1PQXA

Solution nmr structure of staphylococcus aureus protein sav1430. northeast strucutral genomics consortium target zr18.
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
91
structure length
91
Chain Sequence
MKIISISETPNHNTMKITLSESREGMTSDTYTKVDDSQPAFINDILKVEGVKSIFHVMDFISVDKENDANWETVLPKVEAVFELEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords conserved hypothetical protein
publication title Solution Strucutre of the Hypothetical Staphylococcus Aureus protein SAV1430. Northest Strucutral Genomics Consortium target ZR18
rcsb
source organism Staphylococcus aureus subsp. aureus mu50
molecule tags Structural genomics, unknown function
total genus 10
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2003-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08712 Nfu_N Scaffold protein Nfu/NifU N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Scaffold protein Nfu/NifU, N-terminal domain 1pqxA00
2K1HA 2M8WA 2LTLA 2M6QA 1PQXA 2LTMA 2FFMA
chains in the Genus database with same CATH superfamily
2K1HA 4DR4H 2O4CA 4DV6H 4YY3H 2CPMA 4H8AA 4DV3H 2VKCA 4JI4H 2OPUA 2JA9A 4B3TH 2LTLA 4JI0H 4B8TA 2M6QA 4JYAH 3EZJA 2NN6G 1AN7A 1VIGA 3J80W 4DR2H 4JI1H 3QD7X 1WTJA 4LF8H 1ODHA 5LMNH 3KDGA 4LF6H 2JEAI 4B3RH 2BA0A 1V9NA 2X06A 4OD6A 2AXYA 2HHHH 4DR1H 4JVYA 4LFCH 1X4NA 3JAMW 3GABA 5FLXW 1XNRH 2M8WA 5LMUH 1HNXH 2PQUA 2JVZA 2CWHA 4LIJA 2UU9H 4B3MH 4JI8H 2G8YA 4NZRM 2P2RA 1J5EH 2VQEH 1WVNA 3GKUA 1HR0H 4WALA 4AIMA 2JZXA 1HNWH 2ANNA 4KHPH 4X64H 3NCVA 1MSZA 1S03G 1UG8A 4NBQA 1VBIA 2OPVA 2CTKA 4DV2H 1WE8A 3T1HH 4E9JA 4X65H 5JEAG 4LF4H 1N33H 4B8CD 2CWFA 2UXBH 2E5LH 2F4VH 3GR5A 1I94H 2LRRA 4JV5H 2CPQA 2E3UA 4PDBA 2FMRA 2HH3A 3OSSD 3AEVB 3U1KA 4NZTM 1IBKH 1X0AA 1DTJA 4DUYH 2ZQEA 3I0PA 4IFDG 4JI5H 3V69A 2JEBI 1TUAA 5DT9A 2ANRA 4JI6H 1XNQH 1EC6A 2Y3MA 2BL5A 1N36H 1X9ZA 2Z0SA 1DT4A 1VIHA 3VKEA 2MJHA 4LF7H 4EC5A 3T1YH 1ZTGA 1V8CA 4DV4H 5IT9W 1XRHA 5K36G 4JVHA 4DUZH 4JI3H 4AQYH 4OX9H 4LF9H 2UXCH 4K0KH 2LTMA 4BA1I 4DV7H 1XMQH 1Z2IA 1IBLH 1NXUA 4GKKH 2QNDA 2FFMA 5IWAH 4DR7H 2UXDH 1ZZJA 4B3SH 1K1GA 1WHRA 3L7ZC 2CTEA 2CTMA 4DR5H 4DR3H 3OTOH 1ZZIA 2D9IA 5LL6b 1FKAH 4NXNH 1PQXA 4JI2H 4DV5H 4NXMH 4DR6H 2A1SA 4X62H 4X66H 1FJGH 2DGRA 1F0XA 2LF0A 1I6UA 2HH2A 4YHHH 2CTLA 5C0XG 2UUAH 2PT7G 1S20A 2ZM6H 4JI7H 4GKJH 2UUCH 3KDKA 3RF2A 5BR8H 1KHMA 4OCHA 2JE6I 3SB1A 1J5KA 3FAUA 4LFAH 1SEIA 2UUBH 1IBMH 4FJSA 4WANA 4DV0H 4DV1H 4G08A 5A2QW 1N32H 1XMOH 2PY9A 4QMFB 1ZZKA 1HNZH 4OO1G 2FPHX 4BA2I 1J4WA 4FJUA 3OETA 4LFBH 2VQFH 4AM3A 2CTJA 1N34H 4LF5H 1X4MA 2YQRA 3J7AK 3J81W 3UOEA 2CTFA
chains in the Genus database with same CATH topology
2K1HA 2M8WA 2LTLA 2M6QA 1PQXA 2LTMA 2FFMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K1H A;  2M8W A;  2LTL A;  2M6Q A;  1PQX A;  2LTM A;  2FFM A; 
#chains in the Genus database with same CATH topology
 2K1H A;  4DR4 H;  2O4C A;  4DV6 H;  4YY3 H;  2CPM A;  4H8A A;  4DV3 H;  2VKC A;  4JI4 H;  2OPU A;  2JA9 A;  4B3T H;  2LTL A;  4JI0 H;  4B8T A;  2M6Q A;  4JYA H;  3EZJ A;  2NN6 G;  1AN7 A;  1VIG A;  3J80 W;  4DR2 H;  4JI1 H;  3QD7 X;  1WTJ A;  4LF8 H;  1ODH A;  5LMN H;  3KDG A;  4LF6 H;  2JEA I;  4B3R H;  2BA0 A;  1V9N A;  2X06 A;  4OD6 A;  2AXY A;  2HHH H;  4DR1 H;  4JVY A;  4LFC H;  1X4N A;  3JAM W;  3GAB A;  5FLX W;  1XNR H;  2M8W A;  5LMU H;  1HNX H;  2PQU A;  2JVZ A;  2CWH A;  4LIJ A;  2UU9 H;  4B3M H;  4JI8 H;  2G8Y A;  4NZR M;  2P2R A;  1J5E H;  2VQE H;  1WVN A;  3GKU A;  1HR0 H;  4WAL A;  4AIM A;  2JZX A;  1HNW H;  2ANN A;  4KHP H;  4X64 H;  3NCV A;  1MSZ A;  1S03 G;  1UG8 A;  4NBQ A;  1VBI A;  2OPV A;  2CTK A;  4DV2 H;  1WE8 A;  3T1H H;  4E9J A;  4X65 H;  5JEA G;  4LF4 H;  1N33 H;  4B8C D;  2CWF A;  2UXB H;  2E5L H;  2F4V H;  3GR5 A;  1I94 H;  2LRR A;  4JV5 H;  2CPQ A;  2E3U A;  4PDB A;  2FMR A;  2HH3 A;  3OSS D;  3AEV B;  3U1K A;  4NZT M;  1IBK H;  1X0A A;  1DTJ A;  4DUY H;  2ZQE A;  3I0P A;  4IFD G;  4JI5 H;  3V69 A;  2JEB I;  1TUA A;  5DT9 A;  2ANR A;  4JI6 H;  1XNQ H;  1EC6 A;  2Y3M A;  2BL5 A;  1N36 H;  1X9Z A;  2Z0S A;  1DT4 A;  1VIH A;  3VKE A;  2MJH A;  4LF7 H;  4EC5 A;  3T1Y H;  1ZTG A;  1V8C A;  4DV4 H;  5IT9 W;  1XRH A;  5K36 G;  4JVH A;  4DUZ H;  4JI3 H;  4AQY H;  4OX9 H;  4LF9 H;  2UXC H;  4K0K H;  2LTM A;  4BA1 I;  4DV7 H;  1XMQ H;  1Z2I A;  1IBL H;  1NXU A;  4GKK H;  2QND A;  2FFM A;  5IWA H;  4DR7 H;  2UXD H;  1ZZJ A;  4B3S H;  1K1G A;  1WHR A;  3L7Z C;  2CTE A;  2CTM A;  4DR5 H;  4DR3 H;  3OTO H;  1ZZI A;  2D9I A;  5LL6 b;  1FKA H;  4NXN H;  1PQX A;  4JI2 H;  4DV5 H;  4NXM H;  4DR6 H;  2A1S A;  4X62 H;  4X66 H;  1FJG H;  2DGR A;  1F0X A;  2LF0 A;  1I6U A;  2HH2 A;  4YHH H;  2CTL A;  5C0X G;  2UUA H;  2PT7 G;  1S20 A;  2ZM6 H;  4JI7 H;  4GKJ H;  2UUC H;  3KDK A;  3RF2 A;  5BR8 H;  1KHM A;  4OCH A;  2JE6 I;  3SB1 A;  1J5K A;  3FAU A;  4LFA H;  1SEI A;  2UUB H;  1IBM H;  4FJS A;  4WAN A;  4DV0 H;  4DV1 H;  4G08 A;  5A2Q W;  1N32 H;  1XMO H;  2PY9 A;  4QMF B;  1ZZK A;  1HNZ H;  4OO1 G;  2FPH X;  4BA2 I;  1J4W A;  4FJU A;  3OET A;  4LFB H;  2VQF H;  4AM3 A;  2CTJ A;  1N34 H;  4LF5 H;  1X4M A;  2YQR A;  3J7A K;  3J81 W;  3UOE A;  2CTF A; 
#chains in the Genus database with same CATH homology
 2K1H A;  2M8W A;  2LTL A;  2M6Q A;  1PQX A;  2LTM A;  2FFM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...