5JEAG

Structure of a cytoplasmic 11-subunit rna exosome complex including ski7, bound to rna
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
237
structure length
235
Chain Sequence
DSMSTFIFPGDSFPVDPTTPVKLGPGIYCDPNTQEIRPVNTGVLHVSAKGKVQTAYIDYSSKRYIPSVNDFVIGVIIGTFSDSYKVSLQNFSSSVSLSYMAFPNASKKNRPTLQVGDLVYARVCTAEKELEAEIECFDSTTGRDAGFGILEDGMIIDVNLNFARQLLFNNDFPLLKVLAAHTKFEVAIGLNGKIWVKCEELSNTLACYRTIMECCQKNDTAAFKDIAKRQFKEIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a Cytoplasmic 11-Subunit RNA Exosome Complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule tags Hydrolase/rna
molecule keywords Exosome complex component RRP45
total genus 51
structure length 235
sequence length 237
ec nomenclature
pdb deposition date 2016-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF15985 KH_6 KH domain
G PF18311 Rrp40_N Exosome complex exonuclease Rrp40 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5jeaG01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5jeaG02
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 5jeaG03
1GJXA 3STBC 4K0KQ 4A76A 1N34Q 2F52A 3RLOA 3LNNA 3AEVB 5BN3A 3J7ZC 4DV5L 5BN5A 4UP7A 4GOPC 3S16H 4KHZA 3HOZH 3A0JA 2ASBA 2VY3A 1KC8C 2E2IH 1IYJB 1AE2A 1EWHA 4OONA 2AWOA 4DR1Q 3M9BA 4IPHA 1LABA 1PYSB 3D31A 1QVCA 1YBYA 1HQMC 1V8QA 2QEXA 3PO2H 2R93G 4QMFB 2CWPA 4AYBE 1YI2A 3GTPH 1TWGH 2RHQB 2NVQH 1Q82C 1HZCA 1RIPA 1JMCA 2V4DA 4B3TL 4B3RL 1YZ6A 3H3VH 2UUBQ 2ID0A 1PHJA 3PO2G 4JYAQ 1KHMA 1BBWA 4HJ9A 2AUJD 1KXLA 1I6VC 2EJGC 4JI8L 3MEFA 3TREA 4LNQA 2VQFQ 3V69A 3K80C 4JI3L 2K50A 2NN6I 1X54A 4WANA 2ATWA 2LMCB 2E76C 4DNIA 5C3EG 5JJIA 1K8OA 5C0XI 2QGQA 2I5HA 5AJ3L 1KIXA 2VUMG 1WCMG 1YIJA 5IE8A 2I0QA 4JI0Q 3CCLA 2MO0A 3EQLC 3GQBA 1VQ4A 2K5NA 3CCJA 4JV5L 1VQPA 1X3GA 1YNXA 4R1JA 1A6XA 4DV5Q 1A62A 3S1NH 1DT4A 2JA7H 5GADC 1Z9FA 3CCQA 1CFMA 3ERSX 2N78A 2VQEQ 1IBKL 4P74A 2RF4A 1BBUA 4GN3B 1NMFA 3I4NH 1OXSC 3PO3G 4IOAA 2OQ0A 4IFDG 3GTMH 1OTCA 3PUWA 3GTJH 1IL2A 2EVBA 1VS0A 4I7ZC 5KNDA 3W5OA 1FGUA 1HNZL 1ZKOA 1O7LA 1A0IA 1X3EA 2I5LX 1OXVA 2E5LL 4B3TQ 4JBMA 2R92H 2CWAA 4DPGA 2E75C 1LM0A 4DR5Q 2RCNA 4PG3A 4BBSH 4OWXB 2WB1E 2N8NA 1U5KA 3S17H 2UXDL 4RCNA 2OPUA 4DV2L 2PI2E 4LW1A 4RG1A 4A3EH 3MFYA 1Y1VH 2VQFL 2OWOA 3I56A 4HJAA 3M4YA 5HY6A 5C0XJ 1X9NA 1C9OA 2PCFB 1Y1VG 4A3GG 1GO3E 5A35A 3M85A 4LFCL 2CTMA 4JK1C 2A68C 1NY4A 4JI5Q 1S40A 1WCMH 3LWUA 3CRKC 2KBNA 3NENA 5M5WH 3FPPA 3VDYA 1PH9A 3H15A 1VQ7A 2EQSA 4DR2L 2H5XA 3CMEA 3GTGH 3GTLH 1WE8A 4Y52H 2D2CC 3D0FA 1H9SA 2YTVA 3NE5B 4ALPA 3CC2A 2Y0SE 2K52A 3OTOL 1SFOH 4LF8Q 1IBKQ 1QVFA 4LF5L 2MQHA 5IWAQ 2YQRA 3PIOA 2KA7A 1VQBA 1GHJA 5IP9G 3CRLC 2R6GA 1MJCA 3T51B 4A3MH 3GTKH 4DV3Q 1Z6HA 1V1QA 1EYGA 1HNZQ 2HHHL 3NELA 1I94Q 2K5HA 4JG2A 5C4XH 1Q86C 1YEZA 4PMWA 4LF7L 3RLNA 2AMCB 3W1GA 3AFQA 1M90C 1YNNC 1N8RC 4LF9L 4KKSA 2EIFA 4LFAQ 1SROA 4DK6C 2RHSB 4DUYL 4DV2Q 4HIOA 4A3EG 1C0AA 2O5IC 2R7ZH 1SE8A 1E2VA 1PVOA 3KDFA 4IPCA 2LXJA 2AHOB 3K8AA 2AUKA 5C44G 1PH5A 3G48A 3RN5A 3DXJC 3HOUH 3AYHB 3BZKA 2BA1A 4IOCA 5DLQE 3KFUA 2PNHA 2F1MA 3CPWA 4C2MH 3M4QA 1VQDA 4GZYC 5KNBA 1H9MA 1TWAH 2N49A 4B3SL 1VQKA 1G51A 3S15H 2D0OA 3T53B 3OTOQ 5JEAJ 2ZTDA 1HR0L 1IYVA 4LF5Q 1Q1EA 1Q8KA 3RLFA 2OCEA 3FKIG 3BDOA 3UE0A 1KD1C 2NVXH 1EC6A 5JJKA 3PCOB 1MIUA 4DUZQ 1JE5A 1PYBA 1K83H 2HHHQ 3KYHC 1O78A 3A5UA 2PQAA 4JI2L 2WFWA 4A3KG 2KCTA 4LF7Q 3HOVH 3F1ZA 1K8MA 1HCZA 2JEAI 1WVNA 4BY7G 1GD7A 3CMAA 1X55A 4A3KH 3GD7A 3IKJA 2CTEA 5GQOA 2OPVA 2E8GA 5ELOA 4X6AH 2JXMB 4JC0A 1YNJC 4X65L 1VQAA 2ALYB 1IBML 2CFMA 1ZYRC 5M3MH 3KF8B 1N36L 1AE3A 3ULLA 2DGRA 4LIJA 1XNRQ 3WDNA 1E1OA 1YVCA 2JJQA 3U4ZA 3RNUA 1S72A 4P72A 3U9SA 2UXCL 1CUKA 3CCRA 2KENA 4JI4Q 2Q8IB 1NMGA 1Y14B 5BR8L 1Q81C 4OWTB 2DN8A 4A3CH 4DR1L 4X66Q 1S3OA 2DGYA 1FJGQ 1JJ2A 1K73C 1HPCA 1IW7C 5H1SE 1BDOA 1YHBA 5IYBG 2CW0C 1QUQB 3M3YH 2BA0A 4YY3Q 3ULPA 4A3DH 1GUGA 3CCMA 1Y8NB 2HIVA 4B3RQ 3D4RA 2BE5C 4JBWA 2PQAB 4IFDI 4KKTA 5IYBH 1QVGA 4H44C 4DUZL 4H02A 4C3JH 3VA7A 4HJ8A 2DNCA 4KHPL 3PIPA 4NB3A 4H0LC 4GNXA 2BH2A 2JVZA 3HKZG 3ND9A 1VQLA 5LMNL 1EUJA 3HOVG 5M5YH 1E24A 2NN6H 3SDZA 2O5JC 3TQYA 3G71A 5IYCH 3RZDH 1V43A 3T1HL 5FLXc 2K7VA 2JA5H 1H9RA 1XNQQ 3PGZA 2D62A 3A74A 4JOIC 2L15A 3AFPA 4TQUS 2E2JH 5AJ3Q 4MTNA 2NN6G 3PF5A 4C3HH 5IP7G 4X65Q 1IBMQ 3KJPA 1QZGA 1VQ9A 4JI1L 2UUAQ 3OOCA 4MZ9A 2ZJPA 1EFWA 2JA5G 2JA7G 1IXRA 4AYBG 2ZT9C 2A1AA 1NBWA 3ZJYC 1VQCA 3J80i 1PH2A 1XNRL 2EJFC 1FR3A 3A8IE 2YTYA 5IP7H 4JV5Q 1LACA 2UXCQ 1VQJA 2KHIA 1HZBA 5IY0A 3I4MG 1A63A 4MNOA 1Y69U 3T56B 3A7AB 4TVAB 5BR8Q 4LF4Q 2VQEL 3KLWA 4DNTB 4X66L 3E9HA 3TS2A 1FJGL 2AWNA 3I4MH 2E74C 1SLJA 1E3PA 4L5TA 4GNXC 3HKSA 1ASYA 4YY3L 2K5VA 3CPFA 1FVIA 3JC66 4JBJA 2E5LQ 4DNRB 1XPUA 3JAMi 2Z6KA 1N33L 4HJ7A 4IPDA 3HOWH 1VF7A 4XIGS 1L1OB 4DV0Q 4DR5L 1UE1A 4GLVB 4BA2I 3K7AH 1T9HA 1VQ8A 4JVHA 1X65A 1K3RA 2PNRC 1X6OA 1M1KC 2ES2A 2MNAA 1LTLA 1WFQA 4BBRH 4Y7NH 1D7QA 2I5MX 5LMNQ 4A3FH 4A3IH 3BG3A 2KCCA 1VQFA 3ER0A 4DV4L 3QG1A 5IYCG 3T1HQ 1XNQL 4QQBX 4BBRG 1VF5C 2DUDA 2XTIA 4IJHA 3I55A 2BDOA 4OO1G 3PUXA 3OW7A 3F2DA 3U50C 1AH9A 2MJHA 2L5TA 2PQUA 3KDFB 5J3BA 4JI5L 1W2BA 2VNUD 4OXPA 3CF5A 2UUAL 2AXYA 4QIWE 1GM5A 2CTJA 3P20A 2NZHA 3HGBA 1X4MA 1TU2B 2QF7A 2WAQG 1B9MA 3S24A 1P8LA 3K0XA 4A3JH 1ONLA 1LYLA 1LUZA 1YJ9A 4PZ8A 2HIXA 3A8KE 1PH7A 2HT1A 1YHQA 1GVPA 1YHAA 2CQOA 5IWAL 3PSIA 3CQZH 3HOXH 1CSPA 4B3ML 3I4NG 2UUCL 3PO3H 3GO5A 4X64Q 1JJGA 1X56A 3SE0A 1BVSA 1VIHA 1I94L 5LMNW 2Q2TA 2R93H 1V9PA 2JK8A 1N33Q 2E2HH 3OPOA 2E3UA 1TXYA 3HOWG 4PZ7A 3E9IA 1I50H 3S2DH 4TKOB 1HNWQ 4LF9Q 4KN7C 3BU2A 5K36H 4DR7L 1K1GA 2K14A 2DNEA 2Y0SG 3S2HH 2PY9A 1CTMA 3HOUG 3BJUA 1HR0W 2PMZE 2JA6G 1ZZIA 3IFTA 2P2RA 2VL6A 1HZAA 2LXKA 4NXNL 2Q2IA 1UE5A 4WJ4A 4UPAA 3TEHB 2K75A 1J5KA 1PA6A 5GAHC 4DAYB 4IPGA 4OX9Q 2VS1A 3F2BA 3CXCA 5M3FH 3PUYA 5LMUQ 4PZ6A 2KHJA 1WI5A 2D5DA 2XGTA 1G291 3CCVA 2IHFA 2HH3A 2PI2A 4B3SQ 4R4OA 3CP0A 2FXQA 4B8TA 3AB9A 1H9SB 3I2ZA 1HR0Q 1XMOQ 1HTPA 5HGQA 1XPOA 1PH6A 4AIMA 1PH3A 4A93G 2CTLA 3CC4A 4A93H 5IP9H 4X64L 2A6HD 2KCMA 2GVBA 4ME3A 3UDXA 4GKKQ 3KF6B 4BY7H 5E7NA 5C4XG 4WJ3M 4JOIA 3QIAA 1EOVA 1IBLL 2FMRA 1TWCH 3M4PA 4JI6Q 1J4WA 3E0EA 1WOCA 5K36G 4JI7Q 1PMRA 2JA8G 4OO1I 1XMQQ 1EWIA 1EQRA 2QA4A 4A3LG 1SRUA 1Q90A 3WWVA 2JA6H 5FLMG 4EQ5A 4A75A 3F2CA 4L5SA 5C44H 4KN4C 4GN4B 4UY8C 2R7DA 1X4NA 1Y8OB 1GHKA 2YV5A 4GLXA 5BN4A 1KL9A 3KLRA 2AKWB 4A3CG 2ZTCA 3TRZA 3OYYA 4NXML 4JI4L 4APVA 1I3QH 1NE3A 5JEAG 1JJCB 1TUAA 1UWVA 2NZOA 4DK0A 1QUQA 4BXXH 2QNDA 1U0LA 3ULJA 3J80c 4C3IH 1KHIA 4JCVE 2MO1A 1N32L 4NPSA 5JEAH 3S14H 2A19A 4O0AA 1KAWA 1XMOL 4BXXG 4YCUA 1KRTA 4DK1A 2F3IA 4HIKA 3DLLA 4R4TA 1YJWA 1PV4A 3QJYA 4OGQC 4QGUA 3TZUA 1CI3M 2K32A 3LGJA 4KHPQ 5EAYA 4UP9A 3NBHB 4GKKL 3A8JE 2IX0A 3U4VA 2GVAA 2IX1A 3MXUA 2OQKA 1NTGA 3KF6A 3J81j 4UP8A 3TS0A 2ZTEA 1MKHA 3S1QH 1SMXA 2WB1G 2WAQE 4EX5A 1Q1BA 2YU9H 2UXDQ 1Z47A 1VQMA 4BA1I 2ZJRA 3J81c 3U1KA 2CPQA 2C35B 1YJNA 5GAGC 1R9TH 1XMQL 3ICEA 2B63H 3PUVA 4DV7L 1Q46A 4JI1Q 2JZXA 1DXMA 3UDIA 5M3MG 3H3VI 2CTFA 1NJIC 1TWFH 4K0KL 3PF4A 1GUOA 1B70B 3PV0A 3MXNB 1L2FA 4IJLA 1HZ9A 3N6RA 4YCVA 3RR5A 1ZTGA 2IY5B 4NXMQ 1VQNA 2MFIA 3CCEA 3L2PA 3CD6A 4LF4L 1I5FA 2EXDA 3VKEA 4P73A 4AH6A 2A6ED 3BZCA 4H13C 4IO9A 3HOZG 2UXBL 3M4OH 1DD2A 4DR4L 1N32Q 1DTJA 4HIMA 4BY1G 4OWWB 1KQSA 4IFDJ 4HJ5A 1VDZA 1J5EQ 1B9NA 4A3DG 3JAMc 3HFZB 1B8AA 3G4SA 1VQHA 3CCSA 4KKUA 3VR3A 2UUBL 4YWKA 2YYZA 1B7YB 1SN8A 4DV0L 4BY1H 4A3FG 4A3IG 4DR3Q 2A8VA 3J7A5 2R7FA 1N36Q 1W3SA 2ANNA 4L5RC 1K8GA 1XTDA 5C0XG 3H0GG 2BH8A 1GUSA 4GNXB 1L1OC 4OO1H 1H9JA 1PH8A 1E2WA 3RZOH 4A3BG 4LF6L 1HNXQ 2ZJQA 4DV4Q 2JQOA 4GKJQ 1OXTA 1K0RA 2BE5D 5C0XH 1FYCA 1GUTA 3H0GH 4QJFA 4YCWA 3H94A 4L5QA 3I72A 1J6QA 4DK3C 4DV7Q 2B63G 4G7OC 3PUZA 2JE6I 3S1RH 3S1MH 1A8VA 1WJJA 2V1CC 1MJEA 1E1TA 1ZZJA 4R4CA 4AQYQ 1XPRA 3EIVA 4AM3A 3NEMA 1SMYC 1WYDA 4O2DA 3HOXG 1D8LA 3SGIA 1ZZKA 5IYDG 1H9KA 4X62Q 2Q2UA 1HH2P 2EJMA 3AQQA 4LWCA 3GTOH 2HQLA 2K4KA 2B3GA 3FHWA 4A3MG 1PH4A 2UUCQ 4B3MQ 2K33A 4DR4Q 1VCIA 2UXBQ 3RN2A 2OTJA 3M7NA 2F4VQ 1P16A 1K9MC 1XJVA 3VR2A 1CKNB 1J5EL 1I6HH 5IYDH 4J15A 1YITA 4IFDH 4HR7B 1Z7TA 3GDEA 1L0WA 4A4IA 1EIYB 4GS3A 4DV6L 1CKMA 1L1OA 2EDGA 4LK1C 4DR3L 2R92G 1HNWL 4R4QA 2A69C 2PPBC 4WALA 4DR7Q 1E2ZA 4LUOA 1CKOA 5M5XH 3W3AA 4P71A 5GAEC 1OXUA 1HNXL 4LF6Q 4A3BH 1VQGA 1TWHH 4YHHL 1Y8PB 1GKHA 4GKJL 5KNCA 2GN5A 4LFCQ 4NXNQ 1N9WA 2Z0SA 3DM3A 2A69D 4QY7A 2ZM6L 4OX9L 4A3GH 2HH2A 3F8TA 5LMUL 3K7UC 3VR4A 1K8AC 4AQYL 4DR2Q 4KI0A 3A5ZB 3CW2C 3KJOA 2VW9A 4A3JG 1VQ6A 1T5EA 4DAMA 1IZ6A 4NBQA 2NVTH 3L0OA 3CCUA 4LF8L 4X62L 3J81i 2A68D 3I4OA 4YWLA 3UDFA 3T1YL 3STBD 3EN2A 2UU9L 1CKNA 1UE7A 4QL5A 3CC7A 2N3SA 1Y1WH 1CSQA 1UEBA 1DCZA 1GUNA 4DV3L 1C7YA 2VZAA 3A7LA 3FMCA 1IYUA 2D0PA 1Q7YC 2F4VL 4IQZA 4POFA 4LJZC 3EBEA 4DV1L 1QZHA 1VQEA 4FDBA 4DV6Q 4G7HC 1IBLQ 4A3LH 1PFSA 4JI6L 1JB7A 4DR6Q 1O7IA 4LFBQ 4G7ZC 4DUYQ 4LFAL 2BL5A 2A6HC 4JI7L 3G6EA 3HKZE 1VQIA 1JT8A 3HOYG 1OXXK 4BBSG 4YHHQ 1SR3A 4GOPA 1VQOA 2Q2HA 2CCZA 4XTCS 3OW2A 2IHEA 3FP9A 1HJPA 4JBKA 2ANRA 4JVYA 2IT1A 1N34L 2R7ZG 2JA9A 3AEVA 4PV1C 4P75A 4KMUC 2NVYH 4GOPB 1DGSA 4POGA 3CAMA 2ZM6Q 5M3FG 2LSSA 2A6EC 4GLAC 1G6PA 1FL0A 3K81C 3VR6A 2JEBI 3B6YA 1EQQA 1X3FA 3UE1A 1PH1A 2B29A 2CKZB 4L8JA 3T1YQ 2Z6KC 5GROA 5FJ8G 2UU9Q 3Q8DA 1Y1WG 1IW7D 1QJOA 3I4LA 1Q12A 4RMFA 2WP8J 1BKBA 5ELNA 4JYAL 1E7ZA 1H95A 3UDGA 5C4JH 3FKIH 5FJ8H 4JI2Q 4JI8Q 4DV1Q 1E22A 3ND8A 3IRBA 1KRSA 1RL2A 3VR5A 2OTLA 4JI3Q 5IT9c 3U58A 4R4IA 1ASZA 4LUVA 1VQ5A 4DR6L 1TKWB 4LUZA 5C3EH 4LFBL 1UE6A 4GN5A 4YWMA 2B8FA 4HIDA 2B8GA 3I73A 2YTXA 4KLKA 2JA8H 2VUMH 3GTQH 5JJLA 2CTKA 3L7ZC 1EIFA 3I7FA 4JI0L 4DKAC 3HOYH 1VIGA 3W1BA 5FLMH 3KOJA
chains in the Genus database with same CATH superfamily
1GJXA 3STBC 4DN4M 4DR1H 5KYIA 2F52A 3JAME 3LNNA 1R4PB 5BN3A 4GOPC 5AFWA 3S16H 1W6KA 3HOZH 3A0JA 1RD9D 1KC8C 3Q6SA 2E2IH 1TWAB 4OONA 3HKZB 2AWOA 4DR1Q 2E2HB 1S5ED 4RKBA 1F9PA 1RKNA 1HA5A 2RHQB 2FFMA 1Q82C 1HZCA 1RIPA 1HR0H 3K5OA 1BBWA 1KXLA 2RDFA 5G3LD 2IW3A 3G7LA 3K80C 4WANA 2ATWA 4DNIA 5JJIA 1FNUA 2ICIA 1W6JA 3TMEA 2K5NA 1YNXA 3A56A 3ZYYX 1O80A 5GADC 2N78A 4DGZA 4P74A 3W2DA 3PO3G 2OQ0A 3GTMH 1OTCA 4DR2H 3GTJH 3GP7A 1X3EA 1O7LA 4I65A 4B3TQ 2R92H 1D7QA 4R9WA 2F0IA 4DPGA 2PO4A 1LM0A 2RCNA 3TP7A 3GV6A 3FRPB 2OPUA 3V96A 4LW1A 2Y3MA 4ZRZA 1GUWA 3I56A 4CDEC 4AYBB 5C0XJ 5EKIA 5A35A 1KNEA 2NZ1D 1NY4A 4U68A 1EY0A 1NAPA 1S40A 5M5WH 3NENA 1N34H 1MBYA 2XWJB 5FO7B 4JI1H 3H15A 1VQ7A 4RA8A 1LO5D 5CMDA 1NXUA 2YTVA 4ALPA 2MQHA 1VQBA 4A3KB 3CRLC 4A3MH 3T51B 1EYCA 4DV3Q 1V1QA 1SBBB 2HHHL 3NELA 4RGNA 5C4HA 3Q22A 2K5HA 4JG2A 4PMWA 3W1GA 2UU9H 3AFQA 1YNNC 2EIFA 4DV2Q 1E2VA 1AN8A 4IPCA 4OELB 2AUKA 1PH5A 5FOBB 3G48A 4A3DB 2BA1A 5DLQE 4HCSA 1EU3A 3S16B 1XXGA 4X64H 4C2MH 1VQDA 5KNBA 4GZYC 2N49A 1TWAH 2WV6D 3T53B 3OTOQ 1WTPA 2K03A 5M5YB 2WINB 1Q1EA 4G57A 5IT9W 2OCEA 3RLFA 4NMZA 1EC6A 4FXDA 1EZ8A 3D6CA 4DUZQ 1STHA 1SFOB 1WVNA 2EYOA 1V9NA 4BY7G 5I9OA 2OPVA 5GQOA 2E8GA 5ELOA 2JXMB 1EEFD 4X65L 1WVLA 2ALYB 1IBML 5M3MH 3KF8B 1N36L 3ULLA 4LIJA 1KLGD 1XNRQ 3WDNA 1SNCA 1X32A 3GTOB 1VMPA 1S72A 3U9SA 1CUKA 1JORA 3RF2A 3HOVB 1JCKB 2HCIA 4DR1L 5I2XA 2F0FA 1IW7C 5KRUA 4A3IB 2BA0A 4YY3Q 1IKMA 2CH4W 2HIVA 2B2VC 5CBEE 4IFDI 1QVGA 4X66H 2XRSD 2DNCA 2K04A 4BBRB 1U4PA 3G71A 3SDZA 3RZDH 4DR5H 2HH2A 4OO1I 1KAAA 1H9RA 4JOIC 3AFPA 1QZGA 1VQ9A 1RF2D 2JA5G 2ZJPA 4AYBG 2ZT9C 3R2IA 4DV7H 2CQAA 2EJFC 3A8IE 2YTYA 5IP7H 1HUMA 4J1MA 1LACA 3QO2A 1VQJA 2KHIA 2B2YA 1A63A 3A7AB 4LF4Q 2RKSA 4X66L 1FJGL 1V1OA 5ELEA 3JC66 1FVIA 4CKEA 3OMGA 4OEMB 3JAMi 1XWEA 2Z6KA 2QEJC 1B3AA 1BXTA 4XIGS 1M1KC 1K3RA 2PNRC 5IGGA 4KD3A 1LTLA 2MNAA 2I5MX 5LMNQ 1EQVA 1DJRD 5LL6S 5IIFA 1VQFA 5C4JB 1NNXA 4DV4L 3QG1A 4BBRG 1MSHA 1VF5C 3KLSA 4IJHA 1C8CA 2BDOA 1BNZA 3TP5A 3F2DA 1AH9A 4XYOA 1SYEA 1ET9A 3CF5A 2UUAL 4QIWE 1EEID 1WTRA 1TU2B 4Z9CB 5C44B 1B9MA 5IT9E 3NUCA 1LUZA 4C1NK 2HIXA 3A8KE 1PH7A 2HT1A 1ZEQX 3PSIA 5C4XB 3NBHA 4JI2H 2CW0D 2JK8A 4KHPH 2AQ2B 2NWGA 3HEJA 3SHLA 4LFAH 1I50H 1RJTA 2QCPX 4IALA 2Y0SB 4DR7L 2PY9A 2PMZE 4C3IB 3IFTA 1CT1D 2VL6A 3R3OA 3BVMA 1J5KA 2K75A 1PA6A 5K5PA 3F2BA 3CXCA 3PUYA 5CV7A 5G3LF 3PQIA 3CCVA 2IHFA 2ZXRA 5T1IA 4R4OA 3CP0A 4B8TA 1H9SB 4OIJA 2N55A 1HTPA 1XPOA 1PH6A 1STEA 2AQ3B 1PH3A 2CTLA 4X64L 4QF4A 3I0PA 4OD6A 2A5HA 2X69A 3UDXA 3KF6B 3BS1A 3CU7A 3I4NB 1SAPA 5D3IB 3QIAA 1EOVA 1PRTB 3M4PA 2YU9B 5M5XB 3E0EA 2I07B 3KF8A 1EWIA 1EQRA 2QA4A 4A3LG 1EL0A 5FLMG 5JVH3 5C44H 4KN4C 1CM9A 4GLXA 1KL9A 1X3PA 2AKWB 2SNMA 3KLRA 4APVA 3T16A 1UWVA 2ZM6H 1U0LA 3J80c 1X3QA 3S14H 4O0AA 2H1EA 1EY6A 4BXXG 1KRTA 2ENBA 1PTOF 1HXYD 4FNFA 2MHVA 3LGJA 4UP9A 2O4CA 2HUGA 3MXUA 1NTGA 5JPMC 4RH6A 3SXHA 3J81j 3TS0A 2ZTEA 1MKHA 1HNWH 3S1QH 2WB1G 3IFDA 1WTWA 2XVSA 2ZXPA 4DV7L 3UDIA 2CTFA 1NJIC 4YCVA 4FJUA 1VQNA 4LF4L 4EQNA 4H13C 4DR4L 4B3RH 1MGSA 4BY1G 4IUQA 4OWWB 1VDZA 2CHBD 2VB3X 2UUBL 1SN8A 2YYZA 1TY2A 3J7A5 1W3SA 1O7YA 5C0XG 4GNXB 4CKCA 2B2UA 4FF1A 4H7BA 3PIO3 4OO1H 4A3BG 4LF6L 2ZJQA 2OF1A 4DV4Q 4DAVA 3I90A 3I72A 2B63G 4G7OC 3PUZA 2JE6I 4UHVA 3S1RH 5I6YA 3NEMA 3HOXG 1WYDA 4O2DA 1D8LA 2LF0A 5IYDG 4X62Q 4FVMA 2EJMA 2RBMA 4K14A 2K4KA 1LT4D 4A3MG 1BF4A 5JAVA 3K58A 1IL8A 3RN2A 2NTSA 5IYDH 1CKNB 3PIP3 4J15A 1YITA 4IFDH 1Z7TA 4CJ2C 3EROA 4RKLA 4DR3L 1F9QA 2PPBC 1F2ZA 4ID6A 4DR7Q 1E2ZA 5M5XH 4A3BH 1HNXL 1EIHA 4YHHL 4BWGB 2I46A 1GKHA 1LT6D 1Y8PB 4KK7A 2MUYA 3EFXD 5KNCA 1B3QA 1WTVA 3I91A 2RCFA 3DM3A 1PRTD 3F8TA 1SNDA 1RHPA 1VQ6A 4A3JG 3WOFA 4JV5H 1QCBD 2NVTH 4O1NA 4LF8L 4C1NI 3I4OA 4F88A 5DT9A 1WD1A 2UU9L 1CKNA 4QL5A 1Y1WH 4FF2A 1C7YA 2VZAA 3FMCA 2X06A 3IL8A 2HHHH 3HG9A 1MSGA 1ICFB 1S5FD 4LFBQ 2A6HC 4E9JA 1SR3A 4GOPA 1VQOA 2Q2HA 1ILPA 4XTCS 1MI2A 2KJXA 2M6QA 2R7ZG 4P75A 1EY4A 4C3IG 4B9WA 3HOZB 1X9ZA 3VYTA 3VR6A 1B53A 3VYSA 2CKZB 4K5VA 2F0DA 5C5MA 3K5LA 1MD2D 5GROA 3T1YQ 3Q23A 3Q8DA 4A93G 2WP8J 1BKBA 1E7ZA 2CWHA 5C4JH 2K05A 1LTTD 3CQZB 2TMPA 4DV1Q 3ND8A 3IRBA 2OTLA 3HOXB 3E3XA 4GN5A 4LF6H 4YWMA 3I73A 5IT9L 2CTKA 3GTQH 1BO0A 1EIFA 4LFCH 3S2DB 4DKAC 3NHHA 3GTJB 5FLMH 4LMQD 4A76A 3RLOA 3AEVB 3J7ZC 4KHZA 4QUCA 3DWQA 1EWHA 2EY2A 3ITPA 3M9BA 4IPHA 2K01A 2QEXA 3PO2H 1I50B 4AYBE 4BY1B 1BCPB 4B3TL 3T13A 2V4DA 1YZ6A 2UUBQ 1KHMA 4JYAQ 2JA5B 4HJ9A 3GTKB 2AUJD 5FKAC 5CBAE 4JI8L 5CV5A 1QNUA 3TDQA 4DV4H 2BCOA 5DM73 5LMNH 1EYDA 5C0XI 1K8OA 2QGQA 4Q0FA 2I5HA 3HZXA 1KIXA 3R2TA 1HHVA 1U9RA 1YIJA 3GTPB 1XMQH 4BBSB 2MO0A 5E3FA 4C56C 1ENCA 1BUVT 1Q3LA 1VQPA 1ODHA 3AMUA 1AZQA 2VQEQ 2RF4A 4GN3B 3I4NH 1OXSC 4IOAA 4IFDG 2ZXOA 3PUWA 1C4QA 3W5OA 1VS0A 4JBMA 2F0MA 2E5LL 4K8IA 2E75C 4JI6H 2X6LA 3J7YW 4IN3A 1SYCA 4DV2L 4A3EH 4RG1A 1DOKA 1B4OA 3M4YA 2NB0A 5HY6A 2H4OA 1X9NA 2NVQB 1Y1VG 1GO3E 2CTMA 3LWUA 4X3SA 1HRJA 3FPPA 3S14B 3VDYA 4C2MB 2H5XA 3H6MA 3J81L 4Y52H 2D2CC 1H9SA 1PRTC 3NE5B 3GABA 4B3MH 2K52A 3OTOL 1SFOH 4LF8Q 3NTIA 4B9XA 4FJSA 2YQRA 3EVQA 3PIOA 1FKAH 1WHRA 3GTKH 3VYRA 1I94Q 1HQRD 4LF8H 1NR2A 1J5EH 1LV9A 5JPNC 2M00A 1N8RC 3OIQA 3GTGB 2G8YA 3J7AV 1PVOA 1F2LA 2AHOB 1U4RA 5C44G 5EJWA 3RN5A 3GKUA 4GKJH 3HOUH 5I4DA 3AYHB 4IOCA 4NZTM 2HDLA 2PNHA 1D5MC 3D3RA 4AQYH 1G51A 2D0OA 1I4RA 2LRRA 1FJGH 5JEAJ 3K57A 1HR0L 1IYVA 4LF5Q 1Q8KA 2Z6BA 4B08A 4CBVA 2NVXH 2F0GA 3BYYB 2MJ8A 3SK5A 2XWBB 1S03G 1JE5A 1K0SA 2UUCH 1K83H 2BDNA 3KYHC 3A5UA 2PQAA 2MPMA 4A3KG 2KCTA 5L37A 2K5WA 1K8MA 4RFBA 1GD7A 4CGYB 2D9IA 1TQOA 1SEBD 1VQAA 2CFMA 4C3JB 2EYLA 3L9AX 2JJQA 4NXNH 1TY0A 2A74C 3CCRA 1NMGA 1NSNS 1EYAA 5C6AA 4X66Q 2DGYA 1FJGQ 1JJ2A 1K73C 1TVXA 1HPCA 5H1SE 5IYBG 2CW0C 1QUQB 3ULPA 1QB5D 5C3XA 3D4RA 4JBWA 2PQAB 4KHPL 2SNSA 1PZJD 1A2UA 5ELBA 4NB3A 4QIWB 4FF4A 4H0LC 4GNXA 4RHRA 3HKZG 2G9HD 1RCVD 1TWGB 5LMNL 4A3EB 5LL6b 1DOLA 2NN6H 4RGOS 2UXDL 2KEDA 5IYCH 1V43A 1ZYRD 2L15A 2RSOA 3C2PA 3DWPA 4IURA 2UUAQ 4JI1L 3OOCA 2JA7G 1NBWA 1VQCA 4C3HG 2UXCQ 1HZBA 3I4MG 1I4PA 5LL6X 1V8CA 2VQEL 4DNTB 3OTOH 2AWNA 3I4MH 2E74C 2F0QA 4L5TA 3CPFA 2E5LQ 4DR4H 1XPUA 2UXDH 1UE1A 2E2DC 3MC0B 4GLVB 1VQ8A 4BA2I 4DUYH 3J7AK 1X6OA 1F0XA 4Y7NH 5F2DA 3V05A 1DYQA 2KCCA 3ER0A 5M5WB 4QQBX 2HDMA 1SYGA 2DUDA 3I55A 3ICEA 4DV2H 4IUPA 3PUXA 3OW7A 3SVMA 2L5TA 3KDFB 2AXYA 3X3MA 5C3EB 2CTJA 2F03A 3S24A 4UDUC 1YJ9A 1ONLA 1SE2A 3TP8A 1GVPA 2F0HA 1YHAA 2CQOA 2NBFA 3CQZH 3HOXH 3I4NG 1JJGA 3JAML 1CK1A 1M8AA 4X64Q 1X56A 2JYOA 1BVSA 1ESRA 1I94L 1MSZA 1VIHA 3TBIB 2QILA 1TS5A 4PZ7A 3S2DH 3DMUA 4KN7C 1G8ZD 2Y0SG 3DHQA 3NPPA 2JA6G 1MHWC 1IBMH 2LXKA 3NCVA 1YNJD 4UPAA 1QOHA 3TEHB 3PO2B 2J0TD 4PZ6A 4PMCA 3DEPA 1WI5A 1WD0A 1G291 2HH3A 3S1QB 1HR0Q 4A93H 5IP9H 2KCMA 1L0XB 4JI7H 4BY7H 5C4XG 1D6EC 4JOIA 1IBLL 2XIWA 1TWCH 3BVZA 4HN7A 3PO3B 4JI7Q 1PMRA 1PXUA 2JA6H 4L5SA 2EOTA 2R7DA 2B2VA 1RTNA 4DF7A 5BN4A 1N36H 4A3CG 1WTQA 3OYYA 1I3QH 1NE3A 4DK0A 2NVYB 1QUQA 3ULJA 1STYA 4NPSA 4XYQA 3KLSX 1XMOL 4YCUA 3QD7X 3P7JA 3CKIB 2JN4A 4OGQC 4KHPQ 1SMYD 2F0VA 2K32A 5EAYA 4GKKL 2GVAA 3KF6A 2K1HA 2KHSA 3FDTA 2L11A 1SMXA 2UXDQ 2L55A 4FO2A 4BA1I 1KABA 1CZWA 2ZJRA 1FGBD 2FHTA 2C35B 1YJNA 2PYKA 2LY7A 5GAGC 2B63H 2QDLA 2FINB 4JI1Q 4K0KL 1GUOA 1VMCA 2JSOA 1JOOA 3M7GA 3RR5A 1ZTGA 2MFIA 4G4KA 1I5FA 4AH6A 3BZCA 2WAQB 3HOZG 1N32Q 1EWCA 1DTJA 4HIMA 1SSOA 2L0CA 4XQNA 4YWKA 1B7YB 3MA2B 4A3IG 4DR3Q 3G6JB 5CGKA 1N36Q 2HQEA 1AFPA 1XTDA 2BH8A 1GUSA 3E6ZX 4N8FA 1E2WA 5A2QE 3KDKA 1HNXQ 1JC7A 2JQOA 1LTID 3H0GH 1DOMA 1R9TB 3H94A 5I9PA 4EQOA 2V1CC 1HNXH 1ZZJA 1JE4A 4R4CA 4AM3A 1WTXA 3NP8A 1K83B 2Q2UA 3AQQA 4LWCA 2R93G 2HQLA 1PH4A 4WORA 2UXBQ 1J5EL 4A4IA 1L0WA 1F9SA 1EIYB 2F0TA 1L1OA 1SYDA 3J80E 1IBLH 1I4GA 1KNAA 1U4LA 1CKOA 4LUOA 1HFGA 3W3AA 3SK8A 4N8X1 5E4WC 1XX8A 2Z0SA 2B2WC 3P1HA 4KJOA 4QY7A 3HOYB 4A3GH 4ZKCB 4A3MB 3S1NB 4AQYL 1ET6A 3A5ZB 3KJOA 1BCPD 4LF5H 4DAMA 1IZ6A 3UDFA 4YWLA 1EQTA 1F2YA 4KY6A 3T1YL 2EPBA 1UE7A 4FYDA 1CSQA 1UEBA 1SJHD 1G2TA 3A7LA 2F4VL 4LF7H 4M1UB 4CJ0B 3H3VC 4LJZC 4DV1L 1QZHA 4LF9H 3OMCA 4FDBA 4DV6Q 2FMMA 5JJZA 4G7HC 1IBLQ 3A55A 1O7IA 4G7ZC 3C1EA 2BOSA 4JI7L 3SB1A 3BYTB 3D8GA 1I6HB 1OXXK 1SXTA 3OW2A 2IHEA 2B63B 2ANRA 4JVYA 2IT1A 4DU9A 4POGA 1NCVA 4LF4H 2K6AA 3O13A 2ZM6Q 5M3FG 4I7AA 3I70A 3K81C 4K2KA 1TWHB 1JOQA 1PH1A 1C0AA 1QJOA 4RMFA 1WTHA 4JYAL 1H95A 4C3JG 2F0UA 1TS2A 3UDGA 2UUBH 3KBXA 5C5LA 3FKIH 3D4DA 4EGVA 1UEAB 4JI2Q 5FJ8H 4JI8Q 4NDXA 1QILA 1RL2A 1B50A 2KOLA 2DY7A 4R4IA 1ASZA 4DR6L 5C3EH 1UE6A 1E0BA 2G5DA 1JQYD 2B8GA 4KLKA 3HOYH 4A3GB 1NR4A 3MAQA 3H91A 3KOJA 4HSPA 4K0KQ 1N34Q 1FD7D 2IPKD 2L12A 5BN5A 2VY3A 2WB1B 1IYJB 1DM0B 4JYAH 1LABA 1QVCA 3D31A 1HQMC 1V8QA 2RQXA 5M3FB 1YI2A 2NVQH 1JMCA 2RDHA 4B3RL 5M9OA 2JP1A 2ID0A 3PO2G 1I6VC 5CYUA 3TREA 4LNQA 1SNMA 1D2BA 1B2TA 1X54A 2NN6I 2LMCB 1S5BD 1HTLD 3QB3A 2LTLA 4DV5H 5AJ3L 2VUMG 1WCMG 5IE8A 2I0QA 4JI0Q 3CCLA 2VQEH 4F8MA 1D5XC 4CDFC 2KQ3A 1X3GA 5ISRA 1A62A 4DV5Q 3S1NH 1DT4A 2EYFA 2QW7A 3CCQA 1BBUA 4DXFA 1NMFA 3AU7A 1STNA 4S3SA 1IL2A 3T1YH 4I7ZC 1FGUA 1A0IA 1ZKOA 2RVLA 1OXVA 4J6HA 4XT3B 4OWXB 2N8NA 1U5KA 3S17H 1G2SA 2PI2E 1Y1VH 1X0AA 1SE3A 2VQFL 1C9OA 4ZUJA 2XRQD 1STGA 4C3HB 3M85A 3J80L 5D3DA 2A68C 4JI5Q 1UG8A 3K6OA 3CRKC 1XNRH 1ZXTA 1PH9A 3NQIA 5ELCA 4TSSA 2EQSA 3CMEA 3GTLH 3CC2A 1JB3A 3QOLA 1QVFA 1IBKQ 4LF5L 1BQQT 5ELFA 2KA7A 2NVXB 5IP9G 2F4VH 2R6GA 4YY3H 1EYGA 1HNZQ 1PFMA 1EY7A 1YEZA 4ZQ3A 3FKIB 2AMCB 2K28A 4DK6C 1SROA 5EKKA 2RHSB 5IGEA 4B8CD 2O5IC 5IGDA 3HRZC 5EGTA 2R7ZH 1SE8A 2WKCA 2CVRA 3KDFA 2LXJA 3K8AA 2F0SA 2A73B 3DXJC 4N9PA 1WTOA 3BZKA 2E2JB 1EY8A 1PTOC 4K6LA 4L63B 1V1PB 3KFUA 1S4ZA 2O4XA 3J81W 3NBIA 3CPWA 3SR1A 1VQKA 3S15H 2Q8RE 5D65A 5C3WA 3UE0A 4P2CB 3BDOA 3VYUA 1KD1C 5JJKA 3S17B 1PYBA 4MIUA 4JI2L 4FXKC 1S5DD 4LF7Q 3H09A 3HOVH 3F1ZA 4DR6H 2JEAI 2X6GA 1FNVA 1X55A 3GD7A 3IKJA 3JAMW 4DR7H 1YNJC 1ZYRC 1AE3A 2K5DA 1E1OA 3U4ZA 1BOSA 2UXCL 3OWFA 1Y14B 4OWTB 2DN8A 4A3CH 1S3OA 4V0BA 1YHBA 3D4WA 3M3YH 4B3RQ 1GXDC 4KKTA 5IYBH 4H44C 4H02A 4HJ8A 3PIPA 4KY5A 2F3WA 2SDFA 2HCCA 4Y7NB 3HOVG 5IGCA 4JI8H 3MHBA 4K2LA 5FLXc 2K7VA 1PZKD 3PGZA 2D62A 3A74A 3RUZA 5FLXE 2E2JH 4TQUS 5AJ3Q 4MTNA 2NN6G 3KBGA 4C3HH 3PF5A 3KJPA 1V1PA 4MZ9A 3LWEA 1EFWA 4ABNA 2A1AA 1PH2A 4MHEA 4JI4H 3BZDB 2TSSA 5KYLA 4MNOA 1Y69U 3T56B 4ME5A 4TVAB 5BR8Q 3E9HA 5DAUA 1ICWA 1E3PA 4GNXC 2K5VA 1WE8A 4PDBA 5IGBA 4DNRB 2WIIB 1PYWD 1VF7A 1L1OB 4KTAA 2O2LD 4RGMA 2EYJA 1X65A 2VQFH 5EBDA 3KDGA 4A3FH 5I2YA 3BG3A 4R8IA 4IUTA 4JI3H 5IYCG 1BCPC 3MFGA 4WFN3 3T1HQ 1XNQL 1S5CD 4HIOA 1PTOD 4OO1G 2MJHA 3U50C 3OWEB 1I4XA 5J3BA 4JI5L 5KEEA 2VNUD 4OXPA 3P20A 2NZHA 1STBA 1YNND 1TT2A 3HGBA 1A3UA 2CPMA 5HGTA 1GOZA 3K0XA 4E6IA 1LYLA 4XXEA 3M3YB 3MXGA 4MTKA 2EE1A 1I6UA 4PNYA 1NUCA 2WKDA 4B3ML 3PO3H 2UUCL 3GO5A 4XQQA 3SE0A 4IZ8A 2M2LA 2IL8A 5LMNW 4NP5A 2Q2TA 1V9PA 4ZUIA 2R93H 1N33Q 4DV0H 3HOWG 2LTMA 3E9IA 2EY5A 3CHBD 2DJGC 4OL7A 4TKOB 3RMHA 1HNWQ 4ZLTF 5K36H 1K1GA 2K14A 4O42A 3S2HH 4HMJA 3HOUG 1HR0W 2LKVA 3P75A 1SNPA 2VKCA 3NTKA 4QCLA 4NXNL 1UE5A 1RODA 4DAYB 5J22A 2VS1A 5M3FH 4OX9Q 5LMUQ 1JWUD 2KHJA 1SJED 2D5DA 2KECA 2F0WA 2FXQA 3AB9A 2L1BA 4F7XA 1XMOQ 1CHPD 2CTEA 4DV3H 4AIMA 3VA5A 4ULLA 2A6HD 2JA7B 2GVBA 1EY9A 4GKKQ 3BDCA 5E7NA 4WJ3M 4JI6Q 3K0YA 4CJ1B 1J4WA 1WOCA 5K36G 4GKKH 4HEDA 2JA8G 3MVVA 4WRDA 5EBCA 1SRUA 1KTKA 5EPJA 4DAYA 4UY8C 1I4QA 1Y8OB 1A2TA 2OXPA 3DUZA 2A1SA 1TUAA 5FO9B 1JJCB 4BXXH 1I4HA 2VB2X 1SNQA 4JW0A 4JCVE 4X62H 1N32L 4JVZA 5JEAH 4B3TH 2A19A 1KAWA 2J4XA 4TRDA 4HIKA 1YJWA 3QJYA 4QGUA 3TN2A 1CI3M 4KD4A 3TZUA 3NBHB 3U9OA 3U4VA 3D6WA 2OQKA 3OSOA 4PQXA 4OCHA 2QKIC 1JWSD 2WACA 2PW7A 4EX5A 1Z47A 1VQMA 4A3FB 1L0YB 3J81c 4JI0H 2CPQA 4ZK9B 1IKLA 2EY1A 1R9TH 1XMQL 2EYMA 1Z2IA 3PUVA 1Q46A 5M3MG 3H3VI 1TWFH 1B70B 3PV0A 2RSNA 1L2FA 4IJLA 4U673 3N6RA 4NXMQ 3Q0AA 3CD6A 2LFNA 1AEXA 1U4MA 2B2YC 3EA6A 2UXBL 1DD2A 1KQSA 1J5EQ 1B9NA 3JAMc 3G4SA 1B8AA 1VQHA 2R93B 4YIJA 3K5NA 1BCPF 1PFNA 3H0GG 2PZTA 1XNQH 1K0RA 2BE5D 3R8BA 4YCWA 2MGSA 5E4XA 2OEOA 1PDQA 1J6QA 4L5QA 5NUCA 4DK3C 4RCOA 1WJJA 1MJEA 1E1TA 4AQYQ 1XPRA 4KY7A 3C46A 1SMYC 2L9HA 3TZDA 1BBXC 4A3BB 1ZZKA 1RDPD 4KHVA 3V69A 2F0JA 4B3MQ 2UUCQ 1VCIA 1T5XD 2OTJA 3M7NA 2F4VQ 1P16A 1XJVA 3VR2A 1I6HH 3GTMB 3BVGA 5A2QW 4HR7B 1PFBA 4GS3A 3S1RB 1OO9B 4DV6L 2R92G 1EIGA 1HNWL 5T1GA 4WALA 2KCNA 4KV6A 3K5MA 5GAEC 4NZRM 1TWHH 1Q8IA 4GKJL 4LFCQ 4NXNQ 1JR0D 4HCEA 2LS01 4OX9L 2ZM6L 3S1MB 4IUVA 5LMUL 3KK7A 3K7UC 3T4AC 3VR4A 1K8AC 3RZOB 2UUAH 4DR2Q 2J7ZA 4KI0A 3CW2C 2VW9A 1T5EA 1SYBA 1XMOH 3E5SA 4NBQA 3L0OA 3CCUA 3J81i 3STBD 3EN2A 4ZYSA 3CC7A 1KDCA 1STAA 1IYUA 1G6ZA 4BS9A 4FF3A 4IQZA 2XN9C 1SE4A 3EBEA 1VQEA 1BR9A 3QWNA 1PFSA 4JI6L 4DR6Q 2BL5A 2PQEA 1K28A 4DUYQ 4LFAL 3G6EA 3HKZE 5HURA 1R4QB 5I6WA 3HOYG 2DY8A 1TIID 4JPBW 2CCZA 2Z4HA 1HJPA 3NXWA 4JBKA 1N34L 2JA9A 1EY5A 4GOPB 2NVYH 2F3VA 2AQ1B 2OT2A 2L4NA 5FLXW 4NKLA 4HSVA 1G6PA 1FL0A 2PT7G 1PTOB 2JEBI 3B6YA 3R93A 1EQQA 1X3FA 4L8JA 2C9OA 2Z6KC 5CV8A 1IW7D 1Q12A 5ELNA 2P5ZX 5CC4A 1E22A 3S9WA 1KRSA 1LTSD 1PRTF 3VR5A 5IT9c 5EPLA 4EQPA 1TKWB 4EC5A 2IWHA 4HIDA 2YTXA 5DEHA 1HFNA 3I7FA 4JI0L 2NYZD 5BR8H 4CDCC 4DV5L 1G91A 4UP7A 1WCMB 2ASBA 3I3CA 1AE2A 3NK9A 1UAPA 2NUCA 4LAAA 2B2UC 1PYSB 1YBYA 1AP0A 4QMFB 3VKEA 1M4VA 2CWPA 3GTPH 1D1IA 1TWGH 4K5XA 5JVG3 4RWSC 3S2HB 3H3VH 4DR3H 3DEOA 1PHJA 4PMBA 2EJGC 2DJFC 3MEFA 4EVOA 3SEBA 1QNKA 1Y1VB 2IJ0A 3H0GB 2VQFQ 3T1HH 4JI3L 2K50A 2E76C 5C3EG 5LHY1 5CV4A 2B39A 1LTRD 1WTJA 2VUMB 4X3KA 3EQLC 3GQBA 1VQ4A 1TS3A 3CCJA 1PTOH 4JV5L 4R1JA 4ODGA 1A6XA 3K59A 1S20A 3MTSA 2JA7H 1Z9FA 1CFMA 3BDLA 3ERSX 2JA8B 1QG7A 1IBKL 4QB4A 4K5WA 2EVBA 1HNZL 5KNDA 1RTOA 2I5LX 4DXGA 1FNWA 2CWAA 4CKBA 1DONA 4DR5Q 4PG3A 3ERQA 4BBSH 3MZ5A 2WB1E 4RCNA 1UNSA 3MFYA 4K8JA 2F0EA 2OWOA 4HJAA 5D14A 3SK6A 2PCFB 4A3GG 4LFCL 4JK1C 1LTBD 1AZPA 1WCMH 4FXGC 2KBNA 2F4IA 3FEWX 4DR2L 3GTGH 5LMUH 4CHTB 4J8QA 3D0FA 2Z1CA 4M8AA 2Y0SE 1CQFA 5IWAQ 1GHJA 1MJCA 3EZJA 1Z6HA 2M9VA 5C4XH 1Q86C 4LF7L 3RLNA 1JOKA 1J8IA 3UI2A 1M90C 1A15A 3NTHA 4LF9L 4KKSA 4LFAQ 4DUYL 4A3EG 4ILWA 3A54A 2R92B 2EXZA 4X3UA 2F1MA 3M4QA 1H9MA 4FP5D 4B3SL 4BY7B 5J39A 5EKLA 1KDBA 2ZTDA 3J80W 3FKIG 3FAUA 3PCOB 1SEIA 1MIUA 4NW2A 2HHHQ 1O78A 2SEBD 2WFWA 1ML0D 3HOUB 4XQJA 2JA6B 1HCZA 1D5ZC 5IGFA 2FMCA 1EOTA 3CMAA 3K7AB 2N88A 4IUNA 4A3KH 2RA4A 4UAIA 3V2TA 4X6AH 4JC0A 4QUFA 1I3QB 4G08A 3KUPA 2R61A 2DGRA 4OIKA 1YVCA 3RNUA 2B2TC 4P72A 2KEEA 3PMFA 5COYA 3I8ZA 2KENA 4JI4Q 2Q8IB 5BR8L 3GTQB 2Z4IA 1Q81C 2UXBH 1TS4A 4IUUA 3OHXC 1BDOA 1B44D 1TR5A 4A3DH 1GUGA 3CCMA 1Y8NB 1N32H 2BE5C 4DUZL 4C3JH 3VA7A 3C3LA 2BH2A 2MP1A 2JVZA 1UUPA 3E0JA 3ND9A 1EUJA 1VQLA 5M5YH 1CQVA 1E24A 2O5JC 3TQYA 3OETA 3T1HL 1XNQQ 2JA5H 4LFBH 5IP7G 4X65Q 1IBMQ 1KLUD 5DM63 5M3MB 1IHZA 1IXRA 1XNRL 3ZJYC 3J80i 4JV5Q 2HD3A 1FR3A 2XSCA 5IY0A 2R3ZA 3MEHA 3KLWA 3TS2A 4R8NA 1LTGD 3EJIA 1SLJA 1ASYA 3HKSA 1ILQA 4YY3L 5E1FA 4JBJA 2PZUA 1N33L 4H8AA 5KGUA 4HJ7A 4IPDA 3HOWH 1IBKH 4DR5L 4DV0Q 4JVHA 3K7AH 1T9HA 1O7ZA 2CH4A 1HNZH 2ES2A 1LTAD 1WFQA 4BBRH 3ONAB 4A3IH 1XRHA 1CZGA 5J1ZA 3RZDB 1SYFA 4ZCKA 5C4ZA 2XTIA 4RAUC 1HUNA 2PQUA 1W2BA 4N9TA 1GM5A 5FK9C 3N52A 4HAEA 1X4MA 2QF7A 2WAQG 2CWFA 1P8LA 4A3JH 5JJLA 4PZ8A 1YHQA 1KDAA 5CR3A 5IWAL 1CSPA 5FO8B 1F77A 4DV1H 1LT5D 2E2HH 3OPOA 2E3UA 1TXYA 4DAPA 4LF9Q 3BU2A 1A3TA 2FJ2A 4DV6H 2M8WA 2DNEA 5ELDA 1CTMA 3BJUA 1SDFA 1ZZIA 2P2RA 4DA2A 1HZAA 2Q2IA 4WJ4A 2F0NA 2GA4B 5GAHC 4IPGA 1TWCB 3S15B 2F0OA 2XGTA 1EU4A 3GV3A 2PI2A 4B3SQ 3I2ZA 4KJNA 4QMGA 2F0PA 5HGQA 1XTCD 3HOWB 3CC4A 3Q24A 4ME3A 2VXWA 2FFKB 5EPKA 1CA6A 3X3NA 2FMRA 4MN3A 1II3A 5CORA 1JICA 4ZAIA 2PZWA 1F9RA 1XMQQ 1Q90A 3WWVA 3DWAA 5FLXL 2EY6A 4EQ5A 4A75A 3F2CA 4GN4B 4A93B 2NTTA 1GHKA 1QE6A 2YV5A 2ZTCA 2EYPA 3TRZA 1AW7A 4X65H 4NXML 4JI4L 5JEAG 3TP6A 2NZOA 1C48A 2QNDA 2ICEC 4C3IH 1KHIA 1CA5A 2PMZB 2MO1A 1K3BC 4WJWA 4DK1A 2F3IA 3DLLA 4R4TA 1PV4A 1N33H 2RDGA 5CV9A 3A8JE 2IX0A 4DUZH 2XNAC 2IX1A 4OHJA 4UP8A 5DNFA 2QDBA 2WAQE 2YU9H 1Q1BA 3C1FA 3U1KA 1PLFA 3OSSD 4JI5H 3J81E 2K5QA 2JZXA 1DXMA 3NQTA 3PF4A 1PQXA 3FPUB 2SOBA 1XYIA 4CDDC 2F0LA 3MXNB 1HZ9A 2IY5B 4X3TA 3CCEA 3L2PA 4A3JB 2EXDA 4P73A 2A6ED 3HP3A 4IO9A 3M4OH 2B2WA 3RD4A 4IFDJ 4HJ5A 1DZ1A 4A3DG 3HFZB 3CCSA 4RHSA 5CV6A 4KKUA 3VR3A 4DV0L 3L3OC 4BY1H 3F2UA 2A8VA 4A3FG 4BBSG 3OIPA 2R7FA 2ANNA 1QWYA 3I4MB 4L5RC 5TSSA 1K8GA 1PH8A 1L1OC 3RZOH 1H9JA 1VBIA 4Q5VA 4GKJQ 1OXTA 5C0XH 4L6TB 1FYCA 1GUTA 4QJFA 3QR8A 3TSSA 2Q8TA 4DV7Q 3S1MH 1CHQD 2ZQEA 1A8VA 2KVMA 3J7AF 3EIVA 3NSWA 2E2IB 5IWAH 3SGIA 4OX9H 1F2MA 1H9KA 2Z9HA 1HH2P 2KUMA 3GTOH 1HA6A 2B3GA 3FHWA 2K33A 2B2TA 4DR4Q 3MXPA 1J9OA 1JWMD 1K9MC 2EYHA 5IOCA 1ENAA 3GDEA 1CKMA 2EDGA 4LK1C 4R4QA 2A69C 1A3VA 4HMIA 4P71A 4LF6Q 1OXUA 1VQGA 2Z8LA 1LT3D 5EQ0A 3GTLB 2GN5A 1N9WA 4F87A 3MXNA 4K0KH 2A69D 3FVQA 4B3SH 2IX3A 2FPHX 1D1KA 2F0KA 4X62L 2A68D 1X4NA 1VIGA 3GR5A 2N3SA 2EZVA 1DCZA 1GUNA 4DV3L 4DFAA 2D0PA 1Q7YC 4ZKBB 2R7ZB 4POFA 1I94H 2E5LH 1SNOA 3LX0A 4HTHA 3NWTA 4YHHH 4A3LH 1JB7A 1PZID 3DM1A 1ENFA 1VQIA 1JT8A 3SK4A 4YHHQ 3MWYW 1B1ZA 3FP9A 3QOJA 2UXCH 3AEVA 4PV1C 4KMUC 1DGSA 2G9DA 3CAMA 2LSSA 2A6EC 4GLAC 4K6DA 2C5CA 3IAYA 3UE1A 3UOEA 2B29A 4NXMH 4RGTA 3M4OB 2PW5A 5FJ8G 1Y1WB 3HS0C 2UU9Q 1Y1WG 4V190 2K1BA 3I4LA 1LLRD 5IODA 1EZ6A 3WOEA 5JOBA 3NWSA 2D9UA 1EFID 4JI3Q 1ESFA 2NVTB 3U58A 4LUVA 1VQ5A 5KIXA 4LUZA 4LFBL 5A2QL 2B8FA 2JA8H 2VUMH 1TWFB 3URYA 4XT1B 4XDXA 3L7ZC 3W1BA 1AN7A
chains in the Genus database with same CATH topology
1GJXA 3STBC 4DN4M 5KYIA 2F52A 3JAME 3LNNA 1R4PB 5BN3A 4GOPC 5AFWA 3S16H 1W6KA 3HOZH 3A0JA 1RD9D 1KC8C 3Q6SA 2E2IH 1TWAB 4OONA 3HKZB 2AWOA 4DR1Q 2E2HB 1S5ED 4RKBA 1F9PA 1RKNA 1HA5A 2RHQB 1Q82C 1HZCA 1RIPA 3K5OA 1BBWA 1KXLA 2RDFA 5G3LD 2IW3A 3G7LA 3K80C 4WANA 2ATWA 4DNIA 5JJIA 1FNUA 2ICIA 1W6JA 3TMEA 2K5NA 1YNXA 3A56A 3ZYYX 1O80A 5GADC 2N78A 4DGZA 4P74A 3W2DA 3PO3G 2OQ0A 3GTMH 1OTCA 3GTJH 3GP7A 1X3EA 1O7LA 4I65A 4B3TQ 2R92H 1D7QA 4R9WA 2F0IA 4DPGA 2PO4A 1LM0A 2RCNA 3TP7A 3GV6A 3FRPB 2OPUA 3V96A 4LW1A 4ZRZA 1GUWA 3I56A 4AYBB 5C0XJ 5EKIA 5A35A 1KNEA 2NZ1D 1NY4A 4U68A 1EY0A 1NAPA 1S40A 5M5WH 3NENA 1MBYA 2XWJB 5FO7B 3H15A 1VQ7A 4RA8A 1LO5D 5CMDA 2YTVA 4ALPA 2MQHA 1VQBA 4A3KB 3CRLC 4A3MH 3T51B 1EYCA 4DV3Q 1V1QA 1SBBB 2HHHL 3NELA 4RGNA 5C4HA 3Q22A 2K5HA 4JG2A 4PMWA 3W1GA 3AFQA 1YNNC 2EIFA 4DV2Q 1E2VA 1AN8A 4IPCA 2AUKA 1PH5A 5FOBB 3G48A 4A3DB 2BA1A 5DLQE 4HCSA 1EU3A 3S16B 1XXGA 4C2MH 1VQDA 5KNBA 4GZYC 2N49A 1TWAH 2WV6D 3T53B 5M5YB 1WTPA 2K03A 3OTOQ 2WINB 1Q1EA 4G57A 3RLFA 2OCEA 4NMZA 1EC6A 4FXDA 1EZ8A 3D6CA 4DUZQ 1STHA 1SFOB 1WVNA 2EYOA 4BY7G 5I9OA 2OPVA 5GQOA 2E8GA 5ELOA 2JXMB 1EEFD 4X65L 1WVLA 2ALYB 1IBML 5M3MH 3KF8B 1N36L 3ULLA 4LIJA 1KLGD 1XNRQ 3WDNA 1SNCA 1X32A 3GTOB 1VMPA 1S72A 3U9SA 1CUKA 1JORA 3HOVB 1JCKB 2HCIA 4DR1L 5I2XA 2F0FA 1IW7C 5KRUA 4A3IB 2BA0A 4YY3Q 1IKMA 2HIVA 2B2VC 5CBEE 4IFDI 1QVGA 2XRSD 2DNCA 2K04A 4BBRB 1U4PA 3G71A 3SDZA 3RZDH 2HH2A 4OO1I 1KAAA 1H9RA 4JOIC 3AFPA 1QZGA 1VQ9A 1RF2D 2JA5G 2ZJPA 4AYBG 2ZT9C 3R2IA 2CQAA 2EJFC 3A8IE 2YTYA 5IP7H 1HUMA 1LACA 4J1MA 3QO2A 1VQJA 2KHIA 2B2YA 1A63A 3A7AB 4LF4Q 2RKSA 4X66L 1FJGL 1V1OA 5ELEA 3JC66 1FVIA 4CKEA 3OMGA 3JAMi 1XWEA 2Z6KA 2QEJC 1B3AA 1BXTA 4XIGS 1M1KC 1K3RA 2PNRC 5IGGA 4KD3A 1LTLA 2MNAA 2I5MX 5LMNQ 1EQVA 1DJRD 5LL6S 5IIFA 5C4JB 1VQFA 4DV4L 3QG1A 1BNZA 1MSHA 1VF5C 3KLSA 1C8CA 4IJHA 2BDOA 4BBRG 3TP5A 3F2DA 1AH9A 4XYOA 1SYEA 1ET9A 3CF5A 2UUAL 4QIWE 1EEID 1WTRA 1TU2B 4Z9CB 5C44B 1B9MA 5IT9E 3NUCA 4C1NK 1LUZA 2HIXA 3A8KE 1PH7A 2HT1A 1ZEQX 3PSIA 5C4XB 3NBHA 2CW0D 2JK8A 2AQ2B 2NWGA 3HEJA 3SHLA 1I50H 1RJTA 2QCPX 4IALA 2Y0SB 4DR7L 2PY9A 4C3IB 2PMZE 3IFTA 1CT1D 2VL6A 3R3OA 3BVMA 1J5KA 2K75A 1PA6A 5K5PA 3F2BA 3CXCA 3PUYA 5CV7A 5G3LF 3CCVA 2IHFA 2ZXRA 5T1IA 4R4OA 3CP0A 4B8TA 1H9SB 4OIJA 2N55A 1HTPA 1XPOA 1PH6A 1STEA 2AQ3B 1PH3A 2CTLA 4X64L 4QF4A 2A5HA 2X69A 3UDXA 3KF6B 3BS1A 3CU7A 3I4NB 1SAPA 5D3IB 3QIAA 1PRTB 1EOVA 3M4PA 2YU9B 5M5XB 3E0EA 2I07B 3KF8A 1EWIA 1EQRA 1EL0A 2QA4A 4A3LG 5FLMG 5JVH3 5C44H 4KN4C 1CM9A 4GLXA 1KL9A 1X3PA 3KLRA 2SNMA 2AKWB 4APVA 3T16A 1UWVA 1U0LA 3J80c 1X3QA 3S14H 4O0AA 2H1EA 1EY6A 4BXXG 1KRTA 2ENBA 1PTOF 1HXYD 4FNFA 2MHVA 3LGJA 4UP9A 2HUGA 3MXUA 5JPMC 1NTGA 4RH6A 3SXHA 3J81j 3TS0A 2ZTEA 1MKHA 3S1QH 2WB1G 3IFDA 1WTWA 2XVSA 2ZXPA 4DV7L 3UDIA 2CTFA 1NJIC 4YCVA 1VQNA 4LF4L 4EQNA 4H13C 4DR4L 1MGSA 4BY1G 4IUQA 4OWWB 1VDZA 2CHBD 2VB3X 2UUBL 2YYZA 1SN8A 1TY2A 3J7A5 1W3SA 1O7YA 5C0XG 4GNXB 4CKCA 2B2UA 4FF1A 4H7BA 3PIO3 4OO1H 4A3BG 4LF6L 2ZJQA 2OF1A 4DV4Q 4DAVA 3I90A 3I72A 2B63G 4G7OC 3PUZA 2JE6I 3S1RH 5I6YA 3NEMA 3HOXG 1WYDA 4O2DA 1D8LA 5IYDG 4X62Q 4FVMA 2EJMA 2RBMA 4K14A 2K4KA 1LT4D 1BF4A 4A3MG 3K58A 5JAVA 1IL8A 3RN2A 2NTSA 5IYDH 1CKNB 3PIP3 4J15A 1YITA 4IFDH 1Z7TA 4CJ2C 3EROA 4RKLA 4DR3L 1F9QA 2PPBC 1F2ZA 4ID6A 4DR7Q 1E2ZA 5M5XH 4A3BH 1HNXL 1EIHA 4YHHL 4BWGB 2I46A 1Y8PB 1LT6D 4KK7A 1GKHA 2MUYA 3EFXD 5KNCA 1WTVA 3I91A 3DM3A 1PRTD 3F8TA 1SNDA 1RHPA 1VQ6A 4A3JG 3WOFA 1QCBD 2NVTH 4O1NA 4LF8L 4C1NI 4F88A 3I4OA 1WD1A 2UU9L 1CKNA 4FF2A 4QL5A 1Y1WH 1C7YA 2VZAA 3FMCA 3IL8A 3HG9A 1MSGA 1S5FD 4LFBQ 2A6HC 1SR3A 4GOPA 1ILPA 2Q2HA 1VQOA 4XTCS 1MI2A 2KJXA 2R7ZG 4P75A 1EY4A 4C3IG 4B9WA 3HOZB 3VYTA 3VR6A 1B53A 3VYSA 2CKZB 4K5VA 2F0DA 5C5MA 3K5LA 1MD2D 5GROA 3T1YQ 3Q23A 3Q8DA 4A93G 2WP8J 1BKBA 1E7ZA 5C4JH 2K05A 1LTTD 3HOXB 3CQZB 2TMPA 3ND8A 3IRBA 4DV1Q 2OTLA 4GN5A 4YWMA 3I73A 5IT9L 2CTKA 3GTQH 1BO0A 1EIFA 3S2DB 4DKAC 3NHHA 3GTJB 5FLMH 4LMQD 4A76A 3RLOA 3AEVB 3J7ZC 4KHZA 4QUCA 3DWQA 1EWHA 2EY2A 3ITPA 3M9BA 4IPHA 2K01A 2QEXA 3PO2H 1I50B 4AYBE 4BY1B 1BCPB 4B3TL 3T13A 2V4DA 1YZ6A 2UUBQ 1KHMA 4JYAQ 2JA5B 4HJ9A 3GTKB 2AUJD 5FKAC 5CBAE 4JI8L 5CV5A 1QNUA 3TDQA 2BCOA 5DM73 1EYDA 5C0XI 1K8OA 2QGQA 4Q0FA 2I5HA 3HZXA 1KIXA 3R2TA 1HHVA 1U9RA 1YIJA 3GTPB 4BBSB 2MO0A 5E3FA 4C56C 1ENCA 1BUVT 1Q3LA 1VQPA 3AMUA 1AZQA 2VQEQ 2RF4A 4GN3B 3I4NH 1OXSC 4IOAA 4IFDG 2ZXOA 3PUWA 1C4QA 3W5OA 1VS0A 4JBMA 2F0MA 2E5LL 4K8IA 2E75C 2X6LA 3J7YW 4IN3A 1SYCA 4DV2L 4A3EH 4RG1A 1DOKA 1B4OA 3M4YA 2NB0A 5HY6A 2H4OA 1X9NA 2NVQB 1Y1VG 1GO3E 2CTMA 3LWUA 4X3SA 1HRJA 3FPPA 3S14B 3VDYA 4C2MB 3H6MA 3J81L 2H5XA 4Y52H 2D2CC 1H9SA 1PRTC 3NE5B 2K52A 3OTOL 1SFOH 4LF8Q 3NTIA 4B9XA 2YQRA 3EVQA 3PIOA 3GTKH 3VYRA 1I94Q 1HQRD 1NR2A 1LV9A 5JPNC 2M00A 1N8RC 3OIQA 3GTGB 3J7AV 1PVOA 1F2LA 2AHOB 1U4RA 5C44G 5EJWA 3RN5A 3HOUH 5I4DA 3AYHB 4IOCA 2HDLA 2PNHA 1D5MC 3D3RA 1G51A 2D0OA 1I4RA 5JEAJ 3K57A 1HR0L 1IYVA 4LF5Q 4CBVA 4B08A 1Q8KA 2NVXH 2F0GA 3BYYB 2MJ8A 3SK5A 2XWBB 1JE5A 1K83H 2BDNA 3KYHC 3A5UA 2PQAA 2MPMA 4A3KG 2KCTA 2K5WA 1K8MA 4RFBA 1GD7A 4CGYB 1TQOA 1SEBD 1VQAA 2CFMA 4C3JB 2EYLA 3L9AX 2JJQA 1TY0A 2A74C 3CCRA 1NMGA 1NSNS 1EYAA 5C6AA 4X66Q 2DGYA 1FJGQ 1JJ2A 1K73C 1TVXA 1HPCA 5H1SE 5IYBG 2CW0C 1QUQB 3ULPA 1QB5D 5C3XA 3D4RA 4JBWA 2PQAB 4KHPL 2SNSA 1PZJD 1A2UA 5ELBA 4FF4A 4QIWB 4NB3A 4H0LC 4GNXA 4RHRA 3HKZG 2G9HD 1TWGB 1RCVD 5LMNL 4A3EB 1DOLA 2NN6H 4RGOS 2UXDL 2KEDA 5IYCH 1V43A 1ZYRD 2L15A 2RSOA 3C2PA 3DWPA 4IURA 2UUAQ 4JI1L 3OOCA 2JA7G 1NBWA 1VQCA 4C3HG 2UXCQ 1HZBA 3I4MG 1I4PA 5LL6X 2VQEL 4DNTB 2AWNA 3I4MH 2E74C 2F0QA 4L5TA 3CPFA 2E5LQ 1XPUA 2E2DC 1UE1A 3MC0B 4BA2I 4GLVB 1VQ8A 1X6OA 4Y7NH 5F2DA 3V05A 1DYQA 2KCCA 3ER0A 5M5WB 4QQBX 2HDMA 1SYGA 2DUDA 3I55A 3ICEA 4IUPA 3PUXA 3OW7A 3SVMA 2L5TA 3KDFB 2AXYA 3X3MA 5C3EB 2CTJA 2F03A 3S24A 4UDUC 1YJ9A 1ONLA 1SE2A 3TP8A 2F0HA 1GVPA 1YHAA 2NBFA 2CQOA 3CQZH 3HOXH 3I4NG 1JJGA 3JAML 1CK1A 1M8AA 4X64Q 1X56A 2JYOA 1BVSA 1ESRA 1I94L 1VIHA 3TBIB 2QILA 1TS5A 4PZ7A 3S2DH 3DMUA 4KN7C 1G8ZD 2Y0SG 3DHQA 3NPPA 2JA6G 2LXKA 1YNJD 4UPAA 1QOHA 3TEHB 3PO2B 2J0TD 4PZ6A 4PMCA 3DEPA 1WI5A 1WD0A 1G291 2HH3A 3S1QB 1HR0Q 4A93H 5IP9H 2KCMA 1L0XB 4BY7H 5C4XG 1D6EC 4JOIA 1IBLL 2XIWA 3BVZA 1TWCH 4HN7A 3PO3B 4JI7Q 1PMRA 1PXUA 2JA6H 4L5SA 2EOTA 2R7DA 2B2VA 1RTNA 4DF7A 5BN4A 4A3CG 1WTQA 3OYYA 1I3QH 1NE3A 4DK0A 2NVYB 1QUQA 3ULJA 1STYA 4NPSA 4XYQA 3KLSX 1XMOL 4YCUA 3P7JA 3CKIB 4OGQC 4KHPQ 1SMYD 2F0VA 2K32A 5EAYA 4GKKL 2GVAA 3KF6A 2KHSA 3FDTA 2L11A 1SMXA 2UXDQ 2L55A 4FO2A 4BA1I 1KABA 1CZWA 2ZJRA 1FGBD 2FHTA 2C35B 1YJNA 2PYKA 2LY7A 5GAGC 2B63H 2FINB 4JI1Q 4K0KL 1GUOA 1VMCA 2JSOA 1JOOA 3M7GA 3RR5A 1ZTGA 2MFIA 4G4KA 1I5FA 4AH6A 3BZCA 2WAQB 3HOZG 1N32Q 1EWCA 1DTJA 4HIMA 1SSOA 2L0CA 4XQNA 4YWKA 1B7YB 3MA2B 4A3IG 4DR3Q 3G6JB 5CGKA 1N36Q 2HQEA 1AFPA 1XTDA 3E6ZX 1GUSA 2BH8A 1E2WA 5A2QE 1HNXQ 1JC7A 2JQOA 1LTID 3H0GH 1DOMA 1R9TB 3H94A 5I9PA 4EQOA 2V1CC 1ZZJA 1JE4A 4R4CA 4AM3A 1WTXA 3NP8A 1K83B 2Q2UA 3AQQA 4LWCA 2R93G 2HQLA 1PH4A 4WORA 2UXBQ 1J5EL 4A4IA 1L0WA 1F9SA 1EIYB 2F0TA 1SYDA 1L1OA 3J80E 1I4GA 1KNAA 1U4LA 1CKOA 4LUOA 1HFGA 3W3AA 3SK8A 5E4WC 1XX8A 2Z0SA 2B2WC 3P1HA 4KJOA 4QY7A 3HOYB 4A3GH 4ZKCB 4A3MB 3S1NB 4AQYL 1ET6A 3A5ZB 3KJOA 1BCPD 4DAMA 1IZ6A 3UDFA 4YWLA 1EQTA 1F2YA 4KY6A 3T1YL 2EPBA 1UE7A 4FYDA 1CSQA 1UEBA 1SJHD 1G2TA 3A7LA 2F4VL 4M1UB 4CJ0B 3H3VC 4LJZC 4DV1L 1QZHA 3OMCA 4FDBA 4DV6Q 2FMMA 5JJZA 4G7HC 1IBLQ 3A55A 1O7IA 4G7ZC 3C1EA 2BOSA 4JI7L 3BYTB 3D8GA 1I6HB 1OXXK 1SXTA 2B63B 2IHEA 3OW2A 2ANRA 4JVYA 2IT1A 4DU9A 4POGA 1NCVA 2K6AA 3O13A 2ZM6Q 5M3FG 3I70A 3K81C 4K2KA 1TWHB 1JOQA 1PH1A 1C0AA 1QJOA 4RMFA 1H95A 4JYAL 4C3JG 2F0UA 1TS2A 3UDGA 3KBXA 5C5LA 4EGVA 3D4DA 3FKIH 1UEAB 4JI2Q 5FJ8H 4JI8Q 1QILA 4NDXA 1RL2A 1B50A 2KOLA 2DY7A 4R4IA 1ASZA 4DR6L 5C3EH 1UE6A 1E0BA 1JQYD 2B8GA 4KLKA 4A3GB 3HOYH 1NR4A 3MAQA 3H91A 3KOJA 4HSPA 4K0KQ 1N34Q 1FD7D 2IPKD 2L12A 5BN5A 2VY3A 2WB1B 1IYJB 1DM0B 1LABA 1QVCA 3D31A 1HQMC 1V8QA 2RQXA 5M3FB 1YI2A 2NVQH 1JMCA 2RDHA 4B3RL 5M9OA 2JP1A 2ID0A 3PO2G 1I6VC 5CYUA 3TREA 4LNQA 1SNMA 1D2BA 1B2TA 2NN6I 1X54A 2LMCB 1S5BD 1HTLD 3QB3A 5AJ3L 2VUMG 1WCMG 5IE8A 2I0QA 4JI0Q 3CCLA 4F8MA 1D5XC 2KQ3A 1X3GA 5ISRA 1A62A 4DV5Q 3S1NH 1DT4A 2EYFA 3CCQA 4DXFA 1BBUA 1NMFA 3AU7A 1STNA 4S3SA 1IL2A 4I7ZC 1FGUA 1ZKOA 1A0IA 2RVLA 1OXVA 4J6HA 4XT3B 4OWXB 2N8NA 1U5KA 3S17H 1G2SA 2PI2E 1Y1VH 1SE3A 2VQFL 1C9OA 4ZUJA 2XRQD 1STGA 4C3HB 3M85A 3J80L 5D3DA 2A68C 4JI5Q 3K6OA 3CRKC 1ZXTA 1PH9A 3NQIA 5ELCA 4TSSA 2EQSA 3CMEA 3GTLH 3CC2A 1JB3A 3QOLA 1QVFA 1IBKQ 4LF5L 1BQQT 5ELFA 2KA7A 2NVXB 5IP9G 2R6GA 1EYGA 1HNZQ 1PFMA 1EY7A 1YEZA 4ZQ3A 3FKIB 2AMCB 2K28A 4DK6C 5EKKA 1SROA 2RHSB 5IGEA 2O5IC 5IGDA 3HRZC 5EGTA 2R7ZH 1SE8A 2WKCA 2CVRA 3KDFA 2LXJA 3K8AA 2F0SA 2A73B 3DXJC 4N9PA 1WTOA 2E2JB 3BZKA 1EY8A 1PTOC 4K6LA 4L63B 1V1PB 3KFUA 1S4ZA 2O4XA 3NBIA 3CPWA 3SR1A 1VQKA 3S15H 2Q8RE 5D65A 5C3WA 3UE0A 4P2CB 3BDOA 3VYUA 1KD1C 5JJKA 3S17B 1PYBA 4MIUA 4JI2L 4FXKC 1S5DD 4LF7Q 3H09A 3HOVH 3F1ZA 2JEAI 2X6GA 1FNVA 1X55A 3GD7A 3IKJA 1YNJC 1ZYRC 1AE3A 2K5DA 1E1OA 3U4ZA 1BOSA 2UXCL 3OWFA 1Y14B 4OWTB 2DN8A 4A3CH 1S3OA 4V0BA 1YHBA 3D4WA 3M3YH 4B3RQ 1GXDC 4KKTA 5IYBH 4H44C 4H02A 4HJ8A 3PIPA 4KY5A 2F3WA 2SDFA 2HCCA 4Y7NB 3HOVG 5IGCA 3MHBA 4K2LA 5FLXc 2K7VA 1PZKD 3PGZA 2D62A 3A74A 3RUZA 5FLXE 2E2JH 4TQUS 5AJ3Q 4MTNA 2NN6G 3KBGA 4C3HH 3PF5A 3KJPA 1V1PA 4MZ9A 3LWEA 1EFWA 4ABNA 2A1AA 1PH2A 4MHEA 3BZDB 2TSSA 5KYLA 4MNOA 1Y69U 3T56B 4ME5A 4TVAB 5BR8Q 3E9HA 5DAUA 1ICWA 1E3PA 4GNXC 2K5VA 1WE8A 5IGBA 4DNRB 2WIIB 1PYWD 1VF7A 1L1OB 4KTAA 2O2LD 4RGMA 2EYJA 1X65A 5EBDA 4A3FH 5I2YA 3BG3A 4R8IA 4IUTA 5IYCG 1BCPC 3MFGA 4WFN3 3T1HQ 1XNQL 1S5CD 4HIOA 1PTOD 4OO1G 2MJHA 3U50C 3OWEB 1I4XA 5KEEA 2VNUD 5J3BA 4JI5L 4OXPA 3P20A 2NZHA 1STBA 1YNND 1TT2A 3HGBA 1A3UA 5HGTA 1GOZA 3K0XA 4E6IA 4XXEA 3M3YB 1LYLA 3MXGA 2EE1A 4PNYA 1NUCA 2WKDA 4B3ML 3PO3H 2UUCL 3GO5A 4XQQA 3SE0A 4IZ8A 2M2LA 2IL8A 5LMNW 4NP5A 2Q2TA 4ZUIA 1V9PA 2R93H 1N33Q 3HOWG 3E9IA 2EY5A 3CHBD 4OL7A 4TKOB 3RMHA 1HNWQ 4ZLTF 5K36H 1K1GA 2K14A 4O42A 3S2HH 4HMJA 3HOUG 1HR0W 2LKVA 3P75A 1SNPA 3NTKA 4QCLA 4NXNL 1UE5A 1RODA 4DAYB 5J22A 2VS1A 5M3FH 4OX9Q 5LMUQ 1JWUD 2KHJA 1SJED 2D5DA 2KECA 2F0WA 2FXQA 3AB9A 2L1BA 4F7XA 1XMOQ 1CHPD 2CTEA 4AIMA 3VA5A 4ULLA 2A6HD 2JA7B 2GVBA 1EY9A 4GKKQ 3BDCA 5E7NA 4WJ3M 4JI6Q 3K0YA 4CJ1B 1J4WA 1WOCA 5K36G 4HEDA 2JA8G 3MVVA 4WRDA 5EBCA 1SRUA 1KTKA 5EPJA 4DAYA 4UY8C 1I4QA 1Y8OB 1A2TA 2OXPA 3DUZA 1TUAA 5FO9B 1JJCB 4BXXH 1I4HA 2VB2X 1SNQA 4JCVE 1N32L 5JEAH 2A19A 2J4XA 1KAWA 4TRDA 4HIKA 1YJWA 3QJYA 4QGUA 3TN2A 1CI3M 4KD4A 3TZUA 3NBHB 3U9OA 3U4VA 3D6WA 2OQKA 3OSOA 4PQXA 2QKIC 1JWSD 2WACA 2PW7A 4EX5A 1Z47A 1VQMA 4A3FB 1L0YB 3J81c 2CPQA 4ZK9B 1IKLA 2EY1A 1R9TH 1XMQL 2EYMA 3PUVA 1Q46A 5M3MG 3H3VI 1TWFH 1B70B 3PV0A 2RSNA 4U673 1L2FA 4IJLA 3N6RA 4NXMQ 3Q0AA 3CD6A 2LFNA 1AEXA 1U4MA 2B2YC 3EA6A 2UXBL 1DD2A 1KQSA 1J5EQ 1B9NA 3JAMc 3G4SA 1B8AA 1VQHA 2R93B 4YIJA 3K5NA 1BCPF 1PFNA 3H0GG 2PZTA 2BE5D 3R8BA 1K0RA 4YCWA 2MGSA 5E4XA 2OEOA 1PDQA 5NUCA 1J6QA 4L5QA 4DK3C 4RCOA 1WJJA 1MJEA 1E1TA 4AQYQ 1XPRA 4KY7A 3C46A 1SMYC 2L9HA 3TZDA 1BBXC 4A3BB 1ZZKA 1RDPD 4KHVA 3V69A 2F0JA 4B3MQ 2UUCQ 1VCIA 1T5XD 2OTJA 3M7NA 2F4VQ 1P16A 1XJVA 3VR2A 1I6HH 3GTMB 3BVGA 4HR7B 1PFBA 4GS3A 3S1RB 1OO9B 4DV6L 2R92G 1EIGA 1HNWL 5T1GA 4WALA 2KCNA 4KV6A 3K5MA 5GAEC 1TWHH 1Q8IA 4GKJL 4LFCQ 4NXNQ 1JR0D 4HCEA 2LS01 3S1MB 2ZM6L 4OX9L 4IUVA 5LMUL 3KK7A 3T4AC 3K7UC 3VR4A 1K8AC 3RZOB 4DR2Q 2J7ZA 4KI0A 3CW2C 2VW9A 1T5EA 1SYBA 3E5SA 4NBQA 3L0OA 3CCUA 3J81i 3STBD 3EN2A 4ZYSA 3CC7A 1KDCA 1STAA 1IYUA 1G6ZA 4BS9A 4FF3A 4IQZA 2XN9C 1SE4A 3EBEA 1VQEA 1BR9A 3QWNA 1PFSA 4JI6L 4DR6Q 2BL5A 2PQEA 4DUYQ 4LFAL 3G6EA 3HKZE 5HURA 1R4QB 5I6WA 3HOYG 2DY8A 1TIID 2CCZA 2Z4HA 3NXWA 1HJPA 4JBKA 1N34L 2JA9A 1EY5A 4GOPB 2NVYH 2F3VA 2AQ1B 2OT2A 2L4NA 4NKLA 4HSVA 1G6PA 1FL0A 1PTOB 2JEBI 3B6YA 3R93A 1EQQA 1X3FA 4L8JA 2C9OA 2Z6KC 5CV8A 1IW7D 1Q12A 5ELNA 5CC4A 1E22A 3S9WA 1KRSA 1LTSD 1PRTF 3VR5A 5IT9c 5EPLA 4EQPA 1TKWB 2IWHA 4HIDA 2YTXA 5DEHA 1HFNA 3I7FA 4JI0L 2NYZD 4DV5L 1G91A 4UP7A 1WCMB 2ASBA 3I3CA 1AE2A 3NK9A 1UAPA 2NUCA 4LAAA 2B2UC 1AP0A 1PYSB 1YBYA 4QMFB 3VKEA 1M4VA 2CWPA 3GTPH 1D1IA 1TWGH 4K5XA 5JVG3 4RWSC 3S2HB 3H3VH 3DEOA 1PHJA 4PMBA 2EJGC 3MEFA 4EVOA 3SEBA 1QNKA 1Y1VB 2IJ0A 3H0GB 2VQFQ 4JI3L 2K50A 2E76C 5C3EG 5LHY1 5CV4A 2B39A 1LTRD 2VUMB 4X3KA 3EQLC 3GQBA 1VQ4A 1TS3A 3CCJA 1PTOH 4JV5L 4R1JA 4ODGA 1A6XA 3K59A 3MTSA 2JA7H 1Z9FA 1CFMA 3BDLA 3ERSX 2JA8B 1QG7A 1IBKL 4QB4A 4K5WA 2EVBA 1HNZL 5KNDA 1RTOA 4DXGA 2I5LX 1FNWA 2CWAA 4CKBA 1DONA 4DR5Q 4PG3A 3ERQA 4BBSH 3MZ5A 2WB1E 4RCNA 1UNSA 3MFYA 4K8JA 2F0EA 2OWOA 4HJAA 5D14A 3SK6A 2PCFB 4A3GG 4LFCL 4JK1C 1LTBD 1AZPA 4FXGC 1WCMH 2KBNA 2F4IA 3FEWX 4DR2L 3GTGH 4CHTB 4J8QA 2Z1CA 3D0FA 4M8AA 2Y0SE 1CQFA 5IWAQ 1GHJA 1MJCA 1Z6HA 2M9VA 5C4XH 1Q86C 4LF7L 3RLNA 1JOKA 1J8IA 3UI2A 1M90C 1A15A 3NTHA 4LF9L 4KKSA 4LFAQ 4DUYL 4A3EG 4ILWA 3A54A 2R92B 2EXZA 4X3UA 2F1MA 3M4QA 1H9MA 4FP5D 4B3SL 4BY7B 5J39A 5EKLA 1KDBA 2ZTDA 3FKIG 3PCOB 1MIUA 4NW2A 2HHHQ 1O78A 2SEBD 3HOUB 1ML0D 2WFWA 4XQJA 2JA6B 1HCZA 1D5ZC 5IGFA 2FMCA 1EOTA 3CMAA 3K7AB 2N88A 4IUNA 4A3KH 2RA4A 4UAIA 3V2TA 4X6AH 4QUFA 4JC0A 1I3QB 3KUPA 2R61A 2DGRA 4OIKA 1YVCA 3RNUA 2B2TC 4P72A 2KEEA 3PMFA 5COYA 3I8ZA 2KENA 4JI4Q 2Q8IB 3GTQB 5BR8L 2Z4IA 1Q81C 1TS4A 4IUUA 3OHXC 1BDOA 1B44D 1TR5A 4A3DH 1GUGA 3CCMA 1Y8NB 2BE5C 4DUZL 4C3JH 3VA7A 3C3LA 2BH2A 2MP1A 2JVZA 1UUPA 3E0JA 3ND9A 1EUJA 1VQLA 5M5YH 1CQVA 1E24A 2O5JC 3TQYA 3T1HL 1XNQQ 2JA5H 5IP7G 4X65Q 1IBMQ 1KLUD 5DM63 5M3MB 1IHZA 1IXRA 1XNRL 3ZJYC 3J80i 4JV5Q 1FR3A 2XSCA 5IY0A 2R3ZA 3MEHA 3KLWA 3TS2A 4R8NA 1LTGD 3EJIA 1SLJA 1ASYA 3HKSA 1ILQA 4YY3L 5E1FA 4JBJA 2PZUA 1N33L 5KGUA 4HJ7A 4IPDA 3HOWH 4DR5L 4DV0Q 4JVHA 3K7AH 1T9HA 1O7ZA 2ES2A 1LTAD 1WFQA 4BBRH 3ONAB 4A3IH 1CZGA 5J1ZA 3RZDB 1SYFA 5C4ZA 2XTIA 4RAUC 1HUNA 2PQUA 1W2BA 4N9TA 1GM5A 5FK9C 3N52A 4HAEA 1X4MA 2QF7A 2WAQG 1P8LA 4A3JH 5JJLA 4PZ8A 1YHQA 1KDAA 5CR3A 5IWAL 1CSPA 5FO8B 1F77A 1LT5D 2E2HH 3OPOA 2E3UA 1TXYA 4DAPA 4LF9Q 3BU2A 1A3TA 2FJ2A 2DNEA 5ELDA 1CTMA 3BJUA 1SDFA 1ZZIA 2P2RA 4DA2A 1HZAA 2Q2IA 4WJ4A 2F0NA 2GA4B 5GAHC 4IPGA 1TWCB 3S15B 2F0OA 2XGTA 1EU4A 3GV3A 2PI2A 4B3SQ 3I2ZA 4KJNA