2O4CA

Crystal structure of d-erythronate-4-phosphate dehydrogenase complexed with nad
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
380
structure length
380
Chain Sequence
MRILADENIPVVDAFFADQGSIRRLPGRAIDRAALAEVDVLLVRSVTEVSRAALAGSPVRFVGTCTIGTDHLDLDYFAEAGIAWSSAPGCNARGVVDYVLGCLLAMAEVRGADLAERTYGVVGAGQVGGRLVEVLRGLGWKVLVCDPPRQAREPDGEFVSLERLLAEADVISLHTPLNRDGEHPTRHLLDEPRLAALRPGTWLVNASRGAVVDNQALRRLLEGGADLEVALDVWEGEPQADPELAARCLIATPHIAGYSLEGKLRGTAQIYQAYCAWRGIAERVSLQDVLPETWLAGLQLNPGCDPAWALATLCRAVYDPRSDDAAFRRSLTGDSATRRAAFDALRKHYPPRREITGLRVATGGQAELQRVVRALGAQLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of d-Erythronate-4-phosphate Dehydrogenase Complexed with NAD
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Oxidoreductase
molecule keywords Erythronate-4-phosphate dehydrogenase
total genus 125
structure length 380
sequence length 380
chains with identical sequence B
ec nomenclature ec 1.1.1.290: 4-phosphoerythronate dehydrogenase.
pdb deposition date 2006-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00389 2-Hacid_dh D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain
A PF02826 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain
A PF11890 DUF3410 Domain of unknown function (DUF3410)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.170 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 2o4cA03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2o4cA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2o4cA01
3JQCA 1O8CA 3RU7A 2W98A 1BXGB 1QG6A 1XWFA 1R15A 4MVJD 2V65A 4W82A 2YV3A 3ZNQA 3H2ZA 3MZ0A 4TZTA 1PS0A 3OJFA 3WJ7A 2TMGA 2HK7A 2EV9A 1X7GA 2IXAA 2DU8A 3E82A 3GUCA 3FD8A 4E21A 1ZW1A 4CMEC 3HDJA 1ADGA 4ZRNA 4WOKA 1QYXA 4BO4A 5B4UA 1HDZA 1PGOA 1BTOA 4WASA 3WSVA 4GX5A 2Q2WA 3VAZA 1L7DA 1YWGO 3TNLA 3I5MA 2JCXA 5L53A 2DBZA 3L4BC 1GPJA 1ZCJA 1H6DA 2UV8A 5ILGA 4EJ6A 4RGBA 5K9ZA 4TVBA 4O0LA 1N7HA 2Q1WA 3M1AA 2OP0A 1P9LA 1HE4A 3LT2A 4R01A 4U0KA 3PQDA 2H5LA 3ZNNA 1UUFA 2E49A 3DMYA 2VRCD 5CP8A 1QYCA 4GSLA 4HBGA 5ES3A 3E9NA 4AJNA 3AI3A 1DC5A 1Z7EA 4CLDA 3ONFA 5DNAA 4I5DA 1UDBA 3D7LA 2QHXA 2E37A 4R1NA 1AXGA 1QRRA 3UCXA 1EUZA 3V8BA 3WGHA 3AJRA 5KOIA 4FDAA 5BT9A 4PVCA 2O2YA 1E1KA 1R4MA 2GASA 1UDCA 3TOXA 3ZWCA 3TFQA 2Q2QA 2JKVA 3HZZA 4L4RA 2QYTA 1O94A 3W1VA 3IAHA 1UXHA 5HM8A 1V8BA 3CZMA 1MC5A 4XZ3A 1W6UA 4J2OA 1U3WA 2DTXA 4IS2A 4J1SA 3PI7A 5ICSA 1T2AA 4FW8A 2BLLA 1T2DA 1WDMA 1YRLA 2VRCA 3WNVA 3B1FA 1A5ZA 4U7WA 3HADA 4E6PA 3ANMA 1BSVA 4ALKA 4BQPA 1ENZA 2X1HA 2GN8A 3RROA 4H15A 1C0LA 5T8KC 3DMTA 1HF3A 4Z0PA 2QIOA 3PYXA 3IKTA 3C7AA 2DPHA 3OIGA 3KRTA 4GX0A 1VL0A 4FPXA 4IXWA 5CFZA 3ZU5A 4DYDA 1ZIDA 1DOHA 1PJ3A 1W4ZA 3QJ5A 4QO7A 3X2FA 3KSZO 4GSKA 2JFFA 2AQKA 4MIYA 1AHIA 4BOYA 3FI9A 4DBZA 2B35A 2GNAA 1Q1NA 3HJAA 1DO8A 1ZMOA 4DPKA 3B70A 5AXBA 1I33A 1DB3A 4YJGA 1O6ZA 4CM4A 5JSFA 4K1LA 4WCFA 3WYBA 1GR0A 3E5RA 4RVDA 3RC9A 1HZZA 3QA9A 5IXYA 3ANLA 2PD6A 2P68A 4RPKA 5KCZA 4XRRA 3ZV5A 4A27A 3GEDA 2YJZA 2Y0CA 3OECA 3I6QA 1X7HA 1HEUA 4PLPA 1E1LA 1J5PA 2OL4A 3GZNB 1G0OA 3OFSA 5IFLA 5IDYA 1B8PA 4UUPA 4WE3A 4BKRA 2VZ8A 5IDQA 1A71A 5F5NA 2J6IA 3GFBA 3CPSA 1MV8A 1BRMA 3ZZNA 1QMGA 1EFLA 4UUOA 4BGIA 2Y1CA 4KDEA 5IAAA 1ZMTA 1QV7A 2O50A 5ENVA 4J6FA 3VZPA 1PU2A 2NTJA 1N1GA 1XIVA 1YE3A 1ZK2A 1P0CA 1SB9A 3H2SA 1BXZA 2VT3A 3SXPA 3PZRA 2O7SA 1SPXA 2IYPA 4YJHB 3RFVA 4OKIA 4CQMA 4U0JA 5IZCA 5A4DA 1HE3A 1Y1PA 4EDFA 2X5KO 3EGOA 4O1MA 6LDHA 4JBGA 3H3JA 1HYGA 2EJVA 5JAMA 1I3KA 4AG3A 3UH1A 4E5MA 1UP7A 4YT4A 1HETA 3M6IA 1E3EA 1LA2A 5C37A 1WZEA 2GN4A 2FRDA 1XLTA 5DCWA 1U2GA 1VJ0A 3WXBA 4XYBA 5I7FA 4AL4A 4A0SA 1R12A 2LDBA 3KEQA 1WWKA 2DAPA 3IDSA 3ZCXA 2W2KA 1XSEA 2GSDA 3GQVA 2ZB3A 1ENYA 4ITUA 3RUDA 2IZ1A 2FPGA 1D1SA 4CMIA 2J5RA 4YPOA 1U8FO 3ORFA 4II2A 5IG2A 4HWKA 5F1PA 2B0JA 3F4BA 2OO5A 4CQMD 3AY6A 4NDNE 1KYQA 3GN1A 4MVJF 5HA5A 1N1EA 1B14A 3EVTA 3ZHYA 3EY4A 4DLLA 4BO3A 2BFAA 3RD5A 4ZN6A 1Q7BA 4CM7A 1CETA 2W4QA 2PNFA 1YOVB 1PR3A 1Z74A 2CVQA 3MWEB 4BNHA 4CLOA 1VKNA 3E5MA 5BNFA 1KS9A 3OQ1A 4C7JA 1HSZA 3WGOA 3DOOA 1RWBA 3FWNA 3Q6IA 2X6TA 3INGA 1ZJZA 3CMMA 2BGLA 4OSOA 1F8GA 1IULA 3DR3A 3CXRA 4ZVVA 4CMJA 1H6BA 4G81A 3A14A 4UVHA 3BTVA 3FNHA 4P4NA 5T67A 3D4NA 4J1QA 1U3TA 5G4KA 4WKGA 4YWJA 4R54A 4ND3A 4PLZA 4PLFA 4RO0A 1GFSA 2PR2A 3BHJA 1VJ1A 5G0SA 4UVEA 4YQYA 5L7TA 1P0FA 1G1AA 3GDFA 5JPIA 1LSOA 2WYVA 4E0BA 4IPTA 3PJDA 3COSA 3CSDA 4Z9YA 5J23A 3OP4A 1BHSA 4GVXA 2PZLA 2J3KA 1KY5A 3O9ZA 1W73A 4AJJA 4JK3A 5KJ6A 3WS7A 1HZJA 5JDCA 1Z45A 3H5AA 3AFNA 4R4JA 3U49A 4PG8A 2HQ1A 2FZEA 3KETA 3NKLA 3PQEA 2BMAA 4TRJA 1IOLA 1BGVA 5EL0A 3WNQA 5LDHA 1W8DA 1E5LA 3B1JA 1LDNA 1T2CA 3LT4A 1U28A 2ET6A 4R3WA 3NJ8A 1SOVA 2IZZA 1Q7CA 4RF3A 2J5QA 2HRZA 4DC0A 1NVGA 3BMQA 2ZB8A 4PLYA 3IL2A 3H6KA 3WGTA 3MJEA 4B7UA 4QT0A 3RUIA 1ADFA 4J0EA 5COQA 5L4SA 4XRGA 1PX0A 1PZFA 3RKUA 4CM1A 3WMXA 5IDWA 1ZSNA 4N7RA 3TFOA 4L0QA 4BO7A 4LN1A 3PJEA 1PGJA 2C20A 4GX2A 1QXSA 3AFMA 2AEMA 3GHHA 4GVLA 2FWMX 2Y1GA 1JW9B 1U7HA 1N8KA 1EDZA 1QKIA 1U7TA 2D2IA 3WQQA 1CRWG 1H6CA 1Q0LA 3E8XA 1GEEA 3OJ0A 4IMRA 1YBVA 3V2HA 4W9NA 4XGNA 3D5TA 4WNCA 2C7VA 5T64A 3JD0A 3GVPA 2A94A 1NYTA 1EVJA 4HV4A 3EAGA 2FP4A 3I83A 1V9LA 2BF7A 1QYWA 1PEDA 2X58A 2ILTA 3TZKA 2OFPA 4XX0A 3VKVA 4CMIB 3VH1A 2VTEA 1VKOA 2A4KA 3S2FA 1HLDA 4DLAA 1BWSA 4Y98A 4EYEA 4NBWA 1HDCA 2HMTA 3IKVA 3FSRA 1R0LA 4R5HA 2NVWA 3O03A 2CNBA 2AQHA 2VWHA 3F6YA 3DOCA 3ZWOA 1EMDA 1V3TA 3E18A 5THKA 4RVUA 3RC2A 4Y6RA 4S3MA 5A5FA 5FEUA 2FN7A 1B0AA 3B6ZA 4CV1A 4R3NA 3T7EA 3UAGA 1NX6A 3ZW9A 8LDHA 1LSJA 5BQFA 2NTVA 3OBBA 1XGKA 2Y66A 3KO8A 5GZ1A 1IL0A 4YAIA 2D0IA 4WCDA 1GQ2A 2PKRA 3TQHA 2CVZA 2FSVA 2NV6A 4FOSA 3GDGA 1PGPA 3K2EA 4A10A 3KHUA 4I08A 3Q1LA 4XWYA 2EKPA 4KQWA 3AY3A 1VRWA 2YDXA 4L4SA 2GN9A 1RKXA 4BKQA 3MJCA 1Y9EA 1WMBA 4ZQFA 4L73A 2Z1NA 5TC4A 3CEAA 2JAHA 1ENOA 2Y1OA 3CMCO 3ONEA 4IQ0A 2WMDA 4AVYA 4OMUA 1DFGA 3SBOA 4IZHA 2Y0DA 1EE2A 1OI7A 3BA1A 3FPLA 4I5EA 4IIVA 4UVGA 2JCVA 1DHRA 4IDBA 3WWZA 4D3SA 4FB5A 1Z73A 4BNKA 3WGIA 1M67A 1R0KA 3O38A 2VT2A 2FR1A 4Q3EA 4NJMB 1B26A 2CSUA 2YQ4A 5L7YA 1FDWA 1MA0A 2HLPA 4JN6B 3K73O 2BGKA 3AM3A 4ZRMA 3ZWAA 3GRPA 1MFZA 1DHTA 4R1UA 1HE5A 3WYCA 3PTZA 9LDBA 3E9MA 1LLCA 4PZDA 2FZWA 2PLAA 4CQLB 5LDGA 3ZV6A 1PJSA 1GU7A 3BHIA 4IIUA 2D59A 3AM5A 4CM8B 1YB4A 3E9QA 3WB9A 1DLIA 3QWIA 5EERA 5CEFA 3FF4A 1ORRA 1WNTA 4CLRB 5EPOA 4KQXA 5TRTA 3WBBA 2YQ5A 3VVCA 1LDEA 1SEVA 4RL6A 1LLQA 3NJ4A 4KWIA 3CINA 3ROKA 4CM8A 3OICA 1N9GB 1ZKMA 3PYLA 4CJXA 4DLBA 3ROMA 2VYNA 3DAGA 3PHLA 1LRLA 1CWUA 1M2WA 2DT5A 4KOAA 4RQTA 1T4DA 5F21A 1GQYA 2GZ1A 4LW8A 4HNGA 1NBOA 1XEAA 3UF0A 4D41A 5JY6A 3S55A 2BKAA 2H6EA 1E7SA 1SO8A 2VUSA 2IYOA 3I1JA 3FWZA 1XQ6A 2RHRA 1XU9A 3WGGA 4RVSA 3GK3A 4GPD1 2AG5A 3ZN2A 5TSDA 3U09A 4YAKA 1MUUA 3D4OA 2Y1FA 1D1TA 2R2GA 3INRA 2WSBA 1PL7A 2VNAA 1BDBA 2G82A 3K8ZA 2VYND 1ZNQO 4FJ0A 3DZJA 1O9BA 3N58A 3TZHA 3FR7A 1ZO8A 4YJFB 3DAPA 1KEPA 5DZSA 1JA9A 3VTZA 4E32A 5IJZA 4DMLA 4OXNA 2ZQZA 1P1FA 3DOJA 4P22A 4WEOA 1WP4A 3ZWWA 1DEHA 2GUGA 1LQUA 3GMSA 1NP3A 3OIDA 4DIBA 4WNIA 3QQPA 3QHAA 3F1KA 3GNTA 3S8MA 2Y93A 4LK3A 5ENDA 1K6XA 5BNTA 3PYMA 4LMRA 3TJRA 4XR9A 3GR6A 3UVEA 2NACA 3F4LA 3KYDA 4K6FA 3I9JA 4WLFA 4A73A 3LK7A 3NT2A 1LRJA 1TT7A 3MJ4A 4DQVA 1YL5A 3NYWA 5L95A 4J1TA 4IJUA 5JCJD 1E7YA 2AQ8A 4U8GA 1EVYA 3PFWO 3K96A 2PZJA 3SVTA 4J43A 1HLPA 2HUNA 3PWZA 2NU8A 1NFQA 4R16A 1UR5A 3FTPA 1SOWA 2YDYA 3QV1A 4OQYA 3OETA 3I23A 2G0TA 3UXYA 5CG1A 3KB6A 3H3FA 1HT0A 3NDIA 1XHLA 3AOEC 1VSUA 1AN9A 2YFHA 2Z5LA 4NBVA 1PQUA 4F6LA 2AXQA 5CG2A 4C4OA 1E1MA 3WX0A 4RCVA 4XCVA 4OJNA 2YHUA 4AJ4A 2NVUB 3KYCA 4DUPA 3AU8A 2J8ZA 4WJZA 4PN3A 4H7PA 2WEKA 2POQX 4JIGA 4ZQEA 4B7CA 4XDYA 1VL6A 4GGPA 4PFJA 1T1SA 2UUPA 3OHSX 4EBFA 1P1IA 2B4TO 3NDRA 3RJ9A 3IC5A 5FF9A 4D43A 1EEHA 3U0BA 3WSWA 4BL5A 2GCGA 1H93A 4IM7A 3QWAA 2Q2VA 3FTNA 3K30A 2P5UA 3S1LA 4YACA 5KTKA 2Q46A 4MPDA 2CUKA 3KV3O 3D3WA 5A02A 5JYDA 4HX5A 2UYYA 2HMUA 1KVRA 4ZICA 4R69A 5JO9A 5JE8A 2HK8A 3VDRA 5EMHA 4BS9A 4W99A 4D45A 3PIDA 2UVDA 1TI7A 4MP8A 4R68A 4LSWA 3RUEA 3VH3A 2CVOA 4GX1A 3FNGA 4P4LA 2GPTA 3A4VA 1VL8A 1XYGA 4DPLA 4J1NA 1GYQA 3I4CA 5ICMA 1X7DA 2DLDA 3QW2A 3AW9A 4TQGA 1QORA 3P7MA 3JYPA 4CMBA 1M6HA 4FIZA 3D3EA 5H82A 2YHIB 4CMGA 1K89A 3ICCA 3WDSA 3AUAA 2VOEA 1GAEO 4MIEA 4OGWA 5DF1A 2PD4A 4I9NA 2J3HA 1UZLA 5F5LA 4J9VA 5ADHA 4CR8A 4GWGA 3L9WA 3LC7O 3ICPA 1DC4A 4FJ1A 2DFDA 1NQTA 2E4AA 5U9CA 4GAEA 4IQGA 3PWKA 4JBIA 4K6CA 2QRLA 4PLVA 2YY7A 4O59O 1PGNA 1ZBQA 2BFPA 5CDSA 1W0CA 5AXAA 4E5NA 4X54A 3FN4A 3RSHA 1A7KA 1MB4A 5KJ1A 4TMFA 2DQ4A 5JYEA 1UP6A 3T4EA 1DXYA 3CZRA 1A72A 3I6IA 2VQ3A 3HFGA 1TXGA 1C1DA 2DTDA 2AA3A 4Y8VA 4CM5A 2AG8A 4OAQA 4ZA2A 4CM6A 4OH1A 5CEEA 3S2EA 3TF5A 3LF2A 2XXJA 3LT1A 4OKNA 4PIVA 3V1TC 1O0SA 1E7QA 2XAAA 1ISJA 2G76A 1XDWA 1YBAA 4UREA 2Y1DA 5H83A 4BHTA 1M76A 2CMDA 4WK6A 5K6AA 2OMEA 4DA9A 5T8KA 1ISFA 1MGOA 2X9NA 2Y68A 2P5YA 2C2YA 1G6KA 4BO6A 3DMTC 2GDZA 3GPDG 3GNSA 5DBFA 4ALMA 1YB1A 3GLQA 4OOEA 1BXGA 1GV0A 3GVIA 4FS3A 2YYYA 2PKQP 4CPDA 3ST7A 3VZSA 1EVZA 5JC1A 3RC7A 1JAXA 2EIHA 1GEGA 1S6YA 1DRUA 4FGWA 4HXYA 3RAJA 2BH9A 1Y8RB 3AM4A 2IXBA 4RVHA 5CDYA 2UDPA 2X0NA 4UAGA 1IHXA 2WD7B 1YL6A 1NQ5A 3F5SA 2P9CA 2VN8A 3NAQA 3OEWA 4WEQA 1V6AA 4XEHA 2P9GA 3B1KA 3HHPA 1U2DA 4DBVO 4ZQBA 3GEMA 3HG7A 1R0SA 4GKVA 3BHMA 1QYVA 3JQ7A 1A4UA 3OJOA 4JP3A 4PZCA 3AOEA 4BKPA 3L9XA 5IDXA 1GV1A 2P9EA 3UGKA 4E13A 4A5OA 2WD8A 4FQ8A 5GY7A 3OM9A 2X5OA 3EW7A 1CEQA 4E2YA 1KVTA 3VPFA 1PL8A 4NPCA 5G0UA 4QECA 2VWGA 3FNFA 3KZVA 4E33A 5JO0A 1DAOA 1O95A 3JQ8B 3KBOA 3OQBA 3W8EA 1QLHA 3WTCA 1C1DB 3RIHA 2HRBA 4TRMA 4Z6KA 1D7OA 4AFNA 2EG9A 3GUYA 4MINA 1OMOA 1EUCA 3FHLA 4MKXA 1HDRA 4YAEA 4A26A 2NQ8A 3E03A 4BO1A 4NBTA 4PLHA 3K6JA 4GWKA 3H5RA 4LSMA 4MVJE 5HS6A 4BNIA 5BSHA 4MP6A 2O3TA 1HYHA 3TOZA 1R4NB 3AI1A 2O3SA 1X0VA 1L7EA 1NQOA 4IGEA 1V3VA 3GG2A 2PKQO 3JQAB 4A2CA 3NT5A 4IDDA 5DP2A 1P1RA 3R6DA 4WLUA 3WLFA 4FC6A 5AXCA 4TWRA 1I01A 2ZATA 4W4TA 3S2IA 1SEPA 1GL3A 5L51A 1HE2A 1WPQA 3PFFA 3U9LA 2YHIA 4P38A 3E48A 5JDCC 5C3MA 3ASVA 4NMHA 3JQGA 1K6JA 1AE1A 2FHSA 8ADHA 3OEYA 4Y6SA 2GLXA 5TF4A 5C7LO 4B4VA 4NJMA 4Y67A 1JDJA 2XPCA 1T4BA 1YOVA 4YB8A 4BNZA 4FGSA 1ADCA 2I65A 3GGGA 2B5WA 1I30A 1M6WA 1Y81A 2Q4EA 3JD1A 4KUEA 1LXCA 4PG4A 4XB2A 3O8QA 4XIJA 2O3UA 3OMLA 2G1UA 2AW5A 3FBTA 2VHVA 5A9RA 2HMVA 3FCOA 1E6UA 4YCAA 3CE6A 4EEZA 2RH8A 5EIOA 4IDGA 1PL6A 2C54A 3WR5A 2IEBA 1IUKA 1O89A 3U4HA 3DZKA 1LJ8A 4XYEA 1WW8A 2HK9A 1E3JA 3DBRA 3SEFA 3DQPA 4CLRA 3UN1A 1PTJA 4YTEA 4MVJP 3MJSA 4DIOA 3L4SO 3R0IA 3JQ7B 1TVEA 2Z1MA 4NU6A 2C07A 3VPGA 4YXFA 1UP4A 4J2HA 3AUTA 2NNLD 1SB8A 3CUKA 4W7HA 2EGHA 2RHCA 4IXTA 1AGNA 1K2WA 1T1RA 4BNVA 1F14A 3LLSA 4YAGA 4HUJA 2F00A 4LCEA 3VZRA 4TZKA 3WTBA 3K9QO 2V6BA 2HMWA 4JJFA 4RDHA 1TT5B 5BSEA 2WWRA 2WYUA 1FXSA 1T2EA 3D1LA 1GY8A 2AE2A 3HNPA 2HJRA 4JNKA 4R1SA 2JAPA 4TKLA 1LSUA 3V2GA 1PZEA 3AOGA 1WDKA 4TRRA 3R1IA 4KDFA 4U5QA 3H9EO 2CDCA 4YRDA 4YDRA 5CPFA 2HO5A 2C59A 2ZJ1A 3IJPA 4P8RA 1G0NA 3JV7A 1FDTA 3GGPA 2Y99A 1PJCA 2QW8A 2Q99A 3ENKA 2ZTVA 1GTMA 4R9SA 3RUAA 4D42A 3TZ6A 2XF8A 4YVFA 1LDYA 2I3GA 1D8AA 1FJHA 1I2BA 3KXDA 4G5HA 4Y9DA 3PLRA 2VUTA 1B2LA 4BKOA 4BNMA 2PH3A 1NXQA 2GF2A 2UUOA 2VNSA 7MDHA 5B4VA 5L45A 1U3VA 3BXXA 1UAYA 3MJVA 4ZJUA 4FJ2A 3PVZA 4ALIA 4JXKA 4QTZA 1F0YA 3FRJA 2NU7A 1P74A 1I5RA 5G2OA 3WGQA 3JQ8A 1PSDA 1PS8A 5TT0A 2EKQA 3OSUA 3WIDA 2NADA 3ULKA 1LLDA 1GPDG 2DPGA 3ROPA 4FD3A 4W7IA 1ISGA 1F17A 4ND4A 3KSDO 3HDYA 4FFLA 3TDKA 1IHYA 4EITA 2EEZA 3HSKA 3AUUA 1PR9A 2P4HX 4ALJA 6ADHA 1NPYA 2JJYA 3PGJA 3MWDB 1ZK4A 3PHGA 4KP7A 1I0ZA 2X9VA 1OBFO 1PWZA 1U4SA 5A05A 3NTQA 3ITDA 3VPSA 4FFOA 3VZQA 3W6UA 4AJEA 3ZI0A 5JC8A 5FI3A 4BVAA 1PGQA 1Q0QA 2Q1UA 3RKRA 3G1UA 4E2ZA 4PG6A 4HFNA 1XR3A 2B83A 3GN2A 3FNEA 4MP3A 4BNGA 4NI5A 1T25A 3KYCB 3H7AA 4LRSB 4XJTA 1C0IA 2NVBA 1KEWA 4M55A 3PHJA 3W8FA 3D0OA 2VCYA 1RM3A 4OQZA 3NTRA 1CQJA 3PK0A 2B4QA 3AY7A 4WGGA 3VC7A 1FK8A 4B3HA 2YV2A 5LCXA 1PQPA 1X0XA 4C7KA 3ZNOA 3RFXA 5A1TA 3GAZA 5CEJA 1R4MB 4GKBA 1KETA 3WOHA 1DC6A 3BMOA 4O5OA 4KTVE 1JTVA 1UH5A 3HN2A 4E12A 3BTOA 4J49A 4CODB 1UJMA 4BIIA 1ZXLA 4QXMA 1JKIA 3H9JA 2DUUA 2J3JA 5JDIA 1E7WA 4J7UA 1SBYA 4IINA 1TT5A 5I7SA 4BO5A 1UXGA 4II3A 4NQZA 4WLNA 2FR0A 4WCFB 1H2HA 3OJLA 5G0VA 4PLTA 4RVGA 4YA6A 1XA0A 3NDJA 1DIGA 2ZYGA 2D8AA 3G3EA 4M49A 3BYZA 4NU5A 4J7XA 4U6QA 1KVSA 2ZTMA 3M1LA 3UW3A 3EYWA 1IB6A 2Y67A 4JJIA 3OA2A 3X2EA 3N7UA 1N7GA 2JHGA 4YT2A 2ZKLA 3IIEA 5KVVA 1H5QA 1JWBB 1PQWA 5IZ4A 1A4IA 1LSSA 3OQ6A 2VYVA 2C82A 3RWBA 3GEGA 1E3WB 5BNIA 3F5QA 3ZH2A 2O3RA 5K6AC 1RM4A 4BO0A 3Q9UA 3JD3A 2NLOA 1WMAA 4BNLA 3KYBA 3GVHA 1MG0A 1PZGA 1TB4A 5G4LA 3L6EA 2D3TA 1KC1A 2RH4A 3P2OA 4DQUA 1I2CA 3A9WA 1P33A 4NHEA 3IOYA 2DKNA 4XGKA 1LUAA 4PG5A 4XDZA 2P2SA 1IPFA 4BO8A 4NFHA 1JKJA 3WIEA 1K3TA 2HSDA 5FI5A 1OC2A 5COAA 4GLOA 1B3RA 4WOJA 3DBLA 4BNNA 1YKFA 3QVOA 5IN4A 3LT0A 1L1FA 2FOIA 3ROQA 3V2UA 4RJTA 3KYDB 2VYVD 3MCVA 1F12A 1RYEA 1EUDA 4GH5A 5DDIP 3RQSA 2Q50A 4RLSA 3HDQA 1MG5A 3GMDA 1SNYA 3PJGA 4ALNA 1WDLA 3QLJA 5DBIA 2BHLA 1P44A 1GCOA 2O4CA 2GRAA 4UUMA 4XYLA 1N9GA 1ZXBA 3HWRA 4BB6A 1UXJA 3GFGA 4CL8A 4DGSA 3IUSA 2GN6A 3FBGA 2GZ3A 4CMAA 3MJTA 3G1TA 4B8WA 4DC1A 1GCUA 4ZGWA 2X0IA 1ARZA 5A9SA 3UFXA 3ZHBA 2B69A 3GZNA 3OH8A 3CKYA 1PJBA 3DXFA 4EJMA 4CLEA 3F46A 2W90A 4E4YA 1YQGA 5DN9A 5I7EA 5TLSA 4S1VA 4FC7A 1GUFA 4GBJA 4RORA 5H81A 3CIFA 1FDUA 3KTDA 3LVFO 4UEJA 2VHXA 4RZHA 4E5PA 2BELA 4NFSA 4BQRA 2TMDA 1LDMA 1SAYA 3OA0A 1MLDA 2EWMA 4B4UA 3BTSA 1UXKA 3ENNA 5IF3A 4NH4A 3E1KA 1P3DA 2O4UX 4FN4A 1RPNA 1PS9A 1U5CA 2VOJA 4FOOA 2EKLA 4MJLA 4EEXA 1KVQA 4Q3BA 1NAHA 1KERA 2BI8A 3ZGYA 3TZCA 1YJ8A 4BNJA 3ONDA 4WLEA 4PZEA 3DZBA 4AJLA 2C0CA 4I5GA 2JFGA 3STHA 4IJWA 4A03A 1E1NA 5G4KB 5B4TA 2Q49A 3O26A 4OO3A 1BDMA 4B3IA 5K0ZA 1GD1O 3FR8A 3NGXA 3VPHA 4BNFA 3WWYA 4MVJM 3P2YA 4MOWA 5JCXA 4WCFC 2AQIA 1PJLA 2F1KA 5C5IA 1H94A 1Y7TA 1X1TA 3RU9A 1QP8A 1SMKA 4R9RA 3UHAA 4XQGA 4ND2A 3ZWYA 4CLOB 4ZU3A 1Y5MA 1T24A 4D7AA 1YXMA 4HFRA 5EINA 4XYGA 4RLHA 5G0WA 1LC0A 4TVOA 3UOGA 3ZHZA 2VTDA 2NQTA 3L6OO 3NTOA 3DWFA 4ND5A 2DFVA 1LBEA 2PGDA 3H4VA 5KVQA 5CAEA 4DIFA 5EQFA 4XYMA 1PZHA 5I9NA 4NZ9A 1NNUA 3JYLA 1ISHA 2GR9A 4AJ2A 3U5TA 1HDYA 2VWPA 2HCTA 3D5QA 4B3JA 4FSHA 3A28A 5A06A 4CM9A 3WICA 2JD1A 2C5EA 5LC1A 2ZK7A 5ITVA 3L07A 1R4NA 2H63A 4EGFA 1KY4A 3IJRA 2AEFA 3GPIA 1NHGA 1HKUA 1B7GO 3IMFA 4ID9A 1IYZA 4LVUA 5DULA 4CMEA 3EMKA 3V5NA 5B37A 3RCBA 1Q0HA 2V6FA 1A9ZA 4GLLA 1S7CA 4N5MA 3C1AA 3CTMA 2P4QA 3QE3A 3LC1O 1ZUD1 2GO1A 3O8QB 1B16A 1B8UA 4L4XA 4BV8A 4DWVA 2BD0A 1ZEJA 3PRJA 5FFFA 3QY9A 3ZWVA 1GQQA 4DVJA 3RUHA 4OHUA 4CM9D 1QYDA 3PXXA 4BNXA 3BAZA 5L40A 2I66A 1C0KA 1M66A 4P4GA 3V1UA 3U4CA 1YONA 5AYVA 3ZNPA 2PK3A 5FWNA 3SJUA 3WQRA 4BUCA 3HFSA 2GD1O 1GDHA 1GZ4A 1P1KA 1ISIA 2EXXA 2NWQA 3HN7A 4E2XA 1DIAA 2GGSA 1NR7A 3DAFA 2O3QA 3ADOA 4HKTA 1RYDA 3N74A 4L75A 2XXBA 3D64A 2PZKA 5C7OO 2W2KB 1GYRA 2ZB4A 4BMVA 1XCBA 1MXFA 3EK2A 1LU9A 4NG5A 3OJEA 3SC4A 2QYSA 2D5CA 2GYYA 4PVDA 5BSGA 3GA0A 1EBUA 2PD3A 4J4BA 5DCUA 1ZVMA 3M2PA 3BMNB 3DHEA 4NNJA 5TGDA 1JN0A 3H5NA 4WUVA 3F47A 1ENPA 2AMFA 4R5MA 3RBVA 1HRDA 2HMSA 2VRBA 2X4GA 3RVDA 4E2WA 5A03A 2I99A 4FBGA 3ETGA 1NHWA 1IE3A 4E5YA 3C85A 3ZWBA 4AJKA 3EZLA 1IY8A 2E6UX 2R6JA 1HXHA 3KLPX 2D4AA 5L3ZA 1HDGO 1WLYA 4IY1A 3DBLB 1OC4A 4IBOA 2B36A 1IPEA 4IDFA 4XD2A 5DCYA 1EVIA 2ZQYA 3WBFA 5TIIA 1ML3A 5ITWA 4JBHA 4M8SA 1YO6A 1KC3A 3WQSB 3PIIA 5JLAA 2PZMA 1R66A 3JQFA 3LDHA 3K2BA 1PJ4A 2OBNA 1CF2O 4QSMA 5JS6A 2Q1TA 1BVRA 3W4IA 4GL4A 5JAQA 1B15A 1RM5A 4CMCA 4CUJA 1E7MA 3HUDA 2X86A 1VLLA 3OIFA 4CV2A 4LMPA 2D1YA 1I36A 4J4HA 1F8FA 5L7WA 3DZFA 3WGZA 1QR6A 3DHYA 1PIWA 3VH2A 4TROA 3HE3A 3PJFA 1R16A 4HNHA 4IJKA 4Q3NA 3LU1A 1KBZA 1C3VA 1BW9A 3JQGB 1KEVA 3ITKA 3WG9A 2IDZA 5EN4A 2O3JA 2CZCA 3DC2A 3ZU2A 3KVOA 3ZDFA 3ABIA 4YJGB 3DO5A 4J16A 3TN7A 5JY1A 1K5HA 3IUPA 3BZUA 4RF4A 5HBRA 4KZPA 3ZU4A 1XU7A 5C7IO 1SC6A 1LLUA 4PGFA 1LI4A 1UDAA 2DBRA 5JCJA 4Z3KA 1NWHA 3JQBA 1HYEA 1K0UA 1U8XX 1DFHA 3C1OA 4XQ9A 3AK4A 5AOVA 3EC7A 1YDWA 3EZYA 1E6WA 3IQDB 1EK5A 5U1PA 4PLGA 5IXSA 2Q45A 4BNUA 3VH4A 1CYDA 2VHWA 3QRWA 4OM8A 4RPJA 2W8ZA 4DL9A 5JXWA 4ZQHA 4Z3DA 3L4BA 4ROSA 5AXDA 1XG5A 2PH5A 1FDVA 3WYEA 5TJHA 2JFHA 4A7PA 1WXDA 4CLHA 3JYNA 3P19A 1JAYA 1PJ2A 2CDAA 1NTOA 2RCYA 2I6TA 2VUUA 3RI3A 1O5IA 2Z95A 2ZYAA 2JL1A 3JQEA 3INTA 3A1NA 1DLJA 2Q4BA 2E48A 3EDMA 3G79A 2A35A 1E92A 1I32A 4I9UA 2CF6A 2P91A 3KSUA 2V6GA 3GAFA 4OXYA 3RBZA 1KOLA 1EDOA 4J3FA 2NM0A 2X23A 2D5AA 3DZIA 4J0FA 3QVWA 4QQRA 3NEPX 3BTUA 4XIYA 1Z75A 1ISMA 2QZ9A 1CIVA 3GDOA 4YT8A 5GZ3A 1E3WA 1Q2XA 4KTTE 3TSCA 1C14A 4UVDA 1B8VA 4M54A 4AJOA 2WD7A 3EHEA 1U1IA 4LVCA 3JYQA 5JAIA 3I3OA 5AVOA 2PV7A 1NR1A 4Z9XA 2OOSA 4OOFA 4YT5A 9LDTA 5KKCA 3Q11A 1B3BA 4L8VA 2NU6A 3ETEA 4QX6A 3LYLA 1NFFA 4TRNA 1VPDA 3KEOA 2GZ2A 3JQ9A 2ZYDA 2BRUA 3U4DA 1LEHA 4KMSA 5TNXA 1J0XO 5U4QA 3U4IA 3K31A 3TZQA 2BI7A 4XKJA 1LRKA 1P1HA 4PG7A 3DTTA 4N54A 2LDXA 4EZBA 5B1YA 4MVJI 3B20A 3C7CB 4RF5A 4PCVA 3DZHA 2BFOA 1XKQA 4F6CA 4JROA 3W4KA 3BMOB 4YYZA 2BGMA 3DBRB 3Q0EA 2PWZA 3C8MA 1OAAA 1ZZEA 3ETDA 1ZJYA 3GG9A 3HB5X 3VVBA 3BIOA 3R3SA 5KKAA 1MX3A 4RF2A 1JKFA 1YB5A 5EQDA 2WYWA 7ADHA 3I9MA 4ZD6A 1UZMA 2O23A 2YZ7A 1ZH8A 2SCUA 2ZTLA 3NUGA 4WLOA 4FR5A 3HQ4O 1NFRA 1GZ6A 5A04A 4YR9A 2O7QA 4NBRA 4JJGA 4N18A 1JU9A 3EVNA 4IQ8A 3Q3CA 4XR4A 1E7RA 1R37A 4AJ1A 2CDBA 2H9IA 3AUSA 4J7CA 3PHHA 1YQDA 3MTJA 4OSPA 3ADPA 4JCOA 2WDZA 3NGLA 1GUYA 4YEDA 3WFIA 4NIMA 4TSKA 4XA8A 3TPCA 2Y1EA 3F1LA 5T57A 1AXEA 5JW6A 3KLMX 4G65A 4CM4B 3NX4A 5JBIA 1GUZA 4D0RA 2OXIA 5ER6A 3OF2A 1GADO 2YUTA 4UULA 4CMHA 3H9UA 4QFCA 3GOHA 4CMKA 4PLCA 2DBVO 1DBVO 3HB4X 5FYDA 4F46A 1N2SA 4IZIA 5BSFA 4M87A 4NFYA 2YW9A 3PLNA 2B4RO 2G17A 3I4FA 1PJQA 3DZGA 4PRLA 3VPXA 3C3XA 5A9SB 4O6VA 4EUEA 4BGEA 4KWHA 4Z0TA 1EE9A 4B4OA 4J90A 3O4RA 1DC3A 1HWYA 3PGXA 2X5JO 4FFPA 4OL9A 1E3LA 3DDNA 1UZNA 5TX7A 1NVTA 1P45A 1HDXA 1C0PA 1IZ0A 3TL3A 4K9DA 1CJCA 1HDOA 3FPCA 4RV9A 3WFJA 4ND1A 1T26A 4RPGA 2BFMA 4DREA 1ZK1A 1GYPA 2FMUA 2Y0EA 4WLVA 3LF1A 3PWSA 3SLGA 2C5AA 4F45A 2EJWA 2OP1A 3ON5A 3ZWPA 5I8WA 4IS3A 2HJSA 1ULSA 5T5QA 4Q3CA 3D3WB 5I7VA 4B8ZA 4AJHA 5HS4A 4RPLA 3BMCA 1H9AA 1DAPA 3L6DA 2OGUA 2X0JA 4IDEA 4EW6A 4YJFA 4BV9A 2I67A 4GGOA 5L9AA 5MGBA 4MIOA 2ZTUA 4JLWA 5KNLA 1KVUA 1ZK3A 1TEHA 1D3AA 1VC2A 4CLXA 1ONOA 3GC6A 3ANNA 4XQCA 1VSVA 1U4OA 4EI2A 4D3DA 1NWCA 1E0DA 3ZV3A 4BO2A 5KIAA 1FMCA 4KUHA 1V0JA 1C1XA 2RIRA 5ILOA 2X8LA 3NT4A 2HKIA 2R00C 3MTGA 2AHRA 4MVJG 4BKUA 3TWOA 1MC4A 4M86A 4R1TA 1D4FA 4QO8A 2ZIZA 1ZSYA 5CDUA 3ZHXA 1WVGA 1YQXA 2EW8A 2E82A 1DRVA 3RJ5A 2A9FA 4AJIA 1OFGA 1H0KA 1AHHA 1Z6ZA 4DQXA 3KOUA 3WMWA 3P5SA 2O2SA 2X9GA 2VHZA 2AE1A 1DDOA 4GQAA 1ZEMA 1DJNA 1HTBA 5JNLA 2DBQA 4UVIA 1F06A 1NM5A 2C7GA 2OZPA 4F3YA 2EP5A 2XOXA 1WZIA 4OXKA 4CQLA 3UICA 3QWHA 4XGIA 2OORA 3VKUA 5B12A 4JP2A 2NUAA 1EQ2A 4I5FA 3Q2KA 1EZ4A 3C1TA 5COBA 5G0TA 3SX2A 1J4AA 2QRJA 4DMMA 1VI2A 2DUWA 3DFUA 1YL7A 1Y8RA 4E5KA 4DRYA 1ONNA 1BVUA 1YDEA 1PWXA 2UAGA 2RBEA 5CHEA 1SCUA 4Q3DA 2X22A 3KM0A 4Y6PA 4E31A 3LQFA 3VDQA 3PDJA 2DTEA 1WAMA 3F9IA 1P31A 3D4PA 3R3JA 2HAEA 4BO9A 4YAJA 1DSSG 1DIRA 4EUHA 2ZJ0A 1P1JA 1YH3A 3NV9A 4ALLA 3GHYA 2JD0A 5HRUA 4LRTB 1E5QA 5A9TA 3QSGA 3TRIA 1M75A 1ULUA 2VHYA 1X13A 4O63O 3VTFA 1UXIA 3JSAA 2IRWA 5KJCA 3W4JA 3UCEA 3QVSA 2FY8A 1BW9B 1OOEA 3ASUA 5KJFA 5A3JA 4XB1A 1Y9AA 3RC1A 5KVCA 1GZ3A 3A06A 2CY0A 3G0OA 2RAFA 2EERA 2WE7A 4H3VA 1JVSA 2VZ9A 3IP3A 4K26A 3K92A 1A9YA 1E3IA 3DFZA 4W6ZA 2WJPA 5EESA 2PGJA 1YVEI 3QP9A 1VM6A 2PA3A 4RVFA 3PHIA 1J49A 4R41A 3RASA 4YJDA 1Y8QA 3AWDA 4I9HA 4LCJA 5KVSA 4JQCA 1N5DA 4CR7A 5L4NA 5KJEA 1LNQA 5IN5A 5MDHA 5A3VA 4CV3A 3GNQA 3Q9NA 2W2LA 3ZU3A 2J5KA 4RDIA 2OHXA 4CUKA 1LQTA 2OUIA 5DT9A 2Q1SA 2I76A 3I9NA 4FFNA 4IUYA 1ADBA 2V7PA 4ONEA 3U62A 4XJSA 4E3ZA 3JQAD 4AJPA 3W6ZA 4W9NC 3NRCA 3AI2A 2JCYA 5TT1A 1H9BA 5HTOA 4PLWA 4ILKA 1AUPA 3DBHA 1EBFA 3PEFA 3H8VA 1HL3A 4HADA 1K6IA 1MP0A 1C1XB 3RBXA 4NR0A 2B37A 1U5AA 1P77A 2X7HA 1NASA 1XELA 2R00A 4Z0HO 3DBHB 5I9LA 4Z9FA 1SZJG 5ER9A 4HP8A 4J4TA 3F3SA 4LISA 2W2LD 2B5VA 1Z7BA 3HDHA 4N5LA 3VHRA 2FR8A 3DONA 1QV6A 1U3UA 1Z82A 1EQUA 3I9OA 1ZSVA 2EGGA 3JQAA 3QWFA 3SLKA 1V35A 5F1KA 1VE9A 4NBUA 1I3MA 4DTIA 1JVBA 1VJTA 1V3UA 4EUFA 5TQVA 1JQBA 1MFPA 2JD2A 1I3NA 3U3XA 4UEOA 1QSGA 3ZV4A 1NVMB 3PDUA 2PGLA 4K28A 3H9GA 4UUNA 2A92A 4MO2A 4B4WA 1J6UA 1N92A 4D44A 4OYRA 1ZFNA 4N5NA 3L77A 3JD4A 4KUGA 3GF4A 5F3RA 2IZ0A 5JAZA 5JMWA 4FFRA 4UEKA 3K5PA 1JLLA 2NVUA 2I5PO 4M1QA 1LTHR 2IE0A 4QFDA 3ZW8A 5JMPA 4GMGA 4WECA 4B79A 1CERA 2QG4A 1DJQA 2JHFA 2WTBA 5HWSA 2FPPA 3S2GA 3QVXA 1T2FA 2PY6A 3LZ6A 4NK5A 2O48X 3RUCA 4BNWA 4LGVA 4E30A 5A5EA 1YBMA 5T6BA 1R6DA 4HFMA 1YS4A 4EJ0A 4H16A 2WE8A 4B7XA 3PP8A 2WM3A 3BMCB 4RPHA 4IDAA 3JQ6A 4D3FA 4BB5A 1BG6A 3DHNA 4INAA 1I3LA 5F1OA 1NAIA 2HU2A 3LC2O 4M89A 5DOVA 1H2BA 5I8ZA 1CDOA 2PFGA 1DIBA 3W8DA 5KWEA 1E6EA 4URFA 4L74A 5JDIC 2YV1A 1QLJA 3PPIA 4BGUA 4HFJA 5BR7A 4L76A 4FFMA 4OIMA 3UUWA 4ZHSA 4D79A 1CQIA 4I8XA 2PTGA 1X15A 3GGOA 4CL3A 3T4XA 4BNTA 2QRKA 3JYOA 2EHDA 4D0SA 3MOGA 4U6SA 3H9QA 3VOSA 1NPTO 1I2ZA 4Q39A 3H65A 3LSYA 2ZCVA 1BXKA 2FPIA 3G49A 5GZ6A 5TJ9A 4ZQGA 3SC6A 4CR6A 4WPGA 4BNYA 1NPDA 1IZ9A 2FSSA 5CPBA 4IMPA 4XQEA 3TL2A 2OBYA 2EW2A 2HDHA 1XQ1A 1Y6JA 1EK6A 1Y8QB 4D46A 3E6AA 4J9UE 1JWAB 1U9JA 2ZCUA 3C24A 1TA4A 4CV0A 3ZWNA 4ESOA 4G2NA 1EFKA 1KIFA 4MKRA 1BMDA 1DPGA 1X1EA 4YRAA 1TLTA 1RM0A 3JD2A 1E77A 1I8TA 1Q7GA 2IODA 3I9LA 5TS3A 2Y05A 1FF9A 2NU9A 3DEYX 4GMFA 4HY3A 3QWBA 4YJHA 4AICA 4CQMB 3I52A 4QUKA 3IS3A 4DPMA 2VZ0A 3DB2A 3MEQA 4CUZA 2V6MA 3DL2A 1I10A 3M2TA 3JQ9C 4RQUA 3JQDA 2EP7A 4RZIA 4J91A 3L0DA 3Q2IA 5THQA 5DOZA 2J3IA 1KEUA 2DM6A 3RUFA 4BGVA 1YGYA 1H6AA 3WJAA 1LX6A 3DTYA 3GRKA 3V1YA 1LC3A 3G17A 3WLEA 3ZWMA 2GERA 3UCFA 2CF5A 2I3AA 2VWQA 1PJTA 3GVXA 1YJQA 2YFQA 2ZB7A 3GZ4A 4MKZA 2C2XA 3MOIA 5EJ2A 4NJOA 1ZK0A 3UKOA 4YRBA 3SJ7A 3EUWA 4IDCA 4QEDA 3JQFC 3PZBA 3IP1A 4YBZA 1LDBA 3RFTA 1FDSA 4JX8A 2AEJA 5DP1A 4IGFA 3T7CA 2Q3EA 1ID1A 1DFIA 3ZWXA 1OZAA 2DC1A 3GY0A 3CH6A 4BMSA 1ONPA 1I24A 3WGYA 3JQBC 4IJVA 2IEDA 2NSDA 2H1SA 2CFCA 2QX7A 4I1IA 4CM3A 4FCCA 4PRKA 4DYVA 3BMNA 1E3SA 4YQZA 1NQAO 4DXHA 2QQ5A 4L9RA 5DBGA 5L4LA 3GH3A 3BMQB 2I9PA 1A7AA 3KUXA 1X14A 4R51A 1HSOA 2EF1A 2X0RA 3DBVO 5I9MA 5CDTA 4MVJA 5GMOA 2C29D 3JTMA 1MXHA 2CD9A 4JGBA 1LDGA 3QVTA 2NTNA 4MVJH 1UAGA 4NK4A 1Y5RA 3AU9A 4MDHA 1RJWA 4GI2A 3C7DB 5CDGA 4Q3AA 3GVCA 4BMNA 1DRWA 5AQ1A 2G5CA 3QIVA 1A27A 4Q9NA 3PQFA 2QZZA 4TKMA 1DIHA 2DVMA 5IZCC 3JCZA 3I9KA 3LLVA 5JFOA 3GT0A
chains in the Genus database with same CATH superfamily
2JFVA 2AJ8A 2Q5OA 2PCLA 3GPBA 3JQCA 2M1XA 3ZDEA 5FOTA 1MHTA 1SVNA 1QTNA 5BVGB 2W98A 7REQA 3QPCA 2RARA 5F2KA 1SBNE 3P9PA 3OIYA 3OOJA 4XOUA 5EIEA 4FBMA 1XVTA 2V65A 3N59A 4MVJD 3ZNQA 2JEBI 16PKA 1J0BA 2R8RA 4WKNA 4AM8A 1PS0A 3AHJA 3ASYA 4OD0A 2NYRA 1N5LA 1QAQA 4WNAA 4MGHA 2VJAA 4RF5A 4C4PA 4LF8H 3G0BA 1MAAA 4E21A 1J4WA 3QEMB 3GFFA 1QYXA 4BO4A 3P9YA 1PGOA 3DULA 1FRQA 1KZ1A 4PZZA 1TIPA 4WASA 2WIJA 3SGLA 3N2ZB 4EG1A 2FE1A 4A2WA 3S8YA 3KV1A 1GKKA 1CNEA 4WERA 3VAZA 1KO5A 1MOPA 4DKXA 4CL2A 5L53A 1ZCJA 3DF9A 1H6DA 2GTPA 2UV8A 1RC1A 2X06A 2CJFA 1XRHA 4TVBA 4GXNA 3O1IC 1UF9A 1N3LA 3O8OB 1NVEA 4LVNA 2QTBA 2JKYA 4HLNA 3QBEA 3U2QA 1X42A 3V7WA 4R01A 2XOEA 4U0KA 2Z5FA 5FLXA 2AJBA 3V34A 3PQDA 2GOYA 1FJ2A 4FYYA 4G07A 2J0VA 4UCXA 4RSHA 3ZX5A 5DNYB 3WJ2A 4C4XA 4GSLA 4HBGA 1Y3CE 2GBLA 5FCDA 2CJXA 1DC5A 1JRLA 1V1MA 3PV0A 3ZHSA 2PT6A 5DNAA 1D4OA 2O5VA 1P81A 3AEXA 3D7LA 4COKA 2QHXA 4JI6B 2E37A 3UWKA 2I91A 1RYMA 2PRIA 4LJ9A 4JXZA 4N40A 3WGHA 3T9FA 3IUMA 4LOAA 2V4ZA 5JUWA 1E1KA 1JDSA 2CXTA 2ZEJA 5EE0A 5EXDA 4EPRA 1DEAA 3RIYA 3TOXA 3BZBA 2P9ZA 2Y4NA 1FP6A 3T7AA 3ZWCA 4EJSA 4BN0A 1XLUA 3OM8A 4P5PA 1REQB 5EZQA 4UQOA 1SXPA 2G8LA 3GBVA 5JOQA 2QYTA 3L3BA 1MGPA 1LGYA 1R5JA 4L5CA 5ELLA 2N1BA 1V8BA 3RJTA 1BC5A 5I7RA 3ZZMA 4N48A 1W6UA 1WSBA 3K4PA 4IFBA 2DTXA 1G21B 1J2YA 2O9JA 3K5WA 5AW6A 3VKHA 3WJ1A 2P2LA 3V97A 2VRCA 5CGZA 3CKMA 1SG9A 3KEFA 1A5ZA 2ZRCA 3HADA 2IU3A 3FM9A 3ICOA 3PFGA 4U7WA 4WI1A 4Q7QA 1BSVA 3T1OA 2QW0X 2JHPA 2IUEA 2C4WA 4J8PA 1WKCA 2HRDA 2I3DA 5KYTA 4YJ2A 4H15A 5C0XG 3Q3HA 3DMTA 3G2MA 3R7DA 1LNSA 1PYGA 3BIWA 3PYXA 1VYUA 5C46F 5AKXA 2DPHA 5HK8A 2WWWA 4PSAA 2GS9A 3KRTA 2XJ4A 1RABA 2BHSA 4FPXA 4IVRA 3ZU5A 4JVOA 4OFWA 1B8OA 4EY8A 4B6SA 4ZYYA 4P0PB 1UBCA 1MVNA 1ODIA 1U90A 2G08A 2YW2A 3CT6A 3GUZA 1PJ3A 4FD2A 4ESEA 4YUZA 3DQQA 4QO7A 4Z0NA 4I4TA 3X2FA 4CNBA 1X7XA 4F2DA 5EIXA 2AQKA 3LBYA 4MIYA 2NTYC 4NF2A 2B4KA 3OTIA 4WADA 1AHIA 3G23A 3GGDA 1JXQA 3NR2A 4Q4DA 4OXXA 4HZIA 2Z5VA 2DPMA 3G2OA 4DIDA 1H2FA 2B35A 2GNAA 4IG9A 2UYCA 2RC5A 1SHKA 2Q7DA 3QE9Y 2G9NA 2H2FA 4OXIA 4UOZA 3B70A 3IQZA 2PWBA 4CN9A 1DB3A 2AUTA 4NCBA 1JHOA 1T8SA 3CNEA 4CM4A 1DJOA 3TLGB 2RGEA 4G4IA 3UT5B 4DY4A 5JSFA 5CR9A 4JLUA 1E3TA 3K6RA 3EG9B 4WCFA 3OWXA 2R6HA 2JZOA 4RVDA 3RC9A 1Y1SA 3PA8A 4KQJA 4XD7D 3H5VA 1WVNA 2GM3A 2XE6A 3VR4A 5IXYA 3H0CA 3IVGA 1NVVR 4XRRA 2P9JA 1Y1TA 2YJZA 3P9KA 2Y0CA 4DLZA 2GCPA 2WW8A 2XMRA 1QBGA 1M5UA 2LVBA 1X7HA 4S1NA 4UNNA 1E1LA 2BFFB 3OHMA 1DPFA 1G2PA 1NJSA 1QH1B 1J5PA 2H7VA 2OL4A 3R5FA 1XAJA 5J2UB 3SM3A 4BLOA 1G0OA 4LXXA 1QPZA 3REQA 5IFLA 2G9RA 2IYNA 5IDYA 1WULS 5IX8A 4AY6A 5FNVA 1B8PA 3DEKA 1F2TB 4INJA 2NP6A 3DKPA 4HUQA 1TAUA 4M99A 3STTA 4DCGA 1MD9A 1MV8A 4GOJA 5GM2A 2VQEH 1CCWA 1CUUA 1LLFA 2ASEA 3FWYA 3OQHA 2AF4C 4BGIA 2HIMA 2IIPA 3DMRA 3AIKA 4FUQA 5DI9A 3VSAA 1GA4A 1Q92A 4RXMA 3U7EB 3VZPA 3V6MA 1YZQA 1PU2A 4GZMA 1MMFB 1XCPA 4N7MA 5LVAA 1XIVA 4ZO9A 5EIBC 2ZIVB 3ER6A 2XMQA 4KB5A 3ZD9A 1WTAA 1BXZA 2B2XA 3QEOA 4G84A 3LLCA 2VT3A 2JLVA 3F98A 3KQWA 2HHLA 3SX0A 2KWIA 2CLLB 4E70A 3PZRA 2W2MA 1SPXA 4MS1B 4A6XA 2IYPA 4CRWB 2WWTA 1JG3A 2YVKA 5BWLA 2AG6A 2O2ZA 2PLNA 1HE3A 1Y1PA 3HJNA 5KZMB 2H4XA 4WJKB 4B0PA 3FUUA 3THYA 1IN6A 4O1MA 1A5SB 2QTRA 3HVHA 3L7OA 2EJVA 4RE5A 4E5MA 3KFXA 4B3CA 3NBKA 4O33A 3D31A 1SU4A 2I6QA 3URKA 3FI0A 3ITEA 4AO6A 4C3OB 3W5BA 4TT3A 1E3EA 1LA2A 2VPWA 3HJUA 3O21A 4G56A 1P4GA 4L28A 3S7TA 1QGDA 1O03A 2GN4A 4TS1A 1VP9A 1VJ0A 2O8FA 3WXBA 1NNSA 4HH1A 2MSNA 1EB8A 1OUMA 1QH9A 1R00A 2HN9A 2Q1XA 3JWGA 3OOYA 1SBQA 2QLBA 4JHLA 1R12A 4RKEA 2RB4A 3GCGA 1WWKA 4LJLA 5LSAA 3L7MA 3ZCXA 2W2KA 2GSDA 2ZB3A 2FPGA 2QTGA 4MUHA 1D1SA 5DE3A 2CJWB 1CFZA 1U0OC 2QNRA 4GG1A 2UXBH 4AX8A 4DV2H 3FVQA 1MAWA 3E0QA 4II2A 5IG2A 1OQAA 3F4BA 4CQMD 2HJWA 4WBNA 2XZTA 5ABPA 1PYDA 2OAGA 4CCAA 3JZDA 2XUZA 4HNUA 3HDVA 1RQRA 2C94A 1GIAA 4XDGA 2J30A 3EY4A 2RK4A 4Y2SA 2UXDH 1CETA 1FX1A 1PUXA 2PNFA 1PR3A 2R6FA 3QEJA 3QOXA 4HEJA 5AOBA 5LB4A 3FKJA 1NW8A 4MHSA 3OESA 4QJ4A 1KS9A 1ZI9A 2XB6A 3NUQA 3OQ1A 2D13A 2RHMA 1KI4A 4HDMA 1RWBA 3Q6IA 1I7QB 3U7HB 3INGA 4QULA 1J20A 1XRJA 4IXDA 4OSOA 4PYQA 1RAAA 2XD4A 2GZSA 3DZCA 3EPLA 1ZGJA 4DCPA 3T54A 4AYXA 2XB2A 5KSPA 3BTVA 5DLEA 4IOJA 1KFBB 3PNLA 1F4LA 2ERCA 3D4NA 4J1QA 4RUKA 3HNRA 5G4KA 1PKEA 5TMPA 3LP8A 4RY2A 2WILA 4FQ7A 5ECGC 4JLNA 2JLRA 3RF2A 1PR2A 1TAGA 1AHNA 1Y6ZA 2ZT6A 4IRXA 3P97A 3T0GA 3AKEA 5JCZA 5L7TA 1P0FA 2H7XA 2CWWA 1G1AA 3UMCA 4JHXA 1YIDA 1LSOA 1ZWKA 1P2GA 2WYVA 3MXTA 1SXJE 3OCZA 4ZXFA 4EW1A 4XUCA 1LW6E 3HU5A 4B6JA 5IU6A 4MKGA 3H8WA 1GZ5A 2XIJA 5AVYA 1NJ1A 4P5DA 1GPLA 2BKVA 4KK4A 4LFAH 2H7CA 4L2IB 2GDJA 2J3KA 4MUIA 4N3NA 2RAVA 4ZOBA 4D3XA 1DKQA 1W73A 1IHOA 2BZ1A 2XTJA 2IU6A 3I45A 2NAFA 4IZ6A 5UKDA 3WS7A 4BASA 2HR1A 1N6LA 3KDGA 1JG7A 1H5UA 2KB0A 2QP3A 3PQ3A 1Z15A 4R4JA 1FFXA 4O2RA 2H8GA 5AR1A 4IGIA 4NBKA 3PQEA 2BMAA 3MWKA 2LE0A 3IHWA 1LY1A 5EL0A 5LDHA 2ZRMA 4DV5B 1YCHA 1E5LA 2ADFA 2WHPA 4PPQA 5K20A 2V9PA 2XVYA 2X8WA 5CA1F 5DNCA 3BD9A 5FWXB 2QNDA 3D3KA 3QHQA 2PRYA 3X1YA 1CRPA 5KYUB 2FZ5A 2QL6A 2J5QA 1DWQA 3D8RA 4WGFA 5CH5A 2YWJA 4EO9A 2WUFA 2MYTA 2ZB8A 3O3CA 3SE7A 5LXTA 4ZT2A 3HUEA 3MJEA 1ZD9A 3WGTA 4OTZA 2ID9A 3KHTA 1VRVA 1GVHA 4S1WA 5EP2A 3RUIA 3BREA 2EARA 4J0EA 2HK6A 1BH6A 2NYUA 3GLHA 5DMXA 1P7ZA 1Y8CA 5CT9A 1EFPA 4URXR 5EJFA 1QQ5A 4G86A 3UNXA 3TFOA 2HHHB 4NCNA 3FYTA 5IAEA 5LXTB 1FYFA 1QNFA 4N1AA 1CZRA 1WUIS 2AS0A 3AFMA 4GX2A 2ZTHA 1B6TA 1C3OB 1I4DD 2VRNA 1N8KA 1BEEA 1P2UA 2GAOA 1N6RA 2QAJA 4BX2A 1O97D 1S2DA 1NC1A 2C31A 3JRNA 4DVGA 1P39A 4LFBB 3DOUA 1Q0LA 2YFYA 3R4CA 4RPIA 4QLBA 3E7DA 3OJ0A 3HJBA 1D6MA 5JNWA 2BONA 1H2WA 4PF1A 5EMJA 5T64A 3RHZA 4MV5A 3C1UA 2D2FA 1EVJA 1KYWA 4BB9A 1VFPA 3EAGA 2FP4A 4WZZA 5H7XA 3ACBA 2VPTA 3I83A 2AN9A 1H2AS 2C3MA 4KLNA 3UQZA 2H2GA 1QYWA 1PEDA 3DDHA 1L8QA 2ILTA 1DNPA 2OFPA 2B82A 3CYFA 4GD3Q 3W3AA 2RI1A 4CMIB 3FB4A 3UZUA 4YRNA 1VKOA 1C2YA 2UKDA 3FPAA 3T3IA 4DLAA 5AFSA 1BWSA 2J67A 4Y98A 3TQOA 3NONA 4Q1EA 1OB2A 2WIAA 2AKYA 2P2CA 2GXSA 5FOXA 1SCUB 1ZM4A 2PU7A 4WVLA 4RLQA 4R83A 3VBCA 3FSRA 1R0LA 3ESDA 1FUUA 1GITA 2FPKA 4N82A 5EQJB 2ZYTX 4KFRA 3E18A 3R3UA 1TNDA 4PZ9A 5THKA 2TS1A 1K8ZB 3EIWA 2Z6QA 1NVFA 1B0AA 4R3NA 2FJUA 3UAGA 2ISQA 1SBHA 1M73E 3AO0B 1T0BA 1E6KA 2VDQB 2NTVA 2XSZD 2NUTA 3V46A 5BQFA 1YA6A 3N7TA 3L7LA 1UC8A 4GP6A 5KQGA 5CLHA 2FXVA 4TOIA 3FGPA 1JG1A 2VH5R 2MINA 5EXTA 2F9MA 5HJ7A 1XZBA 3TECE 1NQUA 3PI6A 4HTFB 3I42A 4RNDB 4DC9A 3RYCB 1GQ2A 1XXLA 3QVJA 2RK3A 5A71A 2ZPUA 2B6HA 2CVZA 4JEIA 1R8XA 1SA0B 2A5DA 4FOSA 1QHHA 4D3YA 4LJ7A 3GDGA 5GJCA 2XNSA 1J8MF 3VKFA 2ZDHA 1KEEB 3UK6A 3SWWA 1PGPA 1EFVB 3G6WA 1A5BB 4EMUA 4B3RB 3AY3A 2YDXA 1SHJA 2GN9A 3H1AA 3VDNB 4BKQA 2J87A 3HVJA 1PVOA 4DADA 4ZQFA 5LJIA 4F5WA 1CUIA 2JIBA 2OTCA 2JFZA 3GLFA 3QU7A 1CUXA 1C81A 1KR5A 3X2EA 3OWHA 4AVYA 3FOZA 1DFGA 3SBOA 1Z0ZA 2ZYVX 4I1RA 1VYHA 3O8LA 3T5MA 2YTZA 4KZKA 5IKMA 5EIFA 1A8PA 2D2VA 1MW9X 2JAWA 1G16A 4K9RA 1BWPA 1WCIA 1MIHA 1OAOC 1R6TA 2DY1A 2LBPA 2YJ4A 4NYJR 4IJMA 3DM5A 5F35A 2GCOB 2F8TA 3ROFA 4FB5A 3QPBA 2OZLB 1G8MA 1L5VA 2AFHB 2VT2A 3DKIA 2FR1A 3O38A 4NJMB 5C8VA 1FKAH 1B26A 2WJVA 1MVOA 3AF4A 3HJCA 4QATA 3ZX4A 4XWAA 2ARKA 3R75A 1TCAA 2YVLA 4RDCA 1CW2B 4UDOA 1E61A 1WKBA 1FDWA 2HLPA 5CK5A 4CGYA 2Z43A 4JYBA 2ZSUA 2OCIA 4KWCA 3WADA 3BH7A 4R1UA 4DCCA 2KMLA 3PTZA 3E9MA 2AZMA 4PZDA 5E6SA 2FZWA 4G5RA 2IT1A 5HJ5A 3ZV6A 1T91A 2HSJA 4MUFA 4P36A 3OY2A 1PJSA 5J5VA 5AJVB 2WV9A 2F17A 5ALQA 3DV9A 1YV9A 4BTLA 5I5EA 2VBFA 4GUAA 2ZDGA 4CTKA 4EGQA 2GKGA 3KTOA 1R8SA 4RW0A 4KPUB 1ORRA 2H1LA 2ZJ2A 3CRVA 5EPOA 1E9RA 1DARA 2YQ5A 3VVCA 4MV6A 2PY9A 2V55B 4RL6A 5IT4A 4TLEA 2NG1A 2L17A 1TM4E 3QPAA 3PYLA 4MX8A 4CG1A 4CM8A 2ZSKA 4DLBA 2HBYA 2VYNA 1R0XA 1QE3A 3VNVA 5EP4A 1R88A 3R3YA 3THXB 1PW7A 2HQBA 5AHOA 4JKYA 1CWUA 1X8JA 2OR3A 3GARA 4KAAA 1T4DA 4KOAA 5C5CA 5ALEA 4E5DA 3E3MA 1XHEA 2JGIA 3W1WA 4F7DA 4HNGA 1TUBB 1SIBE 3VVMA 3UF0A 1M2EA 4QKQA 1MR3F 2AMJA 4Q4AA 4Q9AA 1QZXA 2YOHA 1IWPB 4J29A 2BKAA 3BQMB 4BYGA 3G13A 3BM5A 2HUPA 1Y3HA 2QTMA 3ZIAA 3NEJA 1J99A 3M34A 3ZKAA 2EX1A 2IYOA 2BKLA 1XQ6A 4JH0A 1KRXA 2RHRA 1XU9A 4Z7JA 1DBPA 2A9RA 3QOFA 4FHCA 3FAKA 4RVSA 5BNWA 3QXSA 4GPD1 4YAOA 3GEBA 3NHLA 4DCVA 4M1OA 5KYWB 2Y1FA 4OMDA 2GF9A 2WLTA 1TYEB 1D1TA 1MAVA 1R8JA 1T3HA 4KL8S 4X64B 1US8A 2QMEA 1PL7A 1MEOA 2IZ6A 3QVKA 4KFSA 4Z86A 3AUYA 1RQPA 4E3WA 1H5NA 2ZIWB 4JI6H 4BFSA 3EPRA 2Z6VA 4YJFB 3DAPA 1FL9A 4E32A 4A23A 4DMLA 1O0BA 5BN4A 1AZSC 2C3OA 1WMDA 2VA9A 3KOXA 3NNNA 4H6WA 3KR0A 4MTLA 1A9QA 2BCGY 4WEOA 1SHTX 2JI6A 5AI5A 4BZPA 2JEYA 4X3OA 2OLJA 2VTVA 2OUKA 3GMSA 3OIDA 3BCHA 1YR8A 1UBTS 3P9ZA 4H4CA 4B3RH 3QHAA 4ZIRB 1BMQA 2V7UA 2LIVA 1YZLA 4Y1FA 2EP8A 2HY7A 3DKVA 3OC0A 5FT9A 3S8MA 3OQPA 1BMFD 1EUCB 4A91A 4ECEA 4EATA 1K6XA 5T4FA 2ZYHA 3PYMA 4OQEA 4CHTA 4YRTA 3TJRA 3TXAA 4M0KA 4WBSA 3MLEA 3RV3A 5U4XA 5LWHA 4HD8A 4A73A 4AAYA 3TIIA 1RJDA 2HC9A 3ZLBA 3IKLA 1LRJA 3B36A 1YL5A 2FE4A 4DEVA 3C4VA 3THSA 1VPLA 1L5RA 4BWYA 1A9XA 2AQ8A 1J21A 3LTEA 3QYFA 1GQFA 3JY6A 3A6JA 3QKSB 1GRQA 2ZI4A 1ICIA 3SVTA 1IZ7A 4W5HA 3PWZA 4JUCA 4DXAA 1GPUA 2NU8A 1RHRA 1RT9A 1C8VB 1MENA 2G9ZA 1J2UA 3G8CA 5DRYA 4R16A 1EDDA 1YVDA 3IRUA 3JALB 1SY7A 1RYBA 2DUNA 5F1YA 1SOWA 3TQQA 4MEBA 1VBKA 3OETA 2FWRA 4N65A 3UXYA 4L4UA 5CG1A 1G8SA 2ZJAA 3KB6A 1SKYE 2O2XA 1E20A 1FX0B 1VSUA 2Z5LA 4Z3OA 1TQ8A 3PR1A 3W79A 1NVAA 4LRUA 2PX6A 4C4OA 2DQZA 4FFBA 1XVIA 1E1MA 2NZXA 2WZBA 3PL1A 4RX1A 3RSGA 1WEHA 5ESRA 1L8OA 2FGJA 2NVUB 1OFUA 1H85A 5A62A 1EP3B 4WJZA 4NZYA 1NM5C 1XLWA 1Z8FA 4G4JA 4MLDA 2VF8A 4WZAE 2POQX 4JIGA 4DWWA 3KKNA 4ENQA 3IT3A 4ZMSA 3H83A 1V45E 1VL6A 2E4XA 1T8RA 1H65A 3OZDA 4FQ5A 3VSDA 1A77A 3OHSX 4Z4FA 4LXYA 1EPUA 2B4TO 3RTEA 2JVZA 2FFMA 4AI6A 1T3LA 2FWIA 5FF9A 1GNQA 1Q22A 1YTUA 2A9QA 4X65H 2B20A 2ZWAA 3DT6A 3WSWA 3PDIA 3FTNA 3H18A 3K30A 4Z9AA 3RDPA 3RS3A 1SU8A 1E2EA 3WL6A 2A5YB 4ASUD 4C03A 4A3SA 1R2QA 2W6MA 5A02A 2KX7A 4PQRA 1VIVA 4KIFA 3UMVA 5JYDA 3CRZA 5KTSA 2EFDB 2Z8YA 1UBLS 1V39A 2XMCA 5AVXA 4CTJA 2HW8A 4F56A 2C3UA 1IVSA 5JE8A 2HK8A 4JP8A 3RVBA 1ZJ6A 2BRUC 4W99A 3F67A 3OF5A 1KI6B 1MEEA 1Q21A 3Q12A 1JWLA 3VYTB 4XJVA 1D5WA 2HD4A 1YR1A 4GX1A 3C6ZA 1VL8A 2D7DA 5DBEX 4DPLA 3UW1A 4J1NA 5LM3A 1GYQA 5ICMA 1X7DA 3IODA 3AW9A 4S2EA 1T9HA 2VAPA 1A76A 3QXGA 4GM4A 2UYGA 3IBTA 4NJEA 4CMBA 4EYOA 5BUQA 4Q1FA 1T4CA 5CRIA 1OY1A 2X3UA 1T3SA 3IYLW 1A82A 4M46A 2PS9A 4WKBA 2IYFA 1XEWY 1AHPA 2DSTA 2G77B 3C3PA 1N77A 3W5HA 1C8KA 2FU5C 4ZZ2A 2J3HA 2VQFH 1UZLA 2J59A 2P5SA 3CJRA 3H0EA 3KZNA 1S1MA 1ZC4A 5TGZA 3IEKA 3PPYA 2X13A 4ZHQA 3DB1A 4C20A 4JI0B 1QVRA 4WXRA 3LOQA 1S89A 3VUEA 1COWA 3C3YA 3FUXA 3LC7O 4M9QA 2WIFA 3L5OA 4CIDA 2H9YA 1P6QA 1W88B 1P7YA 3CLHA 4IQGA 4P2BA 3ZWMA 4BFLA 4ZCPA 1AS2A 3SQOA 3SR3A 4Q9KA 2BFPA 5G53C 5CDSA 4NCXA 1N3YA 4O4JF 4X54A 1P9WA 2Q0XA 1CS4C 3RYIB 2QW1A 3S2SA 4TMFA 2VLIA 3R7SA 1XU4A 2XUAA 4CKZA 3ID6C 1FMJA 1FC0A 1EZ1A 4G4GA 3INNA 1RXSA 4L9SA 4PQEA 5DHRA 5A3RA 1L4BA 2QGFA 4K6KA 1R6AA 1R0YA 2PPVA 3HFGA 6ABPA 3GJRA 3B9RA 3OFND 1C1DA 4PWZA 2C2KA 2EIXA 2AA3A 2IY8A 4NEGA 4N49A 4HO1X 2VA8A 1R4ZA 3NZEA 5LA6A 4HZGA 3N53A 3BDIA 5DTQA 3AB3A 3THXA 4I14A 4UJ5A 1E2GA 2N75A 4KR9A 3LT1A 3S2EA 1O0SA 3CURA 1J0DA 1JMVA 2G76A 5TV2A 4ZK2A 4DLKA 4EPYA 2Y1DA 3S29A 1M76A 3DVAB 3W04A 5K6AA 3CLRD 2AZ4A 4DA9A 5T8KA 2QU7A 4X6YA 2X9NA 4PONA 1GNVA 2Z2KA 3NB0A 3V4ZA 4HOYA 3D6VA 2NXNA 1Q6YA 2I2AA 1WU8A 4B6RA 3MJRA 1GTSA 3NQ41 2F1JA 4CDNA 4X62B 2ZVPX 5I6DA 4ALMA 1I2MA 2YWGA 2BMEA 1CE8A 1YB1A 3MT8A 1QIKA 3Q7QA 3TD2A 1CUJA 3D7MA 4UZFA 2G04A 2PKQP 1AQ6A 2CLCX 2J6CA 2XNDA 2ZRFA 4MWOA 4PGGA 5F51A 2CMHA 5TB5A 1M0TA 3FZYA 4Z99A 5ERYA 1IK6A 1CJBA 1QGUB 4O25A 3TLKA 2F48A 5J9FA 4E46A 3KR9A 5ED4A 2O2EA 4GP7A 1OFVA 1IOZA 3RAJA 1OA0A 1CEEA 2BH9A 2ZKIA 4RVHA 4EA7A 2ZJ5A 2UDPA 1QP7A 1PR4A 1M74A 1LK7A 2WD7B 3A3KA 3H9BA 1ZLXA 2VN8A 3E8MA 1V8CA 4RDXA 1VHJA 2A9OA 2F3SA 4N3CA 3OTHA 3I62A 4WEQA 4KO4S 1V6AA 4LOKA 3WLHA 4B2LA 3U7QA 3DEIA 3EW9A 4LF9B 2JF0A 3B1KA 3H1PA 3K05A 3M4ZA 3QM1A 2X0DA 3HG7A 1R0SA 5KOHA 4GKVA 3FX2A 1NBMA 1T9KA 5DM4A 1QYVA 2HX1A 4JP3A 2R7MA 4XPZA 2TSYB 3EAQA 5FUBA 5IP5A 4E08A 3PTLA 3DD5A 3WMRA 1U1EA 2BKEA 4TXJA 5JRDS 3T5CA 4MHTA 4UTXA 3WGVA 2QPAA 3EA5A 1OA1A 1UMBA 4H1VA 4KMOA 4PQGA 2JAUA 1K92A 2WD8A 3GLSA 5JSUA 5L3VA 2R3SA 1P0QA 1LJLA 1XROA 3AL3A 1OTHA 2QTNA 2BFFA 3EW7A 3H8JA 2BA0A 1PL8A 3LPAA 5G0UA 3QNUA 2VJLA 2XWSA 3FNFA 3KE8A 1VPEA 2F9LA 5EUQB 3R7LA 3SQNA 5JJBA 1NOKA 4DR4H 1QLHA 2VSXA 4TM8A 4Q0MA 1U11A 1ZH0A 1ECCA 4NQZA 3WTCA 4F11A 4YUAA 1NJ5A 4ZALA 1T35A 4Z6KA 3WYDA 1BCRA 4C0XA 5HJEA 1Z7GA 1WSAA 4X24A 1D7OA 1QIMA 9MHTA 4MINA 3DZDA 2CZQA 3DHWC 3LQ1A 1L5HB 2NTEA 3L0BA 2HDNB 1RVDA 1OYYA 1T9GS 2ZSAA 3Q9SA 3E03A 1ZD4A 3IB3A 3FWKA 1J5XA 2QD4A 4MP6A 1UOQA 3LMKA 2OVBA 1JILA 2Z2IA 2PGIA 1W76A 2Z98A 1Q20A 3WP1B 1P4HA 1R3UA 4MB6A 3O84A 2G06A 1YK0A 1LV8A 2PUVA 1QO0A 2PKQO 2QX9A 2E3UA 3JQAB 4HGOA 3NT5A 3TSWA 1HL7A 5DP2A 5JAHA 5KTTA 4FYPA 4U7GA 3T8YA 1WE8A 1SUFA 3GUUA 2DWQA 3LX5A 4K05A 5AXCA 4WXYB 2WF9A 4TWRA 3T1YH 1I01A 2ZATA 5ADVA 1FFAA 2WC1A 1KZ7B 1PZXA 1SEPA 3GAMA 4G2TA 1D8TA 1JBQA 1WNFA 1WPQA 1C7ZA 3OIWA 4QTXA 2IYAA 1SQFA 2YHIA 3CLSD 2JJ2A 1PR1A 1U4NA 1UBUS 2IC5A 4KAJA 1AE1A 2LZ0A 4MKIA 1E89A 3SXJA 1Q16A 3UAYA 3PGA1 3OEYA 4X97A 4DR1B 1PHPA 4Y6SA 5TF4A 3USCS 3U1BA 3BEDA 1CJSA 1SUEA 4KHZA 1XKTA 1QO9A 4K9QA 4BFYA 4Y67A 4BNZA 4BPRA 3LRPA 3U19A 2V03A 4V0LA 4DLNA 3ABZA 4L5YA 3KAKA 2O8EA 1I30A 1M6WA 1S2IA 2Q4EA 4YASA 3U7JA 1TCUA 4F2PA 3PB3A 1L7VC 2O3UA 3GT3A 3HJHA 2DFPA 3E5HA 4IVQA 2VHVA 4ENWA 5A9RA 2HMVA 1KAMA 3Q0TA 2CBXA 1Y89A 3FCOA 3I1YA 4NMWA 3LI2A 3CE6A 4PBTA 3UMRA 2ZRJA 2RH8A 3ZK7A 3O8RA 4PR3A 2P6PA 1USIA 4IDGA 2C95A 2C54A 5LNK1 3NTLA 4I1OA 2XUGA 3IMCA 1Z5WA 3L82B 5DSZA 5KU7A 1U7WA 2IEBA 2PLWA 1O89A 3P96A 4QYWA 3U4HA 3DZKA 4Y9SA 1Y4UA 3REQB 3MWFA 5AD1A 3UN1A 4CLRA 4N9QA 1H05A 4J0DA 1AV6A 4MVJP 1WVMA 1KFKB 2J4DA 4TKUB 2D5LA 4DIOA 2JGRA 1E2FA 2K4MA 1QB8A 5BP7A 1RC8A 2Z1MA 2AOXA 5FYQA 2C07A 1QOZA 4JQSA 7MHTA 3UWOA 2FPUA 5ANRB 1UP4A 3QTTA 2NNLD 4MQFA 4UU8A 3CUKA 2WD9A 2EGHA 1J90A 4Q7LA 1AGNA 3W6OA 4BNVA 1T1RA 1T9CA 3D4LA 2ZIGA 4FFVA 5KQRA 3L4EA 3E2MA 5J40A 3EZ7A 4D6YA 1GPH1 1K4KA 4OAOA 3C8HA 4RHCA 1T5IA 2CDRA 1A4XA 3P0FA 4GRIA 5LZ8A 4DV4B 4DR2B 4UXJA 2J45A 1KO1A 4JDUA 5BSEA 1TEVA 2BFEA 2WWRA 1V71A 3F6RA 4BX0A 4O08A 3NS7A 5DX8A 1GY8A 3HNPA 1EWKA 4RZXA 4C87A 4F1WA 1GTRA 1Z5NA 3V2GA 5P8WA 1PZEA 5ALPA 4AIMA 1Q1AA 4GXQA 1WDKA 3R1IA 1NUPA 1DEXA 1LVHA 1W4CA 5ALGA 2YC2C 5DW3A 3NP9A 3V8NA 2AFIB 4YRDA 4Q19A 1ZJWA 1NSYA 2HO5A 3K16A 4F4HA 2C59A 1Z62A 5EGNA 4B8YA 2XKJE 2Q5QA 2FW7A 3CIOA 2P69A 3H2KA 2J9XB 1SXGA 1D2NA 1F1BA 1FDTA 1SCKA 2H48A 3FDZA 2CMKA 2NU8B 1DTSA 1PJCA 3HU3A 5C51B 1AMNA 3VYVA 2MSCB 4C0BA 2W0MA 1GTMA 4MXDA 1U5BB 4QD3A 2XF8A 3UWSA 1LDYA 3DMFA 2I3GA 4YROA 5FPQA 3ZDXB 4C7MA 3ZD7A 3R6LA 1BS2A 3BXGA 3PLRA 4F04A 2N9UA 4PHFA 3MLAA 4BNMA 4JQOA 4MQ4A 4QJIA 2UUOA 1DO0A 5IJAA 1XTSA 5M34A 1UJ6A 4JY7A 1N4AA 2QQGA 4TTQA 3KDPA 2PUWA 2ZE5A 3D8HA 4PSVA 4AUNA 2VC2B 1F0YA 5LQUA 1NIJA 3CUUA 3Q5GA 1EP2B 5G2OA 2TMYA 4MCAA 5J59A 2HCBA 2YHAA 5FB3A 3T7IA 1DUVG 1PSDA 1Z6XA 3AHEA 4LC0A 3EEFA 3DTVA 3FUVA 3OSUA 5T3YA 2ONKA 1RR6A 4NEHB 2NADA 3LUAA 3K0BA 3NM5A 2GBFA 3ROPA 2QMHA 4FD3A 4W7IA 1OT3A 3UJCA 3I61A 2I7DA 1Z56C 3SMQA 3KSDO 3NWPA 4FFLA 3QXHA 2FA9A 1PR5A 3NBAA 4MA4A 3SSAA 3NASA 3AUUA 1MT0A 1PR9A 1Z2CA 2P4HX 4EFMA 2XOKA 4KDRA 4H08A 4WY8A 1QM5A 4H60A 4KP7A 1ZPDA 1SKAA 2ODAA 5F64A 5JPDA 1NQXA 3WXMA 2CXRA 1WZ2A 2C7RA 3VPSA 1CRZA 4BA1I 1KKMA 4FFOA 1T1GA 3VZQA 2JJ1D 5FI3A 3ROEA 4BVAA 2C4MA 5JRZA 3CB2A 3L1JA 1FPMA 4FVTA 4E2ZA 4I6JA 2J4FA 3H97A 3NAZA 1OHHD 1DTWA 2YMQA 3A1UA 1W4LA 2R11A 1Z29A 4HFNA 5FNZA 4YPFA 1NUHA 3FHCB 3IAFA 4CIXA 5FL7D 1XR3A 2B83A 4IWNA 5KYYA 3FNEA 4BNGA 1KMNA 1OBHA 1QHHB 1NE2A 2JPDA 3NHPA 4GYWA 3T7JA 4D9NA 4BP1A 4KBGA 4TUYA 1ZU4A 4MQ6A 1Q7TA 3DXZA 2D54A 4GVPA 1Z34A 3ABSB 1KEWA 3MJDA 3KS9A 2YIDA 1JUDA 4AMGA 4GR9A 1O5OA 2VCYA 2ZIEA 4OQZA 1PDVA 3M9XA 3NORA 3DL0A 2ZR0A 2WU8A 3HZRA 4YREA 3AY7A 3LGXA 4EK9A 3UGJA 4WXHA 2I7CA 1PLKA 4ETNA 1UPCA 1FSSA 4JXJA 1FLVA 5LCXA 3FYDA 1NLFA 3T06B 2AR0A 4ZQCB 1Z25A 4U2FA 3TGWA 1OZHA 5JRJA 3GAZA 2GPAA 5CEJA 3BMOA 1V25A 2A1UB 4O5OA 3EZGA 4KTVE 1UH5A 3H6HA 4F6RB 5HM6A 3BTOA 1P9RA 4P7GA 1N0UA 2HF8A 1UJMA 1I1OA 2YNMA 1Y0BA 3JX9A 3ADDA 1HR0H 4URZR 1N5KA 4IDOA 4CEJB 1SUWA 2F3TA 4HN9A 3A1DA 3H9JA 4WNYA 4KG7A 2XZLA 3ZHOA 4ZVLA 1XZLA 3U37A 3CG4A 4J7UA 1SBYA 2AH5A 2ATXA 2PXXA 1TT5A 3CA8A 4EELA 5I7SA 5JT1A 1SKBA 1G8HA 2AYYA 2P78A 2HFJA 4Q1CA 3A36A 3TBKA 4YMHA 5KOJB 5KBYA 3H86A 1PT8A 1KAHA 4PLTA 521PA 2C0QA 1DIGA 4OQPA 1H4SA 2D8AA 4ZAGA 4N03A 1YQEA 1J8FA 4D92A 4EHNA 1G8JA 2W2PA 4OUDA 3AESB 1WHTB 1WLSA 4U6QA 1KVSA 3O82A 3M1LA 4LE1A 5DNEA 1L5OA 3ZPXA 1IB6A 4R31A 1RWPA 3ELYA 4JJIA 4GGMX 1CK4A 3ROTA 4UC0A 1H5QA 5KVVA 1Z2NX 5EZYA 4UTVA 4H18A 2RJNA 2O52A 2ZSFA 4LFAB 1G17A 2ZS8A 3ORHA 2DR3A 3PFBA 5IZ4A 1YR2A 1UDWA 4QUGA 1V5WA 1SKQA 3GEGA 4ZAWA 2JA2A 5K03A 1OI2A 2R6ZA 1X7XB 5K6AC 4DA0A 2F3UA 1RM4A 1IHUA 2GJ4A 1GSHA 4ZV9A 4AB1A 4DOMA 2NLOA 4BNLA 3SHVA 1PHRA 3AG6A 2VSNA 2PZAA 1UJ4A 4AUKA 3PD1A 4Y1GA 4WFJA 3WA7A 2CLHB 2C42A 1N2IA 1E9EA 3L6EA 2D3TA 3H1BA 1HV8A 1QK5A 1V2GA 2IIBA 3A9WA 4GI5A 5F33A 1UBSB 4BMPB 4XGKA 2C5SA 3ISTA 1CLUA 3LP6A 4XDZA 3VOAA 1F48A 3BJRA 4BO8A 1JKJA 3K35A 4R7GA 3L8MA 4AULA 3FPFA 5COAA 3OZIA 4GLOA 3X44A 3ECSA 2ZBPA 3M5CA 3LT0A 1JQLB 3QYJA 1L1FA 3UAWA 4RJTA 4UXIA 1KHTA 3KYDB 4AWAA 1Z4KA 1GRNA 2E4UA 4NBNA 1YI0A 2XRYA 4EVRA 3RQSA 3A6HA 2Q50A 1J09A 3HDQA 3GMDA 3K6SB 1G3UA 3ENZA 4ALNA 3ND7A 1XVVA 3QLJA 2F3RA 4WBNB 3ZLJA 3SJAA 3FTDA 4UUMA 5LMNB 3PEUA 3HWRA 4EHIA 4YMGA 5LYYA 4EUSA 3FBGA 3H0KA 1JG6A 1KDRA 4XAQA 4E07A 4EHHA 2FETA 3JPYA 2D62A 3K20A 3R44A 3NHAA 3KOWA 4O02B 3V4VB 4ZGWA 3EOBI 5FA6A 1ACMA 5BXQC 3UFXA 4O4LA 1KRHA 3GZNA 3R5XA 4MI6A 4FYKA 3RRMA 1PJBA 1U0LA 4KXFB 2WNIA 3K1ZA 2YJGA 3F74A 1U8TA 3NP7A 4GR4A 8MHTA 3O2QB 1YQGA 2JCBA 5DN9A 1ZUNA 3WWCA 4S1VA 5I7EA 5AIBA 1GUFA 4KQKA 2ZE6A 3SY8A 1FDUA 1KARA 4BX9A 5LFAA 1FTQA 1RS0A 1ODFA 2TMDA 4JOBA 4JR1A 3OA0A 4ZWNA 1MLDA 1M83A 4X20A 3BTSA 1UXKA 3ENNA 4A36A 1P3DA 2LW7A 1O97C 4FN4A 2QMZA 2QN6A 1QHEA 2ID8A 4YUYA 1U63A 1PS9A 1SN7A 2DQYA 1SXJD 3FBWA 3F2VA 3OLCX 4FOOA 2EKLA 3K0FB 2R4TA 3I5YA 2HHHH 3BL5A 4EEXA 1Q1ZA 2HCJB 1RPTA 3AIMA 3DV2A 2Q3MA 1NAHA 1YHNA 3HKBA 3TZCA 1R18A 3NBQA 4Z5XA 4UDYX 2JG3A 4AJLA 3FXAA 1RYFA 2C0CA 3HCEA 3M8KA 4GF5A 4J7AA 4IJWA 4QJBA 3STHA 4P3YA 3WLAA 1HGXA 3O47A 3HYNA 4A03A 4P7KA 4FZJA 4HAIA 1GD1O 4TTIA 4Z2AA 3I09A 3HB9A 4X92A 3P2YA 3TIVA 1QH0A 3NHJA 5HUHA 5JCXA 3G9UA 2NO6A 3HYLA 3KJZA 3QHPA 4NV1A 3JQPA 4WACA 3KKKA 2W6OA 3SDZA 4RANA 1FXWA 1NYLA 2GRJA 2F8LA 1XMSA 4DLTA 1SMKA 4Y2HA 3UHAA 3U61B 5TDHA 3ZXXA 1I94B 4QUEA 3ZVMA 1R9JA 4ZU3A 1QVVA 4UMEA 2BFEB 1AXRA 2Q6IA 2HA2A 3DCIA 4HYQA 4RS3A 5EINA 3MUEA 1W44A 4P5EA 4D7AA 4P3KA 3RFFA 3SQLA 4GLFA 3ZHZA 3WLMA 3KWLA 3NTOA 1P29A 4ND5A 1BS1A 4DIMA 5ARBA 3D6FA 3ZOKA 4RK1A 5EQFA 3NHKA 1GZ7A 1NW9B 1ND6A 1RXIA 5TQ0A 4WQMA 3ZG6A 3A4NA 1HLGA 2EGUA 2M32A 3N1UA 4YP1A 5KINB 3JU3A 3WBKA 2B30A 4JL5A 4FSHA 4MI1A 3UXMA 2YRFA 4AT1A 4HL6A 2C5EA 4W8GA 4EBBA 1ZVQA 1CU1A 3EVEA 1N36H 3GELA 3L07A 5ITVA 1R4NA 3ACCA 3F78A 4H6PA 1N34H 3GJXC 4CIWA 3UAZA 3IJRA 1AN7A 3CO0S 3GPIA 1HKUA 1JKXA 1QWOA 3A9CA 4ID9A 4JGGA 4UHCA 3TVTA 4ZI5A 5EUBA 3EMKA 4W1PA 3V5NA 3RCBA