5JEAG

Structure of a cytoplasmic 11-subunit rna exosome complex including ski7, bound to rna
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
237
structure length
235
Chain Sequence
DSMSTFIFPGDSFPVDPTTPVKLGPGIYCDPNTQEIRPVNTGVLHVSAKGKVQTAYIDYSSKRYIPSVNDFVIGVIIGTFSDSYKVSLQNFSSSVSLSYMAFPNASKKNRPTLQVGDLVYARVCTAEKELEAEIECFDSTTGRDAGFGILEDGMIIDVNLNFARQLLFNNDFPLLKVLAAHTKFEVAIGLNGKIWVKCEELSNTLACYRTIMECCQKNDTAAFKDIAKRQFKEIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exosome complex component RRP45
publication title Structure of a Cytoplasmic 11-Subunit RNA Exosome Complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule tags Hydrolase/rna
total genus 51
structure length 235
sequence length 237
ec nomenclature
pdb deposition date 2016-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF15985 KH_6 KH domain
G PF18311 Rrp40_N Exosome complex exonuclease Rrp40 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5jeaG01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5jeaG02
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 5jeaG03
5ELOA 3M85A 4C3HH 4UPAA 4GOPC 2YV5A 1A8VA 2XGTA 2KA7A 3RLFA 2B3GA 4IJHA 3I4MH 2EVBA 1EQQA 2CTMA 3JAMi 1YJWA 2R93G 4H13C 1ONLA 4LF9Q 1Q12A 1A62A 1MJCA 4LUVA 1H9MA 1WOCA 1JE5A 4P71A 4GN3B 3NENA 3FP9A 4A4IA 1ASYA 2UXBQ 4JYAL 1PMRA 3UE1A 1ZYRC 1N33Q 4DR4L 3OTOQ 4A3FH 2A68C 2CFMA 2HHHL 2RHSB 2PNHA 3ULPA 1VQLA 4UP8A 5HY6A 4A3JH 2PNRC 2EJGC 3GTPH 1X54A 3TS2A 3FHWA 1X3EA 3MFYA 3BU2A 4DV6Q 3PUZA 4HIOA 1VCIA 3H0GG 3NELA 2A6HD 3PUWA 4DR1L 1HR0L 4JI1Q 4A93G 4BA1I 2CQOA 1S40A 2ZM6L 4LF5L 3GQBA 1YZ6A 4JBJA 1I5FA 1ZZJA 2ZJRA 3GDEA 3OPOA 2N49A 2IT1A 1J5KA 1KC8C 4LJZC 4UP9A 1IYVA 1SMYC 3CW2C 2JQOA 1XPUA 3CCEA 3J81c 1XPRA 2K32A 1LACA 1HNWL 2ID0A 4A3GH 2HIXA 2Q2IA 2R6GA 4DV1Q 1Y8NB 1YITA 4KHPQ 1BKBA 2YTVA 3J7ZC 1D7QA 1Y1WH 1Z6HA 1Q81C 1K8AC 5IYDG 5C4XH 2F1MA 2D5DA 1HZ9A 4A75A 4JVYA 2QF7A 4L8JA 1L1OC 3CF5A 5GADC 1J6QA 3RLNA 3K81C 1PH1A 1SROA 1E1TA 4AM3A 1LUZA 2EJMA 4YHHQ 2D2CC 4LIJA 3CXCA 2R7ZH 4A3IH 2FMRA 3OYYA 1T5EA 1LABA 1K73C 4B3TL 3CPWA 2ZTDA 4NXNQ 3V69A 3L0OA 3AEVA 4IPCA 4PZ6A 3T1YQ 1V1QA 2MFIA 4Y52H 5LMUQ 1YI2A 4H44C 5C44G 3H94A 3PO3H 3M4QA 1U0LA 1Y1VG 4BBRG 2K52A 1Q1BA 4LF7Q 1EOVA 1NJIC 1JJGA 5IWAL 4DNTB 3K8AA 3IFTA 1XNRL 2DN8A 1WVNA 4GOPB 1JJCB 1X6OA 2CKZB 2QGQA 4KKSA 4OONA 1X4MA 1I6HH 4EX5A 1O7LA 5M5WH 2QEXA 4FDBA 4H02A 2CTLA 3CC7A 3S16H 5IYBH 5JEAH 2K4KA 3PV0A 1TKWB 3CMEA 1E3PA 3MXUA 4JBMA 1UE6A 3H3VI 4JBWA 2UUCQ 1EYGA 4JI5Q 2VQFL 1Q86C 1B9NA 4MNOA 1EUJA 1O7IA 1A63A 3A74A 4XTCS 1JB7A 5C0XH 3S2HH 2BDOA 3S1NH 2N78A 1NTGA 3AEVB 2JVZA 5JJLA 1Q7YC 3GTGH 1PH5A 1NE3A 1PVOA 2IX0A 3I2ZA 3ULJA 4JI8Q 1GD7A 2KENA 3G6EA 1T9HA 4JI0Q 1CUKA 1EWHA 1A0IA 3BZKA 3CCUA 3EIVA 1VQ6A 3KJPA 2NN6H 4DK3C 3I4MG 1FL0A 2B8GA 1ZZIA 1IBLQ 3TREA 4LF9L 3U58A 1K8MA 1VQ8A 2ASBA 3P20A 1CTMA 3FKIH 3J80c 1BBUA 4O2DA 3S1QH 3LNNA 1MJEA 2UXBL 2F4VQ 1EIYB 2JEBI 4R4TA 1N33L 1W3SA 3EN2A 3OTOL 3W5OA 3S24A 1YNJC 4A3FG 4GKJQ 1ASZA 3KJOA 2AKWB 3G4SA 3HKZE 1IL2A 4A3JG 1L1OB 4LF4Q 2KBNA 4POFA 4JV5L 1HZAA 3TS0A 2JA7H 4DV6L 2WAQE 4R4CA 1K83H 1IYUA 4DV7Q 3A8KE 2Y0SG 2BH8A 1X56A 1Q1EA 2IX1A 3NE5B 4JI1L 1O78A 3GTMH 4OX9Q 1CSPA 4HJ8A 3CC4A 1PA6A 2D0PA 3I56A 2BE5D 4YY3Q 4LUOA 5FJ8H 2VS1A 1SRUA 2OCEA 2NZHA 1W2BA 2OTLA 3I73A 4GLXA 1VQMA 3KOJA 4A3GG 4Y7NH 4DUYQ 1L0WA 4L5RC 3HOZH 4DV1L 4IJLA 1GKHA 4OGQC 2RF4A 3QJYA 1Y1WG 2K5HA 5C4XG 3FMCA 5KNBA 4DK0A 3L7ZC 4DK6C 3PO2H 4KKTA 3EQLC 2K33A 4JOIA 3VR4A 4IOAA 4OWTB 4YHHL 3CAMA 1H9RA 4PZ8A 2R7ZG 3U50C 4A3IG 3CRLC 3F2CA 3CMAA 1Q90A 1VDZA 1I94Q 5GQOA 2UU9Q 1IYJB 1N32Q 4NXNL 1VF5C 4IPGA 3T1YL 2NN6I 3EBEA 2Z6KA 5KNCA 1KAWA 3HKSA 5LMUL 5IT9c 1EQRA 3PF5A 1UEBA 4AH6A 3PO3G 4GKKQ 3JC66 4LK1C 3BZCA 4IFDJ 2V1CC 4G7ZC 1PH4A 2CWAA 4A3BH 1HZBA 3AYHB 1U5KA 1KHIA 4HIKA 4K0KQ 1Y69U 4UY8C 5A35A 3CD6A 3D4RA 3U4ZA 2P2RA 2R7DA 5IYCH 2E5LQ 5IP7H 3AFQA 2YTXA 3VR3A 4WALA 2Q2HA 1VQPA 2CW0C 4UP7A 1Y8PB 5IYBG 2YQRA 4L5QA 4LF6Q 2JE6I 1G6PA 3K80C 1K1GA 5JEAG 4KKUA 2L15A 2A68D 3I72A 3A7AB 4IPDA 2VL6A 1XMOQ 3PCOB 1UWVA 1I3QH 2LXKA 4POGA 2UUCL 4JI5L 1X3GA 2BA1A 2NVTH 2VW9A 1S72A 3KLWA 3M9BA 4GZYC 3IRBA 5LMNW 3LWUA 1A6XA 1E2VA 3KF6A 3RR5A 5C0XG 1HH2P 4JV5Q 1N8RC 4BY7H 3OW7A 4JVHA 2MNAA 1PH7A 3BG3A 4JI8L 3M4YA 3HOXH 2N8NA 2ALYB 2OWOA 2QNDA 5BR8Q 1XTDA 1VQBA 4PV1C 3CCJA 4A3MH 4ALPA 3ND8A 3Q8DA 4JI0L 4X66Q 1PHJA 1UE1A 4YWMA 1Z9FA 5GAEC 4B3RQ 2NN6G 1K0RA 1IBLL 1GUGA 1OXVA 1J5EQ 1GUOA 2JA9A 5HGQA 1K8OA 4HJ9A 1WI5A 3FKIG 4A3LH 2B29A 4BBSG 2PY9A 4DUZQ 3HOWH 4RG1A 1HCZA 4GOPA 2F4VL 3L2PA 2ZJPA 5LMNQ 1V8QA 1NMFA 1X65A 2JA5H 3VR6A 4DV2Q 3J80i 4GKJL 2YTYA 4ME3A 3I4NH 1SN8A 1PH2A 4RCNA 4PMWA 1FGUA 3LGJA 4LF4L 4YCWA 3T53B 5ELNA 1E2ZA 2K5VA 2JA7G 3CCMA 1NY4A 1GHKA 4DV7L 3KF6B 3KYHC 2K14A 2AXYA 4JK1C 3I55A 1ZKOA 1JMCA 3D31A 3I4LA 4DV4Q 1YHQA 1H9JA 4JBKA 4OX9L 2OPUA 4JG2A 2CTFA 1AH9A 4YY3L 1QUQA 3KLRA 2K7VA 3CCLA 5FJ8G 2HIVA 1PH6A 1OTCA 2LSSA 2E3UA 5IP9H 2IHFA 4DAMA 3D0FA 3WDNA 4LF8Q 4DUYL 1RL2A 4JI7Q 1PFSA 2BL5A 3HOZG 5BN5A 1SFOH 2RCNA 1CKMA 1K9MC 1XPOA 3PF4A 1GM5A 3CPFA 3PUYA 1E24A 3G71A 1GVPA 1N9WA 3AB9A 2E2HH 1DT4A 1CKNB 4QY7A 2PCFB 3STBC 3CCVA 3PO2G 4DV0Q 1ZTGA 1K3RA 3I7FA 1EWIA 3NEMA 2OTJA 1X3FA 2IY5B 4WJ3M 4P74A 4IOCA 4DNIA 2K75A 2CTEA 3HGBA 2JA8H 1VQCA 2PQUA 1SMXA 4J15A 2LMCB 1SE8A 5IE8A 1TWHH 2E2IH 3CRKC 4X65Q 2EIFA 1KRTA 2O5IC 4DPGA 1L1OA 1I94L 2UU9L 1N32L 5JJKA 4NB3A 3CCRA 4JI2Q 3HOVH 4HJAA 3RZOH 4JI6Q 1Z7TA 4LUZA 3GD7A 2AUJD 1KHMA 1VQIA 2Q2TA 1I50H 1WJJA 4GKKL 2DGYA 1E1OA 1KQSA 1QUQB 3SE0A 1IW7C 4R4OA 3T1HQ 4A3BG 2JJQA 3ZJYC 3A5ZB 4DK1A 2VZAA 3WWVA 4JI3Q 2E8GA 1DCZA 2QA4A 3RN5A 4K0KL 3VA7A 2VUMH 2D62A 3N6RA 3CCSA 3VDYA 5IYCG 4GS3A 1VQNA 4OO1H 4GN5A 2E5LL 1SR3A 2A1AA 2AWOA 5IP7G 5AJ3Q 2I5HA 1C7YA 1FJGQ 1VQEA 3S14H 1PH3A 1XMQQ 4LF6L 1XNQQ 2UXCQ 1VQAA 3PUXA 3G48A 1QVGA 1RIPA 2Y0SE 1XMOL 2VY3A 4NXMQ 1CSQA 5M5YH 3U9SA 3KFUA 4L5SA 1G291 4NPSA 4GN4B 2NZOA 2K50A 2A6ED 4TQUS 1M90C 1WCMH 4C2MH 2R7FA 2PI2E 1TUAA 2Z0SA 4AYBE 3HOYH 4BY7G 2EXDA 2BA0A 1YVCA 2A6EC 2I5LX 1PYBA 2WFWA 4APVA 4LW1A 1HNZQ 4HIDA 3VR2A 3HOXG 1YIJA 1L2FA 2DGRA 5BR8L 4LFAQ 4HJ7A 3CCQA 4A3MG 2KCCA 4X66L 1GJXA 5EAYA 3ICEA 4A3DH 1HPCA 3S17H 1YBYA 2KCMA 4B3RL 2IHEA 4DNRB 2EDGA 4AYBG 1B7YB 1QZGA 1J5EL 4LFBQ 3SGIA 4A3LG 2WB1E 4QIWE 3GTOH 4O0AA 4DUZL 3HOWG 1LTLA 3NBHB 1WE8A 3J81i 5LMNL 3A8IE 3AQQA 3TQYA 2PQAB 3M7NA 5IY0A 2E75C 4X64Q 4KI0A 4DV2L 2JA5G 1VQOA 4BBRH 1GO3E 1Y8OB 3I4NG 3BJUA 4RMFA 1BDOA 5C0XI 1TWFH 1BBWA 3M4OH 2HH2A 4YCUA 4OXPA 2WB1G 1GUNA 1DXMA 1EC6A 3A5UA 1PH8A 3OOCA 1UE5A 4DV3Q 1YHBA 2GN5A 1K8GA 1B70B 2NVQH 3PSIA 4DV4L 2UUBQ 1VQ4A 4AIMA 1X4NA 3A8JE 3E9IA 1OXUA 4OWXB 4A3EH 3A7LA 3J7A5 3DXJC 2ZJQA 2R92H 4R4IA 3FPPA 4JC0A 3GTJH 4DR7Q 5IP9G 2PMZE 1VF7A 3TZUA 4A3CH 4LF8L 2MO1A 1H95A 4GNXC 1VIGA 4JI7L 2ZTCA 2UXDQ 5K36H 1IBMQ 2AMCB 2B8FA 1OXXK 2OPVA 2DNEA 2MO0A 1VQDA 1HJPA 1WYDA 4X62Q 1HQMC 2HH3A 4B8TA 2UUAQ 1IXRA 2NVXH 3I4OA 1IBKQ 2NVYH 4DV0L 1ZZKA 5M5XH 1FR3A 4AQYQ 2JA8G 4KMUC 2VQEQ 1IZ6A 3W3AA 1C9OA 1M1KC 3M3YH 3S2DH 3ND9A 1QVFA 4X65L 3KDFA 3QIAA 2ES2A 4IQZA 1MKHA 3RN2A 1SLJA 4JI2L 3HOVG 3K7AH 4JI6L 2JA6H 4DR3Q 3MXNB 1KL9A 4BA2I 3S1MH 1HZCA 3T1HL 2B63H 4IFDH 4JI3L 4DR2Q 2VUMG 1Q46A 1VQFA 4DR6L 3F2DA 2DUDA 2RHQB 1TU2B 4HJ5A 3RZDH 1NMGA 1PYSB 4BY1H 3T51B 4OO1G 2H5XA 1G51A 4GNXA 5FLMH 4BXXH 5AJ3L 3TEHB 1FJGL 3T56B 5H1SE 3OW2A 1XMQL 1H9KA 3H3VH 1XNQL 2UXCL 2A6HC 4DV5Q 2KCTA 1CKNA 3GTKH 1YNNC 4LNQA 2JK8A 1OXTA 4NXML 5M3FH 4P75A 2ZTEA 1VQ5A 1KRSA 2C35B 3KDFB 2ATWA 1JJ2A 1WCMG 1PV4A 2CWPA 3QG1A 3HOYG 2PPBC 5J3BA 1TWGH 1X9NA 4B3SQ 1GHJA 2PI2A 1HNZL 1YJ9A 4LFCQ 3ER0A 1C0AA 4IPHA 4LFAL 3HOUH 4R1JA 1GUTA 3UDFA 4JI4Q 3F2BA 5JEAJ 1GUSA 5E7NA 2GVAA 3RNUA 4A3KH 1P16A 4A3DG 3GO5A 1N36Q 4P73A 1DTJA 2I0QA 2MQHA 4L5TA 3M4PA 4LFBL 4YWKA 1CI3M 4GNXB 3VR5A 3HFZB 1NBWA 5C3EH 4DR5Q 1HNXQ 2A19A 4G7HC 5C0XJ 3S1RH 2CTKA 3AFPA 1PH9A 3SDZA 3PIPA 3H15A 3E0EA 3STBD 1KXLA 4X64L 1V43A 5M3MH 1VQ7A 4B3MQ 2EQSA 1TXYA 3GTLH 3JAMc 1CFMA 3VKEA 4P72A 4IFDI 1B9MA 4DV3L 3ERSX 1J4WA 2ANNA 1HR0W 2UUBL 2R93H 2V4DA 4HR7B 1N34L 1Y14B 4A3EG 4EQ5A 3DLLA 2L5TA 1IW7D 2R92G 2HQLA 1UE7A 3W1BA 1S3OA 3J81j 4DR7L 2JEAI 2DNCA 4JYAQ 1R9TH 3U1KA 4PG3A 4H0LC 1FVIA 4JCVE 4DR4Q 2MJHA 3F1ZA 4A3CG 4KLKA 2E76C 2HHHQ 5GROA 2UXDL 1VS0A 1IBML 5K36G 2ZT9C 3U4VA 2YU9H 4YWLA 1HTPA 1TWCH 4X62L 4DR6Q 2HT1A 1D8LA 1QVCA 1Q8KA 2UUAL 2F3IA 4KN7C 3H0GH 1H9SA 4QMFB 1IBKL 1DD2A 1YNXA 4DR1Q 4A93H 1HR0Q 4AQYL 1X55A 3MEFA 2ZM6Q 4LF5Q 2PQAA 3CC2A 2VQEL 4QJFA 4QGUA 1VQ9A 2A8VA 3B6YA 4TVAB 2FXQA 2OQKA 1KIXA 4KN4C 4G7OC 2LXJA 1HNWQ 1AE3A 4BBSH 4IO9A 3UDXA 2XTIA 4WJ4A 4YCVA 5GAHC 2JA6G 4QL5A 4DR3L 4WANA 4JOIC 1MIUA 1XJVA 3RLOA 5BN3A 5FLXc 4TKOB 4DAYB 5IYDH 3K7UC 2B63G 2VNUD 4IFDG 1Z47A 3IKJA 4DR2L 4I7ZC 1YHAA 1QJOA 5DLQE 1AE2A 2CPQA 4BY1G 2K5NA 4X6AH 2Z6KC 4GLVB 3GTQH 3KF8B 2CTJA 1LYLA 4MZ9A 5FLMG 4BXXG 1LM0A 3K0XA 3CP0A 2KHJA 3W1GA 1TWAH 3HKZG 2D0OA 1E7ZA 4B3TQ 1H9SB 1YEZA 4DV5L 3UDGA 1B8AA 3BDOA 1VQHA 3UDIA 4XIGS 2AHOB 5C4JH 4R4QA 3DM3A 5C44H 2Q2UA 5M3FG 2JZXA 2WAQG 1Y1VH 2N3SA 2ANRA 4C3JH 1VQGA 2BE5C 3ULLA 4LWCA 2Q8IB 3UE0A 4OWWB 4GLAC 3A0JA 2OQ0A 1YJNA 2A69D 1I6VC 4KHZA 1OXSC 3F8TA 4KHPL 1EIFA 4C3IH 5IWAQ 1Q82C 3PUVA 4B3SL 2CCZA 1XNRQ 2EJFC 3E9HA 2A69C 4LFCL 1EFWA 3PIOA 3HOUG 4JI4L 5GAGC 5KNDA 4OO1I 1VQKA 1N34Q 1DGSA 4A3KG 1N36L 2AWNA 5BN4A 1E2WA 1BVSA 1P8LA 1WFQA 3S15H 3PGZA 2AUKA 1KD1C 4PZ7A 2VQFQ 2I5MX 4DR5L 2JXMB 2E2JH 3CQZH 5C3EG 1HNXL 1V9PA 1QZHA 2BH2A 1FYCA 5JJIA 2WP8J 4A76A 2E74C 4QQBX 3TRZA 4MTNA 1VIHA 4DKAC 4NBQA 1E22A 1VQJA 2O5JC 1CKOA 1JT8A 4LF7L 5M3MG 4B3ML 2YYZA 2F52A 2KHIA 2GVBA 4HIMA
chains in the Genus database with same CATH superfamily
1NXUA 5ELOA 3QO2A 3M85A 5I9PA 1RDPD 1HA6A 1CZGA 1UNSA 4C3HH 2EXZA 3SXHA 2LF0A 3GABA 4UPAA 4GOPC 2YV5A 1A8VA 2XVSA 3K5NA 2XGTA 2KA7A 3OHXC 2EPBA 3C3LA 3RLFA 2B3GA 4IJHA 3I4MH 2EVBA 4Z9CB 1EQQA 2CTMA 5TSSA 2OEOA 3JAMi 1IHZA 1YJWA 2R93G 4H13C 1ONLA 3DM1A 4A3DB 3S17B 4F88A 4LF9Q 1F9SA 2F0PA 1A62A 1MJCA 1Q12A 1ZYRD 4LUVA 4FYDA 1H9MA 1WOCA 4PQXA 1JE5A 4P71A 3HRZC 4KHPH 4GN3B 3AU7A 1X3PA 4N8FA 4OELB 3NENA 5IGFA 3GR5A 1S03G 3FP9A 4B3SH 4A4IA 1AFPA 1ASYA 2UXBQ 3H3VC 4JYAL 1PMRA 3GTOB 3UE1A 1ZYRC 1N33Q 4LFCH 4DR4L 3OTOQ 4RAUC 4A3FH 2A68C 4JI4H 2CFMA 1SBBB 2HHHL 2RHSB 2PNHA 3ULPA 1VQLA 2DY7A 4FP5D 4UP8A 3BVMA 5HY6A 5EBDA 2B2WA 4A3JH 4BBRB 2PNRC 2EJGC 5E3FA 5NUCA 1DYQA 3GTPH 1HFGA 1X54A 5FO7B 1N36H 3TS2A 1F9QA 3FHWA 1LV9A 1X3EA 1JORA 3SK5A 3MFYA 1AN7A 3BU2A 1TWFB 5CR3A 2AQ3B 3M4OB 4DV6Q 2RDHA 1A3VA 1EU3A 3PUZA 1CA5A 2G9DA 4HIOA 1VCIA 3H0GG 1PZKD 3NELA 2A6HD 3PUWA 4WFN3 3MAQA 1QOHA 4DR1L 4DR5H 1HNXH 1HA5A 1HR0L 4JI1Q 4A93G 4BA1I 2CQOA 1S40A 2ZM6L 4LF5L 3GQBA 1YZ6A 4JBJA 1I5FA 2NVQB 1PZJD 2MGSA 3PQIA 1ZZJA 2ZJRA 3GDEA 3OPOA 2N49A 2X6LA 1X3QA 3QD7X 2IT1A 2J0TD 2EE1A 1J5KA 1KC8C 4LJZC 4UP9A 5T1IA 1IYVA 4IALA 3M7GA 1SMYC 3CW2C 1ESFA 2JQOA 1SXTA 4A3EB 5CV4A 2EOTA 5CYUA 3CCEA 1XPUA 3J81c 3KDGA 4LF7H 4B3MH 1XPRA 3MXGA 2K32A 2R92B 1LACA 3OETA 5KYIA 1SNCA 1NUCA 3I0PA 1ZEQX 3GTJB 1HNWL 4RGNA 4FF1A 2ID0A 3DHQA 4A3GH 3A55A 1MGSA 3TN2A 5CBEE 4UDUC 1ESRA 2NZ1D 2HIXA 1MSZA 2RDFA 1D1IA 2B2TC 2QW7A 2Q2IA 2PZWA 1SNDA 2R6GA 2Z8LA 4DV1Q 1Y8NB 1YITA 3DEPA 4KHPQ 4KTAA 1BCPD 1BKBA 5LHY1 2YTVA 3J7ZC 1D7QA 2KJXA 1Y1WH 2F0GA 1Z6HA 1Q81C 1K8AC 5IYDG 5C4XH 1IL8A 1M8AA 1XTCD 2F1MA 2D5DA 1S5FD 4RHSA 3R8BA 1HZ9A 4A75A 1BCPC 4JVYA 2RCFA 2QF7A 5EBCA 4L8JA 5C3WA 1L1OC 3CF5A 5GADC 2NVXB 5E4XA 1J6QA 1RTOA 3RLNA 4JYAH 2NVYB 3K81C 4H7BA 5M5XB 1PH1A 1SROA 1E1TA 4AM3A 1LUZA 4DR4H 2N55A 3P7JA 4JI5H 2EJMA 3NTKA 4LAAA 4YHHQ 3MEHA 2HHHH 2D2CC 4LIJA 3CXCA 5EPLA 2R7ZH 1F9PA 2B2VC 4A3IH 2CPMA 2FMRA 4PNYA 3OYYA 4E6IA 3PIP3 3M3YB 3S2DB 4FF4A 1T5EA 2NB0A 1LABA 5KIXA 1K73C 3EZJA 2EYHA 5J39A 3CPWA 2F0LA 4B3TL 1GUWA 2ZTDA 1G2TA 4XT1B 4NXNQ 3V69A 3L0OA 3AEVA 1II3A 1SNQA 3H6MA 4IPCA 4PZ6A 1I3QB 3T1YQ 1HFNA 5I4DA 2XIWA 4EC5A 1V1QA 2F0IA 2MFIA 3RD4A 1KNAA 4Y52H 4ZCKA 5LMUQ 1YI2A 2Q8RE 4H44C 2VB2X 2XRSD 1PFBA 5C44G 3H94A 3PO3H 1I4PA 3M4QA 3K7AB 1U0LA 3TP5A 1Y1VG 2JA6B 3NWTA 4C3JG 1HR0H 2FINB 4BBRG 4IUPA 2TMPA 2K52A 4CJ1B 2ZM6H 4LF5H 3HZXA 1Q1BA 3J80E 4LF7Q 3OMCA 1EOVA 3S1MB 1NJIC 3HS0C 1JJGA 2B63B 5IWAL 1EY7A 4C3IG 4DNTB 3K8AA 1PRTD 3IFTA 4UAIA 1JWMD 1XNRL 4L63B 2DN8A 1WVNA 4GOPB 1JJCB 2KEEA 1X6OA 2CKZB 2QGQA 5FLXE 4KKSA 4OONA 1HNWH 1X4MA 2F0HA 1I6HH 4EX5A 3RZDB 4QF4A 1O7LA 5M5WH 4BY1B 2QEXA 4FDBA 2L1BA 4H02A 2CTLA 3IFDA 3CC7A 1KTKA 3S16H 5IYBH 3E5SA 5JEAH 2K4KA 4IN3A 4HEDA 3PV0A 1TKWB 1XXGA 3CMEA 4EQOA 1E3PA 3HKZB 3MXUA 4DAYA 2QCPX 4JBMA 1GOZA 1UE6A 5ELFA 1AN8A 3H3VI 5IGCA 2WINB 4JBWA 3GTKB 2UUCQ 1EYGA 1CHPD 4JI5Q 2VQFL 1SNPA 1NCVA 2OXPA 1JICA 5A2QW 3TSSA 5M3FB 5IGEA 1Q86C 1SNMA 2WAQB 1B9NA 4MNOA 1F2YA 1EUJA 3NTIA 1O7IA 1A63A 3K6OA 4DA2A 1V9NA 3GV6A 3A56A 3A74A 4XTCS 1JB7A 5C0XH 3S2HH 2BDOA 2KCNA 3S1NH 1ET6A 4ZRZA 2N78A 1NTGA 3AEVB 2JVZA 1LTTD 5JJLA 1Q7YC 3UI2A 3GTGH 4N8X1 3K5OA 4ZAIA 1PDQA 1PH5A 4MTKA 1NE3A 4XQNA 1PVOA 2IX0A 4B3TH 3I2ZA 3R3OA 2F3WA 1TWGB 3ULJA 4F8MA 4JI8Q 1FD7D 5ELCA 1GD7A 5I9OA 2KENA 4NW2A 1SYEA 3MWYW 1S20A 3G6EA 4ZQ3A 5JOBA 1KABA 2R61A 3BVGA 1T9HA 3RMHA 4CKEA 3HOUB 3OSSD 4CGYB 4JI0Q 1CZWA 1CUKA 1PTOD 1EWHA 1A0IA 1EY5A 1SE3A 1Q3LA 3BZKA 3CCUA 3EIVA 1VQ6A 3FEWX 3KJPA 2NN6H 4DK3C 3I4MG 1FL0A 2B8GA 5IODA 1JB3A 4A3KB 1ZZIA 1IBLQ 2F0NA 4RCOA 3TREA 4LF9L 3U58A 4MN3A 1K8MA 4KD4A 1VQ8A 3D3RA 3P20A 2ASBA 1PTOC 1CTMA 3FKIH 5IWAH 4HMJA 2RDGA 4C56C 4RWSC 3I8ZA 1LTGD 3J80c 1BBUA 1GXDC 4O2DA 3S1QH 1WHRA 3LNNA 1MJEA 1XNRH 1M4VA 2UXBL 5EKKA 2P5ZX 2F4VQ 2F0JA 1EIYB 5C3EB 2O4XA 2PW7A 1QNUA 3S9WA 2JEBI 4R4TA 1N33L 1KNEA 1W3SA 3EN2A 3OTOL 3S1RB 3W5OA 1V1OA 3S24A 1YNJC 1BQQT 3V2TA 4B08A 4A3FG 2HD3A 4GKJQ 1ASZA 3KJOA 1X9ZA 3CU7A 2M9VA 4X3TA 2AKWB 3G4SA 3HKZE 1ENAA 1MBYA 1IL2A 4KHVA 4I65A 4A3JG 1BCPB 4IUTA 1L1OB 5IT9E 4LF4Q 2KBNA 4POFA 4K5WA 5M3MB 4JV5L 1HZAA 5FKAC 3TS0A 1SE2A 2JA7H 4DV6L 2WAQE 4R4CA 1K83H 3GTLB 4V0BA 1IYUA 4R9WA 3RUZA 4DV7Q 2Y0SG 3A8KE 2BH8A 1X56A 2VQFH 2F0TA 1EYAA 1Q1EA 2IX1A 3NE5B 4JI1L 4EQNA 1O78A 3GTMH 4OX9Q 5D14A 1CSPA 2DJGC 2LRRA 2R93B 4HJ8A 4CDFC 1PA6A 3CC4A 2D0PA 3I56A 2BE5D 3T16A 4YY3Q 4LUOA 5JVG3 1B50A 3JAMW 5FJ8H 1JWUD 5DT9A 2VS1A 1U4MA 1SRUA 1CM9A 2OCEA 2ICIA 1ICWA 2NZHA 1W2BA 3BDCA 1G2SA 2OTLA 3I73A 4NZTM 3BYYB 4GLXA 2LTMA 1VQMA 4JVZA 3KOJA 5EKIA 4A3GG 1R9TB 4Y7NH 1ENCA 1BBXC 4ZUJA 4DUYQ 4IZ8A 4ODGA 1L0WA 3W2DA 4L5RC 3HOZH 1PFMA 4DV1L 3Q0AA 1EZ8A 4IJLA 1GKHA 4OGQC 2RF4A 1AZQA 1RKNA 2YU9B 3QJYA 2VKCA 4KV6A 1Y1WG 1UG8A 1TWCB 2K5HA 4FXKC 5C4XG 4LF9H 1LTRD 3FMCA 3BS1A 1XRHA 1G6ZA 5KNBA 4DK0A 1G91A 1SYGA 3L7ZC 4DK6C 5CC4A 1EWCA 3PO2H 2CWFA 4KKTA 3EQLC 2K33A 1WD0A 1KLGD 3H0GB 2UXBH 1LT4D 4NMZA 4JOIA 2IX3A 3VR4A 2EYMA 1N33H 4A93B 4IOAA 2RA4A 4OWTB 4YHHL 3CAMA 5I2YA 1H9RA 3J7AF 3HEJA 1KLUD 4PZ8A 3P75A 2R7ZG 2CQAA 1STBA 1R4QB 1V1PB 3X3NA 3U50C 4A3IG 2VB3X 3CRLC 3V05A 3F2CA 3AMUA 1D6EC 2F0WA 3CMAA 1Q90A 1VDZA 1I94Q 5GQOA 2UU9Q 1IYJB 1N32Q 4RGOS 4JV5H 2BCOA 4NXNL 1VF5C 2EYFA 4IPGA 4FXGC 3T1YL 2NN6I 3EBEA 2Z6KA 5KNCA 1KAWA 3HKSA 3K57A 4DV6H 3FAUA 5LMUL 1F77A 2DY8A 1SYCA 1EQRA 5IT9c 3PF5A 2WIIB 1UEBA 3TZDA 2F0DA 4DXGA 4AH6A 3T4AC 3PO3G 2MHVA 4GKKQ 3JC66 5I2XA 4LK1C 3BZCA 4JI1H 4IFDJ 2V1CC 1RJTA 4G7ZC 1PH4A 2CWAA 4HMIA 1EQVA 4QB4A 4A3BH 1HZBA 2F0UA 1BF4A 1XX8A 3AYHB 1U5KA 1KHIA 4HIKA 4K0KQ 4CJ0B 1Y69U 1G8ZD 4UY8C 1DONA 3SHLA 5DEHA 1UAPA 1STEA 3TP7A 5A35A 1LLRD 3CD6A 3D4RA 3U4ZA 2P2RA 2R7DA 2CWHA 5IYCH 1RF2D 1KAAA 2FFMA 1B2TA 2E5LQ 3L3OC 3QOJA 3A54A 5IP7H 3AFQA 2YTXA 3VR3A 4WALA 2OF1A 5FLXW 1S5CD 2Q2HA 1BCPF 3GTQB 1VQPA 2CW0C 4UP7A 1JOKA 1Y8PB 4DAPA 1PTOB 4PDBA 4DV1H 5IYBG 2YQRA 4L5QA 4LF6Q 2JE6I 1G6PA 1F2ZA 2B2YC 3K80C 1K1GA 5EJWA 5JEAG 1B3QA 4KKUA 2L15A 3PMFA 2A68D 2F0FA 1TWAB 2FMMA 3I72A 5EKLA 3A7AB 4IPDA 4IUQA 2Q8TA 4FJSA 5CV7A 3WOFA 2VL6A 3NTHA 3ERQA 1XMOQ 3PCOB 2B39A 4U673 1UWVA 1I3QH 2LXKA 5ISRA 5C4JB 2UUCL 4POGA 4JI5L 1SAPA 1X3GA 2BA1A 5C44B 2EYOA 1K28A 2NVTH 2XN9C 2VW9A 2FJ2A 1S72A 3KLWA 1Y1VB 3M9BA 4C3JB 4GZYC 3IRBA 2K01A 5LMNW 1EYCA 3LWUA 3KF6A 1E2VA 3RR5A 4C1NI 1A6XA 5C0XG 4YHHH 1HH2P 4JV5Q 3EA6A 1N8RC 4BY7H 3NSWA 3OW7A 4HAEA 4JVHA 1JQYD 3SVMA 4C3IB 1BXTA 5EGTA 2MNAA 5D3IB 2HCIA 1HQRD 1R4PB 1PH7A 3BG3A 4JI8L 3G7LA 3U9OA 3M4YA 4NXNH 3EJIA 3HOXH 2N8NA 2ALYB 2A5HA 2OWOA 2QNDA 1LT5D 1SMYD 3T1YH 5BR8Q 4N9TA 4O42A 1XTDA 1VQBA 3LWEA 4PV1C 5LMUH 3CCJA 1MD2D 2NTSA 4A3MH 4ALPA 3ND8A 4PMBA 3Q8DA 1SEBD 4JI0L 4X66Q 4R8NA 3I91A 3FDTA 1DOKA 1UE1A 4YWMA 1PHJA 1Z9FA 2F0KA 1ET9A 5GAEC 4B3RQ 3DWQA 2NN6G 1K0RA 1IBLL 1GUGA 1OXVA 1J5EQ 4YIJA 3NUCA 1PRTF 1GUOA 2K1HA 2JA9A 5HGQA 1K8OA 3MA2B 2BDNA 2NTTA 5I6WA 1WI5A 3FKIG 4HJ9A 4A3LH 1WTPA 2Z1CA 1I4XA 1LT6D 2B29A 5A2QL 3OIQA 4EQPA 4BBSG 5LL6X 1EIHA 2PY9A 3S15B 4DUZQ 3HOWH 1U4PA 4RG1A 1HCZA 4GOPA 2F4VL 2WKDA 3L2PA 2ZJPA 5LMNQ 2E2JB 3CQZB 1V8QA 4ULLA 1RHPA 1NMFA 1B44D 1F2MA 1X65A 2JA5H 3VR6A 2OT2A 4DV2Q 3J80i 4GKJL 2YTYA 3H91A 3KDKA 4ME3A 5G3LF 3I4NH 1SN8A 1PH2A 3MZ5A 4RCNA 1K0SA 4QUCA 4U68A 3KUPA 4PMWA 1FGUA 3LGJA 4LF4L 3VA5A 4QUFA 4YCWA 2BOSA 3T53B 4RKLA 1E2ZA 5ELNA 4DFAA 1L0XB 2K5VA 2JA7G 5IT9W 1UUPA 3CCMA 2EY1A 1NY4A 4C1NK 1GHKA 4DV7L 2G5DA 2Y3MA 2EYPA 2UUCH 3KF6B 3KYHC 2K14A 2L0CA 2KEDA 2AXYA 5FO8B 4JK1C 3I55A 2RVLA 1ZKOA 1JMCA 3D31A 1TS4A 1RCVD 2PO4A 3I4LA 4DV4Q 1YHQA 1H9JA 4JBKA 2F0OA 4OX9L 1HTLD 1A2TA 4JG2A 2OPUA 3T13A 3I4MB 3TP8A 1HUMA 3C46A 1WTHA 2CTFA 2K6AA 1AH9A 2FFKB 4YY3L 1QUQA 1SE4A 2K5WA 3KLRA 3SEBA 4PMCA 2K7VA 3CCLA 5FJ8G 2HIVA 1PH6A 1OTCA 2F03A 3T1HH 2LSSA 3FVQA 2E3UA 5IP9H 3SK6A 4OHJA 2AQ2B 2IHFA 2EY6A 4JI8H 3NP8A 2PYKA 4ME5A 4DAMA 3D0FA 1PTOF 3WDNA 4LF8Q 4HSPA 4ZLTF 4O1NA 1TY2A 4DUYL 1RL2A 3Q23A 2EY2A 3Q6SA 3D4DA 4JI7Q 1PFSA 2BL5A 1C4QA 3HOZG 5BN5A 2M8WA 4A3FB 4JI0H 3Q24A 1SFOH 3J7YW 2RCNA 1CKMA 2M6QA 1K9MC 1XPOA 2X6GA 5KYLA 3OIPA 3ITPA 1GM5A 3PF4A 3CPFA 3PUYA 3R93A 3G6JB 4K5XA 4A3JB 5CORA 1E24A 2JSOA 1B3AA 1IBLH 3G71A 1GVPA 1N9WA 3AB9A 2E2HH 3GTPB 1EOTA 1DT4A 1CKNB 4QY7A 5FO9B 2QKIC 4K8IA 3SR1A 2PCFB 1TS3A 4NKLA 3STBC 3CCVA 2AQ1B 1QCBD 2CH4W 2B2TA 1B4OA 3PO2G 3V96A 4DV0Q 1ZTGA 1K3RA 2CH4A 3I7FA 1EWIA 1U4RA 3NEMA 2Y0SB 1X3FA 2OTJA 3F2UA 2IY5B 4WJ3M 4P74A 5E1FA 4IOCA 2F4VH 4DNIA 2K75A 2CTEA 1CT1D 1TR5A 3HGBA 2JA8H 4NXMH 1VQCA 2PQUA 1DM0B 1SMXA 4J15A 3JAML 2LMCB 1I4HA 5G3LD 3KBGA 4S3SA 4GKJH 1SE8A 5IE8A 4ILWA 1EEFD 5KRUA 1TWHH 2E2IH 2H4OA 3CRKC 4X65Q 2EIFA 3IL8A 3ONAB 4RGTA 2MUYA 1KRTA 4DPGA 2O5IC 1L1OA 1I94L 2UU9L 4LF4H 1N32L 5JJKA 5C4HA 2Z4HA 1NNXA 4NB3A 3CCRA 2B2UC 4JI2Q 3HOVH 1DZ1A 4HJAA 1TT2A 3RZOH 1TQOA 4JI6Q 1Z7TA 5DNFA 4A3GB 4LUZA 3GD7A 1LTID 4DV7H 2AUJD 1KHMA 1VQIA 1EY6A 2Q2TA 1I50H 1WJJA 4GKKL 2B2VA 2DGYA 1E1OA 3NQTA 1KQSA 1QUQB 3SE0A 1CQFA 4LFAH 1IW7C 2F3VA 4R4OA 3J81W 5FOBB 3T1HQ 4OX9H 3EFXD 4A3BG 2JJQA 3ZJYC 3A5ZB 2EY5A 2K5DA 2VZAA 3QWNA 3WWVA 4DK1A 4JI3Q 2ICEC 2E8GA 1X32A 3SK4A 1DCZA 2QA4A 3RN5A 1Y1WB 4HTHA 4K0KL 3VA7A 2K5QA 5KEEA 2VUMH 1MHWC 2D62A 3N6RA 5C4XB 1MSGA 4YY3H 2LS01 4BS9A 1D5XC 3CCSA 1RTNA 1J8IA 5C5LA 3VDYA 1STNA 5IGDA 3FPUB 5IYCG 4GS3A 4C3HG 1VQNA 4OO1H 4GN5A 2E5LL 1SR3A 2A1AA 3DWAA 1LO5D 2AWOA 2IW3A 4QIWB 5IP7G 3K59A 5AJ3Q 1QNKA 3TDQA 4DUYH 2I5HA 4IUVA 1C7YA 3NBHA 1FJGQ 3DUZA 1VQEA 3S14H 1PH3A 2NBFA 4JPBW 3ZYYX 1XMQQ 4LF6L 2VXWA 3NQIA 3KK7A 2R7ZB 2IWHA 1RODA 1L0YB 3C1EA 4A3IB 3BVZA 4RA8A 3R2TA 1YNJD 2FHTA 1F0XA 1XNQQ 2UXCQ 1VQAA 3PUXA 3G48A 1SNOA 4X3KA 2EYJA 5C4ZA 1QVGA 1RIPA 2Y0SE 1XMOL 2VY3A 4QMGA 4KK7A 2NWGA 4NXMQ 1CSQA 1EY8A 3OWEB 5M5YH 3U9SA 3KFUA 4L5SA 2F0VA 1G291 4NPSA 4GN4B 2NZOA 3PO3B 2K50A 2PZUA 2A6ED 4TQUS 1SYBA 1M90C 2D9UA 5J1ZA 1WCMH 1J9OA 3OMGA 1TS5A 4C2MH 4K2LA 2R7FA 1S5BD 2PI2E 2JN4A 1TUAA 2Z0SA 3J80L 4AYBE 4CJ2C 3HOYH 4DXFA 4BY7G 2EXDA 4R8IA 2BA0A 1V1PA 2QDLA 1YVCA 2A6EC 2I5LX 1PYBA 2WFWA 4APVA 1I94H 4LW1A 1EYDA 2UU9H 1HNZQ 1N32H 4HIDA 3VR2A 3HOXG 1YIJA 1L2FA 2DGRA 5FLXL 2L12A 5BR8L 4LFAQ 2EYLA 3K0YA 4KJNA 4HJ7A 3CCQA 4M8AA 2J4XA 1I6HB 4A3MG 2LKVA 5M5WB 2PMZB 2KCCA 3DMUA 5CMDA 1STYA 4X66L 1VMCA 4GKKH 3OWFA 1IKLA 3S16B 1GJXA 5EAYA 3ICEA 4A3DH 1HPCA 3S17H 1YBYA 2KCMA 4FJUA 4B3RL 1MSHA 2IHEA 5HURA 4DNRB 2EDGA 5EPKA 4AYBG 1B7YB 5D3DA 2SOBA 1QZGA 5FK9C 1JOQA 1J5EL 4OEMB 1NAPA 4LFBQ 3SGIA 1S5DD 4K0KH 4IURA 2ZQEA 1WD1A 4HCEA 4CDEC 3H09A 4A3LG 2WB1E 1WTOA 4KJOA 4QIWE 3GKUA 3GTOH 4DGZA 4O0AA 4DUZL 1PFNA 3HOWG 1LTLA 3NBHB 1WE8A 1A3UA 3KLSX 3J81i 1WTRA 2SNSA 5LMNL 3A8IE 3AQQA 3TQYA 2E5LH 2PQAB 3M7NA 2F0EA 1U4LA 4EGVA 1A2UA 5IY0A 1ENFA 2E75C 1DJRD 4X64Q 1HHVA 1IBKH 4KI0A 1JC7A 1ZXTA 4DV2L 2JA5G 1VQOA 4BBRH 3C1FA 1GO3E 3MHBA 3NCVA 1Y8OB 3S2HB 3S1NB 4FF2A 5IOCA 3I4NG 4LF6H 3BJUA 4RMFA 1BDOA 5C0XI 5K5PA 3GTGB 4V190 1TWFH 1BBWA 3M4OH 3OSOA 2C9OA 3NHHA 4HN7A 2HH2A 4WRDA 4YCUA 4OXPA 2WB1G 1IKMA 4XYOA 1GUNA 1QWYA 1DXMA 1EC6A 4B8CD 1XMOH 3A5UA 1PH8A 1NR2A 3OOCA 1UE5A 4DV3Q 2F0QA 1X0AA 1YHBA 2GN5A 1K8GA 1B70B 2NVQH 1EZ6A 3PSIA 4DV4L 2UUBQ 1VQ4A 4AIMA 3MVVA 4OL7A 1DOMA 1X4NA 3A8JE 3E9IA 4DU9A 1OXUA 1TVXA 1JCKB 4OWXB 2O2LD 3MXNA 2I46A 4A3EH 5AFWA 3A7LA 2B2WC 3J7A5 3DXJC 2ZJQA 2R92H 3NBIA 3FKIB 4R4IA 1U9RA 3FPPA 4JC0A 4BWGB 1VBIA 3GTJH 1JE4A 4BBSB 4DR7Q 4FNFA 1JR0D 5IP9G 3S1QB 5A2QE 2SEBD 2JYOA 2PMZE 2SDFA 1VF7A 3NPPA 1W6KA 3TZUA 4A3CH 5BR8H 1B53A 1BO0A 4ZUIA 1JOOA 4LF8L 5DM73 2MO1A 1H95A 4G57A 4GNXC 1VIGA 4ZKCB 2ZTCA 4JI7L 5E4WC 2UXDQ 5K36H 2L4NA 1IBMQ 2AMCB 2B8FA 2HUGA 2PQEA 3GV3A 1SYFA 1OXXK 4X66H 2OPVA 2DNEA 2H1EA 3J80W 2MO0A 4B3RH 1VQDA 1HJPA 1WYDA 2CW0D 1HQMC 3BZDB 4X62Q 1BNZA 5IT9L 3IAYA 2HH3A 1J5EH 4B8TA 4K14A 1DOLA 1WTJA 3I90A 2UUAQ 1IXRA 1AZPA 1SDFA 2NVXH 2JA7B 3I4OA 1IBKQ 2NVYH 1K83B 2MJ8A 2TSSA 4UHVA 4B9WA 4DV0L 1ZZKA 5M5XH 3E0JA 4DUZH 5CV5A 1AW7A 1FR3A 4AQYQ 4NZRM 5LMNH 4XYQA 2JA8G 4KMUC 2RSNA 2VQEQ 1MI2A 4LMQD 2CHBD 1IZ6A 4B9XA 3GTMB 4RGMA 4DV2H 3W3AA 1C9OA 1M1KC 1ML0D 3M3YH 3S2DH 3SB1A 3ND9A 1EY0A 4OD6A 2G9HD 2SNMA 4QCLA 1QVFA 4X65L 3KDFA 3Q22A 3QIAA 2ES2A 4FXDA 2I07B 1MKHA 1TIID 4IQZA 1QE6A 5IGBA 3RN2A 1SLJA 3L9AX 4ID6A 4JI2L 5T1GA 1HXYD 3HOVG 3GP7A 3K7AH 4JI6L 1KDAA 5DM63 2QEJC 2WACA 2JA6H 4Y7NB 4MIUA 2XWJB 1JWSD 4DR3Q 3MXNB 1KL9A 3HOZB 1PLFA 4BA2I 4DV4H 2JP1A 5C6AA 3S1MH 1HZCA 3T1HL 1PYWD 2B63H 5M9OA 1NSNS 4JI3L 4IFDH 4DR2Q 4EVOA 3K5LA 2VUMG 1Q46A 1VQFA 4G4KA 4DR6L 3F2DA 1WTQA 2DUDA 2RHQB 4TSSA 1STGA 1TU2B 4HJ5A 3PO2B 4FO2A 3RZDH 1PZID 1NMGA 1PYSB 4BY1H 5JJZA 3T51B 4OO1G 5EPJA 2H5XA 4FF3A 1CQVA 4CHTB 1G51A 4GNXA 4LF8H 2K28A 3HG9A 5FLMH 5AJ3L 4BXXH 3TEHB 4JI7H 1FJGL 1YNND 3T56B 5H1SE 3OW2A 1XMQL 1H9KA 3JAME 3H3VH 1A15A 3KLSA 2Z6BA 1XNQL 2UXCL 2A6HC 3BYTB 4DV5Q 2KCTA 1EQTA 4CKCA 2KECA 1CKNA 3GTKH 1YNNC 4LNQA 2JK8A 2PW5A 1OXTA 4NXML 5M3FH 4P75A 3MXPA 4CKBA 4DV0H 2K03A 2Z9HA 2ZTEA 1FNUA 4JW0A 1VQ5A 5LL6b 2RSOA 3J81L 1SYDA 2B2YA 3D6WA 2ZXPA 1KRSA 4XT3B 2C35B 3KBXA 1EY4A 1EL0A 4OIKA 1BOSA 2HQEA 3KDFB 5L37A 1WCMG 1PV4A 1JJ2A 2ATWA 5ELBA 4A3BB 2O4CA 3SK8A 3FRPB 2KVMA 3MTSA 2CWPA 3QG1A 4K6DA 3HOYG 2PPBC 3D8GA 5J3BA 2G8YA 1TWGH 4X65H 1X9NA 2L55A 4B3SQ 1GHJA 2PI2A 4IUUA 2KOLA 1HNZL 1YJ9A 1BR9A 3TMEA 2RBMA 4LFCQ 3ER0A 1C0AA 4C3HB 4N9PA 4IPHA 4LFAL 3HOUH 1EEID 4JI2H 4R1JA 1GUTA 3UDFA 4JI4Q 3F2BA 1B1ZA 1QB5D 5JEAJ 4JI6H 1EFID 4XQJA 1GUSA 4K6LA 5E7NA 2GVAA 3X3MA 2C5CA 5CGKA 5IGGA 5JPNC 3RNUA 3VYTA 4A3KH 1P16A 4Q5VA 4ZK9B 4J1MA 3GO5A 4WJWA 1TS2A 1N36Q 4A3DG 4P73A 4ZYSA 3NK9A 1DTJA 2I0QA 2MQHA 4JI3H 1HUNA 1XWEA 4L5TA 3M4PA 4LFBL 3QOLA 1SJHD 4YWKA 2RQXA 1CI3M 2QILA 4K2KA 2L11A 2K05A 1NR4A 4GNXB 2IL8A 3VR5A 2ZXRA 3HFZB 4L6TB 1NBWA 4DR6H 2EZVA 5C3EH 4DR5Q 4IUNA 1HNXQ 3WOEA 1LTSD 2A19A 4G7HC 2PZTA 4CDDC 5C0XJ 3S1RH 1QG7A 2CTKA 2E2DC 3AFPA 1PH9A 3SDZA 3PIPA 2NVTB 3H15A 3E0EA 3STBD 1KXLA 3C2PA 4X64L 1K3BC 1BUVT 3CKIB 4DR1H 1V43A 2IJ0A 4DF7A 1XYIA 1FJGH 2Z4IA 5C5MA 2CVRA 1XMQH 5M3MH 4BY7B 1VQ7A 3MFGA 4B3MQ 1CHQD 1S4ZA 1T5XD 2EQSA 2X06A 1TXYA 2F0SA 1XNQH 2UXCH 5CBAE 3GTLH 1SEIA 3D6CA 4Q0FA 2HCCA 1FNVA 3JAMc 1CFMA 3EROA 3VKEA 3K5MA 3R2IA 4RFBA 3HOXB 3CHBD 4P72A 4IFDI 1B9MA 4DV3L 3ERSX 1J4WA 2IPKD 1C48A 5D65A 2XNAC 1SSOA 4A3MB 2ANNA 2ZXOA 1HR0W 2UUBL 2XSCA 4DN4M 4F7XA 5HGTA 4KD3A 2R93H 1PRTC 4HCSA 3O13A 2RKSA 2V4DA 3DWPA 4HR7B 4KY7A 3VYUA 4J8QA 4AYBB 1N34L 4TRDA 1Y14B 2K1BA 5JAVA 4A3EG 4EQ5A 1LTBD 2XRQD 2NUCA 3DLLA 1STAA 2L5TA 1IW7D 4OCHA 3K58A 2R92G 5JVH3 2HQLA 1PQXA 3EVQA 1UE7A 3W1BA 1S3OA 4KY5A 3J81j 3UOEA 4DR7L 3LX0A 2JEAI 2DNCA 4JYAQ 1R9TH 5COYA 5ELDA 3U1KA 1HNZH 3HOWB 3E3XA 4PG3A 4H0LC 1FVIA 4JCVE 4NDXA 4DR4Q 2MJHA 3F1ZA 4A3CG 2HDLA 1CA6A 2K04A 5LL6S 4KLKA 2E76C 3NWSA 4CDCC 2HHHQ 5GROA 2UXDL 1VS0A 1IBML 4E9JA 5K36G 1RD9D 2JA5B 2ZT9C 1ILQA 3U4VA 2YU9H 4YWLA 4WORA 3VYSA 1HTPA 1TWCH 3KF8A 3VYRA 3I4NB 1I4QA 4X62L 4DR6Q 4K8JA 2HT1A 1D8LA 4LFBH 1QVCA 2A73B 1Q8KA 1WTXA 2UUAL 2F3IA 3J7AV 1FNWA 2KHSA 2WB1B 4KN7C 3H0GH 1I6UA 1WTWA 1H9SA 4QMFB 1IBKL 1O7YA 1DD2A 1YNXA 4DR1Q 4A93H 1HR0Q 1S5ED 4AQYL 1X55A 3MEFA 4ABNA 1LT3D 2ZM6Q 4LF5Q 2PQAA 3CC2A 5CV6A 2VQEL 4QJFA 4XQQA 4X64H 2MPMA 1TY0A 1KDBA 5EQ0A 4QGUA 1VQ9A 1WVLA 2A8VA 3B6YA 4TVAB 2FXQA 4K5VA 2OQKA 1KIXA 3RF2A 1E0BA 4KN4C 1D2BA 2GA4B 1W6JA 2X69A 2HDMA 1HNWQ 2LXJA 4G7OC 1AE3A 4BBSH 4IO9A 3UDXA 2XTIA 5IIFA 1AP0A 4WJ4A 4YCVA 3I3CA 2XWBB 5GAHC 1FKAH 2JA6G 4QL5A 4DV3H 4DR3L 1ILPA 4WANA 1I4RA 4NP5A 4XXEA 4JOIC 1MIUA 2PT7G 1XJVA 1SFOB 2UUBH 3RLOA 5BN3A 5FLXc 4TKOB 4DAYB 3TBIB 5IYDH 3QR8A 3K7UC 2B63G 1LTAD 2VNUD 3HP3A 4IFDG 1Z47A 1N34H 3IKJA 4DR2L 1YHAA 2B2UA 4I7ZC 3TP6A 2FMCA 1QJOA 2E2HB 1AEXA 5DLQE 3QB3A 1AE2A 2CPQA 2N88A 4DR7H 1EY9A 4BY1G 2K5NA 4X6AH 2MP1A 1QILA 2Z6KC 4GLVB 3GTQH 3KF8B 4M1UB 2LY7A 2CTJA 2QDBA 1LYLA 5KGUA 1PTOH 4MZ9A 5FLMG 3MC0B 4BXXG 2JA8B 1LM0A 2UXDH 3K0XA 2WV6D 3CP0A 2KHJA 1IBMH 4ZKBB 3E6ZX 3W1GA 2A74C 1TWAH 1TWHB 1OO9B 3HKZG 2E2IB 2L9HA 2D0OA 1E7ZA 4B3TQ 1H9SB 1YEZA 3J7AK 4X62H 3BDLA 4DV5L 3UDGA 1B8AA 3BDOA 1VQHA 3UDIA 4XIGS 2AHOB 5C4JH 2UUAH 4R4QA 3DM3A 5C44H 2Q2UA 3HOVB 1D5ZC 3DEOA 5M3FG 2WKCA 2JZXA 2WAQG 3RZOB 2LTLA 1Y1VH 2N3SA 4KY6A 5DAUA 4C3JH 2ANRA 2KUMA 5C3XA 1VQGA 2F4IA 2BE5C 4P2CB 3ULLA 4AQYH 1I50B 1O80A 4LWCA 2Q8IB 3UE0A 2DJFC 4OWWB 4GLAC 3A0JA 4G08A 2OQ0A 2ENBA 1KDCA 1YJNA 2VQEH 2A69D 1I6VC 5I6YA 1UEAB 1STHA 2NYZD 4KHZA 5CV8A 1OXSC 3F8TA 1EIGA 4KHPL 1F2LA 1EIFA 4C3IH 5IWAQ 4RHRA 1Q82C 2R3ZA 4HSVA 4H8AA 3PIO3 3PUVA 2VUMB 5JPMC 4B3SL 2CCZA 1XNRQ 2EJFC 1O7ZA 3P1HA 4J6HA 3E9HA 1CK1A 2A69C 4LFCL 1EFWA 4F87A 2J7ZA 1VMPA 1PRTB 2F0MA 3PIOA 3HOUG 4JI4L 5GAGC 2M2LA 5F2DA 5KNDA 4DR3H 1WTVA 5CV9A 4OO1I 1VQKA 1D5MC 1N34Q 1DGSA 3S14B 4A3KG 1F9RA 3OTOH 1SJED 1Q8IA 2M00A 1N36L 2AWNA 5BN4A 1E2WA 3D4WA 1BVSA 1P8LA 2D9IA 1WFQA 4DR2H 4CBVA 3S15H 3PGZA 1EU4A 2AUKA 2A1SA 1KD1C 4PZ7A 2VQFQ 5J22A 2I5MX 1PXUA 4DR5L 2JXMB 2E2JH 3CQZH 5C3EG 1HNXL 1ICFB 2FPHX 1V9PA 4RKBA 3URYA 5M5YB 4OIJA 1QZHA 2BH2A 1FYCA 4I7AA 5JJIA 2WP8J 3NXWA 4A76A 1V8CA 2E74C 4QQBX 3TRZA 1A3TA 4MTNA 4MHEA 4X3UA 1ODHA 1Z2IA 4FVMA 1VIHA 3J81E 4DKAC 4NBQA 1E22A 1WCMB 3N52A 4C2MB 3I70A 4DAVA 1VQJA 3HOYB 1I4GA 4XDXA 2O5JC 1CKOA 5ELEA 4RH6A 1C8CA 5M3MG 4B3ML 4LF7L 1HRJA 1JT8A 1D1KA 2YYZA 4X3SA 2F52A 2KHIA 2GVBA 4HIMA 2LFNA 4DV5H 2KQ3A 1FGBD
chains in the Genus database with same CATH topology
5ELOA 3QO2A 3M85A 5I9PA 1RDPD 1HA6A 1CZGA 1UNSA 4C3HH 2EXZA 3SXHA 4UPAA 4GOPC 2YV5A 1A8VA 2XVSA 3K5NA 3OHXC 2KA7A 2XGTA 2EPBA 3C3LA 3RLFA 2B3GA 4IJHA 3I4MH 2EVBA 4Z9CB 1EQQA 2CTMA 5TSSA 2OEOA 3JAMi 1IHZA 1YJWA 2R93G 4H13C 1ONLA 3DM1A 4A3DB 3S17B 4F88A 4LF9Q 1F9SA 2F0PA 1Q12A 1ZYRD 4FYDA 1A62A 1MJCA 4LUVA 1H9MA 4PQXA 1WOCA 1JE5A 4P71A 3HRZC 4GN3B 3AU7A 1X3PA 5IGFA 3NENA 3FP9A 4A4IA 1AFPA 1ASYA 2UXBQ 3H3VC 4JYAL 1PMRA 3GTOB 3UE1A 1ZYRC 1N33Q 4DR4L 3OTOQ 4RAUC 4A3FH 2A68C 2CFMA 1SBBB 2HHHL 2RHSB 2PNHA 3ULPA 1VQLA 2DY7A 4FP5D 4UP8A 3BVMA 5HY6A 5EBDA 2B2WA 4A3JH 4BBRB 2PNRC 2EJGC 5E3FA 5NUCA 1DYQA 3GTPH 1HFGA 1X54A 5FO7B 3TS2A 1F9QA 1JORA 1LV9A 1X3EA 3FHWA 3SK5A 3MFYA 3BU2A 1TWFB 5CR3A 2AQ3B 3M4OB 4DV6Q 2RDHA 1A3VA 1EU3A 3PUZA 1CA5A 2G9DA 4HIOA 1VCIA 3H0GG 1PZKD 3NELA 2A6HD 3PUWA 4WFN3 3MAQA 1QOHA 4DR1L 1HA5A 1HR0L 4JI1Q 4A93G 4BA1I 2CQOA 1S40A 2ZM6L 4LF5L 3GQBA 1YZ6A 4JBJA 1I5FA 2NVQB 1PZJD 2MGSA 1ZZJA 2ZJRA 3GDEA 3OPOA 2X6LA 2N49A 1X3QA 2IT1A 2J0TD 2EE1A 1J5KA 1KC8C 4LJZC 5T1IA 4UP9A 1IYVA 4IALA 3M7GA 1SMYC 3CW2C 1ESFA 2JQOA 1SXTA 4A3EB 5CV4A 2EOTA 5CYUA 3CCEA 1XPUA 3J81c 1XPRA 3MXGA 2K32A 2R92B 1LACA 5KYIA 1SNCA 1NUCA 1ZEQX 3GTJB 1HNWL 4RGNA 4FF1A 2ID0A 3DHQA 4A3GH 3A55A 1MGSA 3TN2A 5CBEE 4UDUC 1ESRA 2NZ1D 2HIXA 2RDFA 1D1IA 2B2TC 2Q2IA 2PZWA 1SNDA 2R6GA 2Z8LA 4DV1Q 1Y8NB 1YITA 3DEPA 4KHPQ 4KTAA 1BCPD 1BKBA 5LHY1 2YTVA 3J7ZC 1D7QA 2KJXA 1Y1WH 2F0GA 1Z6HA 1Q81C 1K8AC 5IYDG 5C4XH 1IL8A 1M8AA 1XTCD 2F1MA 2D5DA 1S5FD 4RHSA 3R8BA 1HZ9A 4A75A 1BCPC 4JVYA 5EBCA 2QF7A 4L8JA 5C3WA 1L1OC 3CF5A 2NVXB 5GADC 5E4XA 1J6QA 1RTOA 3RLNA 2NVYB 3K81C 4H7BA 5M5XB 1PH1A 1SROA 1E1TA 4AM3A 1LUZA 2N55A 3P7JA 2EJMA 3NTKA 4LAAA 4YHHQ 3MEHA 2D2CC 4LIJA 3CXCA 5EPLA 2R7ZH 1F9PA 2B2VC 4A3IH 2FMRA 4PNYA 3OYYA 4E6IA 3PIP3 3M3YB 3S2DB 4FF4A 1T5EA 2NB0A 1LABA 5KIXA 1K73C 2EYHA 5J39A 3CPWA 2F0LA 4B3TL 1GUWA 2ZTDA 1G2TA 4XT1B 4NXNQ 3V69A 3L0OA 3AEVA 1II3A 1SNQA 3H6MA 4IPCA 4PZ6A 1I3QB 1HFNA 3T1YQ 5I4DA 2XIWA 2F0IA 1V1QA 2MFIA 3RD4A 1KNAA 4Y52H 5LMUQ 1YI2A 2Q8RE 4H44C 2VB2X 2XRSD 1PFBA 5C44G 3H94A 3PO3H 1I4PA 3M4QA 3K7AB 1U0LA 3TP5A 1Y1VG 2JA6B 3NWTA 4C3JG 2FINB 4BBRG 4IUPA 2TMPA 2K52A 4CJ1B 3HZXA 1Q1BA 3J80E 4LF7Q 3OMCA 3S1MB 1EOVA 1NJIC 3HS0C 1JJGA 2B63B 5IWAL 1EY7A 4C3IG 4DNTB 3K8AA 1PRTD 3IFTA 4UAIA 1JWMD 1XNRL 4L63B 2DN8A 1WVNA 4GOPB 1JJCB 2KEEA 1X6OA 2CKZB 2QGQA 5FLXE 4KKSA 4OONA 1X4MA 2F0HA 1I6HH 4EX5A 3RZDB 4QF4A 1O7LA 4BY1B 5M5WH 2QEXA 4FDBA 2L1BA 4H02A 2CTLA 3IFDA 3CC7A 1KTKA 3S16H 5IYBH 3E5SA 5JEAH 2K4KA 4IN3A 4HEDA 3PV0A 1TKWB 1XXGA 3CMEA 4EQOA 1E3PA 3HKZB 3MXUA 4DAYA 2QCPX 4JBMA 1GOZA 1UE6A 5ELFA 1AN8A 3H3VI 5IGCA 2WINB 4JBWA 3GTKB 2UUCQ 1EYGA 1CHPD 4JI5Q 2VQFL 1SNPA 1NCVA 2OXPA 1JICA 3TSSA 5M3FB 5IGEA 1Q86C 1SNMA 2WAQB 1B9NA 4MNOA 1F2YA 3NTIA 1EUJA 1O7IA 1A63A 3K6OA 4DA2A 3GV6A 3A56A 3A74A 4XTCS 1JB7A 5C0XH 3S2HH 2BDOA 2KCNA 3S1NH 1ET6A 4ZRZA 2N78A 1NTGA 3AEVB 2JVZA 1LTTD 5JJLA 1Q7YC 3UI2A 3GTGH 3K5OA 4ZAIA 1PDQA 1PH5A 1NE3A 4XQNA 1PVOA 2IX0A 3I2ZA 3R3OA 2F3WA 1TWGB 3ULJA 4F8MA 4JI8Q 1FD7D 5ELCA 5I9OA 1GD7A 2KENA 4NW2A 1SYEA 3MWYW 3G6EA 4ZQ3A 5JOBA 1KABA 2R61A 3BVGA 1T9HA 3RMHA 4CKEA 3HOUB 4CGYB 4JI0Q 1CZWA 1CUKA 1PTOD 1EWHA 1EY5A 1SE3A 1A0IA 1Q3LA 3BZKA 3CCUA 3EIVA 1VQ6A 3FEWX 3KJPA 2NN6H 4DK3C 3I4MG 1FL0A 2B8GA 5IODA 1JB3A 4A3KB 1ZZIA 1IBLQ 2F0NA 4RCOA 3TREA 4LF9L 3U58A 4MN3A 1K8MA 4KD4A 1VQ8A 3D3RA 3P20A 2ASBA 1PTOC 1CTMA 3FKIH 4HMJA 2RDGA 4C56C 4RWSC 3I8ZA 1LTGD 3J80c 1GXDC 1BBUA 4O2DA 3S1QH 3LNNA 1MJEA 1M4VA 2UXBL 5EKKA 2F4VQ 2F0JA 1EIYB 5C3EB 2O4XA 2PW7A 1QNUA 3S9WA 2JEBI 4R4TA 1N33L 1KNEA 1W3SA 3EN2A 3S1RB 3OTOL 3W5OA 1V1OA 3S24A 1YNJC 1BQQT 3V2TA 4B08A 4A3FG 4GKJQ 1ASZA 3KJOA 3CU7A 2M9VA 4X3TA 2AKWB 3G4SA 3HKZE 1ENAA 1MBYA 1IL2A 4KHVA 4I65A 4A3JG 1BCPB 4IUTA 1L1OB 5IT9E 4LF4Q 2KBNA 4POFA 4K5WA 5M3MB 4JV5L 1HZAA 5FKAC 3TS0A 1SE2A 2JA7H 4DV6L 2WAQE 4R4CA 3GTLB 1K83H 4V0BA 1IYUA 4R9WA 3RUZA 4DV7Q 3A8KE 2Y0SG 2BH8A 1X56A 2F0TA 1EYAA 1Q1EA 2IX1A 3NE5B 4JI1L 4EQNA 1O78A 3GTMH 4OX9Q 5D14A 1CSPA 2R93B 4HJ8A 3CC4A 1PA6A 2D0PA 3I56A 2BE5D 3T16A 4YY3Q 5JVG3 1B50A 4LUOA 5FJ8H 1JWUD 2VS1A 1U4MA 1SRUA 1CM9A 2OCEA 2ICIA 1ICWA 2NZHA 1W2BA 3BDCA 1G2SA 2OTLA 3I73A 3BYYB 4GLXA 1VQMA 3KOJA 5EKIA 4A3GG 1R9TB 4Y7NH 1ENCA 1BBXC 4ZUJA 4DUYQ 4IZ8A 4ODGA 3W2DA 1L0WA 4L5RC 3HOZH 1PFMA 4DV1L 3Q0AA 1EZ8A 4IJLA 1GKHA 4OGQC 2RF4A 1AZQA 1RKNA 2YU9B 3QJYA 4KV6A 1Y1WG 1TWCB 2K5HA 4FXKC 5C4XG 1LTRD 3FMCA 3BS1A 1G6ZA 5KNBA 4DK0A 1G91A 1SYGA 3L7ZC 4DK6C 5CC4A 1EWCA 3PO2H 4KKTA 3EQLC 2K33A 1WD0A 1KLGD 3H0GB 1LT4D 4NMZA 2IX3A 4JOIA 3VR4A 2EYMA 4A93B 4IOAA 2RA4A 4OWTB 4YHHL 3CAMA 5I2YA 1H9RA 3J7AF 3HEJA 1KLUD 4PZ8A 3P75A 2R7ZG 2CQAA 1STBA 1R4QB 1V1PB 3X3NA 3U50C 4A3IG 2VB3X 3CRLC 3V05A 3F2CA 3AMUA 1D6EC 2F0WA 3CMAA 1Q90A 1VDZA 1I94Q 5GQOA 2UU9Q 1IYJB 1N32Q 4RGOS 2BCOA 4NXNL 1VF5C 2EYFA 4IPGA 4FXGC 3T1YL 2NN6I 3EBEA 2Z6KA 5KNCA 3K57A 1KAWA 3HKSA 5LMUL 1F77A 2DY8A 1SYCA 1EQRA 5IT9c 3PF5A 2WIIB 1UEBA 3TZDA 2F0DA 4DXGA 4AH6A 3T4AC 3PO3G 2MHVA 4GKKQ 3JC66 5I2XA 4LK1C 3BZCA 4IFDJ 2V1CC 1RJTA 4G7ZC 1PH4A 2CWAA 4HMIA 1EQVA 4QB4A 4A3BH 1HZBA 2F0UA 1BF4A 1XX8A 3AYHB 1U5KA 1KHIA 4HIKA 4K0KQ 4CJ0B 1Y69U 1G8ZD 4UY8C 1DONA 3SHLA 5DEHA 1UAPA 1STEA 3TP7A 5A35A 1LLRD 3CD6A 3D4RA 3U4ZA 2P2RA 2R7DA 5IYCH 1RF2D 1KAAA 1B2TA 2E5LQ 3L3OC 3QOJA 3A54A 5IP7H 3AFQA 2YTXA 3VR3A 4WALA 2OF1A 1S5CD 2Q2HA 1BCPF 3GTQB 1VQPA 2CW0C 4UP7A 1JOKA 1Y8PB 4DAPA 1PTOB 5IYBG 2YQRA 4L5QA 4LF6Q 2JE6I 1G6PA 1F2ZA 2B2YC 3K80C 1K1GA 5EJWA 5JEAG 4KKUA 3PMFA 2L15A 2A68D 2F0FA 1TWAB 2FMMA 3I72A 5EKLA 3A7AB 4IPDA 4IUQA 2Q8TA 5CV7A 3WOFA 3NTHA 2VL6A 3ERQA 1XMOQ 3PCOB 2B39A 4U673 1UWVA 1I3QH 5ISRA 2LXKA 5C4JB 2UUCL 4POGA 4JI5L 1SAPA 1X3GA 2BA1A 5C44B 2EYOA 2NVTH 2XN9C 2VW9A 2FJ2A 1S72A 3KLWA 1Y1VB 3M9BA 4C3JB 4GZYC 3IRBA 2K01A 5LMNW 1EYCA 3LWUA 4C1NI 1E2VA 1A6XA 3KF6A 3RR5A 5C0XG 1HH2P 4JV5Q 3EA6A 1N8RC 4BY7H 3NSWA 3OW7A 4HAEA 4JVHA 1JQYD 3SVMA 4C3IB 1BXTA 5EGTA 2MNAA 5D3IB 2HCIA 1HQRD 1R4PB 1PH7A 3BG3A 4JI8L 3G7LA 3U9OA 3M4YA 3EJIA 3HOXH 2N8NA 2ALYB 2A5HA 2OWOA 2QNDA 1LT5D 1SMYD 5BR8Q 4N9TA 4O42A 1XTDA 1VQBA 3LWEA 4PV1C 3CCJA 1MD2D 2NTSA 4A3MH 4ALPA 3ND8A 4PMBA 3Q8DA 1SEBD 4JI0L 4X66Q 4R8NA 3I91A 3FDTA 1DOKA 1UE1A 4YWMA 1PHJA 1Z9FA 2F0KA 1ET9A 5GAEC 4B3RQ 3DWQA 2NN6G 1K0RA 1IBLL 1GUGA 1OXVA 1J5EQ 4YIJA 3NUCA 1PRTF 1GUOA 2JA9A 5HGQA 1K8OA 3MA2B 2BDNA 2NTTA 5I6WA 1WI5A 3FKIG 4HJ9A 4A3LH 1WTPA 2Z1CA 1I4XA 1LT6D 2B29A 5A2QL 3OIQA 4EQPA 4BBSG 5LL6X 1EIHA 2PY9A 3S15B 4DUZQ 3HOWH 1U4PA 4RG1A 1HCZA 4GOPA 2F4VL 2WKDA 3L2PA 2ZJPA 5LMNQ 2E2JB 3CQZB 1V8QA 4ULLA 1RHPA 1NMFA 1B44D 1F2MA 1X65A 2JA5H 3VR6A 2OT2A 4DV2Q 3J80i 4GKJL 3H91A 2YTYA 5G3LF 4ME3A 3I4NH 1SN8A 1PH2A 3MZ5A 4RCNA 4QUCA 4U68A 3KUPA 4PMWA 1FGUA 3LGJA 4LF4L 3VA5A 4QUFA 4YCWA 2BOSA 3T53B 4RKLA 1E2ZA 5ELNA 4DFAA 1L0XB 2K5VA 2JA7G 1UUPA 3CCMA 2EY1A 1NY4A 4C1NK 1GHKA 4DV7L 2EYPA 3KF6B 3KYHC 2L0CA 2K14A 2KEDA 2AXYA 5FO8B 4JK1C 3I55A 2RVLA 1ZKOA 1JMCA 3D31A 1TS4A 1RCVD 2PO4A 3I4LA 4DV4Q 1YHQA 1H9JA 4JBKA 2F0OA 4OX9L 1HTLD 1A2TA 4JG2A 2OPUA 3T13A 3I4MB 3TP8A 1HUMA 3C46A 2CTFA 2K6AA 1AH9A 2FFKB 4YY3L 2K5WA 1SE4A 3KLRA 3SEBA 1QUQA 4PMCA 2K7VA 3CCLA 5FJ8G 2HIVA 1PH6A 2F03A 1OTCA 2LSSA 3FVQA 2E3UA 5IP9H 3SK6A 4OHJA 2AQ2B 2IHFA 2EY6A 3NP8A 2PYKA 4ME5A 4DAMA 3D0FA 1PTOF 3WDNA 4LF8Q 4HSPA 4ZLTF 4O1NA 1TY2A 4DUYL 1RL2A 3Q23A 2EY2A 3Q6SA 3D4DA 4JI7Q 1PFSA 2BL5A 1C4QA 3HOZG 5BN5A 4A3FB 3Q24A 1SFOH 3J7YW 2RCNA 1CKMA 1K9MC 1XPOA 2X6GA 5KYLA 3OIPA 3ITPA 1GM5A 3PF4A 3CPFA 3PUYA 3R93A 3G6JB 4K5XA 4A3JB 5CORA 1E24A 2JSOA 1B3AA 3G71A 1GVPA 1N9WA 3AB9A 3GTPB 2E2HH 1EOTA 1DT4A 1CKNB 4QY7A 5FO9B 2QKIC 4K8IA 3SR1A 2PCFB 1TS3A 4NKLA 3STBC 3CCVA 2AQ1B 1QCBD 2B2TA 1B4OA 3PO2G 3V96A 4DV0Q 1ZTGA 1K3RA 3I7FA 1U4RA 1EWIA 3NEMA 2Y0SB 1X3FA 2OTJA 3F2UA 2IY5B 4WJ3M 4P74A 5E1FA 4IOCA 4DNIA 2K75A 2CTEA 1CT1D 1TR5A 3HGBA 2JA8H 1VQCA 2PQUA 1DM0B 1SMXA 4J15A 3JAML 2LMCB 5G3LD 1I4HA 3KBGA 4S3SA 1SE8A 5IE8A 4ILWA 1EEFD 5KRUA 1TWHH 2E2IH 2H4OA 3CRKC 4X65Q 2EIFA 3IL8A 3ONAB 4RGTA 2MUYA 1KRTA 2O5IC 4DPGA 1L1OA 1I94L 2UU9L 1N32L 5JJKA 5C4HA 2Z4HA 4NB3A 3CCRA 2B2UC 1DZ1A 4JI2Q 3HOVH 4HJAA 1TT2A 3RZOH 1TQOA 4JI6Q 1Z7TA 5DNFA 4A3GB 4LUZA 3GD7A 1LTID 2AUJD 1KHMA 1VQIA 1EY6A 2Q2TA 1I50H 1WJJA 4GKKL 2B2VA 2DGYA 1E1OA 3NQTA 1KQSA 1QUQB 3SE0A 1CQFA 1IW7C 2F3VA 4R4OA 5FOBB 3T1HQ 3EFXD 4A3BG 2JJQA 3ZJYC 3A5ZB 2EY5A 2K5DA 4DK1A 3QWNA 2VZAA 3WWVA 4JI3Q 2ICEC 3SK4A 1X32A 2E8GA 1DCZA 2QA4A 3RN5A 1Y1WB 4HTHA 4K0KL 3VA7A 2K5QA 5KEEA 2VUMH 2D62A 3N6RA 5C4XB 1MSGA 2LS01 4BS9A 1D5XC 3CCSA 1RTNA 1J8IA 5C5LA 3VDYA 1STNA 5IGDA 3FPUB 5IYCG 4GS3A 4C3HG 1VQNA 4OO1H 4GN5A 2E5LL 1SR3A 2A1AA 3DWAA 1LO5D 2AWOA 2IW3A 4QIWB 5IP7G 3K59A 5AJ3Q 1QNKA 3TDQA 2I5HA 4IUVA 1C7YA 3NBHA 1FJGQ 3DUZA 1VQEA 3S14H 1PH3A 2NBFA 3ZYYX 1XMQQ 4LF6L 2VXWA 3NQIA 3KK7A 2R7ZB 2IWHA 1RODA 1L0YB 3C1EA 4A3IB 3BVZA 4RA8A 3R2TA 1YNJD 2FHTA 1XNQQ 2UXCQ 1VQAA 3PUXA 3G48A 1SNOA 4X3KA 2EYJA 5C4ZA 1QVGA 1RIPA 2Y0SE 1XMOL 2VY3A 4QMGA 4KK7A 2NWGA 4NXMQ 1CSQA 1EY8A 3OWEB 5M5YH 3U9SA 3KFUA 4L5SA 2F0VA 1G291 4NPSA 4GN4B 2NZOA 3PO3B 2PZUA 2K50A 2A6ED 4TQUS 1SYBA 1M90C 2D9UA 5J1ZA 1WCMH 1J9OA 3OMGA 1TS5A 4C2MH 4K2LA 2R7FA 1S5BD 2PI2E 1TUAA 2Z0SA 3J80L 4AYBE 4CJ2C 3HOYH 4DXFA 4BY7G 2EXDA 4R8IA 2BA0A 1V1PA 1YVCA 2A6EC 2I5LX 1PYBA 2WFWA 4APVA 4LW1A 1EYDA 1HNZQ 4HIDA 3VR2A 3HOXG 1YIJA 1L2FA 2DGRA 5FLXL 2L12A 5BR8L 4LFAQ 2EYLA 3K0YA 4KJNA 4HJ7A 3CCQA 4M8AA 2J4XA 1I6HB 4A3MG 2LKVA 5M5WB 2PMZB 2KCCA 3DMUA 5CMDA 1STYA 4X66L 1VMCA 3OWFA 1IKLA 3S16B 1GJXA 5EAYA 3ICEA 4A3DH 1HPCA 3S17H 1YBYA 2KCMA 4B3RL 1MSHA 2IHEA 5HURA 4DNRB 2EDGA 5EPKA 4AYBG 1B7YB 5D3DA 2SOBA 1QZGA 5FK9C 1JOQA 1J5EL 1NAPA 4LFBQ 3SGIA 1S5DD 4IURA 1WD1A 4HCEA 3H09A 4A3LG 1WTOA 2WB1E 4KJOA 4QIWE 3GTOH 4DGZA 4O0AA 4DUZL 1PFNA 3HOWG 1LTLA 3NBHB 1WE8A 1A3UA 3KLSX 3J81i 1WTRA 2SNSA 5LMNL 3A8IE 3AQQA 3TQYA 2PQAB 3M7NA 2F0EA 1U4LA 4EGVA 1A2UA 5IY0A 1ENFA 2E75C 1DJRD 1HHVA 4X64Q 4KI0A 1JC7A 1ZXTA 4DV2L 2JA5G 1VQOA 4BBRH 3C1FA 3MHBA 1GO3E 1Y8OB 3S2HB 3S1NB 4FF2A 5IOCA 3I4NG 3BJUA 4RMFA 1BDOA 5C0XI 5K5PA 3GTGB 4V190 1TWFH 1BBWA 3M4OH 3OSOA 2C9OA 3NHHA 4HN7A 2HH2A 4WRDA 4YCUA 4OXPA 2WB1G 1IKMA 4XYOA 1GUNA 1QWYA 1DXMA 1EC6A 3A5UA 1PH8A 1NR2A 3OOCA 1UE5A 4DV3Q 2F0QA 1YHBA 2GN5A 1K8GA 1B70B 2NVQH 1EZ6A 3PSIA 4DV4L 2UUBQ 1VQ4A 4AIMA 3MVVA 4OL7A 1DOMA 1X4NA 3A8JE 3E9IA 4DU9A 1OXUA 1TVXA 1JCKB 4OWXB 2O2LD 3MXNA 2I46A 4A3EH 5AFWA 3A7LA 2B2WC 3J7A5 3DXJC 2ZJQA 2R92H 3NBIA 3FKIB 4BWGB 1U9RA 3FPPA 4JC0A 4R4IA 3GTJH 1JE4A 4BBSB 4DR7Q 4FNFA 1JR0D 5IP9G 3S1QB 5A2QE 2SEBD 2JYOA 2PMZE 2SDFA 1VF7A 3NPPA 1W6KA 3TZUA 4A3CH 1B53A 1BO0A 4ZUIA 1JOOA 4LF8L 5DM73 2MO1A 1H95A 4G57A 4GNXC 1VIGA 4ZKCB 2ZTCA 4JI7L 5E4WC 2UXDQ 5K36H 2L4NA 1IBMQ 2PQEA 2B8FA 2HUGA 2AMCB 3GV3A 1SYFA 1OXXK 2OPVA 2DNEA 2H1EA 2MO0A 1VQDA 1HJPA 1WYDA 2CW0D 1HQMC 3BZDB 4X62Q 1BNZA 5IT9L 3IAYA 2HH3A 4B8TA 4K14A 1DOLA 3I90A 2UUAQ 1AZPA 1IXRA 1SDFA 2NVXH 2JA7B 3I4OA 1IBKQ 2TSSA 1K83B 2MJ8A 4B9WA 2NVYH 4DV0L 1ZZKA 5M5XH 3E0JA 5CV5A 1AW7A 1FR3A 4AQYQ 4XYQA 2JA8G 4KMUC 2RSNA 2VQEQ 1MI2A 4LMQD 2CHBD 4B9XA 1IZ6A 3GTMB 4RGMA 3W3AA 1C9OA 1M1KC 1ML0D 3M3YH 3S2DH 3ND9A 1EY0A 2G9HD 2SNMA 4QCLA 1QVFA 4X65L 3KDFA 3Q22A 3QIAA 2ES2A 4FXDA 2I07B 4IQZA 1TIID 1MKHA 1QE6A 5IGBA 3RN2A 1SLJA 3L9AX 4ID6A 4JI2L 5T1GA 1HXYD 3HOVG 3GP7A 3K7AH 4JI6L 1KDAA 5DM63 2QEJC 2WACA 2JA6H 4Y7NB 4MIUA 2XWJB 1JWSD 4DR3Q 3MXNB 1KL9A 3HOZB 1PLFA 4BA2I 2JP1A 5C6AA 3S1MH 1HZCA 3T1HL 1PYWD 2B63H 5M9OA 1NSNS 4IFDH 4JI3L 4DR2Q 4EVOA 3K5LA 2VUMG 1Q46A 1VQFA 4G4KA 4DR6L 3F2DA 1WTQA 2DUDA 4TSSA 2RHQB 1STGA 1TU2B 4HJ5A 3PO2B 4FO2A 3RZDH 1PZID 1NMGA 1PYSB 4BY1H 5JJZA 3T51B 4OO1G 5EPJA 4FF3A 2H5XA 1CQVA 4CHTB 1G51A 4GNXA 2K28A 3HG9A 5FLMH 5AJ3L 4BXXH 3TEHB 1FJGL 1YNND 3T56B 5H1SE 3OW2A 1XMQL 1H9KA 3JAME 3H3VH 1A15A 3KLSA 1XNQL 2UXCL 2A6HC 3BYTB 4DV5Q 2KCTA 1EQTA 4CKCA 2KECA 1CKNA 3GTKH 1YNNC 4LNQA 2JK8A 2PW5A 1OXTA 4NXML 5M3FH 4P75A 3MXPA 4CKBA 2K03A 2ZTEA 1FNUA 1VQ5A 2RSOA 3J81L 1SYDA 2B2YA 3D6WA 2ZXPA 1KRSA 4XT3B 2C35B 3KBXA 1EY4A 1EL0A 4OIKA 1BOSA 2HQEA 3KDFB 1WCMG 1PV4A 1JJ2A 2ATWA 5ELBA 4A3BB 3SK8A 3FRPB 2KVMA 3MTSA 2CWPA 3QG1A 4K6DA 3HOYG 2PPBC 3D8GA 5J3BA 1TWGH 1X9NA 2L55A 4B3SQ 1GHJA 2PI2A 4IUUA 2KOLA 1HNZL 1YJ9A 1BR9A 3TMEA 2RBMA 4LFCQ 3ER0A 1C0AA 4C3HB 4N9PA 4IPHA 4LFAL 3HOUH 1EEID 4R1JA 1GUTA 3UDFA 4JI4Q 3F2BA 1B1ZA 1QB5D 5JEAJ 1EFID 4XQJA 1GUSA 4K6LA 5E7NA 2GVAA 3X3MA 2C5CA 5CGKA 5IGGA 5JPNC 3RNUA 3VYTA 4A3KH 1P16A 4Q5VA 4ZK9B 4J1MA 3GO5A 4WJWA 1TS2A 1N36Q 4A3DG 4P73A 4ZYSA 3NK9A 1DTJA 2I0QA 2MQHA 1HUNA 1XWEA 4L5TA 3M4PA 4LFBL 3QOLA 1SJHD 4YWKA 2RQXA 1CI3M 2QILA 4K2KA 2L11A 2K05A 1NR4A 4GNXB 2IL8A 3VR5A 2ZXRA 4L6TB 3HFZB 1NBWA 2EZVA 5C3EH 4DR5Q 4IUNA 1HNXQ 3WOEA 1LTSD 2A19A 4G7HC 2PZTA 5C0XJ 3S1RH 1QG7A 2CTKA 2E2DC 3AFPA 1PH9A 3SDZA 3PIPA 2NVTB 3H15A 3E0EA 3STBD 1KXLA 3C2PA 4X64L 1BUVT 3CKIB 1V43A 2IJ0A 4DF7A 1XYIA 2Z4IA 5C5MA 2CVRA 5M3MH 4BY7B 1VQ7A 3MFGA 4B3MQ 1CHQD 1S4ZA 1T5XD 2EQSA 2F0SA 1TXYA 5CBAE 3GTLH 3D6CA 4Q0FA 2HCCA 1FNVA 3JAMc 1CFMA 3EROA 3VKEA 3K5MA 3R2IA 4RFBA 3HOXB 3CHBD 4P72A 4IFDI 1B9MA 4DV3L 3ERSX 1J4WA 2IPKD 1C48A 5D65A 2XNAC 1SSOA 4A3MB 2ANNA 2ZXOA 1HR0W 2UUBL 2XSCA 4DN4M 4F7XA 5HGTA 4KD3A 2R93H 1PRTC 4HCSA 3O13A 2RKSA 2V4DA 3DWPA 4HR7B 4KY7A 3VYUA 4J8QA 4AYBB 1N34L 4TRDA 1Y14B 2K1BA 5JAVA 4A3EG 4EQ5A 1LTBD 2XRQD 2NUCA 3DLLA 1STAA 2L5TA 1IW7D 3K58A 2R92G 5JVH3 2HQLA 3EVQA 1UE7A 3W1BA 4KY5A 1S3OA 3J81j 4DR7L 3LX0A 2JEAI 2DNCA 4JYAQ 1R9TH 5COYA 5ELDA 3U1KA 3HOWB 4PG3A 4H0LC 1FVIA 4JCVE 4NDXA 4DR4Q 2MJHA 3F1ZA 4A3CG 2HDLA 1CA6A 2K04A 5LL6S 4KLKA 2E76C 3NWSA 2HHHQ 5GROA 2UXDL 1VS0A 1IBML 5K36G 1RD9D 2JA5B 2ZT9C 1ILQA 3U4VA 2YU9H 4YWLA 4WORA 3VYSA 1HTPA 1TWCH 3KF8A 3VYRA 3I4NB 1I4QA 4X62L 4DR6Q 4K8JA 2HT1A 1D8LA 1QVCA 2A73B 1WTXA 1Q8KA 2UUAL 2F3IA 3J7AV 1FNWA 2KHSA 2WB1B 4KN7C 3H0GH 1WTWA 1H9SA 4QMFB 1IBKL 1O7YA 1DD2A 1YNXA 4DR1Q 4A93H 1HR0Q 1S5ED 4AQYL 1X55A 3MEFA 4ABNA 1LT3D 2ZM6Q 4LF5Q 2PQAA 3CC2A 5CV6A 2VQEL 4QJFA 4XQQA 2MPMA 1TY0A 1KDBA 5EQ0A 4QGUA 1VQ9A 1WVLA 2A8VA 3B6YA 4TVAB 2FXQA 4K5VA 2OQKA 1KIXA 1E0BA 4KN4C 1D2BA 2GA4B 1W6JA 2X69A 2HDMA 4G7OC 2LXJA 1HNWQ 1AE3A 4BBSH 4IO9A 3UDXA 2XTIA 5IIFA