1VIGA

Nmr study of vigilin, repeat 6, 40 structures
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
71
structure length
71
Chain Sequence
INRMDYVEINIDHKFHRHLIGKSGANINRIKDQYKVSVRIPPDSEKSNLIRIEGDPQGVQQAKRELLELAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VIGILIN
publication title Three-dimensional structure and stability of the KH domain: molecular insights into the fragile X syndrome.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ribonucleoprotein
total genus 9
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 1995-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 1vigA00
2PY9A 4AIMA 1DTJA 4JVHA 2HH2A 2CTJA 1ZZKA 2JE6I 1WVNA 2OPVA 2JZXA 3V69A 1VIGA 2BA0A 4LIJA 2CTKA 4OO1G 5JEAG 4BA1I 2E3UA 2HH3A 1X4NA 2AXYA 3AEVB 2JA9A 2NN6G 4AM3A 2BL5A 1J5KA 2CTFA 1K1GA 2QNDA 5K36G 1J4WA 3VKEA 2JVZA 2P2RA 2CPQA 2Z0SA 4B8TA 2ANNA 2YQRA 2OPUA 2CTLA 3L7ZC 2CTMA 2JEBI 4QMFB 1ZTGA 1X4MA 1TUAA 2CTEA 2ANRA 1ZZIA 1DT4A 2JEAI 4NBQA 3U1KA 4WALA 4IFDG 1EC6A 2FMRA 1ZZJA 1KHMA 4BA2I 2DGRA 4WANA 4JVYA 2PQUA 1VIHA 2MJHA 5C0XG 1WE8A
chains in the Genus database with same CATH superfamily
2LTLA 2UUBH 1DTJA 5DT9A 2CTJA 1V8CA 2JZXA 4GKJH 4X66H 2BA0A 2G8YA 4OO1G 5JEAG 4OCHA 1S20A 1X4NA 1XNRH 1WHRA 2O4CA 2AXYA 2JA9A 2Y3MA 1MSZA 3UOEA 2UUAH 3VKEA 4B8TA 2CWFA 3NCVA 4DR5H 1I94H 1XNQH 3JAMW 4DR1H 4B3SH 2ANRA 4DR7H 1X4MA 1TUAA 2CTEA 4K0KH 4LFAH 2HHHH 1EC6A 1ZZJA 1J5EH 2CPMA 3J80W 1SEIA 1HR0H 2UUCH 4LF9H 1WTJA 1PQXA 4AIMA 3GKUA 2CWHA 2JE6I 2OPVA 3GR5A 4X62H 3V69A 4JI2H 1VIGA 3J81W 3GABA 4LIJA 4FJSA 3KDKA 5FLXW 3SB1A 2M8WA 2NN6G 4FJUA 4JI8H 1K1GA 2QNDA 4JI5H 4X64H 4JI6H 1NXUA 4LF4H 4DR6H 2ANNA 3FAUA 4DUZH 1XMQH 5IWAH 4JI0H 1IBMH 2UXCH 3T1HH 2CTLA 1ZTGA 2JEBI 3EZJA 4G08A 4QMFB 3OETA 3J7AK 4NBQA 3U1KA 4NZRM 2ZQEA 1IBLH 2LTMA 2F4VH 1HNZH 4WANA 2A1SA 1N36H 4NXNH 4AQYH 4LFBH 1F0XA 2K1HA 4PDBA 5BR8H 2HH2A 1IBKH 4DR4H 2UXBH 4JVHA 2M6QA 4DV4H 4NZTM 1WVNA 4H8AA 2FPHX 1N32H 4YHHH 1I6UA 4BA1I 4JI4H 1HNWH 4DV1H 3AEVB 4LF8H 4DUYH 4AM3A 1Z2IA 1S03G 2BL5A 1J5KA 2CTFA 3KDGA 4E9JA 4LFCH 4JV5H 5LMNH 2VQFH 4OD6A 1X0AA 3RF2A 3L7ZC 2CTMA 4X65H 4B3TH 1ZZIA 1DT4A 4DV3H 2JEAI 5IT9W 5A2QW 2VKCA 4DV5H 4DV6H 2UU9H 1AN7A 1N33H 4BA2I 5LL6b 4OX9H 1VIHA 4JI3H 5C0XG 1UG8A 4EC5A 4JI7H 2PY9A 2VQEH 1ZZKA 3T1YH 1VBIA 4JYAH 2LF0A 4DV0H 2CTKA 2D9IA 2E3UA 2HH3A 1XMOH 2PT7G 4DV7H 2LRRA 5LMUH 4LF7H 3OSSD 3OTOH 1FJGH 4DR3H 1J4WA 4YY3H 2JVZA 2P2RA 2CPQA 2Z0SA 4KHPH 2UXDH 2FFMA 1X9ZA 2OPUA 2YQRA 5K36G 1ODHA 1N34H 1XRHA 2E5LH 4LF5H 4NXMH 4B3MH 4WALA 1HNXH 4IFDG 2FMRA 4DR2H 1KHMA 2DGRA 1V9NA 3I0PA 4DV2H 1FKAH 4JVYA 4B8CD 3QD7X 2PQUA 4B3RH 2MJHA 4JI1H 2ZM6H 4LF6H 2X06A 1WE8A 4GKKH
chains in the Genus database with same CATH topology
2PY9A 4AIMA 1DTJA 4JVHA 2HH2A 2CTJA 1ZZKA 2JE6I 1WVNA 2OPVA 2JZXA 3V69A 1VIGA 2BA0A 4LIJA 2CTKA 4OO1G 5JEAG 4BA1I 2E3UA 2HH3A 1X4NA 2AXYA 3AEVB 2JA9A 2NN6G 4AM3A 2BL5A 1J5KA 2CTFA 1K1GA 2QNDA 5K36G 1J4WA 3VKEA 2JVZA 2P2RA 2CPQA 2Z0SA 4B8TA 2ANNA 2YQRA 2OPUA 2CTLA 3L7ZC 2CTMA 2JEBI 4QMFB 1ZTGA 1X4MA 1TUAA 2CTEA 2ANRA 1ZZIA 1DT4A 2JEAI 4NBQA 3U1KA 4WALA 4IFDG 1EC6A 2FMRA 1ZZJA 1KHMA 4BA2I 2DGRA 4WANA 4JVYA 2PQUA 1VIHA 2MJHA 5C0XG 1WE8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PY9 A;  4AIM A;  1DTJ A;  4JVH A;  2HH2 A;  2CTJ A;  1ZZK A;  2JE6 I;  1WVN A;  2OPV A;  2JZX A;  3V69 A;  1VIG A;  2BA0 A;  4LIJ A;  2CTK A;  4OO1 G;  5JEA G;  4BA1 I;  2E3U A;  2HH3 A;  1X4N A;  2AXY A;  3AEV B;  2JA9 A;  2NN6 G;  4AM3 A;  2BL5 A;  1J5K A;  2CTF A;  1K1G A;  2QND A;  5K36 G;  1J4W A;  3VKE A;  2JVZ A;  2P2R A;  2CPQ A;  2Z0S A;  4B8T A;  2ANN A;  2YQR A;  2OPU A;  2CTL A;  3L7Z C;  2CTM A;  2JEB I;  4QMF B;  1ZTG A;  1X4M A;  1TUA A;  2CTE A;  2ANR A;  1ZZI A;  1DT4 A;  2JEA I;  4NBQ A;  3U1K A;  4WAL A;  4IFD G;  1EC6 A;  2FMR A;  1ZZJ A;  1KHM A;  4BA2 I;  2DGR A;  4WAN A;  4JVY A;  2PQU A;  1VIH A;  2MJH A;  5C0X G;  1WE8 A; 
#chains in the Genus database with same CATH topology
 2LTL A;  2UUB H;  1DTJ A;  5DT9 A;  2CTJ A;  1V8C A;  2JZX A;  4GKJ H;  4X66 H;  2BA0 A;  2G8Y A;  4OO1 G;  5JEA G;  4OCH A;  1S20 A;  1X4N A;  1XNR H;  1WHR A;  2O4C A;  2AXY A;  2JA9 A;  2Y3M A;  1MSZ A;  3UOE A;  2UUA H;  3VKE A;  4B8T A;  2CWF A;  3NCV A;  4DR5 H;  1I94 H;  1XNQ H;  3JAM W;  4DR1 H;  4B3S H;  2ANR A;  4DR7 H;  1X4M A;  1TUA A;  2CTE A;  4K0K H;  4LFA H;  2HHH H;  1EC6 A;  1ZZJ A;  1J5E H;  2CPM A;  3J80 W;  1SEI A;  1HR0 H;  2UUC H;  4LF9 H;  1WTJ A;  1PQX A;  4AIM A;  3GKU A;  2CWH A;  2JE6 I;  2OPV A;  3GR5 A;  4X62 H;  3V69 A;  4JI2 H;  1VIG A;  3J81 W;  3GAB A;  4LIJ A;  4FJS A;  3KDK A;  5FLX W;  3SB1 A;  2M8W A;  2NN6 G;  4FJU A;  4JI8 H;  1K1G A;  2QND A;  4JI5 H;  4X64 H;  4JI6 H;  1NXU A;  4LF4 H;  4DR6 H;  2ANN A;  3FAU A;  4DUZ H;  1XMQ H;  5IWA H;  4JI0 H;  1IBM H;  2UXC H;  3T1H H;  2CTL A;  1ZTG A;  2JEB I;  3EZJ A;  4G08 A;  4QMF B;  3OET A;  3J7A K;  4NBQ A;  3U1K A;  4NZR M;  2ZQE A;  1IBL H;  2LTM A;  2F4V H;  1HNZ H;  4WAN A;  2A1S A;  1N36 H;  4NXN H;  4AQY H;  4LFB H;  1F0X A;  2K1H A;  4PDB A;  5BR8 H;  2HH2 A;  1IBK H;  4DR4 H;  2UXB H;  4JVH A;  2M6Q A;  4DV4 H;  4NZT M;  1WVN A;  4H8A A;  2FPH X;  1N32 H;  4YHH H;  1I6U A;  4BA1 I;  4JI4 H;  1HNW H;  4DV1 H;  3AEV B;  4LF8 H;  4DUY H;  4AM3 A;  1Z2I A;  1S03 G;  2BL5 A;  1J5K A;  2CTF A;  3KDG A;  4E9J A;  4LFC H;  4JV5 H;  5LMN H;  2VQF H;  4OD6 A;  1X0A A;  3RF2 A;  3L7Z C;  2CTM A;  4X65 H;  4B3T H;  1ZZI A;  1DT4 A;  4DV3 H;  2JEA I;  5IT9 W;  5A2Q W;  2VKC A;  4DV5 H;  4DV6 H;  2UU9 H;  1AN7 A;  1N33 H;  4BA2 I;  5LL6 b;  4OX9 H;  1VIH A;  4JI3 H;  5C0X G;  1UG8 A;  4EC5 A;  4JI7 H;  2PY9 A;  2VQE H;  1ZZK A;  3T1Y H;  1VBI A;  4JYA H;  2LF0 A;  4DV0 H;  2CTK A;  2D9I A;  2E3U A;  2HH3 A;  1XMO H;  2PT7 G;  4DV7 H;  2LRR A;  5LMU H;  4LF7 H;  3OSS D;  3OTO H;  1FJG H;  4DR3 H;  1J4W A;  4YY3 H;  2JVZ A;  2P2R A;  2CPQ A;  2Z0S A;  4KHP H;  2UXD H;  2FFM A;  1X9Z A;  2OPU A;  2YQR A;  5K36 G;  1ODH A;  1N34 H;  1XRH A;  2E5L H;  4LF5 H;  4NXM H;  4B3M H;  4WAL A;  1HNX H;  4IFD G;  2FMR A;  4DR2 H;  1KHM A;  2DGR A;  1V9N A;  3I0P A;  4DV2 H;  1FKA H;  4JVY A;  4B8C D;  3QD7 X;  2PQU A;  4B3R H;  2MJH A;  4JI1 H;  2ZM6 H;  4LF6 H;  2X06 A;  1WE8 A;  4GKK H; 
#chains in the Genus database with same CATH homology
 2PY9 A;  4AIM A;  1DTJ A;  4JVH A;  2HH2 A;  2CTJ A;  1ZZK A;  2JE6 I;  1WVN A;  2OPV A;  2JZX A;  3V69 A;  1VIG A;  2BA0 A;  4LIJ A;  2CTK A;  4OO1 G;  5JEA G;  4BA1 I;  2E3U A;  2HH3 A;  1X4N A;  2AXY A;  3AEV B;  2JA9 A;  2NN6 G;  4AM3 A;  2BL5 A;  1J5K A;  2CTF A;  1K1G A;  2QND A;  5K36 G;  1J4W A;  3VKE A;  2JVZ A;  2P2R A;  2CPQ A;  2Z0S A;  4B8T A;  2ANN A;  2YQR A;  2OPU A;  2CTL A;  3L7Z C;  2CTM A;  2JEB I;  4QMF B;  1ZTG A;  1X4M A;  1TUA A;  2CTE A;  2ANR A;  1ZZI A;  1DT4 A;  2JEA I;  4NBQ A;  3U1K A;  4WAL A;  4IFD G;  1EC6 A;  2FMR A;  1ZZJ A;  1KHM A;  4BA2 I;  2DGR A;  4WAN A;  4JVY A;  2PQU A;  1VIH A;  2MJH A;  5C0X G;  1WE8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...