5JEAG

Structure of a cytoplasmic 11-subunit rna exosome complex including ski7, bound to rna
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
237
structure length
235
Chain Sequence
DSMSTFIFPGDSFPVDPTTPVKLGPGIYCDPNTQEIRPVNTGVLHVSAKGKVQTAYIDYSSKRYIPSVNDFVIGVIIGTFSDSYKVSLQNFSSSVSLSYMAFPNASKKNRPTLQVGDLVYARVCTAEKELEAEIECFDSTTGRDAGFGILEDGMIIDVNLNFARQLLFNNDFPLLKVLAAHTKFEVAIGLNGKIWVKCEELSNTLACYRTIMECCQKNDTAAFKDIAKRQFKEIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/rna
molecule keywords Exosome complex component RRP45
publication title Structure of a Cytoplasmic 11-Subunit RNA Exosome Complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
total genus 51
structure length 235
sequence length 237
ec nomenclature
pdb deposition date 2016-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF15985 KH_6 KH domain
G PF18311 Rrp40_N Exosome complex exonuclease Rrp40 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5jeaG01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5jeaG02
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 5jeaG03
4LFAQ 4JVHA 1SFOH 5ELOA 3D4RA 4IQZA 1IBLL 1XJVA 1YJNA 1E3PA 2E2JH 1Y8OB 2BH8A 4BY7G 3FPPA 4DR1L 1WJJA 1X56A 4YY3L 4JVYA 4JI4Q 3PUWA 2H5XA 1PH4A 1Q81C 3CMAA 2BE5C 2IHFA 2ZJRA 2BL5A 1W3SA 2GN5A 4IFDJ 4QGUA 4OONA 1MJEA 2PNHA 4LF9Q 4R4IA 2P2RA 5C44G 2B63H 2HH2A 1PH8A 1E1OA 1J6QA 2D2CC 2JA6H 1IBKL 1CKMA 1TWHH 3EIVA 4XTCS 1WI5A 1UE7A 3M85A 2CTMA 1ZZJA 3F2BA 1HNWQ 1HR0W 2CTJA 5FJ8H 1LM0A 1S3OA 3A7AB 3UDXA 4ME3A 1V9PA 1X65A 5ELNA 2Y0SE 3IKJA 1VQGA 4QQBX 5IP9G 1HPCA 2A69C 3T1YQ 4DV5Q 4NXMQ 4X64Q 3GTOH 1N33L 4LK1C 3LGJA 5BR8Q 1EQRA 3I4NH 1FL0A 4GOPC 1V1QA 3JAMc 4JCVE 3W1GA 3CCLA 1EUJA 3MXNB 1PH6A 4BY1H 3PO3H 2JVZA 3A8KE 4JI6L 3IFTA 3TS0A 1K3RA 1U0LA 3UE1A 4H13C 1N36L 2OQKA 1QJOA 2A69D 4DUZQ 1UEBA 5AJ3Q 1ZKOA 4DAMA 3M9BA 5IP7G 3KDFB 3NEMA 3I2ZA 3LNNA 2EDGA 3TS2A 2K5HA 1SRUA 1KRSA 2L5TA 1J5EL 3H0GH 4G7HC 2HQLA 1YHAA 2GVBA 4LF8Q 1N34L 3U9SA 2BH2A 2Q2UA 5C0XH 1HNXL 4KMUC 1NY4A 2Q2TA 3G71A 1B8AA 2A8VA 2MJHA 1CSQA 2WFWA 4Y7NH 4GKJL 3HKSA 1U5KA 1Q86C 5A35A 2R93G 4IFDI 2QA4A 1JB7A 1VQ9A 4JBKA 4HJ9A 4KHZA 4YCUA 2UUBQ 1VQ6A 3I4MH 1C0AA 4IJLA 4DPGA 3VR5A 1A62A 2OQ0A 2OWOA 2OCEA 4DNIA 3HOZG 1P8LA 3CD6A 5IYDG 4QJFA 1DGSA 2VUMG 1LACA 2OTJA 2Q2IA 1X6OA 4GZYC 1VQKA 1PH3A 4HJ8A 2E2HH 1VQBA 4A3EG 1OTCA 5GAEC 1YZ6A 1GJXA 4PMWA 2PPBC 1IBMQ 5IYCH 2EJGC 5LMNL 4JBMA 4X66L 1SLJA 3OW7A 3G6EA 1IL2A 4A3KG 2LXKA 3ND9A 3D31A 1V43A 5IYBH 1Y1VG 5LMUQ 2JEBI 1E24A 2PQAB 4YCVA 2V1CC 2VZAA 3FP9A 4JI3Q 2JA7H 3K7AH 4A3BG 2UXDQ 4DV4L 3PUZA 4BXXG 3UE0A 1H9JA 1WCMG 4AH6A 1KQSA 4RG1A 3VA7A 2CW0C 4DR6Q 4GNXB 3A8JE 4A3LH 3A7LA 3GTKH 3FMCA 3GO5A 2JZXA 4DK3C 1V8QA 2UU9Q 4DV6L 2N8NA 1H9KA 3F2DA 3G4SA 1K8GA 1JT8A 3VKEA 5IT9c 2AXYA 4J15A 4C2MH 4WALA 1PYSB 2N78A 1ZZIA 2VQFQ 4XIGS 2PNRC 3TZUA 1A0IA 4KKSA 1HJPA 4BBSH 3A5ZB 2PI2E 4JK1C 1UE6A 5JJIA 4JI0Q 5K36G 1NMGA 1K1GA 2KENA 1NTGA 1B70B 2PQAA 1QVFA 1E1TA 2MO1A 1L1OB 5JEAG 5FLMH 1KRTA 4APVA 2UXBL 2YTYA 1H9SB 2OPVA 4L5QA 3FKIH 2VY3A 4B3MQ 4JI8L 2HT1A 3A5UA 2VNUD 1HZAA 1CSPA 2LSSA 4O2DA 1XTDA 1SMXA 5C3EH 1GUGA 4AQYL 3PV0A 4UP7A 4NBQA 3S24A 4A3JH 2N49A 1I94L 4LFAL 2D5DA 4B3SQ 2IHEA 3CC2A 2ASBA 1AE2A 3PIOA 3CPFA 1BBUA 1HTPA 1YNNC 1HR0Q 2CTEA 1PH2A 1KXLA 1TXYA 4DV7L 4LF6L 1O78A 3AB9A 4IJHA 2ZM6Q 2KHIA 3GDEA 4YCWA 3OTOQ 2JK8A 5C0XJ 3MEFA 1VQIA 4DR7Q 4GLXA 4X62Q 1KHIA 1K8AC 3U4VA 4H02A 1X4NA 1JE5A 1PHJA 4HIKA 5M3FH 3JAMi 2DNEA 3J7ZC 1HNWL 1LABA 2R7FA 1L0WA 2CFMA 3UDIA 2KHJA 2WB1G 1N8RC 3J7A5 3CCVA 1EIFA 1PH9A 1UE1A 5BN3A 4JI7L 3ULLA 2K5NA 3A74A 4AM3A 1BKBA 4DV5L 4A3DH 4X64L 2R7ZH 3GTJH 3PO2H 1EC6A 2UUAQ 2EJMA 1B7YB 2FMRA 1AE3A 1HNZL 2NVYH 1DTJA 2PQUA 4OO1G 2E75C 3BJUA 1C7YA 3ULPA 1YVCA 3KOJA 2HIVA 5GQOA 1OXVA 4UY8C 4DUYQ 4B8TA 1FR3A 5JJLA 4DR5Q 1BDOA 1GD7A 3VR3A 3HOYH 1GUOA 2KCCA 2CWPA 5GAGC 1Y69U 2AWNA 3S1NH 4P74A 4NB3A 4JV5L 4DUZL 1UWVA 3GTPH 3E9IA 5DLQE 2K50A 2E5LQ 1XMQQ 1KHMA 3W5OA 4B3TL 5FLXc 1K0RA 2EIFA 1Z47A 1K8OA 2OPUA 4L5SA 2JA6G 4LF8L 4DR2L 3WDNA 4GKKL 2ANNA 3U4ZA 2K32A 4A3MG 4LJZC 2AHOB 3I56A 1TWFH 4PG3A 2BDOA 1GO3E 2AUJD 5FJ8G 1X3FA 2QGQA 4LFBL 1XNRQ 4DR4Q 1Q46A 2NN6H 1GUNA 2JA5H 4OXPA 4JI1Q 1IYVA 2CPQA 3TQYA 1I50H 1MKHA 3GTLH 4QMFB 4LUOA 3L0OA 2Y0SG 4HR7B 1EOVA 1Z7TA 4KLKA 3IRBA 2L15A 1VCIA 2K7VA 4EX5A 3S14H 1RIPA 1YJ9A 5C0XI 2YYZA 5M3MG 1FGUA 1FJGQ 1XMOQ 3I4NG 4K0KQ 3QIAA 1IXRA 2VL6A 2BE5D 4C3HH 1G291 2XGTA 2D0OA 4BY1G 3PO3G 3S1MH 4JBWA 2KA7A 2ZTDA 1G6PA 1XPUA 2R7DA 4JI2L 4FDBA 1GHJA 3DM3A 2K33A 5BN5A 1IBML 2IX0A 4GN3B 1EWIA 4GNXC 3AQQA 3OW2A 1UE5A 3HOWG 4DNRB 2QNDA 1WE8A 1NMFA 1X54A 2HIXA 4A3IG 4LF5Q 1HCZA 3B6YA 4IPDA 1ONLA 3DLLA 1SROA 3SE0A 3HOXG 2ZT9C 2E76C 4NPSA 3ER0A 3K0XA 4R1JA 5H1SE 5JJKA 2PY9A 3E9HA 4BBRG 1GUSA 1SN8A 3ERSX 4A3CG 2AWOA 3CC4A 4DV0Q 2UU9L 1VQ5A 2NVTH 1J4WA 5C4XG 4PV1C 1H9RA 1L1OC 3TRZA 1IBLQ 2B8FA 3RNUA 4DR1Q 1TU2B 4IPHA 3T1HQ 1ZYRC 2JQOA 4JOIC 4LUVA 2Z6KA 4JI0L 5IP7H 2VQEL 4DV3L 2E74C 3RLNA 2CTLA 1WOCA 5EAYA 1TKWB 3HKZE 3PUXA 2JJQA 2KCTA 5IYCG 3CRKC 3M7NA 1I3QH 2K5VA 4GLVB 1J5KA 4JI5L 4UPAA 3RR5A 3KF8B 2DGYA 4KHPQ 4DK1A 4DV1Q 3HOVH 4LF4L 4A3GG 3NENA 2HHHQ 3NE5B 3T56B 2JA7G 4LF7Q 2JXMB 4DR3L 1C9OA 3CXCA 3CMEA 3AEVA 2EVBA 2YV5A 4B3SL 2R93H 1X55A 4I7ZC 4TQUS 1GM5A 1KL9A 3PUYA 4A93G 3KJOA 4HJ7A 2FXQA 1Y14B 3HOZH 4WJ3M 5IYDH 1VF5C 4IFDG 1M1KC 2UUCQ 1PVOA 3NBHB 4X65L 4QL5A 1YI2A 1HR0L 3EQLC 4L8JA 1FVIA 1O7LA 4POGA 2F4VQ 3U58A 1QZGA 1N9WA 4MTNA 5IWAL 3OTOL 5HGQA 4KKTA 1PYBA 4DR7L 2A68C 2DN8A 3H3VI 1JJGA 1N36Q 2KBNA 4LFCL 4KN4C 2Q2HA 3H15A 5IE8A 4A3KH 1BVSA 3PGZA 4B3RQ 2DUDA 1PH7A 2MO0A 2K75A 3AFQA 4JYAL 1L2FA 1CKOA 4A75A 1D7QA 3H94A 1SE8A 1HH2P 5FLMG 3OPOA 4ALPA 3L7ZC 4A3BH 3RN5A 2PMZE 4A3FG 1EIYB 3DXJC 4L5TA 2UXCQ 1HNXQ 1KD1C 1X3GA 1WCMH 3VR6A 3I7FA 1YIJA 1VQPA 3VR4A 1KAWA 5C3EG 4YHHL 4IPGA 1OXXK 1VQ7A 2XTIA 4GKJQ 1IW7C 4H0LC 3PF5A 3CCUA 1I6VC 3I72A 3BDOA 4GN4B 4R4CA 1H95A 3F2CA 2Q8IB 1NJIC 5E7NA 2OTLA 3F8TA 1XNQQ 4IOCA 2CCZA 2D0PA 3N6RA 4PZ8A 2E5LL 5K36H 2VS1A 4GOPA 2A19A 2E3UA 3H3VH 1PMRA 5KNDA 3BU2A 2NVXH 1IW7D 4P71A 3KLRA 5LMNQ 4DV2Q 4JI4L 3M4PA 2E2IH 2EXDA 5M3FG 3KF6A 1ASYA 1VS0A 1VQNA 1Z9FA 2K14A 1XNRL 4LF9L 3U50C 1TWCH 3RZOH 2ZTCA 3E0EA 2CQOA 1NE3A 2JA8H 4A3DG 2CWAA 2R7ZG 3PO2G 1VQLA 4DV4Q 3AYHB 1EFWA 2AKWB 2AUKA 1VQFA 3CRLC 3BZKA 3D0FA 3A0JA 3LWUA 3CP0A 1GKHA 1XMOL 4X6AH 3PIPA 1LTLA 4HJ5A 1Q82C 3J81j 4DK6C 1H9MA 1Q1EA 2NN6I 4DV6Q 3T1YL 4NXML 1Y1WG 1DCZA 4POFA 3PSIA 2B8GA 2PI2A 1Y8NB 5BR8L 1E22A 1HZBA 1PFSA 4A4IA 3S1RH 2JA9A 1CUKA 3CW2C 1EYGA 3ICEA 2MQHA 2F3IA 4PZ7A 1PA6A 1DD2A 3HOUH 2QEXA 2UXBQ 5AJ3L 3TREA 2PCFB 1W2BA 4JI8Q 1T9HA 1PH5A 1O7IA 2B63G 1YNJC 2I5MX 1IYUA 3HGBA 3CF5A 2IT1A 1VQCA 4AQYQ 1E2VA 1VIHA 1N32Q 1Y8PB 1I94Q 2R92H 1I5FA 2EJFC 1B9MA 4OGQC 3STBC 1IYJB 1WYDA 3VDYA 1GVPA 1DT4A 3T1HL 2HH3A 4G7ZC 1Q1BA 3CPWA 4R4TA 1YHBA 3J81i 1EQQA 1I6HH 4DV7Q 1P16A 4LF6Q 5LMNW 3GTMH 3SGIA 3QJYA 3J80i 1X3EA 3UDFA 2UUBL 2RHQB 4DAYB 2O5JC 3TEHB 1WVNA 4BY7H 1VIGA 4OX9Q 2RHSB 4NXNQ 2CTKA 4A3MH 1Z6HA 4QY7A 3STBD 3W1BA 1XPOA 1B9NA 4KHPL 1FYCA 4OWTB 4DV1L 4BA2I 4LNQA 1MIUA 2HHHL 5C44H 4LF7L 3G48A 2JE6I 1E7ZA 4JI7Q 4TKOB 3U1KA 4HIMA 2IX1A 1ZZKA 1VQHA 4O0AA 1QVCA 1DXMA 4MNOA 3UDGA 2CKZB 3S1QH 1HNZQ 5LMUL 1WFQA 5M3MH 1QVGA 2UUCL 4YWKA 3H0GG 1D8LA 4JI3L 4AYBG 2C35B 1HZCA 5IP9H 4LIJA 2UXDL 2F4VL 2YQRA 2A6HC 1JJCB 5C0XG 4IOAA 5JEAJ 1S72A 2MFIA 4IO9A 5C4JH 2K52A 4L5RC 4JC0A 4DR6L 4AYBE 1OXSC 3SDZA 4JV5Q 3HOWH 1ZTGA 2NZHA 2E8GA 4HIDA 1K9MC 4B3RL 1A8VA 4P73A 3EN2A 1G51A 1LYLA 3I4MG 1PV4A 3AEVB 5GADC 1VQOA 4B3TQ 2VQFL 1PH1A 4A3IH 4GLAC 4DR2Q 1Q12A 1SR3A 3HKZG 4GKKQ 4YY3Q 3CCMA 3PF4A 3HOXH 1OXUA 1K8MA 1VQDA 2A6HD 4EQ5A 2UXCL 1JMCA 4RCNA 2ZJPA 3A8IE 3HOVG 4LFBQ 1IZ6A 4BBRH 4PZ6A 3PCOB 4WANA 4R4QA 2ES2A 4HJAA 4A3CH 1VQ8A 1Q8KA 3ULJA 1IBKQ 5C4XH 2YTVA 5BN4A 3CCJA 1TWAH 5M5XH 5J3BA 3ZJYC 2QF7A 3GTGH 4B3ML 2EQSA 2VW9A 4UP8A 5M5WH 5IYBG 1XNQL 3VR2A 3KDFA 4HIOA 1T5EA 3J81c 3OYYA 2R6GA 3F1ZA 1HZ9A 2KCMA 4GS3A 3J80c 3Q8DA 1N33Q 1RL2A 4RMFA 4JI2Q 4A3LG 4DV2L 1QZHA 2F1MA 2LXJA 2VUMH 2BA0A 4YWLA 4C3JH 1NBWA 2LMCB 3CCRA 4A76A 2A6EC 2DNCA 3RZDH 4A3EH 2ZM6L 2DGRA 3JC66 1ASZA 3BZCA 4A3GH 2ZTEA 4JI6Q 4OWWB 3M4OH 4X62L 2A1AA 2ATWA 4AIMA 3PUVA 4LWCA 4BBSG 1TWGH 3OOCA 3S2HH 2V4DA 3K7UC 3GQBA 1EWHA 4H44C 4DKAC 1X4MA 4A93H 1YJWA 4GOPB 1Y1VH 1J5EQ 2YTXA 1TUAA 4IFDH 4C3IH 4KN7C 1SMYC 5M5YH 3GTQH 1N34Q 3S16H 1CFMA 3K81C 2A6ED 3P20A 2UUAL 3WWVA 3FKIG 2CTFA 3ND8A 4QIWE 4BXXH 3S17H 4DNTB 5GAHC 1XPRA 2A68D 3KF6B 3GD7A 1K83H 1S40A 2D62A 2WP8J 3M4YA 3RLOA 4GN5A 3W3AA 4A3JG 1VQEA 1VQ4A 4R4OA 4G7OC 4MZ9A 3T53B 4YWMA 1GUTA 4DUYL 2WAQG 2VQEQ 1Q7YC 4DV3Q 4P72A 2ANRA 4OWXB 2ID0A 4DR5L 5GROA 2B3GA 3HFZB 2YU9H 5KNBA 2GVAA 3KYHC 4IPCA 1M90C 4JI5Q 2WAQE 5IY0A 4A3FH 2I5HA 2N3SA 4GNXA 1CTMA 1XMQL 1A63A 3AFPA 1CI3M 5KNCA 4LF4Q 3KLWA 3CCQA 1E2WA 2Z0SA 2IY5B 2JA8G 2K4KA 4DR3Q 1N32L 2I5LX 4X66Q 5JEAH 1YEZA 1K73C 4Y52H 3V69A 3QG1A 1QUQB 1YNXA 4DR4L 3T51B 3FHWA 1CKNB 3MFYA 1VQJA 4X65Q 4JI1L 4KKUA 4OO1I 3RLFA 3CC7A 1OXTA 1MJCA 4JG2A 3KFUA 1KIXA 3M4QA 2NVQH 1L1OA 5IWAQ 1H9SA 4OX9L 2Z6KC 1FJGL 3CQZH 4NXNL 3BG3A 4K0KL 3K8AA 1BBWA 1YITA 4KI0A 4WJ4A 4LFCQ 3EBEA 3I73A 2I0QA 1R9TH 1VQMA 3S15H 2B29A 4JOIA 1LUZA 3K80C 2BA1A 1HQMC 1A6XA 1VF7A 3I55A 3HOYG 1AH9A 4UP9A 4JYAQ 3HOUG 1KC8C 1YBYA 4LUZA 1YHQA 3S2DH 3MXUA 3M3YH 1QUQA 4JBJA 5HY6A 2ZJQA 2O5IC 3I4OA 3NELA 1CKNA 2WB1E 1Q90A 4LW1A 4TVAB 4YHHQ 2MNAA 1E2ZA 2RCNA 4LF5L 1JJ2A 1GHKA 2JEAI 4DK0A 2NZOA 2AMCB 2R92G 3L2PA 3KJPA 3CCSA 1Y1WH 3CCEA 1X9NA 2RF4A 3RN2A 3CAMA 1VQAA 2NN6G 4P75A 2ALYB 3I4LA 2F52A 2JA5G 4OO1H 4DV0L 4BA1I 1VDZA
chains in the Genus database with same CATH superfamily
4LFAQ 2F0MA 3T13A 3W2DA 4JVHA 3J7YW 1SFOH 5ELOA 3D4RA 4IQZA 5I9PA 4OD6A 2F0VA 1IBLL 1XJVA 1YJNA 3T1YH 1E3PA 2E2JH 3NWSA 1OO9B 1Y8OB 4NXMH 2HUGA 1QILA 2K5QA 4MIUA 2BH8A 1BBXC 2LFNA 4BY7G 3FPPA 4DR1L 1WJJA 1Y1WB 3RD4A 5K5PA 4CBVA 5E1FA 4O42A 2QILA 1X56A 4YY3L 4JVYA 4JI4Q 3PUWA 4ABNA 2H5XA 1PH4A 5G3LD 5JPMC 5L37A 5A2QE 3CMAA 1Q81C 2BE5C 2IHFA 2ZJRA 1VMPA 2XNAC 2BL5A 1W3SA 1EU3A 5EBCA 3S1NB 2GN5A 3JAME 4IFDJ 4QGUA 5HGTA 4LMQD 3R2IA 3GV3A 4OONA 2G9DA 3SK5A 1EY7A 1F9SA 1MJEA 4IALA 2PNHA 1QOHA 1EEFD 4LF9Q 4R4IA 1JR0D 1CZGA 1YNJD 3HEJA 4F8MA 2P2RA 1LV9A 5C44G 2G5DA 1SFOB 3P75A 2B63H 2O2LD 2HH2A 1PH8A 1E1OA 1WTOA 1J6QA 2D2CC 2KEEA 5DEHA 2O4CA 1I4GA 3AMUA 2EYMA 1CHPD 2JA6H 4CJ0B 1IBKL 1CKMA 1TWHH 4CJ1B 4G08A 3EIVA 4XTCS 1D5MC 3EROA 1WI5A 1UE7A 3M85A 2CTMA 1ZZJA 3F2BA 1HNWQ 1HR0W 5ELCA 2CTJA 5FJ8H 1LM0A 3J7AK 1TWFB 1EY6A 1S3OA 2P5ZX 3A7AB 3UDXA 1AZPA 4IN3A 2ZXOA 1V9PA 2C9OA 3ONAB 1X65A 3KBXA 4ME3A 5ELNA 2DY8A 2Y0SE 3IKJA 1VQGA 3TMEA 3J81L 4QQBX 5IP9G 2B63B 1HPCA 2A69C 3T1YQ 4V190 4DV5Q 2TMPA 4HCEA 4NXMQ 4X64Q 1S4ZA 3GTOH 3SB1A 1VMCA 1N33L 1CQFA 2B2WA 2WKDA 4UHVA 3J80L 2M00A 1U4LA 1TWHB 4LK1C 3LGJA 3SK8A 1G91A 3MEHA 3D6WA 2EY1A 1SNOA 5BR8Q 3K57A 1EQRA 1F2ZA 3S14B 1JOKA 5CORA 3I4NH 4DR1H 3G6JB 1FL0A 4RGTA 4GOPC 3T1HH 1V1QA 2B2UA 3JAMc 2CVRA 5DNFA 1EFID 3T4AC 4JCVE 3FAUA 3W1GA 2HDMA 3CCLA 1EUJA 3MXNB 1PH6A 4BY1H 1LT6D 1TQOA 3PO3H 1LTRD 2PW5A 4C3HB 2JVZA 3A8KE 1LT4D 2QEJC 3GTOB 2C5CA 1EU4A 2F4IA 4XQJA 3HRZC 4JI6L 4FJSA 3IFTA 3TS0A 3FVQA 1K3RA 3R8BA 1PDQA 1U0LA 2UUBH 3UE1A 4H13C 1N36L 2OQKA 1QJOA 2A69D 2LF0A 2RSOA 4DUZQ 1UEBA 5AJ3Q 1SDFA 1DOLA 1ZKOA 4DAMA 3M9BA 4FF1A 5IP7G 3KDFB 3NEMA 1JWUD 1CT1D 5G3LF 3I2ZA 5LL6S 3I4NB 1O80A 3LNNA 1DONA 3NBIA 3BZDB 1ILPA 4DGZA 2EDGA 3TS2A 2K5HA 1SRUA 1KRSA 2L5TA 4KHPH 1DJRD 1J5EL 1ZEQX 1JOOA 3NP8A 4DV1H 3H0GH 4G7HC 2HQLA 1YHAA 2GVBA 2TSSA 4EQNA 4LF8Q 1I4XA 1N34L 1AW7A 3U9SA 2BH2A 2HHHH 4PNYA 3TSSA 1I4RA 1B1ZA 2Q2UA 4LF7H 2R61A 4X3TA 3Q6SA 1TS4A 5C0XH 1HNXL 2PZUA 2J4XA 4KMUC 1NY4A 1I4QA 5KRUA 2Q2TA 2GA4B 2XWJB 2IW3A 3G71A 1B8AA 2A8VA 1JOQA 2MJHA 3VYSA 1CSQA 2WFWA 4Y7NH 4E9JA 2ENBA 2F0TA 1NR2A 4ZCKA 4GKJL 3HKSA 1UAPA 5LMUH 2X6LA 1CA6A 2IPKD 1U5KA 1Q86C 5FLXW 3EVQA 5A35A 2A73B 5CBEE 2R93G 2UUCH 1JB7A 3KUPA 2QA4A 1VQ9A 4JBKA 4BWGB 4HJ9A 4IFDI 4KHZA 3H0GB 2FINB 4YCUA 2UUBQ 4AYBB 1VQ6A 3I4MH 3R93A 1C0AA 1S5ED 4IJLA 1X3PA 5CV9A 3VR5A 4DPGA 2UXDH 1A62A 2F4VH 2OQ0A 2OWOA 2OCEA 4DNIA 3HOZG 1P8LA 3H6MA 3CD6A 5KYLA 5IYDG 4QJFA 1DGSA 1WHRA 2VUMG 3DM1A 2B2TA 1LACA 3DUZA 2OTJA 4C3JG 3K6OA 2Q2IA 4IUPA 4DR6H 1R4QB 1X6OA 4GZYC 3BVGA 1VQKA 4Y7NB 1PH3A 4HJ8A 2L55A 2E2HH 1VQBA 4EQOA 2B2VA 4FF4A 4A3EG 4IUQA 1OTCA 5GAEC 2SOBA 1YZ6A 4ZQ3A 5IT9E 1GJXA 4PMWA 3C3LA 3VYRA 4IURA 2FJ2A 3NQIA 4B3RH 2PPBC 1Z2IA 1IBMQ 5IOCA 5IYCH 2EJGC 5LMNL 3I4MB 4JBMA 4X66L 4KD3A 1SLJA 4F88A 1STEA 2VQFH 3OW7A 3G6EA 4B08A 1I3QB 1BCPB 1IL2A 4A3KG 2LXKA 4RGOS 3ND9A 4XQNA 3HKZB 3D31A 4J8QA 2RDFA 1LTSD 4C56C 4HSPA 1V43A 2UXCH 5IYBH 1Y1VG 5LMUQ 1ESFA 2E2HB 2JEBI 5ELDA 4C3IG 1E24A 2PQAB 4YCVA 3HOVB 1EQVA 2V1CC 2VZAA 3FP9A 4JI3Q 4IUTA 2JA7H 3K7AH 4ZYSA 3BYTB 3MXPA 5COYA 5NUCA 3F2UA 4A3BG 1SE2A 2X69A 1F77A 2UXDQ 4DV4L 4GKJH 3PUZA 1S5FD 2A74C 4RAUC 1I6UA 1KLUD 4BXXG 3UE0A 1H9JA 1WCMG 5E4WC 4AH6A 1KQSA 4RG1A 4RHRA 3VA7A 2CW0C 5A2QW 2DJGC 2LKVA 4DR6Q 4GNXB 1AFPA 3A8JE 3JAMW 4A3LH 2ICEC 3A7LA 3TP6A 3GTKH 4B3MH 3FMCA 1U4MA 3GO5A 2JZXA 3KF8A 4DK3C 2M8WA 1F2MA 1V8QA 1XNQH 3NSWA 2UU9Q 4DV6L 2N8NA 1H9KA 4FP5D 3F2DA 3NPPA 4RA8A 3G4SA 2KUMA 4IUUA 1G8ZD 1K8GA 4CDDC 1JT8A 1SE3A 3VKEA 4X3SA 5IT9c 2AXYA 3K7AB 4J15A 1E0BA 4C2MH 4WALA 2JN4A 3CHBD 1PYSB 2N78A 1ZZIA 2VQFQ 3A55A 5FO9B 4XIGS 2PNRC 3TZUA 1A0IA 4KKSA 1ET6A 1HJPA 1HQRD 4BBSH 1MD2D 3A5ZB 2PI2E 4JK1C 1UE6A 3NTHA 5JJIA 4DV2H 4JI0Q 2MHVA 5K36G 1NMGA 1RF2D 4IUVA 3C46A 3SEBA 1K1GA 2X06A 2KENA 4P2CB 3NBHA 4KV6A 1NTGA 1B70B 2PQAA 3QOLA 4DA2A 1QVFA 1SYFA 3K5MA 1ENAA 5C3XA 1E1TA 3FRPB 2MO1A 2B2WC 1L1OB 4C2MB 5JEAG 5FLMH 2KOLA 1KRTA 4APVA 2UXBL 2YTYA 1H9SB 2OPVA 3KK7A 2MGSA 3X3NA 4L5QA 3FKIH 1I4HA 3O13A 2VY3A 4B3MQ 4JI8L 4BBSB 2HT1A 3A5UA 2VNUD 1HZAA 2O4XA 1CSPA 1V1OA 2LSSA 4HCSA 3A54A 4O2DA 1XTDA 1SMXA 5C3EH 1A3UA 1GUGA 4AQYL 3PV0A 3I90A 4UP7A 4NBQA 3S24A 4A3JH 2N49A 1I94L 4LFAL 2EE1A 2D5DA 4B3SQ 3A56A 2IHEA 4ILWA 1S03G 1NXUA 5EGTA 3CC2A 2ASBA 1AE2A 4L6TB 2F0JA 1KABA 3PIOA 1GXDC 1JWSD 4LAAA 3CPFA 3FKIB 1BBUA 5EPKA 4XT1B 1HTPA 5I9OA 3R2TA 1YNNC 1HR0Q 3V05A 2CTEA 1B3AA 1WTRA 1PH2A 3EFXD 4PQXA 4R8IA 1KXLA 2NB0A 1TXYA 5C3EB 4DV7L 4LF6L 4U673 1O78A 3AB9A 4IJHA 4A3JB 2CWFA 2ZM6Q 2KHIA 1SNCA 3GDEA 3FEWX 4DUYH 4YCWA 3OTOQ 2JK8A 2WAQB 2F0OA 5C4ZA 5C0XJ 2J0TD 3MEFA 1VQIA 4DR7Q 4GLXA 3P7JA 4X62Q 1KHIA 4DFAA 5D3DA 1TIID 3DWAA 1K8AC 3U4VA 2JP1A 2F0LA 4MN3A 2K1BA 1MHWC 4H02A 2NVXB 1X4NA 3KDGA 1JE5A 1PHJA 4HIKA 5M3FH 1UG8A 3JAMi 2UXBH 2DNEA 3J7ZC 5JVG3 1BR9A 1HNWL 1HRJA 1LABA 2R7FA 4KJNA 1L0WA 1PZID 1B4OA 2CFMA 4XYQA 2MP1A 3UDIA 1XMQH 2KHJA 1M4VA 5FLXE 1WTQA 2WB1G 1N8RC 1PRTD 3D3RA 4NDXA 1EIFA 3CCVA 1PH9A 3J7A5 1UE1A 1YNND 5BN3A 4JI7L 3GP7A 3ULLA 2K5NA 2QCPX 3A74A 2L0CA 3PMFA 4AM3A 1BKBA 4DV5L 1L0XB 4A3DH 2HCIA 4X64L 1FKAH 4K6DA 2R7ZH 4AQYH 5CBAE 2EY6A 3GTJH 3PO2H 2F0WA 2PZTA 1EC6A 2L4NA 2UUAQ 2JA8B 2EJMA 1B7YB 1KLGD 2NTTA 1AE3A 2FMRA 2EOTA 1BOSA 1I94H 1N32H 5D14A 1PYWD 4O1NA 4NKLA 1HNZL 2NVYH 1DTJA 2PQUA 4OO1G 2E75C 3BJUA 1C7YA 3ULPA 1YVCA 2B2VC 3KOJA 5IODA 5KGUA 2HIVA 5GQOA 5CGKA 1II3A 5DM63 2RBMA 4DR4H 1OXVA 5EJWA 1S5BD 4UY8C 4DUYQ 3LX0A 4B8TA 1FR3A 3JAML 1B3QA 4WORA 4B9XA 5JJLA 1HUMA 2QDLA 4DR5Q 2CH4W 1BDOA 1GD7A 3VR3A 5E3FA 2Z6BA 3HOYH 4DV7H 2PT7G 1GUOA 3ERQA 4ZK9B 2KCCA 2CWPA 3DEPA 5GAGC 2EZVA 1EY8A 1Y69U 2ICIA 1PXUA 4OL7A 1EIGA 2AWNA 1SNQA 2B39A 1WD0A 5EKIA 3S1NH 4P74A 3VA5A 5CMDA 4NB3A 4JV5L 4DUZL 4OX9H 2RKSA 1UWVA 1FJGH 3GTPH 4NXNH 3E9IA 5DLQE 4K0KH 1PTOB 1FNUA 4H7BA 2K50A 2E5LQ 1XMQQ 4OHJA 1KHMA 1HXYD 3W5OA 2FFMA 4B3TL 1HFGA 5FLXc 3E3XA 1K0RA 2EIFA 1RCVD 4IUNA 5I2YA 1WTHA 1Z47A 1K8OA 2OPUA 4L5SA 2JA6G 4LF8L 4DR2L 1X9ZA 2XRSD 3WDNA 1SYCA 3HOYB 4GKKL 2ZXRA 2K32A 3U4ZA 2ANNA 5JAVA 4A3MG 3Q23A 1QNUA 4LJZC 3ZYYX 2AHOB 3I56A 1TWFH 4JI7H 2D9IA 4PG3A 2EXZA 2BDOA 1GO3E 4NZTM 2AUJD 5FJ8G 1X3FA 2QGQA 4LFBL 3GTPB 1XNRQ 4F7XA 4DR4Q 1SBBB 1Q46A 1T5XD 1X0AA 2NN6H 1GUNA 2B2YC 2JA5H 4OXPA 1HNZH 4QB4A 4JI1Q 1BF4A 1IYVA 1AN7A 2CPQA 1PRTF 3TQYA 1I50H 1MKHA 3GTLH 4QMFB 4LUOA 4LF5H 3L0OA 2Y0SG 4HR7B 1EOVA 1G2SA 1Z7TA 4KLKA 3IRBA 2K5WA 2OXPA 3R3OA 2L15A 1VCIA 1BCPC 2K7VA 4CHTB 2R92B 4EX5A 3S14H 4FJUA 1RD9D 1RIPA 1YJ9A 3V2TA 5C0XI 2YYZA 4KK7A 1RTOA 5M3MG 1FGUA 2OF1A 1FJGQ 1XMOQ 3I4NG 1PZJD 4ULLA 4K0KQ 1EL0A 2PQEA 1MSZA 3QIAA 2KJXA 1IXRA 2VL6A 2BE5D 2QDBA 1SYEA 4FO2A 4C3HH 1WVLA 1G291 4ZAIA 2XGTA 2D0OA 3GABA 2JA5B 4BY1G 3PO3G 3S1MH 4DV0H 4JBWA 1I6HB 2KA7A 2ZTDA 5FO8B 1G6PA 1I50B 1XPUA 2R7DA 4JI2L 4FDBA 1GHJA 3GTLB 5CYUA 1V9NA 3GTMB 3DM3A 2K33A 5BN5A 1IBML 3VYTA 2IX0A 1IBLH 2AQ1B 1KDBA 4RHSA 4B3TH 4GN3B 1EWIA 4GNXC 3AQQA 3OW2A 2WIIB 1K0SA 1CA5A 4KTAA 1UE5A 3HOWG 2PO4A 3L3OC 2F0FA 4DNRB 4BY7B 2QNDA 4ODGA 4DR2H 1WTWA 1ENFA 4GKKH 4YY3H 4PMCA 1BCPD 5EKKA 1WE8A 1F2LA 1NMFA 4RGMA 1B2TA 1X54A 2HIXA 2IL8A 4A3IG 1LO5D 3S1MB 1O7YA 5C3WA 3E0JA 4CKCA 4LF5Q 1HCZA 3B6YA 4CJ2C 4IPDA 1JE4A 1RKNA 4EVOA 1ONLA 3DLLA 4HEDA 1TT2A 1SROA 3SE0A 3HOXG 2ZT9C 2E76C 5C44B 4NPSA 3ER0A 2WKCA 1PFNA 3K0XA 4R1JA 1G6ZA 1SJED 5H1SE 1IBKH 5JJKA 2PY9A 3E9HA 4BBRG 1GUSA 4KJOA 2KCNA 4CDFC 1SN8A 2H4OA 1D2BA 3MTSA 3ERSX 3K58A 4A3CG 1JB3A 2AWOA 2RA4A 4I65A 4DV0Q 3CC4A 2IX3A 2UU9L 1VQ5A 2NVTH 1J4WA 2LRRA 2A5HA 5FO7B 5C4XG 4PV1C 1H9RA 1L1OC 3URYA 3TRZA 5C5LA 1IBLQ 4WRDA 2B8FA 3RNUA 5CV4A 4KY7A 5IT9L 2K1HA 5EQ0A 1N33H 4DR1Q 1HUNA 1TU2B 4IPHA 3NCVA 3T1HQ 3KLSA 1EEID 1ZYRC 2JQOA 4UDUC 2PYKA 1Q3LA 1PFMA 4JOIC 4LUVA 2KHSA 2Z6KA 3M7GA 4JI0L 4J6HA 5TSSA 1D1IA 5IP7H 2VQEL 3BS1A 4DV3L 3SK4A 1EY4A 2CWHA 4HN7A 2E74C 4FXKC 2NVTB 3RLNA 2CTLA 1WOCA 4PDBA 5EAYA 4DAPA 1TKWB 3HKZE 2I07B 3PUXA 2JJQA 2QKIC 2KCTA 5IYCG 1TVXA 3CRKC 5AFWA 3M7NA 3MC0B 1I3QH 2K5VA 4GLVB 5T1IA 3OMGA 4DXGA 1J5KA 1NCVA 4JI5L 2XVSA 3OSSD 4JI6H 4UPAA 3RUZA 3NK9A 5C6AA 2MUYA 1L0YB 3NWTA 3HP3A 3NTKA 3RR5A 1N36H 2ZQEA 4QMGA 3GR5A 3KF8B 1TY0A 2DGYA 3BDCA 4KHPQ 1PFBA 4DK1A 4DV1Q 3MFGA 2NWGA 3HOVH 2EY5A 4RCOA 4LF4L 4A3GG 1BCPF 5J1ZA 1ZYRD 3NENA 5DT9A 3DWPA 2HHHQ 1F2YA 3NE5B 3T56B 4BS9A 2JA7G 4LF7Q 2JXMB 4DR3L 1C9OA 3C1EA 2LTLA 3CXCA 3CMEA 3AEVA 1D6EC 1C4QA 2EVBA 2YV5A 4B3SL 1J5EH 2R93H 3I0PA 1X55A 3D8GA 3WOEA 4I7ZC 5EPJA 4ZUJA 4TQUS 1GM5A 1N34H 1KL9A 1M8AA 1NSNS 2L12A 3PUYA 4A93G 3KJOA 4HJ7A 1JICA 2FXQA 1Y14B 4XT3B 3HOZH 2PW7A 1HNXH 3GTGB 4WJ3M 5IYDH 1VF5C 1AN8A 4IFDG 1M1KC 2UUCQ 1PVOA 2WACA 3NBHB 1MSGA 1LTGD 3HG9A 4X65L 4QL5A 2EYJA 1YI2A 1HR0L 1SEIA 3EQLC 4L8JA 1FVIA 1O7LA 4POGA 2F4VQ 1Q8IA 3N52A 3U58A 1QZGA 1N9WA 4RGNA 3K5LA 4R8NA 3ITPA 4H8AA 4MTNA 4CGYB 2FPHX 5IWAL 3OTOL 2VQEH 4DV3H 1NAPA 5HGQA 2R93B 4KKTA 1PYBA 5ELFA 4DR7L 2A68C 2DN8A 2R3ZA 3H3VI 2F3WA 1JJGA 1EY0A 1N36Q 2KBNA 4LFCL 4KN4C 2Q2HA 4CKBA 3X3MA 3HOZB 1QCBD 3K5NA 3H15A 5IE8A 3I70A 3SVMA 1I4PA 4JI5H 4A3KH 1BVSA 3PGZA 1RHPA 1SAPA 3D4WA 4B3RQ 1A2UA 2DUDA 4C3JB 1PH7A 2MO0A 2K75A 3TN2A 3AFQA 1LT3D 4KY5A 4JYAL 1EWCA 1L2FA 1CKOA 2WINB 1G2TA 4A75A 4QUCA 3RZDB 3H94A 1D7QA 1NUCA 3OETA 4RH6A 4A3EB 1SE8A 1HH2P 2KEDA 2LY7A 5FLMG 2AQ3B 3OPOA 5IGDA 1X3QA 2EPBA 4ALPA 2X6GA 3L7ZC 4A3BH 3RN5A 3M4OB 1GOZA 2PMZE 4A3FG 1EIYB 3DXJC 5LMNH 4DR3H 2AQ2B 4L5TA 2UXCQ 1TWGB 1HNXQ 4X66H 1KD1C 1X3GA 1WCMH 3VR6A 3OIPA 3S2HB 3I7FA 2CW0D 4RWSC 1YIJA 2IJ0A 1VQPA 4NW2A 3VR4A 4A3KB 1KAWA 5C3EG 4EGVA 1VBIA 5CR3A 4YHHL 4IPGA 1OXXK 5I2XA 1VQ7A 2XTIA 4GKJQ 1IW7C 4H0LC 4UAIA 3PF5A 3CCUA 3PIO3 1I6VC 1DOMA 3I72A 3BDOA 4GN4B 4R4CA 4C3IB 4X65H 1H95A 1ENCA 3F2CA 2Q8IB 3MXGA 3GTQB 5ELEA 3S16B 1NJIC 4A3BB 3TP8A 3Q0AA 5C5MA 4J1MA 4DV4H 1UEAB 2SNSA 1QE6A 5F2DA 3HZXA 5E7NA 2OTLA 1V1PA 2B2UC 2KVMA 3F8TA 1XNQQ 3Q22A 1WCMB 4IOCA 3S17B 2KECA 1F9PA 1EZ8A 2CCZA 2CPMA 2D0PA 3N6RA 2BDNA 1STNA 2LS01 4PZ8A 4QIWB 1NR4A 2E5LL 5K36H 5CV5A 2CQAA 2VS1A 4LFCH 3Q24A 4GOPA 2A19A 2E3UA 3H3VH 5IGCA 4DV6H 1PMRA 5KNDA 3BU2A 1ESRA 1BUVT 5D65A 1EY9A 3DHQA 5FLXL 2NVXH 4K5WA 4FF2A 2FHTA 1IW7D 2EYOA 4JW0A 3KLRA 4P71A 5LMNQ 4DV2Q 4JYAH 4JI4L 3M4PA 1CK1A 1FGBD 2E2IH 2EXDA 4ID6A 5M3FG 2IWHA 1MBYA 1MGSA 1W6KA 3KF6A 1ASYA 3E5SA 1VS0A 5LL6X 4L63B 1VQNA 2VB3X 1IKLA 1B44D 1SYGA 5HURA 1F0XA 1Z9FA 3J81W 2RDHA 2K14A 1XNRL 4LF9L 3I91A 4I7AA 2F0HA 1TS2A 3U50C 1IKMA 1W6JA 1TWCH 3BVZA 3RZOH 2ZTCA 5J39A 5IGFA 3E0EA 3J80W 2F0GA 2CQOA 1NE3A 2JA8H 4A3DG 2N88A 2CWAA 4NZRM 2R7ZG 3PO2G 4ZLTF 4KHVA 4FVMA 1VQLA 4DV4Q 3AYHB 1EFWA 2AKWB 2AUKA 3DWQA 1VQFA 4K2KA 3CRLC 3BZKA 1WTJA 3D0FA 2L9HA 3TP7A 2E2IB 3A0JA 2K03A 3LWUA 3CP0A 1GKHA 1SNMA 4KY6A 1SYBA 4N9TA 1XMOL 1RODA 3SR1A 4X6AH 3SXHA 4JI8H 4NMZA 3PIPA 3H09A 1LTLA 4HJ5A 1Q82C 3J81j 2EYLA 4DK6C 1H9MA 1Q1EA 1DM0B 2NN6I 4DV6Q 1TWCB 3T1YL 3RZOB 2SDFA 2HD3A 5CV7A 4NXML 1STYA 3V96A 2FMMA 4IZ8A 1Y1WG 1LT5D 1DCZA 1TS5A 4POFA 4B9WA 3PSIA 2B8GA 2PI2A 4LFAH 1Y8NB 4G57A 1XRHA 2B2TC 3D6CA 1V8CA 5CV8A 5M9OA 5BR8L 1E22A 4FYDA 5I6WA 4S3SA 1KTKA 1HZBA 1PTOH 4OCHA 1PFSA 2G9HD 4A4IA 3S1RH 3QR8A 5A2QL 2JA9A 2EY2A 4Z9CB 1CUKA 1K28A 1JWMD 3CW2C 1QG7A 1EYGA 3S15B 3ICEA 2MQHA 2F3IA 4OIJA 3H91A 1AP0A 4HSVA 4PZ7A 1WTPA 1PA6A 4LF6H 1DD2A 3HOUH 4HMJA 1SJHD 3EJIA 2H1EA 2QEXA 2Y3MA 2UXBQ 1SE4A 1DZ1A 1U4RA 5AJ3L 1SXTA 3TREA 2PCFB 1RJTA 1W2BA 3P1HA 4JI8Q 1T9HA 3S1RB 1PH5A 2N55A 4K2LA 1O7IA 4B8CD 2B63G 1YNJC 4R9WA 2I5MX 3MWYW 1C8CA 1IYUA 1HNWH 3HGBA 4JVZA 3CF5A 2IT1A 1VQCA 4AQYQ 1E2VA 1VIHA 1TS3A 2XIWA 1N32Q 5I6YA 1Y8PB 4YIJA 1I94Q 3CU7A 1RTNA 5IIFA 4PMBA 2R92H 1I5FA 3QOJA 3HOUB 2EJFC 1B9MA 2WB1B 4OGQC 3STBC 1IYJB 4DV5H 1WYDA 4X64H 3KLSX 3VDYA 3SK6A 1GVPA 1D1KA 1DT4A 3T1HL 2HH3A 4G7ZC 1LTBD 1K3BC 2F0NA 3U9OA 1Q1BA 5KIXA 4XYOA 3CPWA 1XTCD 1CQVA 4R4TA 1SEBD 4EC5A 1YHBA 3C1FA 5BR8H 4C3HG 3J81i 1EQQA 1I6HH 2F0PA 4ZKBB 1SNDA 4DV7Q 3QWNA 1P16A 5JPNC 4LF6Q 5LMNW 3GTMH 3SGIA 3QJYA 2F3VA 4X3KA 3J80i 1X3EA 3UDFA 2UUBL 1EQTA 2RHQB 2EYFA 4DAYB 2O5JC 3TEHB 3MAQA 3NQTA 1WVNA 4BY7H 1VIGA 4OX9Q 2RHSB 2E2JB 4NXNQ 5IGGA 3OIQA 1FNWA 2CTKA 3G7LA 2K04A 4A3MH 4C1NK 5I4DA 1Z6HA 5J22A 3L9AX 4QY7A 3STBD 2KQ3A 3W1BA 4K14A 4K5VA 5LHY1 1XPOA 4XDXA 1B9NA 4KHPL 2K01A 1TR5A 4JV5H 4DUZH 1JQYD 1LTTD 1FYCA 2PZWA 4OWTB 4FF3A 4DV1L 4KD4A 4BA2I 1RDPD 3TP5A 1PRTB 2RCFA 4LNQA 1MIUA 1F9QA 1EZ6A 1U9RA 4OIKA 2HHHL 5C44H 4LF7L 3G48A 3K5OA 2JE6I 1E7ZA 3GV6A 4JI7Q 1PQXA 4TKOB 2JYOA 4DAVA 3U1KA 4HIMA 1JCKB 2VB2X 2IX1A 2F0KA 1ZZKA 1VQHA 4O0AA 2Q8TA 4LF8H 1QVCA 1U4PA 4E6IA 2JA6B 3DEOA 1DXMA 4MNOA 3UDGA 4A3MB 2CKZB 1O7ZA 3S1QH 4HMIA 4XQQA 1HNZQ 3UOEA 5LMUL 1WFQA 2NYZD 5M3MH 1QVGA 2UUCL 4YWKA 3H0GG 4MHEA 4N8FA 4LFBH 2NTSA 1D8LA 4JI3L 3IL8A 4AYBG 2C35B 1HZCA 5IP9H 4LIJA 2UXDL 4DAYA 2F4VL 1STBA 2YQRA 2K28A 2A6HC 1JJCB 5C0XG 5IGBA 2A1SA 4IOAA 5JEAJ 2D9UA 2MPMA 3HS0C 5ISRA 1S72A 2MFIA 1ZXTA 3MHBA 1ICWA 2J7ZA 4IO9A 5C4JH 2K52A 4L5RC 4JC0A 4DR6L 1PLFA 2F0DA 2Y0SB 4AYBE 1OXSC 1A3VA 1CZWA 4HAEA 3SDZA 4JV5Q 3S1QB 1LTAD 4C1NI 2Z4IA 3J81E 3HOWH 1ZTGA 1WTXA 2NZHA 1ILQA 2E8GA 5M3MB 2Z4HA 4HIDA 3CKIB 1K9MC 1EOTA 5CV6A 1A8VA 3LWEA 4U68A 4CDCC 4P73A 4B3RL 3EN2A 1STAA 1G51A 5JOBA 3J80E 1LYLA 3C2PA 3I4MG 1PV4A 1HHVA 5GADC 3AEVB 1BXTA 2BCOA 1VQOA 4B3TQ 3MZ5A 1D5ZC 1GUWA 1J9OA 2VQFL 1PH1A 4K5XA 4A3IH 4BY1B 3PO3B 1A2TA 4GLAC 4WFN3 4DR2Q 1Q12A 1SR3A 1MSHA 3BYYB 1SNPA 3HKZG 4JI2H 5C4JB 4GKKQ 1PZKD 2DY7A 3QD7X 4YY3Q 3CCMA 4TRDA 1QWYA 3PF4A 3HOXH 1OXUA 1K8MA 1IBMH 1VQDA 1WD1A 2A6HD 4EQ5A 2UXCL 1JMCA 5E4XA 4RCNA 2DJFC 2G8YA 1IHZA 2ZJPA 3A8IE 1ET9A 3HOVG 2XSCA 3HOWB 3K59A 4LFBQ 1IZ6A 2NUCA 4BBRH 4PZ6A 3PCOB 2F03A 4WANA 4R4QA 3NTIA 5DM73 4ZKCB 1XYIA 2ES2A 5EPLA 4HJAA 4A3CH 1S20A 4DN4M 3MXNA 3D4DA 1VQ8A 3OWEB 1Q8KA 1ODHA 3ULJA 1IBKQ 5C4XH 4A3IB 4RKBA 2YTVA 5BN4A 3CCJA 1TWAH 5M5XH 5J3BA 1NNXA 3ZJYC 4JI3H 4CKEA 4XXEA 2QF7A 3GTGH 4B3ML 2EQSA 2RQXA 2VW9A 3HOXB 4UP8A 5M5WH 5IYBG 1XNQL 2F0EA 3VR2A 3KDFA 4HIOA 1T5EA 1KNEA 3J81c 1ICFB 3OYYA 2R6GA 3F1ZA 1HZ9A 2XRQD 4BBRB 2KCMA 5FK9C 3H3VC 2FMCA 1IL8A 4Q5VA 2XWBB 4GS3A 3J80c 3Q8DA 2EYPA 1N33Q 2F0QA 1RL2A 4RMFA 2UU9H 4JI2Q 5C4XB 1XXGA 1TWAB 5M5XB 4A3LG 4N9PA 4DV2L 3BVMA 1QZHA 2F1MA 3NXWA 2LXJA 2VUMH 2BA0A 4OEMB 3NUCA 5M5WB 4YWLA 1JORA 5EKLA 1STGA 4EQPA 4C3JH 1NBWA 4HTHA 4WJWA 3J7AF 2LMCB 3CCRA 4A76A 1JC7A 2A6EC 3E6ZX 2DNCA 2OT2A 2K05A 3RZDH 3FPUB 4A3EH 4QCLA 2Q8RE 2ZM6L 4JPBW 4JI0H 1X32A 2DGRA 3JC66 1ASZA 2HDLA 3BZCA 4A3GH 5JVH3 2ZTEA 4JI6Q 4OWWB 2ZXPA 3M4OH 4X62L 2A1AA 2ATWA 4AIMA 1AEXA 3PUVA 4LWCA 4BBSG 1CM9A 1TWGH 5FKAC 3OOCA 4M1UB 3S2HH 1V1PB 1S5DD 2Z9HA 1B50A 2V4DA 2XN9C 1TY2A 3K7UC 3GQBA 1HA5A 1DYQA 4X3UA 3BDLA 1EWHA 2VUMB 4H44C 4DKAC 1X4MA 4TSSA 1AZQA 4A93H 1YJWA 3RMHA 4GOPB 1Y1VH 2RSNA 2MJ8A 1J5EQ 1FNVA 2YTXA 1TUAA 4IFDH 1LLRD 2QW7A 4C3IH 1BO0A 4KN7C 4LF4H 1SMYC 5M5YH 3GTQH 4A3GB 1N34Q 3S16H 1CFMA 3K81C 1STHA 2B2YA 2RVLA 2A6ED 3P20A 2UUAL 2JA7B 3WWVA 3FKIG 3SHLA 2K6AA 2CTFA 3ND8A 4F87A 4QIWE 4BXXH 1UUPA 3S17H 5EBDA 1C48A 4B3SH 4DNTB 2E2DC 1PTOC 5GAHC 1XPRA 2A68D 3KF6B 2EYHA 3GD7A 4DF7A 1ML0D 2NBFA 1KAAA 4FXDA 1K83H 2F0SA 1S40A 2D62A 2WP8J 4DU9A 3M4YA 3RLOA 4GN5A 3W3AA 4A3JG 1VQEA 4A93B 1VQ4A 2M2LA 4R4OA 4G7OC 4MZ9A 3T53B 4YWMA 1GUTA 1Y1VB 4DUYL 3GTKB 1F9RA 2WAQG 2VQEQ 1Q7YC 4DV3Q 4P72A 5DAUA 1A3TA 2ANRA 1HR0H 4OWXB 2ID0A 3OWFA 4DR5L 5GROA 5M5YB 2B3GA 2JSOA 3HFZB 2YU9H 4MTKA 5KNBA 2GVAA 1B53A 4V0BA 2ZM6H 3KYHC 1SMYD 3I3CA 3FDTA 4IPCA 2Z8LA 1M90C 5IWAH 4JI5Q 3OTOH 4QUFA 2WAQE 5C4HA 4DR7H 3T16A 5IY0A 4X62H 4A3FH 1K83B 2I5HA 2N3SA 4GNXA 1MI2A 1CTMA 1J8IA 1XMQL 2CH4A 2M6QA 3VYUA 1A63A 3AFPA 1CI3M 1D5XC 1PTOD 5KNCA 4LF4Q 3RF2A 3KLWA 3CCQA 3EA6A 1E2WA 2Z0SA 2PMZB 4M8AA 2IY5B 2JA8G 2K4KA 4DR3Q 2RDGA 3WOFA 2I5LX 1N32L 4X66Q 2F0UA 5JEAH 3MA2B 2YU9B 1EIHA 2SEBD 2WV6D 3PIP3 1YEZA 2VKCA 4ME5A 2VXWA 3UI2A 1SYDA 1K73C 4Y52H 3IFDA 3V69A 3QG1A 1QUQB 4Q0FA 4A3FB 2UUAH 1YNXA 4DR4L 3DMUA 2F0IA 3T51B 3FHWA 1CKNB 4G4KA 1PRTC 3MFYA 4CDEC 1BNZA 2LTMA 3NHHA 3I8ZA 1QB5D 1VQJA 4X65Q 4JI1L 4KKUA 5JJZA 3MVVA 1KDCA 1HA6A 4OO1I 4YHHH 1R4PB 3RLFA 3CC7A 1OXTA 1MJCA 4JG2A 1DOKA 3KBGA 3KFUA 1KIXA 3IAYA 3M4QA 2NVQH 1L1OA 5FOBB 2HCCA 5IWAQ 1KDAA 4K6LA 1EYAA 2NZ1D 1H9SA 5KYIA 3GKUA 4DR5H 4OX9L 2Z6KC 1FJGL 3CQZH 5ELBA 4RKLA 4NXNL 3BG3A 1HFNA 4K0KL 3K8AA 1BBWA 1YITA 4KI0A 4WJ4A 4LFCQ 3EBEA 5LL6b 3I73A 2I0QA 1R9TH 1VQMA 3S15H 2B29A 1CHQD 4JOIA 5KEEA 1LUZA 3K80C 2BA1A 1HQMC 3AU7A 4ZRZA 4ZUIA 1A6XA 1VF7A 3I55A 1A15A 3HOYG 2SNMA 4UP9A 1AH9A 2I46A 4FXGC 2L1BA 4JYAQ 5D3IB 2E5LH 1WTVA 4N8X1 3HOUG 4K8JA 1KC8C 1YBYA 2NVQB 4LUZA 3PQIA 1QNKA 1YHQA 3S2DH 4DXFA 3QB3A 3MXUA 3CQZB 3M3YH 4RFBA 1QUQA 4JBJA 5HY6A 4JI4H 1BQQT 2ZJQA 2O5IC 4FNFA 3I4OA 3NELA 1CKNA 2WB1E 2FFKB 1R9TB 1LTID 5M3FB 1UNSA 1EYCA 1Q90A 1EY5A 4LW1A 1FD7D 1XX8A 4TVAB 4YHHQ 2MNAA 1PTOF 1E2ZA 2OEOA 2RCNA 4K8IA 4LF5L 1JJ2A 1GHKA 2HQEA 3TZDA 4DK0A 2JEAI 1XNRH 3QO2A 2NZOA 4LF9H 5IT9W 2AMCB 2R92G 1XWEA 3L2PA 3OHXC 4NP5A 3OMCA 1KNAA 2M9VA 3K0YA 2Z1CA 3KJPA 3CCSA 4JI1H 5IGEA 1Y1WH 4QF4A 1EYDA 3S2DB 3CCEA 1X9NA 4OELB 4A3DB 3OSOA 3TDQA 3EZJA 2R7ZB 3GTJB 2RF4A 3PO2B 1S5CD 3RN2A 1HTLD 3M3YB 3CAMA 3KDKA 1VQAA 2NN6G 4P75A 3J7AV 2ALYB 2CHBD 2F52A 3I4LA 3S9WA 2JA5G 5T1GA 4OO1H 2K5DA 2BOSA 4DV0L 2NVYB 4BA1I 3TBIB 1VDZA 1SSOA 2L11A 5CC4A 1XMOH
chains in the Genus database with same CATH topology
4LFAQ 2F0MA 3T13A 3W2DA 4JVHA 3J7YW 1SFOH 5ELOA 3D4RA 4IQZA 5I9PA 2F0VA 1IBLL 1XJVA 1YJNA 1E3PA 2E2JH 3NWSA 1OO9B 1Y8OB 2HUGA 1QILA 2K5QA 4MIUA 2BH8A 1BBXC 2LFNA 4BY7G 3FPPA 4DR1L 1WJJA 1Y1WB 3RD4A 5K5PA 4CBVA 5E1FA 4O42A 2QILA 1X56A 4YY3L 4JVYA 4JI4Q 3PUWA 4ABNA 2H5XA 1PH4A 5G3LD 5JPMC 5A2QE 1Q81C 3CMAA 2BE5C 2IHFA 2ZJRA 1VMPA 2XNAC 2BL5A 1W3SA 1EU3A 5EBCA 3S1NB 2GN5A 3JAME 4IFDJ 4QGUA 5HGTA 4LMQD 3R2IA 3GV3A 4OONA 2G9DA 3SK5A 1EY7A 1F9SA 1MJEA 4IALA 2PNHA 1QOHA 1EEFD 4LF9Q 4R4IA 1JR0D 1CZGA 1YNJD 3HEJA 4F8MA 2P2RA 1LV9A 5C44G 2B63H 1SFOB 3P75A 2HH2A 2O2LD 1PH8A 1WTOA 1E1OA 1J6QA 2D2CC 2KEEA 5DEHA 1I4GA 3AMUA 2EYMA 1CHPD 2JA6H 4CJ0B 1IBKL 1CKMA 1TWHH 4CJ1B 3EIVA 4XTCS 1D5MC 3EROA 1WI5A 1UE7A 3M85A 2CTMA 1ZZJA 3F2BA 1HNWQ 1HR0W 5ELCA 2CTJA 5FJ8H 1LM0A 1TWFB 1EY6A 1S3OA 3A7AB 3UDXA 1AZPA 4IN3A 2ZXOA 2C9OA 3ONAB 1V9PA 3KBXA 1X65A 4ME3A 5ELNA 2DY8A 2Y0SE 3IKJA 3TMEA 1VQGA 3J81L 4QQBX 5IP9G 2B63B 1HPCA 2A69C 3T1YQ 4V190 4DV5Q 2TMPA 4HCEA 4NXMQ 4X64Q 1S4ZA 3GTOH 1VMCA 1N33L 1CQFA 2B2WA 2WKDA 3J80L 2M00A 1U4LA 1TWHB 4LK1C 3LGJA 3SK8A 1G91A 3MEHA 3D6WA 2EY1A 1SNOA 5BR8Q 3K57A 1EQRA 1F2ZA 3S14B 1JOKA 5CORA 3I4NH 3G6JB 1FL0A 4RGTA 4GOPC 1V1QA 2B2UA 3JAMc 2CVRA 5DNFA 1EFID 3T4AC 4JCVE 3W1GA 2HDMA 3CCLA 1EUJA 3MXNB 1PH6A 4BY1H 1LT6D 1TQOA 3PO3H 1LTRD 2PW5A 4C3HB 2JVZA 3A8KE 1LT4D 2QEJC 3GTOB 2C5CA 1EU4A 2F4IA 4XQJA 3HRZC 4JI6L 3IFTA 3TS0A 3FVQA 1K3RA 3R8BA 1PDQA 1U0LA 3UE1A 4H13C 1N36L 2OQKA 1QJOA 2A69D 2RSOA 4DUZQ 1UEBA 5AJ3Q 1SDFA 1DOLA 1ZKOA 4DAMA 3M9BA 4FF1A 5IP7G 3KDFB 3NEMA 1JWUD 1CT1D 5G3LF 5LL6S 3I2ZA 3I4NB 1O80A 3LNNA 1DONA 3NBIA 3BZDB 1ILPA 4DGZA 2EDGA 3TS2A 2K5HA 1SRUA 1KRSA 2L5TA 1DJRD 1J5EL 1ZEQX 1JOOA 3NP8A 3H0GH 4G7HC 2TSSA 1YHAA 4EQNA 2GVBA 2HQLA 4LF8Q 1I4XA 1N34L 1AW7A 3U9SA 2BH2A 4PNYA 3TSSA 1I4RA 1B1ZA 2Q2UA 2R61A 4X3TA 3Q6SA 1TS4A 5C0XH 1HNXL 2PZUA 2J4XA 4KMUC 1NY4A 1I4QA 5KRUA 2Q2TA 2GA4B 2XWJB 2IW3A 3G71A 1B8AA 2A8VA 1JOQA 2MJHA 3VYSA 1CSQA 2WFWA 4Y7NH 2ENBA 2F0TA 1NR2A 4GKJL 3HKSA 1UAPA 2X6LA 1CA6A 2IPKD 1U5KA 1Q86C 3EVQA 5A35A 2A73B 5CBEE 2R93G 4IFDI 3KUPA 2QA4A 1JB7A 1VQ9A 4BWGB 4HJ9A 4JBKA 4KHZA 3H0GB 2FINB 4YCUA 2UUBQ 4AYBB 1VQ6A 3I4MH 3R93A 1C0AA 1S5ED 4IJLA 1X3PA 5CV9A 3VR5A 4DPGA 1A62A 2OQ0A 2OWOA 2OCEA 4DNIA 3HOZG 3H6MA 1P8LA 3CD6A 5KYLA 5IYDG 4QJFA 1DGSA 2VUMG 3DM1A 2B2TA 1LACA 3DUZA 2OTJA 4C3JG 3K6OA 2Q2IA 4IUPA 1R4QB 1X6OA 4GZYC 3BVGA 1VQKA 4Y7NB 1PH3A 4HJ8A 2L55A 2E2HH 1VQBA 4EQOA 2B2VA 4FF4A 4A3EG 4IUQA 1OTCA 5GAEC 2SOBA 1YZ6A 4ZQ3A 5IT9E 1GJXA 4PMWA 3C3LA 3VYRA 4IURA 2FJ2A 3NQIA 2PPBC 1IBMQ 5IOCA 5IYCH 2EJGC 5LMNL 3I4MB 4JBMA 4X66L 4KD3A 1SLJA 4F88A 1STEA 3OW7A 3G6EA 4B08A 1I3QB 1BCPB 1IL2A 4A3KG 2LXKA 4RGOS 3ND9A 4XQNA 3HKZB 3D31A 4J8QA 2RDFA 1LTSD 4C56C 4HSPA 1V43A 5IYBH 1Y1VG 5LMUQ 1ESFA 2E2HB 2JEBI 5ELDA 4C3IG 1E24A 2PQAB 4YCVA 3HOVB 1EQVA 2V1CC 2VZAA 3FP9A 4JI3Q 4IUTA 2JA7H 4ZYSA 3K7AH 3BYTB 3MXPA 5COYA 5NUCA 3F2UA 4A3BG 1SE2A 2X69A 1F77A 2UXDQ 4DV4L 3PUZA 1S5FD 2A74C 4RAUC 1KLUD 4BXXG 3UE0A 1H9JA 1WCMG 5E4WC 4AH6A 1KQSA 4RHRA 4RG1A 3VA7A 2CW0C 2LKVA 4DR6Q 4GNXB 1AFPA 3A8JE 4A3LH 2ICEC 3A7LA 3TP6A 3GTKH 3FMCA 1U4MA 3GO5A 2JZXA 3KF8A 4DK3C 1F2MA 1V8QA 3NSWA 2UU9Q 4DV6L 2N8NA 1H9KA 4FP5D 3F2DA 3NPPA 4RA8A 3G4SA 2KUMA 4IUUA 1G8ZD 1K8GA 1JT8A 3VKEA 1SE3A 4X3SA 5IT9c 2AXYA 3K7AB 4J15A 1E0BA 4C2MH 4WALA 3CHBD 1PYSB 2N78A 1ZZIA 2VQFQ 3A55A 5FO9B 4XIGS 2PNRC 3TZUA 1A0IA 4KKSA 1ET6A 1HJPA 1HQRD 4BBSH 1MD2D 3A5ZB 2PI2E 4JK1C 3NTHA 1UE6A 5JJIA 4JI0Q 2MHVA 5K36G 1NMGA 1RF2D 4IUVA 3C46A 3SEBA 1K1GA 2KENA 4P2CB 3NBHA 4KV6A 1NTGA 3QOLA 1B70B 2PQAA 4DA2A 1QVFA 1SYFA 3K5MA 1ENAA 5C3XA 1E1TA 3FRPB 2MO1A 2B2WC 1L1OB 4C2MB 5JEAG 5FLMH 2KOLA 1KRTA 4APVA 2UXBL 2YTYA 1H9SB 2OPVA 3KK7A 2MGSA 3X3NA 4L5QA 3FKIH 1I4HA 3O13A 2VY3A 4BBSB 4JI8L 4B3MQ 2HT1A 3A5UA 2VNUD 2O4XA 1HZAA 1CSPA 1V1OA 2LSSA 4HCSA 3A54A 4O2DA 1XTDA 1SMXA 5C3EH 1A3UA 1GUGA 4AQYL 3PV0A 3I90A 4UP7A 4NBQA 3S24A 4A3JH 2N49A 1I94L 4LFAL 2EE1A 2D5DA 4B3SQ 3A56A 2IHEA 4ILWA 5EGTA 3CC2A 2ASBA 1AE2A 4L6TB 2F0JA 1KABA 3PIOA 1GXDC 1JWSD 4LAAA 3CPFA 3FKIB 1BBUA 5EPKA 4XT1B 1HTPA 5I9OA 3R2TA 1YNNC 1HR0Q 3V05A 2CTEA 1B3AA 1WTRA 1PH2A 3EFXD 4PQXA 4R8IA 1KXLA 2NB0A 5C3EB 1TXYA 4DV7L 4LF6L 4U673 1O78A 3AB9A 4A3JB 4IJHA 2ZM6Q 2KHIA 1SNCA 3GDEA 3FEWX 4YCWA 3OTOQ 2JK8A 2WAQB 2F0OA 5C4ZA 5C0XJ 2J0TD 3MEFA 1VQIA 4DR7Q 4GLXA 3P7JA 4X62Q 1KHIA 4DFAA 5D3DA 1TIID 3DWAA 1K8AC 3U4VA 2JP1A 2F0LA 4MN3A 2K1BA 2NVXB 4H02A 1X4NA 1JE5A 1PHJA 4HIKA 5M3FH 3JAMi 2DNEA 3J7ZC 5JVG3 1BR9A 1HNWL 1HRJA 1LABA 4KJNA 2R7FA 1L0WA 1PZID 1B4OA 2CFMA 4XYQA 2MP1A 3UDIA 2KHJA 1M4VA 5FLXE 1WTQA 2WB1G 1N8RC 1PRTD 3D3RA 4NDXA 1EIFA 3CCVA 1PH9A 3J7A5 1UE1A 1YNND 5BN3A 4JI7L 3GP7A 3ULLA 2K5NA 2QCPX 3A74A 2L0CA 3PMFA 4AM3A 1BKBA 4DV5L 1L0XB 4A3DH 2HCIA 4X64L 4K6DA 2R7ZH 5CBAE 2EY6A 3GTJH 3PO2H 2F0WA 2PZTA 1EC6A 2L4NA 2JA8B 2UUAQ 2EJMA 2NTTA 1KLGD 1B7YB 1AE3A 2FMRA 2EOTA 1BOSA 5D14A 1PYWD 4O1NA 4NKLA 1HNZL 2NVYH 1DTJA 2PQUA 4OO1G 2E75C 3BJUA 1C7YA 3ULPA 2B2VC 1YVCA 5IODA 5KGUA 3KOJA 2HIVA 5GQOA 5CGKA 1II3A 5DM63 2RBMA 1OXVA 5EJWA 1S5BD 4UY8C 4DUYQ 3LX0A 4B8TA 1FR3A 3JAML 4WORA 4B9XA 5JJLA 1HUMA 4DR5Q 1BDOA 1GD7A 3VR3A 5E3FA 3HOYH 1GUOA 3ERQA 4ZK9B 2KCCA 2EZVA 3DEPA 2CWPA 5GAGC 1EY8A 1Y69U 2ICIA 1PXUA 4OL7A 1EIGA 2AWNA 1SNQA 2B39A 1WD0A 5EKIA 3S1NH 4P74A 3VA5A 5CMDA 4NB3A 4JV5L 4DUZL 2RKSA 1UWVA 3GTPH 3E9IA 5DLQE 1PTOB 1FNUA 4H7BA 2K50A 2E5LQ 1XMQQ 4OHJA 1KHMA 1HXYD 3W5OA 4B3TL 1HFGA 5FLXc 1K0RA 2EIFA 1RCVD 4IUNA 5I2YA 1Z47A 1K8OA 2OPUA 4L5SA 2JA6G 4LF8L 4DR2L 3WDNA 2XRSD 1SYCA 3HOYB 4GKKL 2ZXRA 2K32A 3U4ZA 2ANNA 5JAVA 4A3MG 3Q23A 1QNUA 4LJZC 3ZYYX 2AHOB 3I56A 1TWFH 4PG3A 2EXZA 2BDOA 1GO3E 2AUJD 5FJ8G 1X3FA 2QGQA 4LFBL 3GTPB 1XNRQ 4F7XA 4DR4Q 1SBBB 1Q46A 1T5XD 2NN6H 1GUNA 2B2YC 2JA5H 4OXPA 4QB4A 4JI1Q 1BF4A 1IYVA 2CPQA 1PRTF 3TQYA 1I50H 1MKHA 3GTLH 4QMFB 4LUOA 3L0OA 2Y0SG 4HR7B 1G2SA 1Z7TA 1EOVA 4KLKA 3IRBA 2K5WA 2OXPA 3R3OA 2L15A 1VCIA 1BCPC 2K7VA 4CHTB 2R92B 4EX5A 3S14H 1RD9D 1RIPA 1YJ9A 3V2TA 5C0XI 2YYZA 4KK7A 1RTOA 5M3MG 1FGUA 2OF1A 1FJGQ 1XMOQ 3I4NG 1PZJD 4ULLA 4K0KQ 1EL0A 2PQEA 3QIAA 2KJXA 1IXRA 2VL6A 2BE5D 2QDBA 1SYEA 4FO2A 4C3HH 1WVLA 1G291 4ZAIA 2XGTA 2D0OA 2JA5B 4BY1G 3PO3G 3S1MH 4JBWA 1I6HB 2KA7A 2ZTDA 5FO8B 1G6PA 1I50B 1XPUA 2R7DA 4JI2L 4FDBA 1GHJA 3GTLB 5CYUA 3GTMB 3DM3A 2K33A 5BN5A 1IBML 3VYTA 2IX0A 2AQ1B 1KDBA 4RHSA 4GN3B 1EWIA 4GNXC 3AQQA 3OW2A 2WIIB 1CA5A 4KTAA 1UE5A 3HOWG 2PO4A 3L3OC 2F0FA 4DNRB 4BY7B 2QNDA 4ODGA 1WTWA 1ENFA 4PMCA 1BCPD 5EKKA 1WE8A 1F2LA 4RGMA 1NMFA 1B2TA 1X54A 2HIXA 2IL8A 4A3IG 1LO5D 3S1MB 1O7YA 5C3WA 3E0JA 4CKCA 4LF5Q 1HCZA 3B6YA 4CJ2C 4IPDA 1JE4A 1RKNA 4EVOA 1ONLA 3DLLA 4HEDA 1TT2A 1SROA 3SE0A 3HOXG 2ZT9C 2E76C 5C44B 4NPSA 3ER0A 2WKCA 1PFNA 3K0XA 1G6ZA 4R1JA 1SJED 5H1SE 5JJKA 2PY9A 3E9HA 4BBRG 1GUSA 4KJOA 2KCNA 1SN8A 2H4OA 1D2BA 3MTSA 3ERSX 3K58A 4A3CG 1JB3A 2AWOA 2RA4A 4I65A 4DV0Q 3CC4A 2IX3A 2UU9L 1VQ5A 2NVTH 1J4WA 2A5HA 5FO7B 5C4XG 4PV1C 1H9RA 1L1OC 3URYA 3TRZA 5C5LA 1IBLQ 4WRDA 2B8FA 3RNUA 5CV4A 4KY7A 5IT9L 5EQ0A 4DR1Q 1HUNA 1TU2B 4IPHA 3T1HQ 3KLSA 1EEID 1ZYRC 4UDUC 2JQOA 2PYKA 1Q3LA 1PFMA 4JOIC 4LUVA 2KHSA 2Z6KA 3M7GA 4JI0L 4J6HA 5TSSA 1D1IA 5IP7H 3BS1A 2VQEL 4DV3L 3SK4A 1EY4A 4HN7A 2E74C 4FXKC 2NVTB 3RLNA 2CTLA 1WOCA 4DAPA 5EAYA 1TKWB 3HKZE 2I07B 3PUXA 2JJQA 2QKIC 2KCTA 5IYCG 1TVXA 3CRKC 5AFWA 3M7NA 3MC0B 5T1IA 1I3QH 2K5VA 4GLVB 3OMGA 4DXGA 1J5KA 1NCVA 4JI5L 2XVSA 4UPAA 3RUZA 3NK9A 5C6AA 2MUYA 1L0YB 3NWTA 3HP3A 3NTKA 3RR5A 4QMGA 3KF8B 1TY0A 2DGYA 3BDCA 4KHPQ 1PFBA 4DK1A 4DV1Q 3MFGA 2NWGA 3HOVH 2EY5A 4RCOA 4LF4L 4A3GG 1BCPF 5J1ZA 1ZYRD 3NENA 3DWPA 2HHHQ 1F2YA 3NE5B 3T56B 4BS9A 2JA7G 4LF7Q 2JXMB 4DR3L 3C1EA 1C9OA 3CXCA 3CMEA 3AEVA 1D6EC 1C4QA 2EVBA 2YV5A 4B3SL 2R93H 3D8GA 1X55A 3WOEA 4I7ZC 5EPJA 4ZUJA 4TQUS 1GM5A 1KL9A 1M8AA 1NSNS 2L12A 3PUYA 4A93G 3KJOA 4HJ7A 1JICA 2FXQA 1Y14B 4XT3B 3HOZH 2PW7A 3GTGB 4WJ3M 5IYDH 1VF5C 1AN8A 4IFDG 1M1KC 2UUCQ 1PVOA 2WACA 3NBHB 1MSGA 1LTGD 3HG9A 4X65L 4QL5A 2EYJA 1YI2A 1HR0L 3EQLC 4L8JA 1FVIA 1O7LA 4POGA 2F4VQ 1Q8IA 3N52A 3U58A 1QZGA 3K5LA 4RGNA 1N9WA 4R8NA 3ITPA 4MTNA 4CGYB 5IWAL 3OTOL 1NAPA 5HGQA 2R93B 4KKTA 5ELFA 1PYBA 4DR7L 2A68C 2DN8A 2R3ZA 3H3VI 2F3WA 1JJGA 1EY0A 1N36Q 2KBNA 4LFCL 4KN4C 2Q2HA 4CKBA 3X3MA 3HOZB 1QCBD 3K5NA 3H15A 5IE8A 3I70A 3SVMA 1I4PA 4A3KH 1BVSA 3PGZA 1RHPA 1SAPA 3D4WA 4B3RQ 1A2UA 4C3JB 2DUDA 1PH7A 2MO0A 2K75A 3TN2A 3AFQA 1LT3D 4KY5A 4JYAL 1EWCA 1L2FA 1CKOA 2WINB 1G2TA 3RZDB 4QUCA 4A75A 3H94A 1D7QA 1NUCA 4RH6A 4A3EB 2KEDA 1HH2P 1SE8A 2LY7A 5FLMG 2AQ3B 3OPOA 5IGDA 1X3QA 2EPBA 4ALPA 2X6GA 3L7ZC 4A3BH 3RN5A 3M4OB 1GOZA 2PMZE 4A3FG 1EIYB 3DXJC 2AQ2B 4L5TA 2UXCQ 1TWGB 1HNXQ 1KD1C 1X3GA 1WCMH 3VR6A 3OIPA 3S2HB 3I7FA 2CW0D 4RWSC 1YIJA 2IJ0A 1VQPA 4NW2A 3VR4A 4A3KB 1KAWA 5C3EG 4EGVA 5CR3A 4YHHL 4IPGA 1OXXK 5I2XA 1VQ7A 2XTIA 4GKJQ 1IW7C 4H0LC 4UAIA 3PF5A 3CCUA 3PIO3 1I6VC 1DOMA 3I72A 3BDOA 4GN4B 4R4CA 4C3IB 1H95A 1ENCA 3F2CA 2Q8IB 3MXGA 3GTQB 5ELEA 3S16B 1NJIC 4A3BB 3TP8A 3Q0AA 5C5MA 4J1MA 1UEAB 2SNSA 1QE6A 5F2DA 3HZXA 5E7NA 2OTLA 1V1PA 2B2UC 2KVMA 3F8TA 1XNQQ 3Q22A 1WCMB 4IOCA 3S17B 2KECA 1F9PA 1EZ8A 2CCZA 2D0PA 3N6RA 2BDNA 1STNA 2LS01 4PZ8A 4QIWB 1NR4A 2E5LL 5K36H 5CV5A 2CQAA 2VS1A 3Q24A 4GOPA 2A19A 2E3UA 3H3VH 5IGCA 1PMRA 5KNDA 3BU2A 1ESRA 1BUVT 5D65A 1EY9A 3DHQA 5FLXL 2NVXH 4K5WA 4FF2A 2FHTA 1IW7D 2EYOA 4P71A 3KLRA 5LMNQ 4DV2Q 4JI4L 3M4PA 1CK1A 1FGBD 2E2IH 4ID6A 2EXDA 5M3FG 2IWHA 1MBYA 1MGSA 1W6KA 3KF6A 1ASYA 3E5SA 1VS0A 5LL6X 4L63B 1VQNA 2VB3X 1IKLA 1B44D 1SYGA 5HURA 1Z9FA 2RDHA 2K14A 1XNRL 4LF9L 3I91A 2F0HA 1TS2A 1IKMA 3U50C 1W6JA 1TWCH 3BVZA 3RZOH 2ZTCA 5J39A 5IGFA 3E0EA 2F0GA 2CQOA 1NE3A 2JA8H 4A3DG 2N88A 2CWAA 2R7ZG 3PO2G 4ZLTF 4KHVA 4FVMA 1VQLA 4DV4Q 3AYHB 1EFWA 3DWQA 2AUKA 2AKWB 4K2KA 1VQFA 3CRLC 3BZKA 2E2IB 2L9HA 3TP7A 3D0FA 3A0JA 2K03A 3LWUA 3CP0A 1SNMA 4KY6A 1GKHA 1SYBA 4N9TA 1XMOL 1RODA 3SR1A 4X6AH 3SXHA 4NMZA 3PIPA 3H09A 1LTLA 4HJ5A 1Q82C 3J81j 2EYLA 4DK6C 1H9MA 1Q1EA 1DM0B 2NN6I 4DV6Q 1TWCB 3T1YL 3RZOB 2SDFA 4NXML 5CV7A 1STYA 3V96A 2FMMA 4IZ8A 1Y1WG 1LT5D 1DCZA 1TS5A 4POFA 4B9WA 3PSIA 2B8GA 2PI2A 1Y8NB 4G57A 2B2TC 3D6CA 5CV8A 5M9OA 5BR8L 1E22A 4FYDA 5I6WA 4S3SA 1KTKA 1HZBA 1PTOH 1PFSA 2G9HD 4A4IA 3S1RH 5A2QL 2JA9A 2EY2A 4Z9CB 1CUKA 1JWMD 3CW2C 1QG7A 1EYGA 3S15B 3ICEA 2MQHA 4OIJA 2F3IA 3H91A 1AP0A 4HSVA 4PZ7A 1WTPA 1PA6A 1DD2A 3HOUH 4HMJA 1SJHD 3EJIA 2H1EA 2QEXA 2UXBQ 1SE4A 1DZ1A 1U4RA 5AJ3L 1SXTA 3TREA 2PCFB 1RJTA 1W2BA 3P1HA 4JI8Q 1T9HA 3S1RB 1PH5A 2N55A 4K2LA 1O7IA 2B63G 1YNJC 4R9WA 2I5MX 3MWYW 1C8CA 1IYUA 3HGBA 3CF5A 2IT1A 1VQCA 4AQYQ 1E2VA 1VIHA 1TS3A 2XIWA 1N32Q 5I6YA 1Y8PB 4YIJA 1I94Q 3CU7A 1RTNA 5IIFA 4PMBA 3HOUB 1I5FA 3QOJA 2R92H 2EJFC 1B9MA 2WB1B 4OGQC 3STBC 1IYJB 1WYDA 3KLSX 3VDYA 3SK6A 1GVPA 1D1KA 1DT4A 3T1HL 2HH3A 4G7ZC 1LTBD 2F0NA 3U9OA 1Q1BA 5KIXA 4XYOA 3CPWA 1XTCD 1CQVA 4R4TA 1SEBD 3C1FA 1YHBA 4C3HG 3J81i 1EQQA 1I6HH 2F0PA 4ZKBB 1SNDA 4DV7Q 3QWNA 5JPNC 1P16A 4LF6Q 5LMNW 3GTMH 3SGIA 3QJYA 2F3VA 4X3KA 3J80i 1X3EA 3UDFA 2UUBL 1EQTA 2RHQB 2EYFA 4DAYB 2O5JC 3TEHB 3MAQA 3NQTA 1WVNA 4BY7H 1VIGA 4OX9Q 2RHSB 2E2JB 4NXNQ 5IGGA 3OIQA 1FNWA 2CTKA 3G7LA 2K04A 4A3MH 4C1NK 5I4DA 1Z6HA 5J22A 3L9AX 4QY7A 3STBD 2KQ3A 3W1BA 4K14A 4K5VA 5LHY1 1XPOA 4XDXA 1B9NA 4KHPL 2K01A 1TR5A 1JQYD 1LTTD 1FYCA 2PZWA 4OWTB 4FF3A 4DV1L 4KD4A 4BA2I 1RDPD 3TP5A 1PRTB 4LNQA 1MIUA 1F9QA 1EZ6A 1U9RA 4OIKA 2HHHL 5C44H 4LF7L 3K5OA 3G48A 2JE6I 1E7ZA 3GV6A 4JI7Q 4TKOB 2JYOA 4DAVA 3U1KA 4HIMA 1JCKB 2VB2X 2IX1A 2F0KA 1ZZKA 1VQHA 4O0AA 2Q8TA 2JA6B 1U4PA 4E6IA 1QVCA 3DEOA 1DXMA 4MNOA 3UDGA 4A3MB 2CKZB 1O7ZA 3S1QH 4HMIA 4XQQA 1HNZQ 5LMUL 1WFQA 2NYZD 5M3MH 1QVGA 2UUCL 4YWKA 3H0GG 4MHEA 2NTSA 1D8LA 4JI3L 3IL8A 4AYBG 2C35B 1HZCA 5IP9H 4LIJA 2UXDL 4DAYA 2F4VL 1STBA 2YQRA 2K28A 2A6HC 1JJCB 5C0XG 5IGBA 4IOAA 5JEAJ 2D9UA 2MPMA 3HS0C 5ISRA 1S72A 2MFIA 1ZXTA 3MHBA 1ICWA 2J7ZA 4IO9A 5C4JH 2K52A 4L5RC 4JC0A 4DR6L 1PLFA 2F0DA 2Y0SB 4AYBE 1OXSC 1A3VA 1CZWA 4HAEA 3SDZA 4JV5Q 3S1QB 1LTAD 4C1NI 2Z4IA 3J81E 3HOWH 1ZTGA 1WTXA 2NZHA 1ILQA 2E8GA 5M3MB 2Z4HA 4HIDA 3CKIB 1K9MC 1EOTA 5CV6A 3LWEA 1A8VA 4U68A 4B3RL 4P73A 3J80E 1STAA 1G51A 5JOBA 3EN2A 1LYLA 3C2PA 3I4MG 1PV4A 1HHVA 5GADC 3AEVB 1BXTA 2BCOA 1VQOA 4B3TQ 3MZ5A 1D5ZC 1GUWA 1J9OA 2VQFL 1PH1A 4K5XA 4A3IH 4BY1B 3PO3B 1A2TA 4WFN3 4GLAC 4DR2Q 1Q12A 3BYYB 1MSHA 1SR3A 1SNPA 3HKZG 5C4JB 4GKKQ 1PZKD 2DY7A 4YY3Q 3CCMA 4TRDA 1QWYA 3PF4A 3HOXH 1OXUA 1K8MA 1VQDA 1WD1A 2A6HD 4EQ5A 2UXCL 1JMCA 5E4XA 4RCNA 1IHZA 2ZJPA 3A8IE 1ET9A 3HOVG 2XSCA 3HOWB 3K59A 4LFBQ 1IZ6A 2NUCA 4BBRH 2F03A 3PCOB 4PZ6A 4WANA 4R4QA 3NTIA 5DM73 4ZKCB 1XYIA 2ES2A 5EPLA 4HJAA 4A3CH 4DN4M 3MXNA 3D4DA 1VQ8A 3OWEB 1Q8KA 3ULJA 1IBKQ 5C4XH 4A3IB 4RKBA 2YTVA 5BN4A 3CCJA 1TWAH 5M5XH 5J3BA 3ZJYC 4CKEA 4XXEA 2QF7A 3GTGH 4B3ML 2EQSA 2RQXA 2VW9A 3HOXB 4UP8A 5M5WH 5IYBG 1XNQL 2F0EA 3VR2A 3KDFA 4HIOA 1T5EA 1KNEA 3J81c 3OYYA 2R6GA 3F1ZA 1HZ9A 2XRQD 4BBRB 2KCMA 5FK9C 3H3VC 2FMCA 1IL8A 4Q5VA 2XWBB 4GS3A 3J80c 3Q8DA 2EYPA 1N33Q 2F0QA 1RL2A 4RMFA 5C4XB 4JI2Q 1XXGA 1TWAB 5M5XB 4A3LG 4N9PA 4DV2L 3BVMA 1QZHA 2F1MA 3NXWA 2LXJA 2VUMH 2BA0A 3NUCA 5M5WB 1JORA 4YWLA 5EKLA 1STGA 4EQPA 4C3JH 1NBWA 4HTHA 4WJWA 3J7AF 2LMCB 3CCRA 4A76A 1JC7A 2A6EC 3E6ZX 2DNCA 2OT2A 2K05A 3RZDH 3FPUB 4A3EH 4QCLA 2Q8RE 2ZM6L 1X32A 2DGRA 3JC66 1ASZA 2HDLA 3BZCA 4A3GH 5JVH3 2ZTEA 4JI6Q 4OWWB 2ZXPA 3M4OH 4X62L 2A1AA 2ATWA 4AIMA 1AEXA 3PUVA 4LWCA 4BBSG 1CM9A 5FKAC 1TWGH 3OOCA 4M1UB 3S2HH 1V1PB 1S5DD 1B50A 2V4DA 2XN9C 1TY2A 3K7UC 3GQBA 1HA5A 1DYQA 4X3UA 3BDLA 1EWHA 2VUMB 4H44C 4DKAC 1X4MA 4TSSA 1AZQA 4A93H 1YJWA 3RMHA 4GOPB 1Y1VH 2RSNA 2MJ8A 1J5EQ 1FNVA 2YTXA 1TUAA 4IFDH 1LLRD 4C3IH 1BO0A 4KN7C 1SMYC 5M5YH 3GTQH 4A3GB 1N34Q 3S16H 1CFMA 3K81C 1STHA 2B2YA 2RVLA 2A6ED 3P20A 2UUAL 2JA7B 3WWVA 3FKIG 3SHLA 2K6AA 2CTFA 3ND8A 4F87A 4QIWE 4BXXH 1UUPA 3S17H 5EBDA 1C48A 4DNTB 2E2DC 1PTOC 5GAHC 1XPRA 2A68D 3KF6B 2EYHA 3GD7A 4DF7A 1ML0D 2NBFA 1KAAA 4FXDA 2F0SA 1K83H 1S40A 2D62A 2WP8J 4DU9A 3M4YA 3RLOA 4GN5A 3W3AA 4A3JG 1VQEA 4A93B 1VQ4A 2M2LA 4R4OA 4G7OC 4MZ9A 3T53B 3GTKB 1GUTA 1Y1VB 4YWMA 4DUYL 1F9RA 2WAQG 2VQEQ 1Q7YC 4DV3Q 4P72A 5DAUA 1A3TA 2ANRA 4OWXB 2ID0A 3OWFA 4DR5L 5GROA 5M5YB</