1VIGA

Nmr study of vigilin, repeat 6, 40 structures
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
71
structure length
71
Chain Sequence
b'INRMDYVEINIDHKFHRHLIGKSGANINRIKDQYKVSVRIPPDSEKSNLIRIEGDPQGVQQAKRELLELAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VIGILIN
molecule tags Ribonucleoprotein
source organism Homo sapiens
publication title Three-dimensional structure and stability of the KH domain: molecular insights into the fragile X syndrome.
pubmed doi rcsb
total genus 9
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 1995-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 1vigA00
2CTFA 1X4NA 2DGRA 4BA1I 2NN6G 2YQRA 2JA9A 4JVYA 2OPVA 1X4MA 5C0XG 2MJHA 2FMRA 1VIGA 4WALA 2JZXA 2HH3A 3VKEA 1WE8A 4BA2I 2AXYA 3U1KA 1TUAA 1WVNA 2JVZA 1K1GA 3AEVB 1ZTGA 2CTLA 2BA0A 3L7ZC 4IFDG 2P2RA 1J5KA 1DTJA 2ANNA 2CTMA 2Z0SA 3V69A 1VIHA 2JE6I 1ZZKA 2JEBI 5JEAG 2CTJA 1J4WA 1KHMA 4WANA 4LIJA 1DT4A 2CTKA 2CTEA 4NBQA 1ZZIA 4AIMA 4QMFB 2E3UA 2HH2A 2QNDA 1ZZJA 2PY9A 4JVHA 1EC6A 2CPQA 4OO1G 4B8TA 2BL5A 2OPUA 2ANRA 5K36G 2PQUA 2JEAI 4AM3A
chains in the Genus database with same CATH superfamily
4NZRM 1IBLH 2DGRA 4JI6H 2NN6G 4FJUA 2MJHA 4WALA 1IBMH 2UUBH 2JZXA 4B3MH 4JV5H 4E9JA 3GKUA 4NZTM 2E5LH 4DR7H 2AXYA 4DUZH 4JI3H 1IBKH 3QD7X 1ZTGA 1XMOH 4IFDG 2P2RA 4DR4H 2HHHH 2O4CA 4DV5H 4H8AA 1J4WA 1KHMA 4B3RH 4DV0H 2CTEA 2LRRA 4NXNH 4AIMA 4DR1H 4QMFB 1ZZJA 3GABA 1WTJA 4DV6H 1N34H 3GR5A 4DV1H 1V8CA 4LF9H 2JEAI 1Z2IA 5DT9A 4JI8H 1XNQH 2UUCH 4B3TH 4PDBA 4BA1I 4LFAH 4GKJH 2JA9A 3I0PA 1NXUA 4DR3H 2FMRA 2CPMA 4LF5H 2FPHX 3FAUA 2CWHA 1WE8A 2VKCA 5LMUH 4K0KH 3SB1A 3T1HH 1HR0H 3AEVB 3KDKA 2CTLA 3L7ZC 1S03G 1I94H 1X0AA 5A2QW 2FFMA 1I6UA 4YY3H 2UUAH 1VIHA 4OCHA 2LF0A 4WANA 4NBQA 1DT4A 4YHHH 4EC5A 1ZZIA 2UXBH 2QNDA 2HH2A 2LTLA 2D9IA 2ZQEA 3J81W 1N36H 2ANRA 3NCVA 1ODHA 4DR2H 4X65H 5FLXW 1X9ZA 1XMQH 4FJSA 2M6QA 1VBIA 5C0XG 4B8CD 5IT9W 1VIGA 2ZM6H 2VQFH 4KHPH 2HH3A 3J80W 4LF8H 2PT7G 2K1HA 3KDGA 1XNRH 3OETA 1WVNA 4GKKH 1K1GA 4JI1H 4JI7H 4JI2H 3UOEA 4DR5H 2LTMA 4JI0H 1S20A 2M8WA 1UG8A 2CTMA 2Z0SA 4X66H 2JEBI 2JE6I 5IWAH 2CTJA 4JI5H 4LIJA 4LFCH 2UXDH 3EZJA 3RF2A 2E3UA 5LL6b 1HNZH 1EC6A 2OPUA 5K36G 2X06A 4AM3A 2F4VH 4G08A 2CTFA 1X4NA 4OD6A 4DUYH 5BR8H 1V9NA 4DV2H 2CWFA 3OTOH 2YQRA 4DR6H 5LMNH 1F0XA 1FKAH 4JVYA 2OPVA 1X4MA 3JAMW 1MSZA 3J7AK 1HNXH 4X64H 3VKEA 4NXMH 4BA2I 2UU9H 4OO1G 3U1KA 1TUAA 2JVZA 4DV4H 4X62H 4DV7H 4LF6H 4AQYH 4JYAH 1HNWH 2BA0A 4LF7H 1N32H 1J5KA 1DTJA 1FJGH 2ANNA 3V69A 2VQEH 1ZZKA 5JEAG 1SEIA 4JI4H 4OX9H 2CTKA 1N33H 2A1SA 1AN7A 2UXCH 4JVHA 1WHRA 1XRHA 3OSSD 2G8YA 2PY9A 2CPQA 2Y3MA 4B8TA 2BL5A 1J5EH 3T1YH 4B3SH 4DV3H 4LF4H 2PQUA 4LFBH 1PQXA
chains in the Genus database with same CATH topology
2CTFA 1X4NA 2DGRA 4BA1I 2NN6G 2YQRA 2JA9A 4JVYA 2OPVA 1X4MA 5C0XG 2MJHA 2FMRA 1VIGA 4WALA 2JZXA 2HH3A 3VKEA 1WE8A 4BA2I 2AXYA 3U1KA 1TUAA 1WVNA 2JVZA 1K1GA 3AEVB 1ZTGA 2CTLA 2BA0A 3L7ZC 4IFDG 2P2RA 1J5KA 1DTJA 2ANNA 2CTMA 2Z0SA 3V69A 1VIHA 2JE6I 1ZZKA 2JEBI 5JEAG 2CTJA 1J4WA 1KHMA 4WANA 4LIJA 1DT4A 2CTKA 2CTEA 4NBQA 1ZZIA 4AIMA 4QMFB 2E3UA 2HH2A 2QNDA 1ZZJA 2PY9A 4JVHA 1EC6A 2CPQA 4OO1G 4B8TA 2BL5A 2OPUA 2ANRA 5K36G 2PQUA 2JEAI 4AM3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CTF A;  1X4N A;  2DGR A;  4BA1 I;  2NN6 G;  2YQR A;  2JA9 A;  4JVY A;  2OPV A;  1X4M A;  5C0X G;  2MJH A;  2FMR A;  1VIG A;  4WAL A;  2JZX A;  2HH3 A;  3VKE A;  1WE8 A;  4BA2 I;  2AXY A;  3U1K A;  1TUA A;  1WVN A;  2JVZ A;  1K1G A;  3AEV B;  1ZTG A;  2CTL A;  2BA0 A;  3L7Z C;  4IFD G;  2P2R A;  1J5K A;  1DTJ A;  2ANN A;  2CTM A;  2Z0S A;  3V69 A;  1VIH A;  2JE6 I;  1ZZK A;  2JEB I;  5JEA G;  2CTJ A;  1J4W A;  1KHM A;  4WAN A;  4LIJ A;  1DT4 A;  2CTK A;  2CTE A;  4NBQ A;  1ZZI A;  4AIM A;  4QMF B;  2E3U A;  2HH2 A;  2QND A;  1ZZJ A;  2PY9 A;  4JVH A;  1EC6 A;  2CPQ A;  4OO1 G;  4B8T A;  2BL5 A;  2OPU A;  2ANR A;  5K36 G;  2PQU A;  2JEA I;  4AM3 A; 
#chains in the Genus database with same CATH topology
 4NZR M;  1IBL H;  2DGR A;  4JI6 H;  2NN6 G;  4FJU A;  2MJH A;  4WAL A;  1IBM H;  2UUB H;  2JZX A;  4B3M H;  4JV5 H;  4E9J A;  3GKU A;  4NZT M;  2E5L H;  4DR7 H;  2AXY A;  4DUZ H;  4JI3 H;  1IBK H;  3QD7 X;  1ZTG A;  1XMO H;  4IFD G;  2P2R A;  4DR4 H;  2HHH H;  2O4C A;  4DV5 H;  4H8A A;  1J4W A;  1KHM A;  4B3R H;  4DV0 H;  2CTE A;  2LRR A;  4NXN H;  4AIM A;  4DR1 H;  4QMF B;  1ZZJ A;  3GAB A;  1WTJ A;  4DV6 H;  1N34 H;  3GR5 A;  4DV1 H;  1V8C A;  4LF9 H;  2JEA I;  1Z2I A;  5DT9 A;  4JI8 H;  1XNQ H;  2UUC H;  4B3T H;  4PDB A;  4BA1 I;  4LFA H;  4GKJ H;  2JA9 A;  3I0P A;  1NXU A;  4DR3 H;  2FMR A;  2CPM A;  4LF5 H;  2FPH X;  3FAU A;  2CWH A;  1WE8 A;  2VKC A;  5LMU H;  4K0K H;  3SB1 A;  3T1H H;  1HR0 H;  3AEV B;  3KDK A;  2CTL A;  3L7Z C;  1S03 G;  1I94 H;  1X0A A;  5A2Q W;  2FFM A;  1I6U A;  4YY3 H;  2UUA H;  1VIH A;  4OCH A;  2LF0 A;  4WAN A;  4NBQ A;  1DT4 A;  4YHH H;  4EC5 A;  1ZZI A;  2UXB H;  2QND A;  2HH2 A;  2LTL A;  2D9I A;  2ZQE A;  3J81 W;  1N36 H;  2ANR A;  3NCV A;  1ODH A;  4DR2 H;  4X65 H;  5FLX W;  1X9Z A;  1XMQ H;  4FJS A;  2M6Q A;  1VBI A;  5C0X G;  4B8C D;  5IT9 W;  1VIG A;  2ZM6 H;  2VQF H;  4KHP H;  2HH3 A;  3J80 W;  4LF8 H;  2PT7 G;  2K1H A;  3KDG A;  1XNR H;  3OET A;  1WVN A;  4GKK H;  1K1G A;  4JI1 H;  4JI7 H;  4JI2 H;  3UOE A;  4DR5 H;  2LTM A;  4JI0 H;  1S20 A;  2M8W A;  1UG8 A;  2CTM A;  2Z0S A;  4X66 H;  2JEB I;  2JE6 I;  5IWA H;  2CTJ A;  4JI5 H;  4LIJ A;  4LFC H;  2UXD H;  3EZJ A;  3RF2 A;  2E3U A;  5LL6 b;  1HNZ H;  1EC6 A;  2OPU A;  5K36 G;  2X06 A;  4AM3 A;  2F4V H;  4G08 A;  2CTF A;  1X4N A;  4OD6 A;  4DUY H;  5BR8 H;  1V9N A;  4DV2 H;  2CWF A;  3OTO H;  2YQR A;  4DR6 H;  5LMN H;  1F0X A;  1FKA H;  4JVY A;  2OPV A;  1X4M A;  3JAM W;  1MSZ A;  3J7A K;  1HNX H;  4X64 H;  3VKE A;  4NXM H;  4BA2 I;  2UU9 H;  4OO1 G;  3U1K A;  1TUA A;  2JVZ A;  4DV4 H;  4X62 H;  4DV7 H;  4LF6 H;  4AQY H;  4JYA H;  1HNW H;  2BA0 A;  4LF7 H;  1N32 H;  1J5K A;  1DTJ A;  1FJG H;  2ANN A;  3V69 A;  2VQE H;  1ZZK A;  5JEA G;  1SEI A;  4JI4 H;  4OX9 H;  2CTK A;  1N33 H;  2A1S A;  1AN7 A;  2UXC H;  4JVH A;  1WHR A;  1XRH A;  3OSS D;  2G8Y A;  2PY9 A;  2CPQ A;  2Y3M A;  4B8T A;  2BL5 A;  1J5E H;  3T1Y H;  4B3S H;  4DV3 H;  4LF4 H;  2PQU A;  4LFB H;  1PQX A; 
#chains in the Genus database with same CATH homology
 2CTF A;  1X4N A;  2DGR A;  4BA1 I;  2NN6 G;  2YQR A;  2JA9 A;  4JVY A;  2OPV A;  1X4M A;  5C0X G;  2MJH A;  2FMR A;  1VIG A;  4WAL A;  2JZX A;  2HH3 A;  3VKE A;  1WE8 A;  4BA2 I;  2AXY A;  3U1K A;  1TUA A;  1WVN A;  2JVZ A;  1K1G A;  3AEV B;  1ZTG A;  2CTL A;  2BA0 A;  3L7Z C;  4IFD G;  2P2R A;  1J5K A;  1DTJ A;  2ANN A;  2CTM A;  2Z0S A;  3V69 A;  1VIH A;  2JE6 I;  1ZZK A;  2JEB I;  5JEA G;  2CTJ A;  1J4W A;  1KHM A;  4WAN A;  4LIJ A;  1DT4 A;  2CTK A;  2CTE A;  4NBQ A;  1ZZI A;  4AIM A;  4QMF B;  2E3U A;  2HH2 A;  2QND A;  1ZZJ A;  2PY9 A;  4JVH A;  1EC6 A;  2CPQ A;  4OO1 G;  4B8T A;  2BL5 A;  2OPU A;  2ANR A;  5K36 G;  2PQU A;  2JEA I;  4AM3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...