1VIGA

Nmr study of vigilin, repeat 6, 40 structures
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
71
structure length
71
Chain Sequence
INRMDYVEINIDHKFHRHLIGKSGANINRIKDQYKVSVRIPPDSEKSNLIRIEGDPQGVQQAKRELLELAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribonucleoprotein
molecule keywords VIGILIN
publication title Three-dimensional structure and stability of the KH domain: molecular insights into the fragile X syndrome.
pubmed doi rcsb
source organism Homo sapiens
total genus 9
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 1995-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 1vigA00
5JEAG 4OO1G 1WE8A 1EC6A 2JEBI 2JA9A 3L7ZC 4LIJA 2OPUA 2JE6I 2E3UA 4JVHA 2PQUA 2BL5A 2HH2A 2MJHA 2P2RA 1DTJA 2NN6G 1DT4A 2ANRA 4JVYA 5C0XG 4AM3A 2CTFA 2CTKA 2Z0SA 3V69A 1J4WA 4WALA 3U1KA 2DGRA 3AEVB 2AXYA 2BA0A 1KHMA 1VIHA 1ZZIA 2CTJA 4B8TA 1K1GA 1VIGA 2CTLA 2HH3A 4BA1I 4AIMA 1ZZJA 4NBQA 1WVNA 2JEAI 4BA2I 3VKEA 5K36G 2FMRA 2YQRA 2ANNA 1TUAA 1ZTGA 1ZZKA 2PY9A 2CTMA 4IFDG 1X4MA 4QMFB 2OPVA 2CPQA 2JZXA 2JVZA 2QNDA 4WANA 1J5KA 2CTEA 1X4NA
chains in the Genus database with same CATH superfamily
1XNQH 4B3SH 2JA9A 3L7ZC 4LIJA 4JI7H 2A1SA 3J7AK 2E5LH 1I94H 1I6UA 2P2RA 1XNRH 2NN6G 1DT4A 2M8WA 5C0XG 1N36H 1J4WA 4DV1H 1HNXH 1IBLH 2DGRA 4DR3H 2CPMA 4B3TH 4DR6H 2UXCH 4LF7H 2UUCH 4BA1I 3T1HH 5LL6b 4B8CD 2FMRA 5LMNH 4JI2H 3T1YH 2PY9A 1FJGH 1V8CA 4B3MH 4DV0H 2HHHH 4OD6A 5BR8H 4X65H 3OETA 4GKKH 1EC6A 5IT9W 5FLXW 3GABA 2UU9H 2LRRA 4GKJH 2JE6I 2E3UA 1IBMH 4DR5H 2PQUA 2BL5A 4PDBA 2HH2A 1N33H 2UXBH 1MSZA 2M6QA 1WTJA 4DV7H 4NXNH 2ANRA 1IBKH 4NZRM 4JI4H 4LF4H 3OTOH 2CTFA 3V69A 4DV5H 3GR5A 4LFCH 1HNWH 2BA0A 5DT9A 1KHMA 4JV5H 1VIGA 2CTLA 4JYAH 4FJSA 1ZZJA 4NBQA 1WVNA 4NXMH 4YHHH 3VKEA 2JEAI 3KDKA 2YQRA 3RF2A 1TUAA 1ZTGA 4G08A 1Z2IA 4DR4H 4DR7H 5IWAH 4IFDG 4DR1H 1NXUA 5LMUH 1N32H 2Y3MA 2FPHX 1PQXA 3J80W 4DUYH 4LF9H 4JI1H 1J5KA 1FKAH 2QNDA 1X4NA 4JI0H 2F4VH 5JEAG 1N34H 2PT7G 4OO1G 1WE8A 4DV4H 2JEBI 4LFAH 1V9NA 2OPUA 1J5EH 2ZQEA 4YY3H 4NZTM 2LF0A 4OCHA 1F0XA 2CWFA 2MJHA 1DTJA 4JVYA 4B3RH 4DV3H 4AM3A 4DV6H 2CTKA 1UG8A 4KHPH 3NCVA 2AXYA 1ODHA 4JI5H 4X62H 4JI8H 2G8YA 3SB1A 4B8TA 1K1GA 4K0KH 4AIMA 4LF6H 5A2QW 1S20A 5K36G 4EC5A 2ANNA 4LF5H 2CTMA 4FJUA 4AQYH 1HR0H 2CPQA 2LTLA 2JVZA 4JI6H 3KDGA 1XRHA 4DV2H 2LTMA 2HH3A 2CTEA 3QD7X 2ZM6H 4X66H 4OX9H 2FFMA 4JVHA 1S03G 1AN7A 4E9JA 3JAMW 4X64H 2UUBH 2O4CA 3EZJA 3OSSD 4DUZH 2Z0SA 2D9IA 4WALA 3U1KA 4LF8H 4LFBH 4H8AA 3AEVB 2UXDH 4JI3H 3GKUA 4DR2H 1VIHA 1ZZIA 2CTJA 3FAUA 4BA2I 2UUAH 1X0AA 1ZZKA 1WHRA 1VBIA 2CWHA 3UOEA 2VQFH 1X4MA 3I0PA 2OPVA 2VKCA 2JZXA 4QMFB 4WANA 2VQEH 1X9ZA 1XMQH 1SEIA 1HNZH 3J81W 2X06A 1XMOH 2K1HA
chains in the Genus database with same CATH topology
5JEAG 4OO1G 1WE8A 1EC6A 2JEBI 2JA9A 3L7ZC 4LIJA 2OPUA 2JE6I 2E3UA 4JVHA 2PQUA 2BL5A 2HH2A 2MJHA 2P2RA 1DTJA 2NN6G 1DT4A 2ANRA 4JVYA 5C0XG 4AM3A 2CTFA 2CTKA 2Z0SA 3V69A 1J4WA 4WALA 3U1KA 2DGRA 3AEVB 2AXYA 2BA0A 1KHMA 1VIHA 1ZZIA 2CTJA 4B8TA 1K1GA 1VIGA 2CTLA 2HH3A 4BA1I 4AIMA 1ZZJA 4NBQA 1WVNA 2JEAI 4BA2I 3VKEA 5K36G 2FMRA 2YQRA 2ANNA 1TUAA 1ZTGA 1ZZKA 2PY9A 2CTMA 4IFDG 1X4MA 4QMFB 2OPVA 2CPQA 2JZXA 2JVZA 2QNDA 4WANA 1J5KA 2CTEA 1X4NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JEA G;  4OO1 G;  1WE8 A;  1EC6 A;  2JEB I;  2JA9 A;  3L7Z C;  4LIJ A;  2OPU A;  2JE6 I;  2E3U A;  4JVH A;  2PQU A;  2BL5 A;  2HH2 A;  2MJH A;  2P2R A;  1DTJ A;  2NN6 G;  1DT4 A;  2ANR A;  4JVY A;  5C0X G;  4AM3 A;  2CTF A;  2CTK A;  2Z0S A;  3V69 A;  1J4W A;  4WAL A;  3U1K A;  2DGR A;  3AEV B;  2AXY A;  2BA0 A;  1KHM A;  1VIH A;  1ZZI A;  2CTJ A;  4B8T A;  1K1G A;  1VIG A;  2CTL A;  2HH3 A;  4BA1 I;  4AIM A;  1ZZJ A;  4NBQ A;  1WVN A;  2JEA I;  4BA2 I;  3VKE A;  5K36 G;  2FMR A;  2YQR A;  2ANN A;  1TUA A;  1ZTG A;  1ZZK A;  2PY9 A;  2CTM A;  4IFD G;  1X4M A;  4QMF B;  2OPV A;  2CPQ A;  2JZX A;  2JVZ A;  2QND A;  4WAN A;  1J5K A;  2CTE A;  1X4N A; 
#chains in the Genus database with same CATH topology
 1XNQ H;  4B3S H;  2JA9 A;  3L7Z C;  4LIJ A;  4JI7 H;  2A1S A;  3J7A K;  2E5L H;  1I94 H;  1I6U A;  2P2R A;  1XNR H;  2NN6 G;  1DT4 A;  2M8W A;  5C0X G;  1N36 H;  1J4W A;  4DV1 H;  1HNX H;  1IBL H;  2DGR A;  4DR3 H;  2CPM A;  4B3T H;  4DR6 H;  2UXC H;  4LF7 H;  2UUC H;  4BA1 I;  3T1H H;  5LL6 b;  4B8C D;  2FMR A;  5LMN H;  4JI2 H;  3T1Y H;  2PY9 A;  1FJG H;  1V8C A;  4B3M H;  4DV0 H;  2HHH H;  4OD6 A;  5BR8 H;  4X65 H;  3OET A;  4GKK H;  1EC6 A;  5IT9 W;  5FLX W;  3GAB A;  2UU9 H;  2LRR A;  4GKJ H;  2JE6 I;  2E3U A;  1IBM H;  4DR5 H;  2PQU A;  2BL5 A;  4PDB A;  2HH2 A;  1N33 H;  2UXB H;  1MSZ A;  2M6Q A;  1WTJ A;  4DV7 H;  4NXN H;  2ANR A;  1IBK H;  4NZR M;  4JI4 H;  4LF4 H;  3OTO H;  2CTF A;  3V69 A;  4DV5 H;  3GR5 A;  4LFC H;  1HNW H;  2BA0 A;  5DT9 A;  1KHM A;  4JV5 H;  1VIG A;  2CTL A;  4JYA H;  4FJS A;  1ZZJ A;  4NBQ A;  1WVN A;  4NXM H;  4YHH H;  3VKE A;  2JEA I;  3KDK A;  2YQR A;  3RF2 A;  1TUA A;  1ZTG A;  4G08 A;  1Z2I A;  4DR4 H;  4DR7 H;  5IWA H;  4IFD G;  4DR1 H;  1NXU A;  5LMU H;  1N32 H;  2Y3M A;  2FPH X;  1PQX A;  3J80 W;  4DUY H;  4LF9 H;  4JI1 H;  1J5K A;  1FKA H;  2QND A;  1X4N A;  4JI0 H;  2F4V H;  5JEA G;  1N34 H;  2PT7 G;  4OO1 G;  1WE8 A;  4DV4 H;  2JEB I;  4LFA H;  1V9N A;  2OPU A;  1J5E H;  2ZQE A;  4YY3 H;  4NZT M;  2LF0 A;  4OCH A;  1F0X A;  2CWF A;  2MJH A;  1DTJ A;  4JVY A;  4B3R H;  4DV3 H;  4AM3 A;  4DV6 H;  2CTK A;  1UG8 A;  4KHP H;  3NCV A;  2AXY A;  1ODH A;  4JI5 H;  4X62 H;  4JI8 H;  2G8Y A;  3SB1 A;  4B8T A;  1K1G A;  4K0K H;  4AIM A;  4LF6 H;  5A2Q W;  1S20 A;  5K36 G;  4EC5 A;  2ANN A;  4LF5 H;  2CTM A;  4FJU A;  4AQY H;  1HR0 H;  2CPQ A;  2LTL A;  2JVZ A;  4JI6 H;  3KDG A;  1XRH A;  4DV2 H;  2LTM A;  2HH3 A;  2CTE A;  3QD7 X;  2ZM6 H;  4X66 H;  4OX9 H;  2FFM A;  4JVH A;  1S03 G;  1AN7 A;  4E9J A;  3JAM W;  4X64 H;  2UUB H;  2O4C A;  3EZJ A;  3OSS D;  4DUZ H;  2Z0S A;  2D9I A;  4WAL A;  3U1K A;  4LF8 H;  4LFB H;  4H8A A;  3AEV B;  2UXD H;  4JI3 H;  3GKU A;  4DR2 H;  1VIH A;  1ZZI A;  2CTJ A;  3FAU A;  4BA2 I;  2UUA H;  1X0A A;  1ZZK A;  1WHR A;  1VBI A;  2CWH A;  3UOE A;  2VQF H;  1X4M A;  3I0P A;  2OPV A;  2VKC A;  2JZX A;  4QMF B;  4WAN A;  2VQE H;  1X9Z A;  1XMQ H;  1SEI A;  1HNZ H;  3J81 W;  2X06 A;  1XMO H;  2K1H A; 
#chains in the Genus database with same CATH homology
 5JEA G;  4OO1 G;  1WE8 A;  1EC6 A;  2JEB I;  2JA9 A;  3L7Z C;  4LIJ A;  2OPU A;  2JE6 I;  2E3U A;  4JVH A;  2PQU A;  2BL5 A;  2HH2 A;  2MJH A;  2P2R A;  1DTJ A;  2NN6 G;  1DT4 A;  2ANR A;  4JVY A;  5C0X G;  4AM3 A;  2CTF A;  2CTK A;  2Z0S A;  3V69 A;  1J4W A;  4WAL A;  3U1K A;  2DGR A;  3AEV B;  2AXY A;  2BA0 A;  1KHM A;  1VIH A;  1ZZI A;  2CTJ A;  4B8T A;  1K1G A;  1VIG A;  2CTL A;  2HH3 A;  4BA1 I;  4AIM A;  1ZZJ A;  4NBQ A;  1WVN A;  2JEA I;  4BA2 I;  3VKE A;  5K36 G;  2FMR A;  2YQR A;  2ANN A;  1TUA A;  1ZTG A;  1ZZK A;  2PY9 A;  2CTM A;  4IFD G;  1X4M A;  4QMF B;  2OPV A;  2CPQ A;  2JZX A;  2JVZ A;  2QND A;  4WAN A;  1J5K A;  2CTE A;  1X4N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...