1PQXA

Solution nmr structure of staphylococcus aureus protein sav1430. northeast strucutral genomics consortium target zr18.
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
91
structure length
91
Chain Sequence
MKIISISETPNHNTMKITLSESREGMTSDTYTKVDDSQPAFINDILKVEGVKSIFHVMDFISVDKENDANWETVLPKVEAVFELEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords conserved hypothetical protein
publication title Solution Strucutre of the Hypothetical Staphylococcus Aureus protein SAV1430. Northest Strucutral Genomics Consortium target ZR18
rcsb
source organism Staphylococcus aureus subsp. aureus mu50
total genus 10
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2003-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08712 Nfu_N Scaffold protein Nfu/NifU N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Scaffold protein Nfu/NifU, N-terminal domain 1pqxA00
2M6QA 2M8WA 2FFMA 2LTMA 2LTLA 2K1HA 1PQXA
chains in the Genus database with same CATH superfamily
4LIJA 2PY9A 2HH2A 4JVYA 4K0KH 3J80W 2UXBH 4DR6H 5A2QW 3AEVB 2VKCA 2DGRA 4DR5H 3J7AK 5LMUH 4DR4H 2YQRA 1S20A 4OD6A 1VIGA 4LF8H 1WE8A 4E9JA 2UUCH 3OETA 1VBIA 1UG8A 2CPMA 2CTKA 2M6QA 1FKAH 1N32H 1IBLH 3J81W 2UUAH 4B8CD 2CTJA 2X06A 1ZZJA 2LTLA 5K36G 4X62H 3JAMW 4BA1I 1SEIA 4JI6H 2CTFA 2D9IA 2PT7G 1ODHA 2CTEA 4QMFB 4LF6H 4AQYH 1V8CA 5LMNH 2JZXA 3QD7X 2Y3MA 4LFAH 2O4CA 2K1HA 1X4NA 4AIMA 4DV5H 4JVHA 2BL5A 4FJUA 4YHHH 4DR1H 4B3TH 1HNWH 1WTJA 4JI7H 2UUBH 2QNDA 1ZTGA 2HH3A 2CTLA 2ZQEA 1DTJA 2ANRA 4LF5H 4H8AA 4DR3H 2LF0A 5FLXW 3UOEA 4OCHA 1K1GA 1KHMA 5C0XG 1AN7A 1PQXA 1N33H 1XRHA 3RF2A 4JI5H 2E3UA 4DV6H 4DR2H 4IFDG 4NZTM 4WANA 4DUYH 4GKKH 1Z2IA 3T1HH 4NBQA 1HNZH 3KDKA 2HHHH 4LF4H 2M8WA 5IWAH 4AM3A 4YY3H 4G08A 1HR0H 2JEAI 4JI2H 4B3MH 3U1KA 2G8YA 1VIHA 4FJSA 1NXUA 3I0PA 2JE6I 4DR7H 4NZRM 4B8TA 4DV3H 4GKJH 4KHPH 2LTMA 3OSSD 1X9ZA 2UXCH 1DT4A 2LRRA 2FPHX 3V69A 3KDGA 1F0XA 1J5EH 2OPUA 4X66H 2P2RA 3GR5A 2UXDH 3VKEA 4JI1H 2JA9A 3FAUA 2F4VH 4LFBH 4OX9H 1HNXH 1XMQH 2Z0SA 5IT9W 2UU9H 2NN6G 4JI0H 4LFCH 2ZM6H 4DV2H 5LL6b 1XMOH 4JI3H 4JI8H 2VQFH 1XNQH 4DUZH 5DT9A 1ZZIA 1J5KA 4X65H 2CWFA 2MJHA 1TUAA 1ZZKA 2FMRA 4DV7H 3T1YH 2ANNA 2A1SA 2PQUA 2BA0A 2CTMA 1WHRA 1IBMH 1I94H 4EC5A 3L7ZC 3GKUA 1MSZA 5JEAG 4WALA 4JI4H 1N36H 4B3SH 4BA2I 4PDBA 3OTOH 1X4MA 1IBKH 2AXYA 4OO1G 1X0AA 4NXMH 4DV0H 4X64H 2JEBI 4DV4H 3GABA 2OPVA 2CWHA 4LF7H 1I6UA 3EZJA 4B3RH 2FFMA 1S03G 1J4WA 2VQEH 4LF9H 1WVNA 1FJGH 1XNRH 2E5LH 4JYAH 1EC6A 2CPQA 4NXNH 3NCVA 4JV5H 2JVZA 3SB1A 1V9NA 1N34H 5BR8H 4DV1H
chains in the Genus database with same CATH topology
2M6QA 2M8WA 2FFMA 2LTMA 2LTLA 2K1HA 1PQXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M6Q A;  2M8W A;  2FFM A;  2LTM A;  2LTL A;  2K1H A;  1PQX A; 
#chains in the Genus database with same CATH topology
 4LIJ A;  2PY9 A;  2HH2 A;  4JVY A;  4K0K H;  3J80 W;  2UXB H;  4DR6 H;  5A2Q W;  3AEV B;  2VKC A;  2DGR A;  4DR5 H;  3J7A K;  5LMU H;  4DR4 H;  2YQR A;  1S20 A;  4OD6 A;  1VIG A;  4LF8 H;  1WE8 A;  4E9J A;  2UUC H;  3OET A;  1VBI A;  1UG8 A;  2CPM A;  2CTK A;  2M6Q A;  1FKA H;  1N32 H;  1IBL H;  3J81 W;  2UUA H;  4B8C D;  2CTJ A;  2X06 A;  1ZZJ A;  2LTL A;  5K36 G;  4X62 H;  3JAM W;  4BA1 I;  1SEI A;  4JI6 H;  2CTF A;  2D9I A;  2PT7 G;  1ODH A;  2CTE A;  4QMF B;  4LF6 H;  4AQY H;  1V8C A;  5LMN H;  2JZX A;  3QD7 X;  2Y3M A;  4LFA H;  2O4C A;  2K1H A;  1X4N A;  4AIM A;  4DV5 H;  4JVH A;  2BL5 A;  4FJU A;  4YHH H;  4DR1 H;  4B3T H;  1HNW H;  1WTJ A;  4JI7 H;  2UUB H;  2QND A;  1ZTG A;  2HH3 A;  2CTL A;  2ZQE A;  1DTJ A;  2ANR A;  4LF5 H;  4H8A A;  4DR3 H;  2LF0 A;  5FLX W;  3UOE A;  4OCH A;  1K1G A;  1KHM A;  5C0X G;  1AN7 A;  1PQX A;  1N33 H;  1XRH A;  3RF2 A;  4JI5 H;  2E3U A;  4DV6 H;  4DR2 H;  4IFD G;  4NZT M;  4WAN A;  4DUY H;  4GKK H;  1Z2I A;  3T1H H;  4NBQ A;  1HNZ H;  3KDK A;  2HHH H;  4LF4 H;  2M8W A;  5IWA H;  4AM3 A;  4YY3 H;  4G08 A;  1HR0 H;  2JEA I;  4JI2 H;  4B3M H;  3U1K A;  2G8Y A;  1VIH A;  4FJS A;  1NXU A;  3I0P A;  2JE6 I;  4DR7 H;  4NZR M;  4B8T A;  4DV3 H;  4GKJ H;  4KHP H;  2LTM A;  3OSS D;  1X9Z A;  2UXC H;  1DT4 A;  2LRR A;  2FPH X;  3V69 A;  3KDG A;  1F0X A;  1J5E H;  2OPU A;  4X66 H;  2P2R A;  3GR5 A;  2UXD H;  3VKE A;  4JI1 H;  2JA9 A;  3FAU A;  2F4V H;  4LFB H;  4OX9 H;  1HNX H;  1XMQ H;  2Z0S A;  5IT9 W;  2UU9 H;  2NN6 G;  4JI0 H;  4LFC H;  2ZM6 H;  4DV2 H;  5LL6 b;  1XMO H;  4JI3 H;  4JI8 H;  2VQF H;  1XNQ H;  4DUZ H;  5DT9 A;  1ZZI A;  1J5K A;  4X65 H;  2CWF A;  2MJH A;  1TUA A;  1ZZK A;  2FMR A;  4DV7 H;  3T1Y H;  2ANN A;  2A1S A;  2PQU A;  2BA0 A;  2CTM A;  1WHR A;  1IBM H;  1I94 H;  4EC5 A;  3L7Z C;  3GKU A;  1MSZ A;  5JEA G;  4WAL A;  4JI4 H;  1N36 H;  4B3S H;  4BA2 I;  4PDB A;  3OTO H;  1X4M A;  1IBK H;  2AXY A;  4OO1 G;  1X0A A;  4NXM H;  4DV0 H;  4X64 H;  2JEB I;  4DV4 H;  3GAB A;  2OPV A;  2CWH A;  4LF7 H;  1I6U A;  3EZJ A;  4B3R H;  2FFM A;  1S03 G;  1J4W A;  2VQE H;  4LF9 H;  1WVN A;  1FJG H;  1XNR H;  2E5L H;  4JYA H;  1EC6 A;  2CPQ A;  4NXN H;  3NCV A;  4JV5 H;  2JVZ A;  3SB1 A;  1V9N A;  1N34 H;  5BR8 H;  4DV1 H; 
#chains in the Genus database with same CATH homology
 2M6Q A;  2M8W A;  2FFM A;  2LTM A;  2LTL A;  2K1H A;  1PQX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...