1PQXA

Solution nmr structure of staphylococcus aureus protein sav1430. northeast strucutral genomics consortium target zr18.
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
91
structure length
91
Chain Sequence
MKIISISETPNHNTMKITLSESREGMTSDTYTKVDDSQPAFINDILKVEGVKSIFHVMDFISVDKENDANWETVLPKVEAVFELEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords conserved hypothetical protein
publication title Solution Strucutre of the Hypothetical Staphylococcus Aureus protein SAV1430. Northest Strucutral Genomics Consortium target ZR18
rcsb
source organism Staphylococcus aureus subsp. aureus mu50
molecule tags Structural genomics, unknown function
total genus 10
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2003-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08712 Nfu_N Scaffold protein Nfu/NifU N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Scaffold protein Nfu/NifU, N-terminal domain 1pqxA00
1PQXA 2M8WA 2LTMA 2FFMA 2K1HA 2LTLA 2M6QA
chains in the Genus database with same CATH superfamily
1X4NA 4DR7H 4DV0H 2BA0A 2MJHA 1AN7A 5LMUH 2M6QA 3U1KA 4X66H 1XNQH 2CTEA 4JI2H 4BA1I 4AM3A 1ODHA 2M8WA 4LFBH 2OPUA 3VKEA 4OD6A 4EC5A 2VQEH 4DR5H 1TUAA 4WALA 4JYAH 1S20A 2X06A 2JZXA 2CWHA 2LTMA 3I0PA 4X62H 1UG8A 1HNXH 4YY3H 4JVHA 3J81W 1KHMA 4JI0H 1X9ZA 2CWFA 1XMQH 1J5EH 4NXMH 2JEAI 2UXBH 2QNDA 1HR0H 1X0AA 2YQRA 1X4MA 1WVNA 4JI6H 1N34H 4FJSA 4LF7H 1F0XA 3V69A 4NXNH 1DTJA 2DGRA 2CPQA 1NXUA 1HNZH 4JI7H 3EZJA 3NCVA 1K1GA 2E3UA 3T1YH 1DT4A 4B3TH 2CPMA 5LMNH 5K36G 2G8YA 2ANNA 1I94H 4GKJH 1WE8A 1S03G 1MSZA 4JI8H 2FMRA 2ZQEA 2UXCH 2CTJA 1PQXA 2E5LH 4LF4H 1VIHA 2HHHH 4PDBA 3RF2A 4DV6H 4JI4H 4B3RH 4AIMA 3KDKA 2FPHX 2UU9H 3JAMW 4X65H 4JI1H 5IT9W 4YHHH 4KHPH 4G08A 4DR1H 1EC6A 2HH3A 3OTOH 4DR2H 2Y3MA 2BL5A 5FLXW 1HNWH 4DR6H 5IWAH 3J7AK 4OO1G 5DT9A 3FAUA 4NZRM 1ZTGA 4DV4H 4LF5H 2FFMA 2CTKA 2K1HA 3UOEA 1N36H 1V8CA 3QD7X 2AXYA 4LF9H 3OSSD 4LIJA 4JVYA 1V9NA 1ZZKA 2Z0SA 4NZTM 1N32H 1XNRH 2VQFH 3SB1A 2JA9A 2PT7G 5C0XG 1I6UA 2NN6G 4BA2I 3GABA 2UXDH 4FJUA 5BR8H 4DV5H 1J4WA 4X64H 3AEVB 2P2RA 4DR4H 1IBLH 2ZM6H 1IBKH 2O4CA 1WHRA 2JEBI 4DV2H 4B8CD 4OX9H 4AQYH 3L7ZC 2CTMA 4K0KH 2D9IA 2F4VH 4OCHA 4LF6H 1ZZJA 4DV3H 3KDGA 4JI3H 2A1SA 2CTLA 2ANRA 4IFDG 2OPVA 4LFAH 3J80W 1SEIA 2UUBH 4JI5H 4B3SH 1WTJA 3T1HH 3OETA 1FJGH 1XRHA 4NBQA 4QMFB 1Z2IA 4H8AA 4B8TA 1XMOH 1IBMH 2LF0A 1N33H 3GKUA 4DUZH 4DUYH 2UUAH 2JE6I 4WANA 2PY9A 5JEAG 4JV5H 2CTFA 2VKCA 4LFCH 2PQUA 1ZZIA 1VBIA 2HH2A 4DV7H 1VIGA 1J5KA 1FKAH 3GR5A 4GKKH 4DV1H 4B3MH 4LF8H 2LTLA 2LRRA 5LL6b 2UUCH 4DR3H 4E9JA 2JVZA 5A2QW
chains in the Genus database with same CATH topology
1PQXA 2M8WA 2LTMA 2FFMA 2K1HA 2LTLA 2M6QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PQX A;  2M8W A;  2LTM A;  2FFM A;  2K1H A;  2LTL A;  2M6Q A; 
#chains in the Genus database with same CATH topology
 1X4N A;  4DR7 H;  4DV0 H;  2BA0 A;  2MJH A;  1AN7 A;  5LMU H;  2M6Q A;  3U1K A;  4X66 H;  1XNQ H;  2CTE A;  4JI2 H;  4BA1 I;  4AM3 A;  1ODH A;  2M8W A;  4LFB H;  2OPU A;  3VKE A;  4OD6 A;  4EC5 A;  2VQE H;  4DR5 H;  1TUA A;  4WAL A;  4JYA H;  1S20 A;  2X06 A;  2JZX A;  2CWH A;  2LTM A;  3I0P A;  4X62 H;  1UG8 A;  1HNX H;  4YY3 H;  4JVH A;  3J81 W;  1KHM A;  4JI0 H;  1X9Z A;  2CWF A;  1XMQ H;  1J5E H;  4NXM H;  2JEA I;  2UXB H;  2QND A;  1HR0 H;  1X0A A;  2YQR A;  1X4M A;  1WVN A;  4JI6 H;  1N34 H;  4FJS A;  4LF7 H;  1F0X A;  3V69 A;  4NXN H;  1DTJ A;  2DGR A;  2CPQ A;  1NXU A;  1HNZ H;  4JI7 H;  3EZJ A;  3NCV A;  1K1G A;  2E3U A;  3T1Y H;  1DT4 A;  4B3T H;  2CPM A;  5LMN H;  5K36 G;  2G8Y A;  2ANN A;  1I94 H;  4GKJ H;  1WE8 A;  1S03 G;  1MSZ A;  4JI8 H;  2FMR A;  2ZQE A;  2UXC H;  2CTJ A;  1PQX A;  2E5L H;  4LF4 H;  1VIH A;  2HHH H;  4PDB A;  3RF2 A;  4DV6 H;  4JI4 H;  4B3R H;  4AIM A;  3KDK A;  2FPH X;  2UU9 H;  3JAM W;  4X65 H;  4JI1 H;  5IT9 W;  4YHH H;  4KHP H;  4G08 A;  4DR1 H;  1EC6 A;  2HH3 A;  3OTO H;  4DR2 H;  2Y3M A;  2BL5 A;  5FLX W;  1HNW H;  4DR6 H;  5IWA H;  3J7A K;  4OO1 G;  5DT9 A;  3FAU A;  4NZR M;  1ZTG A;  4DV4 H;  4LF5 H;  2FFM A;  2CTK A;  2K1H A;  3UOE A;  1N36 H;  1V8C A;  3QD7 X;  2AXY A;  4LF9 H;  3OSS D;  4LIJ A;  4JVY A;  1V9N A;  1ZZK A;  2Z0S A;  4NZT M;  1N32 H;  1XNR H;  2VQF H;  3SB1 A;  2JA9 A;  2PT7 G;  5C0X G;  1I6U A;  2NN6 G;  4BA2 I;  3GAB A;  2UXD H;  4FJU A;  5BR8 H;  4DV5 H;  1J4W A;  4X64 H;  3AEV B;  2P2R A;  4DR4 H;  1IBL H;  2ZM6 H;  1IBK H;  2O4C A;  1WHR A;  2JEB I;  4DV2 H;  4B8C D;  4OX9 H;  4AQY H;  3L7Z C;  2CTM A;  4K0K H;  2D9I A;  2F4V H;  4OCH A;  4LF6 H;  1ZZJ A;  4DV3 H;  3KDG A;  4JI3 H;  2A1S A;  2CTL A;  2ANR A;  4IFD G;  2OPV A;  4LFA H;  3J80 W;  1SEI A;  2UUB H;  4JI5 H;  4B3S H;  1WTJ A;  3T1H H;  3OET A;  1FJG H;  1XRH A;  4NBQ A;  4QMF B;  1Z2I A;  4H8A A;  4B8T A;  1XMO H;  1IBM H;  2LF0 A;  1N33 H;  3GKU A;  4DUZ H;  4DUY H;  2UUA H;  2JE6 I;  4WAN A;  2PY9 A;  5JEA G;  4JV5 H;  2CTF A;  2VKC A;  4LFC H;  2PQU A;  1ZZI A;  1VBI A;  2HH2 A;  4DV7 H;  1VIG A;  1J5K A;  1FKA H;  3GR5 A;  4GKK H;  4DV1 H;  4B3M H;  4LF8 H;  2LTL A;  2LRR A;  5LL6 b;  2UUC H;  4DR3 H;  4E9J A;  2JVZ A;  5A2Q W; 
#chains in the Genus database with same CATH homology
 1PQX A;  2M8W A;  2LTM A;  2FFM A;  2K1H A;  2LTL A;  2M6Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...