EA 1OC2A 5DP1A 3E9QA 2ZJ0A 4Y98A 1HDOA 3FR7A 4J4TA 3UF0A 3UCXA 1FDTA 1IYZA 4CMKA 4D7AA 4DXHA 4GSLA 2IXBA 4A5OA 4L4SA 4BUCA 4E5KA 3UGKA 3AJRA 3KB6A 4CV3A 4BB6A 1OAAA 3NT4A 4WLEA 2OXIA 1PL6A 4UVDA 1UDCA 4B4OA 2JHGA 2BI7A 2Y93A 1PR9A 5BNTA 5FWNA 2SCUA 3MJSA 2OP0A 3PHGA 5J23A 2WD8A 2O2YA 3RUHA 1EUZA 3KLPX 4MO2A 1NPDA 4IJVA 4RQTA 4UEJA 4P38A 3IJPA 1A9ZA 2H9IA 2V6GA 2X6TA 2G1UA 2P5UA 2ZQZA 2ZTUA 3EVNA 4D0SA 2I99A 4O5OA 4RO0A 4YBZA 3TSCA 4ZJUA 2EKLA 2EG9A 4BVAA 5KJCA 1V8BA 3SLGA 4CQLB 4YACA 4YA6A 1XKQA 5BNFA 5HM8A 5ADHA 3BMNA 1CRWG 4YT4A 2FPIA 3DHNA 3VZQA 3JD3A 4FGWA 3UN1A 1VC2A 1X1EA 1MG5A 1IE3A 4YT5A 3VZSA 4Y67A 3GEDA 1ZIDA 1BXZA 4F6CA 3RI3A 3SJ7A 4MKRA 2V6FA 5ICMA 3HDQA 1CQIA 3JYLA 1KVSA 5AVOA 2B36A 4DTIA 2O3SA 3FHLA 4FW8A 1BGVA 2X58A 5A9SB 2VHYA 4OSOA 4RPLA 3QWBA 1DJQA 5ILGA 2JCYA 4QFDA 4FB5A 3Q9NA 2WYWA 3BMOA 1F06A 3O26A 3C1AA 1OOEA 1XDWA 3DZHA 1B7GO 4ND4A 3WQRA 3MJ4A 2Q1UA 3INRA 4K1LA 4Z9XA 4YCAA 1GR0A 2OBNA 4BO0A 2NU9A 4XRRA 4GLLA 5HA5A 3T4XA 3TL2A 4NBRA 3DOCA 1ULUA 1Q7BA 3FNEA 2X23A 3QRWA 3TNLA 1BHSA 4BO2A 5T8KA 5DBFA 3O4RA 3PHIA 4ZU3A 2VZ9A 4D43A 4QX6A 4I08A 1Q7GA 2J5RA 3CKYA 3GF4A 3IL2A 4QXMA 3ITDA 3S2IA 1ZK1A 4XIJA 2QQ5A 3BHIA 1QXSA 4XB1A 1H2BA 3AWDA 3N7UA 4RCVA 3PJEA 1A27A 3DBLA 3PEFA 1B0AA 1H6DA 1EBUA 2A92A 2G0TA 4WK6A 4RVFA 4DVJA 2VHVA 2VTDA 3DZBA 3D5QA 1VSUA 3JQAB 4GSKA 3RKRA 1GADO 1SAYA 4C4OA 2PY6A 3RJ9A 4JIGA 3RFTA 2GZ2A 3IKTA 1O94A 3JD1A 3K92A 3U62A 2Y0DA 1FXSA 5BQFA 3K73O 1LQUA 2BGMA 2Y67A 4BNMA 1R15A 1D1SA 2XPCA 1N92A 1ZZEA 1IZ9A 1O0SA 4R1SA 1NFRA 1K3TA 1ZKMA 4PLZA 2FRDA 2B0JA 2EW8A 2VOEA 4PG5A 5G4KB 5HS6A 3LF2A 3ON5A 1HZZA 3KSDO 5EERA 2E48A 1FJHA 2VYNA 2NTJA 2CZCA 1Z82A 1C0IA 4J49A 4C7JA 3FRJA 1S7CA 3G0OA 5AOVA 5T5QA 5L3ZA 2BI8A 3L6OO 2NQTA 3DEYX 2DT5A 3RQSA 2GUGA 4FFRA 4D0RA 1WZIA 2EGGA 4L4RA 4OOEA 5IF3A 5L7TA 1OC4A 3SEFA 1DPGA 3KYBA 4CQMD 4R68A 2GPTA 3RROA 3E5RA 4R1NA 3QVSA 3IC5A 3O8QA 2DBZA 5CEFA 2RHRA 3RASA 1JWBB 3C24A 4TZKA 3HSKA 1GU7A 1RM4A 4QECA 5IJZA 1U5CA 1RWBA 3F3SA 3K31A 1SZJG 1I2ZA 4CMAA 4ZVVA 3RWBA 1ZFNA 3WFJA 2I67A 1KVUA 4OSPA 4IQGA 1DHRA 1B8UA 1HSZA 4YT8A 1LLDA 5EINA 1IHYA 4W7HA 1ADFA 4BO8A 2Q1WA 4JBHA 3KV3O 3ICCA 4IS2A 5DCYA 3C1OA 3DMTC 1EEHA 1FK8A 4NI5A 4DA9A 3RU7A 3VTFA 2IZ1A 3GN1A 3JYNA 4LVCA 2PV7A 4MVJP 5T67A 5IN4A 4PCVA 4CLEA 1V3VA 5A05A 4BV9A 1ZXLA 5BR7A 3AFMA 4W99A 2H63A 2HRZA 2VRCD 4FJ1A 4IDFA 4M49A 4BNXA 5JYDA 1Q0HA 2AE2A 3V2HA 1R12A 5U9CA 1I5RA 4K26A 3HFSA 1DXYA 3A1NA 1NR1A 2PA3A 1HDRA 4WNIA 1PZFA 5G0SA 2WDZA 1U9JA 5I9MA 1E3WA 1E5LA 3B1JA 1K89A 1IOLA 4MJLA 1L7DA 2WYUA 2GN9A 1GQQA 1LXCA 5C7IO 3F6YA 3A06A 1YKFA 4MVJH 3K30A 2LDBA 1F8FA 3PYXA 4I5GA 2YHIA 5K6AC 3C8MA 4EJ0A 2Z95A 3FWZA 4DPLA 1D3AA 2UDPA 4BHTA 4IIUA 2HU2A 4A7PA 4DC0A 3PIDA 4C7KA 3FBGA 3S55A 4BGEA 3S8MA 3EZLA 3KYDB 3P7MA 3JD4A 1I24A 5CG1A 3IOYA 1F8GA 1HSOA 2FZEA 5JCJD 1NYTA 2V6MA 3GPIA 3V1UA 4BOYA 1HYHA 3WGTA 3GUYA 1WAMA 2Q4BA 4FR5A 3SLKA 5C5IA 3VH3A 2CMDA 4BO3A 3DWFA 4GX0A 3ZU2A 3WSWA 2Y99A 4KWHA 4WOJA 1Z75A 5ICSA 2A94A 2D59A 3IDSA 4RF3A 4TKLA 5HBRA 3H5NA 5DZSA 1G0OA 3TFOA 4I5DA 2XAAA 4YAKA 2I66A 4DYVA 4OKIA 4B7CA 3NT5A 3WGQA 2HJRA 1K2WA 2NUAA 4J7UA 4RVHA 4AJPA 3CIFA 1VJ1A 3OIFA 1LC3A 2ILTA 3IS3A 5TJHA 2ZTMA 3LC1O 3DQPA 5TNXA 1Y1PA 1U5AA 2R6JA 4UUMA 1SMKA 4GX5A 4D46A 1YL6A 4CMEA 1UP6A 2PGJA 4PVCA 3ABIA 4CLOA 5JCXA 2BFPA 3E8XA 2CF6A 2VUTA 3MEQA 2RHCA 2VRBA 1LDYA 3IP3A 4J1SA 1UP4A 1ZSNA 2EKPA 3KBOA 3NV9A 3ZNQA 3GT0A 4WLUA 3V5NA 4FCCA 3KRTA 4EJMA 2O7SA 3M1LA 2CDCA 3QV1A 3DBRB 1GYQA 2O3TA 4HY3A 3ANMA 4KZPA 3Q2IA 1E1MA 1HLPA 4PG8A 4W9NA 1M66A 4E2ZA 5KVSA 3JV7A 1ZMOA 1V0JA 2HKIA 3R0IA 4FBGA 5C3MA 1E6EA 3FCOA 1Q1NA 4M1QA 1C1XA 2PH5A 4U0JA 1PTJA 2DU8A 4PGFA 5JAMA 4FC7A 5THQA 4RDHA 3H9UA 3WSVA 3AOEC 1LDGA 5A5FA 4Y6PA 3UH1A 1VRWA 2GLXA 2W8ZA 1H93A 4TZTA 2DBQA 4U8GA 5KVVA 4XIYA 1J4AA 4QTZA 4H15A 4DGSA 3LC2O 1MFZA 1DFGA 1QYXA 3EVTA 4DMMA 4IDCA 5GZ1A 3I9OA 1HZJA 2HJSA 3WWYA 4YTEA 1LRLA 8LDHA 4E5PA 2WJPA 3RD5A 4PG7A 1RM5A 5KJ6A 3WYBA 4XJTA 2CDBA 3RKUA 3DAPA 3Q2KA 4J9UE 4ND3A 1Y8RB 2X5OA 1QYVA 4D3SA 3DFZA 4RLHA 4O1MA 1E7YA 3AUTA 3E5MA 4AJIA 3WLEA 3L6EA 4WCFA 1P1FA 2Q2QA 4IMRA 1MA0A 1ZW1A 3BMQA 2PKQO 4TRJA 4RF4A 5FI3A 4GH5A 2NVBA 2WYVA 1XQ1A 4P4GA 3AUAA 1SOWA 3L77A 1PWZA 4BNFA 1PJ3A 1I3KA 1V3TA 3DDNA 3AK4A 1U7TA 4FOOA 4J3FA 3GEMA 2EJVA 4E0BA 4P22A 4CLDA 3OIDA 4RVDA 1GUYA 1GFSA 3MOGA 5H82A 3UCEA 1KOLA 5F5NA 1CF2O 4TKMA 5EIOA 3NJ8A 3ST7A 2GN6A 4CR6A 5TLSA 5IXYA 1NPYA 4FFNA 4FPXA 4YAJA 4J2HA 3H9JA 2ZB8A 1P74A 3DTTA 3H8VA 1E92A 1Z45A 5KIAA 3OJLA 2EERA 3V2GA 6LDHA 4XA8A 3QWFA 4FFLA 4CODB 3VZPA 4BQRA 2VCYA 1DRUA 3CUKA 4OXYA 3BA1A 2DPGA 3AU8A 4YJFB 4UAGA 4Z0TA 2FSSA 4M8SA 1LSJA 1JW9B 4L76A 4R9SA 1G1AA 4L73A 5JDCC 3N74A 1DAOA 5JO0A 1YQDA 3OQ6A 5B37A 4HFNA 4RF2A 4MVJA 3UCFA 3B70A 5HRUA 4EW6A 3U09A 4BKRA 2YQ5A 1TT7A 3RFXA 2FHSA 4FC6A 4MP6A 3MTJA 1ISFA 1J0XO 4RVSA 3UHAA 3W4KA 2J8ZA 4A03A 3KLMX 4RDIA 4XQ9A 5JO9A 4INAA 4YVFA 1JVSA 4MIYA 3JSAA 2BFAA 2GYYA 2V6BA 4GWKA 4IXWA 4OHUA 4E5MA 4NJOA 4ONEA 5IDWA 2DUUA 3NGXA 1VPDA 3WWZA 1QRRA 5DULA 4LN1A 2IE0A 4RF5A 1KY4A 1P1RA 4YJDA 3WDSA 1GEGA 4L75A 4KQWA 3D64A 3HG7A 1EVJA 2BH9A 1WXDA 4FS3A 4G5HA 2B4TO 3CPSA 2HUNA 4DPMA 5A06A 4FGSA 1GAEO 4PLFA 5G0UA 2RH8A 5TC4A 1WPQA 5LDHA 3WBBA 1WVGA 2GZ1A 3NDJA 2AQIA 2O3UA 1PIWA 4CMCA 1MXFA 4QO7A 5IG2A 1NTOA 2AG5A 3FWNA 2OGUA 3GHHA 2JL1A 2YY7A 3W4JA 1NM5A 3RBXA 4A27A 3NDRA 2DTXA 2UUOA 3HHPA 2ZJ1A 1BMDA 4FN4A 1E3WB 5IZCA 2W2KB 1J6UA 3OICA 4FDAA 2EEZA 5TQVA 3LDHA 4HX5A 1VL0A 3JQAA 1M67A 2HMWA 3FF4A 3GNSA 3S2EA 2UUPA 1RKXA 1Y5MA 5F1KA 1BXGA 5DT9A 2HQ1A 3HUDA 5GY7A 1QYCA 2ZKLA 2YHIB 4KTTE 3L4BA 3K5PA 3F5QA 1YGYA 4ALNA 1UAGA 5B4TA 3SC6A 2BD0A 4JCOA 3JD2A 5G4KA 2PNFA 3KZVA 5FF9A 1BVRA 1IZ0A 5L53A 1PZGA 4B4WA 5F21A 2BGKA 1QMGA 3EC7A 1PSDA 2FN7A 1T24A 1ID1A 4N5LA 3ZHZA 4P4LA 4GBJA 1LBEA 2ZK7A 1IPEA 3H9GA 1I8TA 3N58A 4OIMA 4IS3A 4LISA 2O23A 2EGHA 2WTBA 1RM3A 3E9NA 1E6WA 4HKTA 4M54A 1X7HA 4JROA 5JBIA 2D5CA 1O6ZA 1ZXBA 1NHWA 2W90A 4FOSA 3WLFA 4XX0A 3ZWAA 4XB2A 5DDIP 3CINA 3RC9A 4BIIA 1M2WA 3OHSX 3D4OA 1NQOA 4IDBA 1TLTA 4UREA 5U4QA 1PS9A 3QA9A 1UXIA 5A1TA 1LDBA 4NQZA 3EUWA 3H2SA 3U4IA 1RYEA 4WOKA 2VHZA 5KVCA 1YVEI 5A3JA 1KEVA 3GH3A 5EESA 4JLWA 3TQHA 1Y9EA 3ZCXA 1P33A 2I3AA 1BRMA 1PGOA 1GD1O 1K6JA 1M6HA 3PFWO 3DAGA 4J7CA 4Q9NA 5G4LA 5BT9A 2W4QA 3AW9A 4E2WA 1MC5A 9LDBA 2OUIA 3E18A 4WLVA 4CMIA 2Q1TA 3VH2A 4CM9A 4ZQFA 2P91A 4NBVA 1YBVA 4IQ0A 2X5KO 5JC1A 1H6AA 2P5YA 3WGZA 3ASUA 2X0NA 1ZK4A 4CMJA 1BW9B 4JK3A 2EHDA 4RZHA 1C1XB 2P4HX 2YDXA 4AJLA 4ALLA 1I32A 1AUPA 4GVLA 3TPCA 1ENYA 4ESOA 4J1QA 2TMDA 2FPGA 4XZ3A 1RPNA 3VDQA 2AA3A 2I65A 2ZYDA 1SO8A 2EIHA 3ZW9A 3NJ4A 3VC7A 4GVXA 2GCGA 3B1KA 1MP0A 4RVUA 1PEDA 2VYVA 3JQ7A 3H5RA 5A04A 4HUJA 1QYWA 2W2LA 3ONEA 2VHXA 4HP8A 4BNHA 3HN2A 4WASA 3I6IA 5DOVA 1EVZA 3W6ZA 1O9BA 3NX4A 4YQYA 3ETEA 4DIBA 1HT0A 3WNQA 1DHTA 3VVCA 2W98A 3AI3A 2ZB4A 4M86A 5TRTA 4D79A 1HTBA 1X0VA 1HL3A 3JQFA 3LC7O 1KIFA 1UXKA 3ZN2A 3COSA 1U3TA 3QHAA 4WCFB 4W7IA 4II3A 4QUKA 2DAPA 2C59A 3DOOA 3UUWA 1ISJA 1LX6A 2AQHA 3BMQB 4BKOA 1PJ2A 1LTHR 3GZ4A 2PGLA 4HFRA 5DP2A 1U3UA 2O3QA 4E12A 1AE1A 1QV6A 2Y68A 3KO8A 3DL2A 3H5AA 1K6XA 2ZQYA 3QWHA 5TX7A 3G17A 1X1TA 2BELA 3GEGA 4U6QA 4II2A 1HETA 1T1SA 2CF5A 4U5QA 3QSGA 1SC6A 3LT2A 1I3MA 4RPHA 3I5MA 2Y1EA 4HV4A 3BAZA 5A02A 4LVUA 4NH4A 3VPGA 1GZ3A 4D44A 4E6PA 2CVQA 3RC1A 2WWRA 1JVBA 3VKUA 1I33A 1E0DA 2O3RA 3D3EA 1TVEA 4R41A 5JSFA 3GAZA 1JTVA 4IM7A 3ZV5A 3L4SO 3ZGYA 4F6LA 4JQCA 3PPIA 4TMFA 5KCZA 1QKIA 1B3RA 3GRKA 4RLSA 2NU6A 3WIDA 3F5SA 4KDFA 2D8AA 2X1HA 3JTMA 3RU9A 2VWGA 3KTDA 3PWZA 4JJGA 3DBRA 4YJHA 1CWUA 3HZZA 3TZQA 3JD0A 1T26A 1E3EA 4EGFA 1XIVA 4Y8VA 1BDMA 2VN8A 4BNIA 4D41A 5CHEA 2DFVA 3PHLA 4K6CA 3QVXA 2NM0A 3GZNA 1V35A 5CP8A 3LT0A 3DB2A 4DBVO 3NGLA 2WEKA 4ALKA 4NK5A 3UAGA 2G5CA 2HSDA 1KEPA 1LNQA 3IUPA 4P4NA 3PQFA 4BO1A 3I3OA 3DZIA 1O95A 1OBFO 4JBIA 1U2GA 3ZNOA 1JLLA 3ZDFA 4J7XA 4OKNA 1VKNA 5LC1A 5CEEA 3OIGA 3WTBA 2UVDA 3WQQA 3UKOA 3RSHA 2PLAA 4BNYA 3A9WA 3KXDA 3A28A 1HDCA 1N2SA 4DLAA 3AM3A 3GUCA 2Y1FA 2VUUA 5AXAA 1HE5A 1HDZA 1GUZA 1YB1A 1WDKA 2JJYA 4BGUA 3ROQA 1UZMA 5T8KC 3WB9A 1NAHA 1Y8RA 3AY6A 3Q0EA 1GCOA 3MZ0A 4Q3AA 1LEHA 1QV7A 3TZHA 4PRKA 4TVBA 5G0TA 1JWAB 4CR7A 3KUXA 3OA2A 3WGYA 2AEJA 4DREA 2J3HA 1YL5A 4CM3A 5KKCA 3U0BA 2I5PO 4TQGA 4XQCA 1DIBA 2GZ3A 5JY1A 1LI4A 4YEDA 1PQPA 1O5IA 1BXGB 1EDZA 2X86A 4O6VA 5DCWA 3L0DA 4PLCA 5KKAA 4RPJA 1UXGA 3D4NA 3K8ZA 4PN3A 4PLVA 4N18A 5CDUA 5G0VA 4B79A 4OQZA 2GDZA 1U7HA 3H7AA 1IUKA 3GVPA 1EFLA 3VH4A 3GNTA 3OJEA 3ONDA 3D7LA 1NNUA 2JHFA 3QE3A 1K6IA 5L7YA 1NHGA 3WGGA 2E82A 1ISIA 4JJFA 5TGDA 1X15A 4J16A 4BQPA 3BTSA 2Q99A 4YJFA 1SBYA 3ORFA 4J0EA 1TI7A 1ORRA 1PJSA 2RAFA 3JYPA 2BF7A 4N54A 1VM6A 3ZWBA 4WLOA 3PJGA 3E48A 3AU9A 1YBAA 4XJSA 3CZMA 3ADOA 4CQMA 4O59O 1JKJA 1VKOA 3OFSA 1X7DA 2I9PA 1BDBA 3PQDA 1B3BA 1G0NA 2GERA 4UVIA 3G79A 2YFQA 4J1NA 3DBHB 3WIEA 1FDWA 5BNIA 3DZKA 5TT1A 1LDNA 4BNZA 1WZEA 1IPFA 1YONA 1LLQA 4CLXA 3GVIA 3Q3CA 3RC7A 1YH3A 3VKVA 4NU5A 3ZNNA 1ULSA 3PVZA 1T25A 1U28A 1C1DA 3M2PA 4LMRA 3GMDA 4CMIB 1B14A 3D3WA 3NTRA 2EXXA 4I8XA 1LDEA 2BHLA 2C0CA 2IYOA 5TIIA 1I2CA 2D3TA 1A4UA 3INGA 4BB5A 3AY3A 4E33A 3SJUA 2AEFA 3S2GA 2P68A 4GGPA 4GKVA 3DAFA 3PDJA 4QEDA 1VE9A 3WYEA 4S3MA 3WNVA 1PQWA 4BKPA 1QYDA 1SOVA 3ETDA 4LCJA 1A4IA 2YFHA 3ZV4A 3TFQA 1H9AA 1LC0A 9LDTA 2W2KA 2GASA 1ZK3A 3ANNA 2VRCA 1DO8A 2DKNA 3R3JA 4JN6B 1AHIA 4XYBA 3JQ7B 4AG3A 2C2YA 3R6DA 4A73A 4BNJA 1HDXA 6ADHA 4D3DA 2DUWA 3EMKA 4N5NA 2YV1A 3G1TA 1T2EA 3H3JA 3ICPA 3K2BA 4CV2A 1GL3A 2PFGA 4B3JA 4CUZA 2GD1O 2P9GA 4TVOA 1EE9A 3WGIA 2O4CA 5C7OO 1GY8A 2E4AA 3DONA 1LA2A 1DC5A 1GTMA 4Q3CA 3KSUA 4ZHSA 1YS4A 3ZHXA 4E31A 2I3GA 5JAIA 2EV9A 2RCYA 3NRCA 1T2AA 2NWQA 1DFIA 3PQEA 4AJNA 3GPDG 4WCDA 3PJDA 4HADA 2NADA 4OH1A 4BGIA 2GSDA 3PYMA 3E6AA 4ZN6A 1KBZA 3FTNA 3ONFA 4AJEA 2Y05A 1E7MA 5ENDA 3U4CA 1A7AA 2Y0CA 2PK3A 5G0WA 5JMPA 3OM9A 3QWAA 1T1RA 4HXYA 1FF9A 1YJQA 3EHEA 1M6WA 1B8VA 3U9LA 2Q4EA 1MXHA 4J6FA 5JCJA 3FN4A 1LDMA 4Q3BA 4AJ4A 1A71A 3ASVA 3EZYA 3LVFO 4XGNA 1Z74A 4YWJA 3GMSA 1A9YA 4CMBA 1H9BA 1T2FA 5CG2A 3ZWYA 2BFMA 1DC4A 2ZCVA 1E5QA 2DTDA 3JQ9C 4IIVA 1HEUA 3RVDA 3ZHYA 2ZATA 3VDRA 5KTKA 5IAAA 4UVEA 1DB3A 1QG6A 4B8ZA 3WTCA 2D0IA 1EFKA 4BNLA 1NVMB 1U4OA 3D4PA 1YRLA 3GLQA 1A7KA 5IN5A 1XA0A 2O50A 3LYLA 3H2ZA 3RFVA 1HE2A 3LZ6A 2EF1A 4Z9YA 3TL3A 3ROKA 4IINA 1Q0LA 1Y7TA 4CM4A 4GX1A 3DMYA 2V65A 3K9QO 1YQGA 4WUVA 4XQEA 5CAEA 2VZ0A 1AXGA 3NTOA 1WW8A 4NIMA 5G2OA 5JDIC 1XWFA 4YJHB 3RUEA 1DIHA 4AICA 4R3NA 3PHJA 3ZWNA 1WLYA 4YPOA 4WEQA 3NT2A 4E21A 4JBGA 4DIOA 4Z3KA 5DCUA 1YXMA 3B1FA 1BW9A 4Z0HO 3GGGA 3GZNB 5C7LO 4J91A 3X2FA 3CZRA 5TSDA 3C85A 5CEJA 5GZ3A 2Q2VA 3H65A 2X0IA 1T2DA 3ADPA 4IDAA 4TSKA 5JLAA 5JXWA 1EVYA 2YV3A 2RBEA 1ZEJA 2XXBA 2X9GA 2OP1A 2D2IA 2EP5A 1V9LA 5COAA 1XCBA 4NFHA 4CJXA 2VNSA 2IZ0A 4BS9A 3BTOA 4ILKA 3VPFA 1C0PA 3JQBC 3V2UA 4HFJA 5F1PA 2P9CA 3H9EO 4I9UA 4KTVE 3FTPA 4YT2A 3JQGA 4XDYA 3AOEA 3I9NA 1PJCA 1UXHA 3OP4A 4M87A 2YV2A 1XU9A 4XYGA 2PTGA 4JGBA 2GF2A 3QVOA 3CEAA 3AUSA 3BMCA 5I7FA 3PDUA 3TOZA 4CL8A 4O0LA 4CPDA 1PS0A 4FFOA 4E2YA 1XQ6A 1UZLA 2X9VA 3I9KA 4GKBA 1SEVA 1WDMA 2ZTVA 3HJAA 3F46A 3U49A 3PRJA 1NASA 2VNAA 1X13A 5COQA 1E3IA 4OXNA 1NAIA 3PXXA 4LRTB 3U4DA 4RZIA 4ZRNA 3L9WA 4YYZA 1GDHA 1FMCA 2JD0A 1M75A 1H6CA 2IRWA 3KVOA 2FR1A 2FR8A 4B7UA 4IGEA 4CR8A 2AW5A 4RORA 2OO5A 3F1KA 5IDQA 3MJVA 2J5KA 1Q2XA 4FIZA 5L95A 2Z1MA 1P3DA 1DLJA 3O9ZA 2CNBA 3UW3A 2X9NA 1U1IA 4BKUA 1D1TA 1HXHA 5EPOA 2PD6A 2PGDA 3PJFA 4DQXA 3ENNA 2C2XA 3LT4A 4KMSA 4DLBA 1PGPA 3W4IA 1WMAA 3M2TA 3PHHA 4LSWA 1F0YA 4CMHA 4YRBA 2J5QA 3PWSA 3WGOA 1I3NA 1R0SA 3B20A 3U5TA 1E1LA 4OL9A 1PR3A 3DR3A 1LRKA 2EKQA 2Z1NA 3PP8A 3HDJA 3KM0A 5B1YA 1R0KA 3BXXA 2NACA 3QP9A 3NAQA 3I9JA 3W8DA 5B12A 4RPKA 5EQFA 3PZBA 4MVJD 3RIHA 5T57A 3BTVA 4CQMB 4I9NA 4NZ9A 1WP4A 2JAPA 4MIOA 1F14A 2Z5LA 2OOSA 2V7PA 5JDCA 3KEOA 4MVJI 2UV8A 1DBVO 2HMUA 1Z73A 1LRJA 3FI9A 4J0FA 3CSDA 2GNAA 4BNUA 4EYEA 3HDYA 1MC4A 1ZK2A 3WX0A 2F00A 2DC1A 3FNHA 2ZYAA 3U4HA 1EVIA 4N5MA 4UEOA 4F46A 1YO6A 2Q3EA 1NXQA 3QW2A 4IY1A 4UUPA 4XYLA 4A2CA 2IEBA 4DBZA 5EMHA 1N1GA 4B4UA 3I4FA 2VHWA 2VUSA 4XEHA 3C3XA 2C82A 1C1DB 3HQ4O 3LT1A 4MIEA 3D3WB 4Q3NA 4RQUA 3C7DB 3E1KA 2ET6A 4LMPA 1YB4A 3ZU4A 4ZRMA 4XR9A 5TS3A 3GFBA 2DBRA 4UULA 5CDGA 5KOIA 3KYCA 2C29D 2P2SA 4DYDA 1GQ2A 2ZCUA 1EBFA 1H0KA 4IJWA 2UAGA 3DC2A 4IMPA 4QT0A 4EUHA 1Q7CA 4E2XA 1CERA 1KY5A 2AG8A 4MKXA 3OETA 2OFPA 5IZ4A 1K0UA 4L4XA 3UOGA 1X14A 3JQAD 1ISHA 1SB8A 3EGOA 4IJUA 1HYEA 1PL8A 3HE3A 4KUEA 1UDAA 1HLDA 4MP8A 2AEMA 1Q0QA 2O48X 2B83A 4YRDA 3I52A 4PLHA 4PVDA 3Q11A 3A4VA 4BO9A 4NNJA 1PJQA 4B3HA 3DFUA 4MPDA 4NDNE 3M6IA 3IQDB 5L4LA 4YR9A 4PLWA 3OJFA 4L0QA 4CV1A 3L9XA 2OHXA 2D4AA 3DHYA 1B15A 4J4BA 2VQ3A 1P45A 5FYDA 3INTA 5JYEA 3CH6A 3D1LA 2HLPA 4CM8A 2DQ4A 2IZZA 5AXDA 2PZMA 5CPBA 1U8XX 2HDHA 3S1LA 2BFOA 2Y0EA 2VTEA 3WGHA 3IKVA 1F17A 1YWGO 1ONPA 4UVGA 3UVEA 3WYCA 1C0LA 1NFQA 4UUNA 5COBA 3RJ5A 5A4DA 1Y6JA 3WG9A 3RUAA 2Q49A 5CPFA 3DBHA 1P9LA 1XGKA 3GG9A 1KERA 4CM4B 4URFA 1P1KA 4IUYA 5EQDA 1I30A 4CM7A 3RUDA 1YQXA 4IDEA 2X4GA 5T6BA 1R4MB 1P0CA 1DOHA 2Y66A 4XD2A 1KVTA 3MWEB 2NTNA 2OORA 4CV0A 1DFHA 1DLIA 3ANLA 5ER9A 4R01A 1LJ8A 3FSRA 4U6SA 3NTQA 2LDXA 4MKZA 4WGGA 3GRPA 4L8VA 4HFMA 4PG4A 4GPD1 4XYMA 4Q39A 3BHJA 4U0KA 1ZUD1 3V8BA 1OFGA 1JDJA 1HYGA 1XR3A 3TOXA 2B37A 1D4FA 2WE8A 2NLOA 4ZQBA 4ZA2A 3WBFA 3GHYA 2G82A 2HCTA 1P77A 4O63O 4XYEA 2QZZA 2B5VA 5DBGA 3QIVA 5JAZA 1DAPA 1JAXA 2NQ8A 2VYVD 5MGBA 4NBUA 2W2LD 1DIGA 1ZVMA 2NSDA 3JQGB 2NNLD 2YDYA 2FR0A 4ALMA 1B8PA 3HWRA 4GX2A 1MG0A 3HFGA 1Y8QB 4QQRA 2CVZA 4PIVA 2P9EA 1GYPA 2CFCA 3BMCB 2PKQP 3C7AA 1WNTA 5ENVA 5LCXA 3AM4A 2R00A 3UFXA 3W8EA 1H94A 3ZWMA 2VWHA 3AM5A 1LSUA 4NPCA 2D1YA 1B26A 1A5ZA 1EMDA 1X7GA 1XELA 2B4RO 3PYLA 4CUKA 1BTOA 1P1HA 3GG2A 1EQUA 1UUFA 3PLRA 4W82A 5H81A 2H5LA 4TRNA 5U1PA 4YRAA 2X22A 2FP4A 3ZV6A 2P4QA 4GMFA 4OMUA 2OMEA 1NPTO 1Y5RA 5GZ6A 4ZQGA 4ROSA 3MWDB 3OJOA 3PGJA 3IIEA 2YYYA 5KWEA 3PK0A 2G17A 3JQCA 3MJCA 5ER6A 3PGXA 2J6IA 1GCUA 4R9RA 4XDZA 3ZWVA 1KVQA 2EP7A 3SXPA 2FWMX 1JU9A 1U4SA 2CVOA 1G6KA 2QX7A 2YZ7A 4MP3A 4ALJA 3RC2A 2QZ9A 1F12A 5ITWA 5A3VA 3LLVA 1HWYA 4FJ0A 1O8CA 4KP7A 1NX6A 3BHMA 1L7EA 1HRDA 3I83A 1BG6A 1TT5A 4NBWA 2FMUA 1ZO8A 1ISGA 4WPGA 2IDZA 1QSGA 2Y1DA 4EBFA 3NEPX 4K28A 3GY0A 1NVGA 1ZBQA 3QJ5A 4BO7A 1T2CA 4PLGA 1VL8A 3FNGA 3PLNA 4TWRA 2IXAA 4IZHA 1IULA 2PZJA 1I01A 4QFCA 1GYRA 3OQ1A 3VH1A 2HK7A 4NU6A 1U3VA 1KS9A 5BSEA 1EUCA 1TEHA 2YQ4A 3GR6A 5A5EA 4R54A 1ADCA 1QP8A 5B4UA 3X2EA 1CIVA 4XR4A 4EI2A 5L4NA 4OM8A 4DRYA 3DO5A 4PZCA 1DC3A 2Y1OA 4DPKA 5EN4A 3K2EA 3ZWXA 2C54A 3LU1A 3ZU5A 3O03A 4ZQEA 3QVTA 4RL6A 1R66A 1EUDA 3EDMA 3TZKA 4XRGA 3PTZA 2X0RA 1U8FO 3R3SA 4B7XA 1J5PA 3DXFA 3HN7A 1EDOA 1PGJA 4L9RA 4MVJG 1PZEA 1W6UA 2OBYA 4J9VA 1PZHA 4E3ZA 1BWSA 4W4TA 2BMAA 3S2FA 1CQJA 1ZEMA 1UXJA 3KYCB 4Y9DA 1ZSYA 4YXFA 8ADHA 3ZZNA 1R0LA 4TRMA 3AUUA 1UR5A 4YJGB 4BMVA 4XWYA 3ZNPA 3TDKA 4KQXA 3AFNA 3DOJA 3DZFA 1CYDA 1PL7A 4CM5A 1NQAO 5JMWA 1NWCA 1NVTA 4CLRA 4ND1A 3D0OA 4N7RA 5ITVA 1PU2A 3ZV3A 5ES3A 5A9TA 1AXEA 1XYGA 3WQSB 5I9LA 3VPHA 4XQGA 4E4YA 5B4VA 5I8ZA 2J3JA 5A03A 1Z7EA 1PGNA 4YAGA 4QO8A 3VPSA 5I8WA 4D3FA 5ILOA 1N8KA 3CMMA 4A10A 4JXKA 2H1SA 3WOHA 2BGLA 3V1TC 5EJ2A 1ONNA 4DIFA 2OZPA 1H5QA 4IXTA 2CSUA 5JAQA 5EL0A 3WR5A 3RUFA 4R5HA 1DIAA 4JNKA 2VYND 1FDUA 3STHA 1IY8A 2VWPA 1ZJYA 1ENOA 3SC4A 1YL7A 5L45A 1KEWA 3F1LA 4CM8B 3BTUA 4GQAA 5KJFA 1IB6A 4EEXA 1Y9AA 1GV0A 2JKVA 2ZIZA 3CE6A 4ND5A 4JP2A 4BV8A 4R4JA 5K6AA 1PGQA 5I7SA 3FPLA 2NVUB 3GVHA 4LGVA 4KDEA 1W8DA 1YJ8A 2JFHA 3ZH2A 2GN4A 4KUHA 3EY4A 5A9RA 5H83A 1E7RA 2QYTA 3GVCA 2X5JO 1ADGA 1HE4A 4KUGA 1EK5A 2HMTA 2IEDA 3GVXA 1E1KA 1HE3A 3WFIA 3EK2A 3HB4X 4ZQHA 3IMFA
chains in the Genus database with same CATH superfamily
1AZWA 1ORWA 2F6RA 3I04M 2NO0A 1KSHA 1UBNA 5CFOA 3DDCA 1XFAA 1SUSA 5ALWA 4LYGA 2JKZA 4DLUA 3H0KA 3L7IA 2VSFA 5HQ3B 3A9SA 1CS0B 4MRMB 1BVUA 4QBTA 1QGED 4HNVA 1WY7A 3VNAA 1N2GA 1T1IA 1U7PA 2XEXA 2XXJA 4D45A 1DU4A 5T41A 5HWSA 2A35A 4FDLA 4DLLA 1S2LA 5JROA 4D5EA 2H2DA 3COZA 1VSVA 1SN7A 1GGJA 4RY0A 5HF8A 1Z7GA 1TC2A 4PNHA 4AG5A 2UZ0A 3QG1A 3QLJA 1GRQA 1W35A 4IIJA 4JS0A 1ZX1A 2NPOA 4ZVKA 2QRLA 4KV7A 3NATA 3Q9LA 2V96A 2XQVA 3EQ8A 2AJLI 2B9EA 4X62H 1KVRA 2XVZA 5AKEA 1XXHB 1SVOA 3A37A 4QYIB 2R97A 3BIJA 1RRVA 1DMSA 2ETXA 1XZPA 1UMCB 2NO6A 2DCMA 2OCYC 2YUTA 2C5EA 3BK2A 5IBPA 4PLTA 4BKQA 1RHRA 3ZJ5A 5KNBA 1QHHA 1U0TA 3TIXB 2CB0A 2IPOA 4ADSG 4GICA 4FT2A 1DKRA 5EZQA 5JBNA 1JEYA 5KC9A 2O5VA 5K5EA 4TROA 3WJAA 5FL3A 3PUIA 4GOLD 1UPBA 4IIJF 4E5YA 1ZN2A 2QB5A 5CVDA 3N2EA 1K6MA 3FYDA 1XPRA 4R69A 4NEGA 2BFDB 4IDDA 1QGYA 1XDUA 5EJ7A 3RUCA 3MG9A 4GWGA 1SXPA 5AQ1A 2P5TB 4J43A 3KUKA 3HNPA 3GUUA 2X8LA 2FQQA 3ODPA 4OTZA 4UD6A 3VNSA 4EQ6B 3D1JA 1ZL2A 2RG1A 1GA6A 1R0BA 3I4CA 4DWOA 4P36A 3AR8A 2B30A 4XUCA 4M0KA 3GDOA 4RMNA 1N1EA 2ZG6A 5EXEA 1C8BA 1IATA 5AKKA 2OLJA 5DLQC 1ONSA 3GCXA 3WMXA 1J2UA 2PX2A 2I55A 2XZTA 1P0FA 3AXSA 1ZGAA 1XDSA 3L4EA 3O0TA 4NYIQ 5MDHA 3I62A 2R6R1 4NBQA 4L16A 4Y2SA 2JD1A 3GW8A 4MTLA 3O74A 2O0JA 4RPGA 1CZKA 3NUGA 3AEUB 2UZ1B 3AFHA 4XEUA 4WOCA 3WXBA 4BNVA 4UQOA 3AVOA 3V69A 3PPYA 3QXSA 3USCS 5BSGA 1F7VA 2P6RA 1W47A 2Z6VA 2WAMA 1GKIA 2ORYA 5AVQA 1KYZA 1QFZA 4J1TA 1HDGO 3VHRA 1C50A 1NE2A 1V25A 1ZJZA 3EGIA 4BO5A 1HE8B 2GVNA 1URPA 2XR1A 3RLIA 5JSZA 3U56A 3EDQA 1HR0H 1QM5A 1OE0A 2GZMA 2PXCA 5HS4A 2VDRB 5DLPA 1GAWA 1R5OA 3JPYA 1S96A 1QH0A 3SM9A 4DM3A 1XJQA 6ABPA 4ZDWA 3K0KA 5KJEA 2QTBA 2WJAA 1S1MA 2FZWA 3CF4G 3E4DA 1PX0A 2H85A 3G2OA 4TKUA 3I64A 4HSGA 1W59A 2LTMA 4R51A 4CMEA 2X8AA 2PD3A 4RGBA 1KI4A 4QJIA 3TBFA 1L7RA 4D4LA 1J5EH 1NWHA 1OPXA 2VP4A 5IMSA 3TKYA 3HKCA 4F4CA 2VR1A 3JQEA 4GYWA 4XPZA 3NVDA 1ZI8A 4FE4A 1ZISA 2Z57A 3QFFA 3U7QA 3VVMA 4MKGA 5DTJA 2EQAA 3MGAA 3R7BA 2PX3A 4O4IA 2GVDC 3TK1A 4Z3DA 2QMQA 5JSYA 4TXHA 2B61A 3L5KA 4I1OA 5H3HA 2WJVA 1FDSA 3KHUA 2ZB3A 3Q8XB 1YDHA 4FD3A 3UG6A 3JASB 2AKEA 3A6PC 2WIFA 4FZJA 5KSOA 1R9NA 3R6LA 4OYRA 2ANRA 2F3TA 3R1IA 3WKAA 1BWQA 1KDYA 3EJWA 4R2WA 2DTEA 4DC1A 1Y5LA 1A9RA 4DJAA 3ESZA 1J0CA 2DGRA 1UFVA 2EW2A 3HKEB 1IOVA 1RCTE 1T91A 4FNOA 3RJZA 3UWPA 4O4IF 3Q8KA 4CEHB 2QTVB 4EPYA 2P6MA 2R2GA 3OJ0A 2I1QA 2XDYA 3M4YA 4Z0PA 1N34B 4FYXA 3RIYA 1C9JA 2C3YA 2ISCA 4LFAH 3AF1A 1XDDA 2GO1A 2HJGA 3BMNB 4MKIA 3TAUA 1GV1A 1Z6QA 4QHTA 4EUEA 4RVGA 2ZVJA 5JD6A 4X61A 2QJWA 5JFTA 4KFCA 3COJA 2FPOA 1OF1A 4AJHA 2IYWA 2A5LA 1AKQA 3AM1A 3QQPA 2QIOA 1PLKA 1Y6RA 3KWFA 4KWIA 5EXPA 3V4OA 5FQOA 3TIGA 4NZYA 5JI2E 4PZLA 4IV8A 1AKTA 2QDKA 2OV1A 2UYYA 4ARVA 4J3JA 2HRQA 3PFBA 2H1IA 2HOQA 3BWMA 5DASA 4ZCLA 3A11A 3SE7A 1T4BA 1WCIB 5CDYA 1UZAA 1SIOA 3AI2A 4Q0MA 1P7ZA 2ADOA 1RXSA 2BSAA 4AZTA 3FFWA 4HNHA 3H2IA 3GWZA 4B82A 1MLDA 3GLHB 4DR1B 3VMMA 1L4GA 1NYQA 4B4VA 2IYPA 1Y8QA 4K0KH 4DR2H 3FZYA 2OOKA 2GHRA 1JIJA 1U7DA 4IZ6A 3HUEA 2HNBA 1YHYA 3QVGB 2ACEA 3CVOA 2O4UX 1B8OA 4ZO6A 5JW6A 3O3NB 4WCFC 1XD8A 1I7DA 3ETCA 3KZCA 4F72A 3PEYA 1Z4KA 3OQHA 4OGWA 1Y63A 4K6FA 1AS0A 4EGQA 3U6KA 5AI5A 3SX2A 1TB4A 2CDAA 5HKOA 1DKPA 4AUMA 3ZY2A 3F5MA 3MWYW 4OB7A 3FPSA 3SFTA 4IGFA 3OH8A 5T64A 1DJNA 3TUZC 2W4IA 5DGIA 1JDNA 2EX1A 1ISMA 2BUAA 4NOKA 3DT6A 4U63A 4JI5B 4KXWA 4OSEA 3QKSB 2JGLA 5DBIA 2CPMA 2SKCA 2FSVA 3Q9SA 3HJGA 3UKDA 3KC2A 3CUVA 1Z08A 4F86A 2PG3A 2QRUA 1WDTA 1N33B 3R20A 4RH3A 4UHJA 1JLMA 4WFQA 2F3SA 1RXCA 2QYHA 5AW3A 4H3KB 2OZEA 4DUGD 2ZM6H 2RIRA 3BYZA 4IR7A 3C3JA 4JZYA 1NUAA 2Z1DA 1VBFA 4KYUA 5AYVA 1NFFA 4MVJE 2UVPB 3LI2A 2EJBA 3OZGA 1L5LA 1MUUA 1IDN1 4QC2A 5AOBA 1XNQB 3K1AB 3M5WA 3EGCA 1XK6A 1VLMA 3K70B 4KW7A 1AHNA 4RM3A 3BQNB 2HI0A 2R79A 2F4NA 2PV0A 1PE0A 2QUJA 2WMDA 3JVUA 4I66A 4QBFA 1BHQ1 4V0QA 1U8EA 1WD7A 2ZZMA 2JCXA 1P31A 1Y1TA 2Q50A 2FPMA 3C6XA 1UKCA 4U2EA 2A1TR 5LN1A 1EFPA 2H11A 1V1MB 1VJ0A 1J39A 2VDWB 2B4AA 2DBVO 3BF7A 3G9TA 3EYAA 1DVRA 2NU7A 4O08A 4C0HA 1RWXA 4PO8A 3AR3A 4UAJA 4L5IA 2MHCA 3D02A 2CNWD 2RC6A 2YL2A 4ZQCB 5DHSA 1RACA 1HFJA 3O7WA 3S44A 4WINA 4TYYA 4BNKA 3MNFA 3RSZA 2PUGA 2YHUA 2ORWA 4HN2A 1U2RA 5DI3B 2YMPA 4EITA 2Q3DA 4RFVA 2BMVA 3DF7A 5CXUA 3HP1A 6PFKA 1HRKA 2LZ0A 1LLCA 1Z4IA 3VMFA 4NZTM 3B6ZA 3H16A 4PW0A 4DWVA 3NQ41 4X8LA 1E6UA 1CY8A 2G4CA 3ROGA 2V7XA 4FE7A 3I6MA 1NBOA 1N5DA 4B6OA 3ZHBA 3C2QA 2HXSA 3I4LA 2QWXA 4E1VA 2J67A 2M6QA 2VG8A 3EBOA 3PE6A 3P9QA 4KYVA 4U7TB 3HADA 4B8WA 5AM1A 3UFBA 1I3LA 4C4SA 1KRXA 3FE2A 5THXA 4AC9A 1HKUA 5DOZA 3V7UA 1SCUA 1WPGA 3O92A 3UMMA 1P0QA 2I4IA 1HORA 2KJQA 1JJ7A 2E4YA 1Z8HA 3E5NA 3HEBA 4IFIA 4LE2A 3IEVA 4Z1MA 1H6BA 3T4UA 4MDYA 4L7VA 2QNRA 3PNMA 4B3CA 4H8AA 2X8BA 4ZZ1A 2Z6UA 3OZSA 4D26A 1E7WA 2ZAOA 3DL0A 3VSDA 1UJBA 3THYB 1J4WA 2BRUA 5IWAH 4JI4H 3TRIA 2YXLA 3ZI0A 5KQPA 3VR3A 2VQFB 2CLFB 1G16A 2CNNA 2GDJA 3G2QA 1NM5C 3ZS9A 3OKAA 1CLEA 2VUIB 3MRSA 4IH9A 2JCSA 2O0MA 3WDLA 4DQVA 3NLLA 5IZCC 2EQBA 1ABEA 3CWCA 3UAVA 4CEJB 4OHYA 3G49A 2GTHA 3UIEA 2HK9A 1UZNA 4GI2A 2H6EA 521PA 4HEHA 4YAEA 1GQRA 1VE7A 5TEVA 2J3IA 3ADKA 4AJ2A 3TSZA 3L07A 3G5MA 1GT6A 3NH6A 4U1RA 1ABFA 1I2BA 2PH3A 3GABA 3BDAA 3GFTA 3PTLA 2WM3A 3K6KA 1E4VA 1NONA 2V5VA 5IFLA 4CETA 1E77A 2C03A 5EUCA 3L4BC 4V0MA 3FYSA 3UY4A 3JQ8B 4TM7A 5DNCA 3MUOA 4ZMRA 3K9GA 3ZWKA 4Z9AA 3RS3A 3NVAA 3OX2A 4RK0A 4H3SA 4CI0B 2P2LA 2DFTA 3QYAA 4D9JA 2IV3A 3U7IA 3DT8A 1Q83A 2XDWA 3D6MA 4X3PA 5KHLB 2OAGA 3FYUC 1EFDN 2HA5A 4QE3A 2VCHA 1RYNA 3AP1A 3WGUA 1EAMA 4B3SB 4XVUA 2WUFA 3H6KA 1OIVA 4A16A 4R1TA 1CNMA 4TS4A 4TSFD 3T9EA 1K88A 2A9FA 3RB8A 3I76A 4DQUA 3GT7A 3W3AD 3DMDA 1PFYA 3W7VA 2N9UA 5ALZA 2Y4OA 1R3UA 1YIOA 2HZ7A 2JK0A 4YMGA 1CUXA 1YKGA 4FJ2A 5ED0A 5KI6A 3QYPA 1R16A 2Q4OA 5FOVA 5AXBA 2PR2A 5CA1A 2NVUA 1EM8B 4ESHA 1ZUIA 1YS7A 3H9QA 3DEAA 3TBHA 1TK3A 2CXQA 2W48A 3DNMA 3OOJA 3W05A 3WKDA 3N9IA 1P29A 4GUAA 1N0HA 1DWPA 2QMZA 4GI1A 3WKEA 3BH0A 2I76A 4AJ1A 4OL0A 2QEQA 1JKIA 4CVNA 1NYLA 1WSDA 3S7TA 3RUIA 2HDWA 3R0JA 1S8OA 4XWGA 3EZ7A 5DLYA 4M0EA 5CA1F 3MJHA 4IHKA 3PJRA 1KWKA 3LK6A 1CS0A 4WBNB 3V8EA 2QLJA 3V00A 2JIBA 2CDRA 3BZUA 2DLDA 2X40A 4KYIB 4AKTA 2CKMA 3HVRA 4Z9FA 3MBKA 2IP1A 4AY3A 1IQ0A 1WWKA 1XTZA 1KK0A 3L6DA 4HWKA 3EMVA 1X74A 2ZBRA 2GRAA 4PONA 4C9BA 5GINE 2DRIA 2M98A 1N5KA 2BGNA 2G40A 2QHXA 2ZTLA 5EHQA 4TWAA 1L1FA 4RD6A 4OK5A 3DOFA 4JC0A 5ABPA 4JL5A 1Z26A 2KLBA 3HJTA 4TS3A 3CRQA 1DP4A 1X7XA 4YREA 1WE8A 2HT6A 4QYIA 4ECAA 3PFHA 1CDEA 1SKUA 3CZQA 2CD9A 4HB3A 8ATCA 3QEAZ 4KITB 3KTAA 1XVLA 1CVRA 3E61A 1NJ2A 3B48A 1G8KA 3ACBA 4PX9A 3TCXB 4CIDA 2C57A 2C92A 1O1YA 2KS6A 4G1UC 2EDAA 3T1OA 2HTFA 1N32B 5DEIA 1NBMA 4G8JA 1YR7A 4YUYA 4FCVA 4UNSA 2R1TA 2PRKA 5BUQA 1XI2A 1Y6QA 1ZVKA 2BFDA 1Z5PA 4GLOA 4HDSB 3JY6A 1OWNA 4YALA 3VX3A 3WL3A 2WICA 5CDHA 2QD1A 1RVDA 1L0BA 3BJRA 4MPRA 4X91A 1M2JA 1YE3A 1U0SY 2C5LA 4JQSA 4MWEA 4EQ6A 5K0ZA 1KYIA 4PQFA 4N8EA 5DTMA 2ZJZA 4ZDJA 3NOVA 1ORIA 4LCEA 1ZNWA 4L5YA 1XKLA 4Z4FA 1I13A 3SHVA 4JL8A 1NQUA 4KOEC 1NQTA 4HVAA 3EA0A 4UTVA 1VP9A 2IS2A 4G65A 1SXJB 2W42A 5J1TB 3P9ZA 2Q6KA 5TEWA 1BDIA 1G63A 1M7BA 2ORVA 3A31A 1UT6A 2I6TA 4YPVA 2ZSJA 4ZPXA 2QAGC 1EE2A 2XOXA 1UKVY 2HHAA 1YRHA 5AVSA 2DY1A 1XXLA 3CF4A 1N6RA 1YZLA 5B7QA 4JLPA 4NFSA 1SOUA 2ODAA 3G0DA 3C8DA 3IR5A 4PS0A 1FDVA 3AHDA 5JZSA 2F55A 1XU7A 4CG1A 4HG2A 2B6HA 2JKYA 3TECE 3QY9A 4BC1A 1R4NB 4G9EA 3DLHA 1C7EA 2X76A 2CCJA 3BA6A 1HT3A 4WXPA 5F51A 1MX3A 2W93A 5DH9A 1SBHA 3I32A 4C7OB 1DTWB 2FFHA 3AL3A 3N87A 4S1PA 5CHYA 5I9NA 1H4QA 3IPCA 2OHIA 5DP1A 1JE1A 2ZJ0A 4Y98A 2LV8A 3QI2A 1EBBA 4WK2B 3UCXA 2AOXA 1SFRA 3ANYB 4RSGA 1UDXA 3AUYA 4RHEA 3UB3A 2JB9A 2Y1WA 3BCSA 1GPH1 4JSTA 5D5HA 3AR7A 1JL3A 3F3KA 4A5OA 2Z04A 1JEEA 2F8TA 2Y6UA 5ALGA 4A5SA 4PNEA 2BGUA 3HU2A 5AM4A 4YP6A 4UMFA 4F71A 2V4UA 4DIMA 5K6RA 3CEPB 1XV5A 1PK8A 1H2XA 2BI7A 2D2XA 2QTZA 4IEIA 2Y93A 1PR9A 3IUBA 3EUEA 5F4BA 4EGAA 2OPUA 1ZITA 2FWAA 1A4RA 3MJSA 4TMVA 4WW0A 4YRJA 1YIDA 4G0QA 4GYJA 5J23A 3PC3A 3KLPX 4LYFA 3TSYA 3FH0A 5CNJA 2VJCA 1A76A 1FRZA 1SM4A 5LP6B 2V6GA 3U3DA 4GWLA 5LMNB 1V4VA 4LFCB 4NXNB 4K9QA 4MSUA 2ZTUA 2ZT6A 1YQQA 3CUEF 3AL0C 1JU3A 1UODA 1DBPA 1OYOA 2I99A 4O5OA 5A6VA 5LQAA 5I6DA 4CEHA 2QTVA 4CKYA 4WVLA 2QVCA 3MTAA 1IEXA 2ISSD 1YE8A 5CXSA 1JEQB 3L1KA 3LKZA 4YA6A 4YACA 1V9CA 3ORRA 1HEYA 3BMNA 4XCXA 5HCIA 5ADHA 3VZQA 1Q3HA 1AO0A 3UN1A 1XZNA 4IVPA 2CE2X 2G77B 4PYKA 2P30A 1JZQA 3DV0A 3PUJA 4DCNA 1MG5A 1VMIA 5UKDA 1U31A 2D8MA 2HZBA 3HR7A 3OPQA 5EIWA 1VE5A 3GEDA 1MQAA 1ZIDA 1BXZA 2ZRPA 3AV3A 3NEAA 3P94A 3RHFA 3RFUA 4ETIA 2NP7A 2JEBI 1Q57A 5DTIA 2K87A 2QZJA 2V5UA 3L7DA 1ZL0A 1TKAA 2OM2A 3KQOA 5AJHA 4WALA 2QPOA 2X58A 1C9YA 3MAJA 2XLCA 2ZJ8A 5C80A 3J81W 1E64A 2VYCA 1JVNA 1DJQA 5KQGA 4HS9A 4QFDA 4FB5A 1NR5A 3GLHA 4C06A 4NOMA 1DT3A 4LDZA 4DSAA 3JVVA 4B2YA 3ISJA 4XLZA 1FP7A 1GZVA 1B7GO 3T3OA 3ESDA 1KZGB 4K9NA 4HPWA 4DR5B 1SVKA 2W00A 1W4AA 4FR0A 2HA2A 4RETA 3O8OA 2A3RA 3QVGA 2PU5A 3W2IA 4BO0A 4XRRA 5B2ZA 1U04A 5CU7A 2RIPA 1O97D 1SR8A 3T4XA 1QDLB 1YJBA 2K2QB 3EEQA 1JDVA 4KO2S 4R6XA 1FU7A 5DEOA 1BHSA 1UBJS 4LUCA 2PVCA 5T8KA 1Z29A 1RAHA 3PHIA 2VZ9A 4Q3OA 1M2HA 3QVVA 1A8IA 4LGYA 4YI5A 1Q7GA 2DF8A 3VUEA 2J5RA 3RSFA 3WADA 3HLYA 5J43A 2NT4A 4KN8A 1QHNA 5H02A 1OAKA 3SDZA 1Z6YA 1GZ7A 2DUJA 2QQ5A 1VXRA 3QKSA 5K0GA 1O6GA 1Y8CA 2C0PA 3BHNA 5IWCA 3M7IA 1GJRA 4IRXA 1H2BA 3QU2A 3NBQA 3A27A 4YDHB 4POOA 3V8QA 1JXQA 2G0TA 3C4QA 3PNYA 4JT9A 4NPHA 5D3MA 4YYEA 4B40A 4DAOA 4DVJA 2BMEA 4FD2A 2BFCB 3BXEA 2B7BA 2VTDA 4QODA 4QYTA 3SQLA 1RYBA 3G5TA 4GSKA 4C4OA 4LNHA 3RJ9A 2OHFA 4L3OA 4RE5A 2NNWB 2YMMA 3T95A 4N12A 1XEXA 3IKTA 1O94A 3K92A 1DG3A 3V4LA 4P5EA 1PD1A 4YRSA 4Q7LA 3KKLA 4RK4A 3TE7A 3GLKA 4D81A 4B45A 1YI0A 1YDGA 1FFGA 3IAAA 1D1SA 2PSHA 4EW3A 1JIUA 3A70A 4Q6BA 3TTSA 4PLZA 2FRDA 5H9VA 4L02A 4WA7A 5BXYA 2D06A 2B0JA 2AYZA 2VOEA 4PG5A 1X6VA 1ILEA 3UAZA 1XVVA 3PR1A 4R31A 3X3HA 2QM0A 4BFWA 1EX6A 3GMIA 4NQRA 1TQ4A 3GO4A 4JT2A 2DETA 1O58A 1R5NA 2VYNA 3HA2A 2NTJA 1C0IA 1IG0A 4C88A 3P2MA 1ECPA 1YR1A 1X70A 4MS3B 4XIFA 5L3ZA 3TLZA 3WA6A 1ST3A 3I1YA 2FOXA 1ML4A 1COZA 4ND8B 2GUGA 4H77A 1WZIA 2WVAA 2ID8A 4ETNA 4ZO4A 5EIBD 1AQUA 3KYBA 4F1KA 1JV2B 4EK9A 1JDTA 4BVBA 3OOHA 3QPVA 3EH1A 4JH0A 3BXOA 2GPTA 4R68A 2WK1A 3UK7A 4BFCA 4EKEA 2QG9A 1CVLA 3L4JA 4TMYA 3J81A 1AHPA 1KFJB 1FYWA 3O9MA 1RHQA 1YA4A 3W5BA 1AKYA 4TZKA 3HSKA 3BCRA 2OC4A 1TJYA 3BC1A 3FIUA 3LCVB 3GT4A 1EAYA 4R8RA 4A0FA 5IJZA 3OCUA 3DE3X 3K31A 1W85A 4RLQA 1EWKA 2K1HA 1U7UA 1PJ8A 1UMBA 3RWBA 1U28C 3WFJA 2I67A 3PT5A 4C6TA 4NICA 4UKDA 5FP0A 1E9EA 2R84A 2ZRKA 4TX1A 3N2ZB 3TRKA 1SCIA 4PO3X 4LNUA 1B8UA 2REQB 1FLAA 2XIQA 4G4SO 1LLDA 4IXMA 2GCIA 1NBEA 2JFYA 2PUVA 1IHYA 4GPBA 4TV8A 3G5LA 1OZ0A 2F2TA 5FB3A 1QX4A 4BO8A 2VJAA 4DV1H 2J3LA 3KV3O 2XWSA 3ICCA 5DCYA 1O6FA 3V9PA 1FK8A 4NI5A 4D80A 2DKOA 4Y6QA 1KJIA 1P81A 2BKVA 2IZ1A 2PL1A 3G9XA 3NTVA 4QNMA 2AJDA 4ZKEA 3T5DA 4QG3A 2PV7A 2ZI9A 2FN3A 2DQZA 4MVJP 5DHQA 4HH4A 4BV3A 3KQWA 4EIWA 3OJCA 4CEJA 5IN4A 4PCVA 1Z6XA 3ZHRA 5A05A 1SPBS 4G1VA 4GE3A 4BV9A 4Q48A 1DQPA 1OXXK 1VMAA 1NRIA 2NZWA 4JB8A 4QXOA 4TV8F 4MI6A 1JBKA 4V2UA 2J9FB 4ZGGA 4M49A 4BNXA 7REQA 5JYDA 1H4SA 4ZOLB 2NPFA 2YINC 2ZRMA 3AHGA 1XLWA 4RMIA 3HFSA 2LUOA 1DXYA 1NR1A 3AIMA 2CLKB 3AMVA 3BE8A 3O31A 4HO1X 5G0SA 3WGJA 5EFZA 1ZS9A 1R6BX 2QY6A 4CU5A 3I2HA 4RXMA 3LDGA 3E7FA 1XPJA 2GJSA 3EDCA 3QXXA 3SBDA 2HHHH 4LEIA 2KQUA 4X6UA 1UBKS 3A06A 1YKFA 1CJKC 4E5UA 1T2UA 3K30A 1VYHA 2XYRA 4R83A 3OEED 2IZOA 1ZOOA 2QT9A 2VPWA 3PYXA 4CDRA 4W5JA 1P8AA 2QSUA 1W94A 2ZRBA 2CZQA 1CEYA 5AESA 1YS2X 3FWZA 4BP3A 2UDPA 2P9BA 4CF5A 4DPLA 3RS5A 3T3MB 2XB8A 4YRCA 1F0KA 3S3TA 1QHIA 4WL0A 1F2UA 2G72A 3FBGA 3VNUA 4BGEA 3S8MA 3VZDA 4B5KA 3P7MA 2C96A 4Y7DA 2X06A 1US8B 1MQSA 5CCEA 5CG1A 3KVRA 4MA0A 3IOYA 1F8GA 1EM8A 4BRSA 3QEKA 5JCJD 1NYTA 3FVWA 3KX2A 3V1UA 2NXNA 3QD7X 1HYHA 3VKHA 3WGTA 4CHTA 1WAMA 3QVMA 4KE7A 2FVXA 4BQEA 3VH3A 1QRAA 4BO3A 4AF6A 1VMKA 4GX0A 5EZYB 3ZU2A 1RZVA 2FPHX 1AB5A 1IK4A 2GYVA 3SJBA 2XKBA 4I4CA 4PTZA 1TQ6A 2VVTA 4KWHA 1NURA 4OLFA 4O1HA 4BEWA 3H4TA 2HV8A 2PKEA 3WIBA 1BMQA 5JEAG 2PPLA 3CZAA 1I14A 2D59A 3HACA 3N2YA 4XWAA 4TKLA 2Q9BA 1A2QA 5CLIA 5BQOA 3H5NA 5CR9A 4OUKX 4RKFA 1OX6A 2CGEA 5DHAA 1YACA 2SCUB 2VDLB 1E0SA 2ZAGA 4N0QA 2OTCA 2OXRA 2GPSA 4GOJA 1TO6A 2IY7A 2REBA 4OKIA 4B7CA 1MAVA 1L1QA 1L4LA 1SBZA 4JP1A 1K2WA 1A9TA 3BJIC 3Q15C 4HDRA 1KRWA 1VJ1A 4MPTA 1LC3A 3IS3A 3LVQE 1Z25A 4C7XA 5TNXA 1KE1A 1S5PA 4J7AA 3WJ1A 1U5AA 2VPXA 4TXNA 4ZALA 1D6NA 2QKYA 3NHWA 4GX5A 1G3QA 3ZQ4A 5LVAA 5CX1B 1I7SB 4EI8A 1JHUA 5REQB 2MMGA 3LW8A 1RQPA 4KCGA 5CBKA 3DE1X 4HDMA 1ADYA 3CF0A 3MEQA 2RHCA 4R1LA 3P9CA 1UBOS 2HFKA 1Z0DA 1CBUA 2P8SA 4MUAA 1ZSNA 1UEXC 2FPIB 2G07A 4FSDA 4X5OA 5FHRA 3V5NA 3AHIA 1Y9ZA 3DBRB 1GYQA 4ISBA 2O3TA 1CDZA 3ANMA 2IU4A 4FNGA 2ZUDA 5SV2A 5E2IA 4DHWA 1DJPA 3Q7RA 4LBYA 1M66A 2G8YA 1NNLA 1VBNA 1XEWY 2HJHA 4HDSA 3RFCA 1NW8A 5AI4A 4Z4CA 1OXVA 2WFLA 4KFRA 4YP0A 3FCOA 5DCLA 2XQGA 1U0GA 4M1QA 2ZANA 1F1BA 3ABSB 4U0JA 3EGVA 4UNQA 3T5CA 2Z0SA 3U4MA 2GEUA 5THQA 1EPUA 2YWFA 3A1VA 4EF5A 4JUCA 1JDSA 1L7PA 2YWCA 4LJ8A 4GQIA 4N3CA 3MSXA 5I7OA 4PSCA 5A5FA 3S99A 3OIUA 1VRWA 4Q24A 1YMUA 1JIIA 2VATA 3IVAA 1KOGA 4QIHA 1H93A 3BX1A 3GDHA 3HA7A 3IILA 1DV1A 4G67A 4U8GA 4ZCPA 5KVVA 2JIOA 3PC4A 4G8DA 4LF5H 4NCJA 3LC2O 5F3DA 1WMSA 5CBPB 1DFGA 5FH9A 4KBGA 3DGEC 1W48A 3BWVA 5JTUA 1TEZA 4EA7A 4FJSA 2HJSA 2WVGA 1L8OA 3IHKA 4YTEA 2A5YB 3VSAA 5DK4A 3R4CA 2W2XA 4K2HA 1ZMXA 2C8VA 3SHFA 3Q6MA 3RD5A 4LRUA 4PG7A 4CIYA 3WYBA 2PMBA 1HFEL 1DZIA 3DAPA 3DEKA 3L18A 5K3CA 3RW9A 3QFCA 5JPCA 1NKSA 4HS4A 4ZI7A 3HXQA 3DFZA 1IBKH 1K98A 1U0JA 1ST2A 2YWRA 1GPUA 3M3DA 4RDCA 4QOGA 3AUTA 3MUEA 4AJIA 3COYA 3EG9A 2E0IA 3ANSA 2R62A 2UYHA 2C2ZA 4R8VA 4WCFA 3U6BA 2NUPB 3E58A 1IXKA 1NRWA 4J0IA 3STWA 4IFTA 4MJ3A 4F1WA 4BMXA 2UXCH 5FI3A 3BWYA 1CUEA 2NVBA 1XQ1A 1H2YA 3KR1A 4ERNA 3L77A 4TMKA 5F9FA 1V3TA 1FMTA 2ESRA 3DDNA 5IULC 4DR6H 1U7TA 4LF7B 4ZI7F 1M6YA 2OK7A 3GEMA 4E0BA 4P22A 2YS7A 5BVGB 3QUBA 1JUDA 3UCEA 2WM2A 3PTAA 4BFVA 4AKEA 1DELA 2WW8A 1QVZA 3QX9A 4FFNA 3FB1A 4QKQA 1QFJA 9GPBA 5EKDA 4J2HA 2YY5A 4Q4AB 4EKGA 5AW7A 1KOJA 1RWVA 3ILSA 4KHPB 1SHLA 1VI5A 2K6GA 2NPIA 5KIAA 3OJLA 5CIWA 1D0SA 3V2GA 6LDHA 4MGHA 4XA8A 3QWFA 4FFLA 5F2KA 3LUFA 5IYZB 4MQ6A 2PGNA 4RK5A 1LK7A 5FX2A 4H7EA 4U7PB 3NG1A 4YJFB 5JPDA 3GIDA 4GW3A 3CLRD 4KODA 4L73A 1JEQA 4BAZA 2BPOA 2FB9A 2J9YB 3TEFA 5B37A 1K7XB 5FTWA 4EUSA 4LOKA 4NPAA 3B70A 4DV6B 3U09A 1VG8A 5DW0A 1FKAH 3NGMA 2XT0A 3OCJA 4CFYA 1HTWA 2J4FA 3EXHC 1GG9A 1YRYE 3LUBA 3MTJA 3OM8A 2WQZA 3PPWA 4RVSA 3UHAA 4A03A 1DCMA 1M2OB 1VMDA 3SY8A 3CCCA 4XQ9A 2YCLA 5JO9A 3UATA 4KPFC 4G0VA 1PG2A 4YVFA 1JVSA 4B74A 3E53A 4TV9B 1Q20A 3JSAA 2CFOA 3C0KA 2BFAA 3K4QA 3WYDA 3L92A 3R0ZA 4E7OA 5JAUA 5JJ5A 3E70C 2FWNA 3L8GA 4OUDB 2BGGA 4BFLA 2R9VA 3QPCA 3K5WA 3WWZA 1QRRA 5KNCA 5DULA 2BCJQ 4OK6A 1G8YA 5CH5A 2PY9A 1ZD2P 3EFEA 2A0XA 4LJKA 4RF5A 4CG0A 4DVGA 3T61A 3ZE7A 4AF7A 4L75A 2PS0A 4CW7A 3KQUA 2IIPA 3HG7A 2IBTA 1EVJA 1IPHA 1VIVA 3DZ8A 1MAAA 1WXDA 3NBFA 4FS3A 1U5BA 1Z9BA 1IAQA 3WQBA 4F0JA 2XCQA 3Q8MA 4KLNA 5EZ5A 4DPMA 2A58A 1W1IA 4OMFG 3WO0A 1BYUA 5GTDA 1AMNA 1G42A 1YZUA 3VO2A 5AJWA 1X4NA 2CFTA 3VDNB 1CFJA 1TA0A 2BDEA 1H2WA 3TDNA 3TXXA 4H0FA 3IULA 3VR2D 4GT1A 2RH8A 2OXTA 2NZJA 4TOIA 5TC4A 3T7SA 2FQWA 4LBZA 1ABBA 3N6XA 3FHTA 1WVGA 3O91A 2GZ1A 3NDJA 4KWCA 1TZJA 2AQIA 3PQ3A 1SZCA 3GLIE 3E9DA 3AR5A 2GK7A 2N42A 4O4HB 5J2TB 4HWGA 2AG5A 2OGUA 2OGTA 3GHHA 3ZHSA 5KOYA 5L8VA 1NM5A 4N7BA 1OBVA 3NDRA 4FN4A 2ZJ1A 2VCEA 3HP4A 1E3WB 1JI0A 3O73A 1J6UA 4JKYA 2M1ZA 4LZZA 3SX0A 5IZCA 3U7HB 2YCBA 4GR5A 1MDFA 4W8GA 2VYQA 2WHEA 4HX5A 1XJ0A 3DXZA 2FUNB 3MAGA 1C8VB 2HMWA 5DYNA 1K63A 5HUHA 3GNSA 5JJBA 2UUPA 2XWJI 4NCBA 3PQ4A 1F3OA 4PPQA 5LNK6 3QXJA 1VB5A 1DJOA 1OWMA 2X2OA 3HFRA 4KTTE 1G2IA 3L4BA 5BWNA 2VKTA 2XTNA 1YGYA 3H13A 2EX4A 2DR3A 3I2KA 4Q4LA 3ZLJA 5A5GA 1R4AA 1UAGA 2W6PA 3SC6A 3IQWA 4BAGA 4JCOA 5L53A 5EY5B 5FF9A 1B0ZA 1IZ0A 3H05A 1PZGA 1IONA 3KD2A 4M0MA 1V37A 2M8WA 3VU9B 3RK0A 4QGHA 3O2QB 1VOTA 3RVQA 1GNQA 1SZDA 1GNPA 2FN7A 3FYUA 4LPSA 1HE1C 2FE1A 2WJZB 5EYPB 2P8JA 4B17A 3IR6A 4MB0A 2ZK7A 1IPEA 1YQUA 1DTSA 3N58A 4PYIA 1XN4A 4WOBA 2EGHA 2PXHA 2WTBA 4GZ5A 5ALYA 4E15A 4RC9A 2RK3A 1E6WA 1JHAA 4EAQA 1DAFA 5CIQA 1RXWA 1TM4E 2DUMA 1ODJA 3R5XA 1G5IA 2D5CA 4PBTA 3SR0A 1Z68A 1G9SA 1JU4A 2V0CA 8GPBA 5CYGA 1YQ9A 4FOSA 1MAUA 2OT3B 2A7QA 3BQ9A 4S12A 4XX0A 3DLCA 1YBHA 1T8YA 3NM5A 2YIVX 3TQFA 3ZWAA 4M0LA 5G1OA 2IXTA 2IOFK 3RC9A 1PEKE 1YU6A 3LQYA 3OHSX 3D4OA 3KQPA 3IXQA 2IWRA 5U4QA 4GZ3A 2NUAB 2ZVQX 3QA9A 3U61B 4B3TH 5IMBA 2HGZA 1LDBA 4YO7A 1MX5A 2ZWIA 3ORHA 4NQZA 3EUWA 3RYIA 3AW8A 1M2FA 3U4IA 5KVCA 2RAUA 1BD4A 2VHZA 2OORC 4L5AA 4P3OA 2REQA 1DKUA 1XCLA 4X44A 1BA3A 1E96A 1ZH6A 3QX8A 4JBWA 1MQ9A 3NYRA 4LTMA 4DS3A 1ODIA 3O9VA 3TQHA 3I5UA 1PGOA 2VEDA 2MR6A 4NBLA 3DAGA 3LY7A 4Q9NA 4LDRA 5BT9A 1A5SB 1U4NA 2OUIA 3F5FA 2FF5A 4CMIA 1V4NA 4WGFA 1Y42X 1FTQA 1X1CA 2H17A 4CM9A 2H7CA 2Q9CA 3NCVA 1F1JA 1NLUA 4G5XA 4FFDA 3S4YA 4IQ0A 2WPDA 2X5KO 2UYQA 4LE1A 5JC1A 4M1KA 2P5YA 1TPZA 3K0AB 4U4AA 3B13B 1QIGA 1ZK4A 1XQ9A 4JK3A 4OAPA 4MEAA 1UOQA 4QHYA 1C1XB 1NVDA 3EZ6A 3VPAA 2HA4A 4LVNA 1I32A 2XA9A 1CDDA 1JFLA 4ECEA 5I5GA 3TPCA 2AR7A 4KWEA 2QVLA 4IHJB 1E8NA 2W6MA 3LO5A 2C42A 4XZ3A 1LQ2A 1NOKA 4ASUD 4KPEC 1T0JB 2X2EA 3KSRA 1DAHA 1N5LA 3NJ4A 4XE5A 2WQ7A 4OQ4A 4BATA 4PSKA 2HO4A 4Y3UA 3N07A 4E5DA 1I4LD 1ZMBA 3CUWA 1PEDA 4RVUA 1X7ZA 3V8NA 3WLAA 1X3LA 4J0DA 5AK6A 3B2QA 3BK1A 1Q50A 2QGZA 2VEOA 3BZBA 3B9RA 3CRRA 3ONEA 5DM2A 3RC3A 1N7JA 4BNHA 5TB5A 4L5BA 1ISSA 3DE6X 3WDKA 4F85A 5IC6A 3W6ZA 4BFUA 3ETEA 4DIBA 1A9OA 3LXRA 2DPXA 2W98A 3MJRA 1I7LA 2J9XB 3EBLA 2VTKA 4KR9A 5TRTA 3ZVLA 1X0VA 4KFUA 3CG0A 4QOFA 3M6VA 2AZDA 1TAQA 5IP5A 4OI1A 2QE7A 1DT5A 1RC1A 1X42A 1G4HA 3O3CA 4PE5B 4QUAA 4W7IA 4YRKA 2H48A 3DOOA 3UGTA 3B3FA 2AQHA 2GXQA 3BMQB 4B2IA 4RH1A 1D6SA 4CIVA 4EELA 1E6LA 2IOYA 2PGLA 3OT5A 1SG9A 2WVHA 2HD4A 4D9CA 4E12A 4BVLA 1QOZA 4H1TA 2X3UA 2ZJAA 1NUQA 2A59A 2AHOA 3KO8A 3F96A 4N3NA 1KAMA 3DVSX 5K1ZA 5A3SA 4RLFA 1VPTA 2H92A 3PU6A 3QWHA 5MFZA 1U02A 3GEGA 4IDQA 1K8XB 4U5QA 4Y1FA 3CLUC 4YRQA 1Q14A 1SQ6A 4HN9A 3RYFB 2YJ5A 4NU0A 5DHRA 3BAZA 4F84A 4LVUA 2O6LA 2HSEA 5I4IA 4D44A 3I6BA 3FOAA 2CHEA 3MCUA 2CLMB 4IZOA 2WD9A 4KVGA 1IHUA 1JFSA 2O7VA 3LECA 4KQKA 3VKUA 1I33A 3D3EA 1F3LA 4FOTA 4ZT6A 4LQ4A 4CGZA 2Y0BA 1LZKA 4QPNA 1Q21A 3CE9A 3IT0A 4BVGA 4MARA 3ZV5A 3Q3GE 1Y1SA 4XGQA 3LQQA 4OGKA 1A82A 2XGGA 2ZS8A 3FLEA 4JQCA 3M1IA 4TMFA 1OX4B 1QKIA 1B3RA 1XQWA 4QGGA 5KCZA 5JEDA 1E4YA 4DNFA 3F5SA 5BW4A 2J0SA 3JTMA 1T3SA 4JJGA 3PWZA 4YJHA 3DBRA 3LDAA 1CWUA 5AVTA 5JMOA 1IXYA 1BCRB 2Q7XA 3FJ1A 5SICE 3FJYA 1JG6A 1MZVA 3A9CA 4B5LA 4D41A 2Z2XA 4L8FA 1Y4UA 2AI2A 2D62A 3AB8A 4UAUA 3GELA 2MMCA 2NM0A 3QVXA 4LWOA 5E2AA 4WWHA 3ZE0B 3ZOKA 1P5RA 3DB2A 3LT0A 3UGQA 3VPDA 1R8JA 3NAMA 2O2HA 3M0EA 1NVVQ 4MYUA 4F6RA 4ALKA 3DH0A 2MSEB 5EIXA 4NK5A 4MCAA 3IAS6 3VM6A 3T3NA 1LNQA 1COWA 2J3MA 1DMRA 4G3XA 3G2IA 2BHNA 3N0XA 4WOPA 4EF6A 3ZNOA 1JLLA 3ZDFA 4J7XA 2COKA 3U5ZB 1EFAA 1VG0B 3OIGA 3TGPA 1XMIA 2UVDA 1HNNA 1E1QD 3RSHA 4PBRA 2HRRA 2WFZA 3A28A 1N2SA 5KBYA 3AM3A 2WJ3A 2Y1FA 3DM9B 4JU9A 5TPZD 3SR3A 2IEYA 3F8WA 1HDZA 3NHRA 4PAOA 3DO6A 3KT8A 3QLTA 4FZ3A 5CA0B 2PZGA 3ROQA 1UZMA 3WB9A 4X7PA 1NAHA 3QU7A 3TH5A 5KTTA<