5JEAG

Structure of a cytoplasmic 11-subunit rna exosome complex including ski7, bound to rna
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
237
structure length
235
Chain Sequence
b'DSMSTFIFPGDSFPVDPTTPVKLGPGIYCDPNTQEIRPVNTGVLHVSAKGKVQTAYIDYSSKRYIPSVNDFVIGVIIGTFSDSYKVSLQNFSSSVSLSYMAFPNASKKNRPTLQVGDLVYARVCTAEKELEAEIECFDSTTGRDAGFGILEDGMIIDVNLNFARQLLFNNDFPLLKVLAAHTKFEVAIGLNGKIWVKCEELSNTLACYRTIMECCQKNDTAAFKDIAKRQFKEIL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exosome complex component RRP45
publication title Structure of a Cytoplasmic 11-Subunit RNA Exosome Complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule tags Hydrolase/rna
total genus 51
structure length 235
sequence length 237
ec nomenclature
pdb deposition date 2016-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF15985 KH_6 KH domain
G PF18311 Rrp40_N Exosome complex exonuclease Rrp40 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5jeaG01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5jeaG02
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 5jeaG03
4LF7L 2MFIA 4OONA 3S1RH 1GHKA 2DGYA 2MJHA 4BY1H 2Z6KA 4YHHL 1DTJA 4A3DG 3HGBA 4A3JH 4APVA 4DAMA 2O5IC 5FJ8G 1GUNA 1KAWA 5C3EH 4DR1L 2N3SA 3BG3A 1XMQL 4DR3Q 3BZCA 1YNNC 1EWHA 1H9SA 4H13C 3OW7A 3MFYA 1P8LA 4IPGA 3RZDH 2CTJA 3RLNA 3A0JA 4QIWE 2AMCB 2F4VQ 2JVZA 4LJZC 4IFDI 3T56B 1EOVA 1WOCA 4A3FG 2E2HH 4O2DA 2LSSA 1YI2A 3EBEA 3F1ZA 4I7ZC 3ULJA 4KN7C 3I4NH 5JEAJ 2Q8IB 3F8TA 3IKJA 1VIHA 2Z6KC 5J3BA 2ANRA 4A3LG 3QG1A 2ZJQA 1VQ8A 2E3UA 2LMCB 3PIPA 3KOJA 2CTLA 2I5MX 4GOPB 2N8NA 2Q2HA 3CC4A 4ALPA 5C3EG 4DV2L 4HIMA 2K5HA 1E7ZA 1YEZA 1AE3A 1IBLQ 5M3FG 2JA7H 3AB9A 2HIXA 1ASZA 1WJJA 1V43A 3J80c 3CCSA 1H9KA 1B9MA 3AEVB 2E2JH 5C4JH 2VQFL 4FDBA 2IT1A 4LIJA 1SMYC 4K0KQ 3PO3G 2R7DA 1XMOQ 2UXCQ 1YHBA 2K5VA 4ME3A 4GNXB 2VS1A 2XTIA 4O0AA 3A7AB 4GKJL 1XPOA 2BA0A 5IYDH 2AHOB 3NBHB 1LM0A 2KENA 4IPCA 3PIOA 1XMOL 1ONLA 2CW0C 4A3MG 5KNCA 1V8QA 3HOWH 1Q1BA 2JA7G 2HH2A 1PH3A 4C3IH 1K73C 2QGQA 1IZ6A 4YY3L 4NXMQ 5AJ3Q 1FL0A 1OXXK 2YTVA 1VQGA 4P72A 5BR8Q 1PYBA 2B63H 2V4DA 1Y8OB 3D4RA 1R9TH 4DR6L 1TWHH 1DD2A 1WYDA 4DV7L 1PFSA 1N9WA 3K81C 4P73A 2AKWB 4R4TA 1ZTGA 4NXML 2R93H 1IYVA 4JC0A 1PA6A 5BR8L 3GTPH 4JOIC 2JA6H 3KDFB 1Z6HA 5C44H 4JBKA 5LMNW 2K5NA 4UP9A 3PV0A 3TEHB 4R4IA 2VNUD 1ASYA 2F3IA 4UPAA 3OTOQ 3CRKC 3MEFA 3RN2A 3RLOA 3DM3A 3CXCA 1GVPA 1K8MA 4DK0A 1SR3A 4JI2Q 5LMUQ 3RN5A 2UXDL 3L0OA 3TS0A 4P74A 4HIDA 1WE8A 4MZ9A 1CI3M 3HOVH 2R93G 2F52A 4KHPQ 4DV1Q 2CPQA 5A35A 5JJLA 3GTMH 4UP8A 1VQ4A 4DNIA 5M5WH 2AXYA 4JI4Q 3JC66 3G71A 5C44G 1KHMA 5IWAL 1E1TA 3NELA 4KN4C 1Y1VH 4JI2L 3U4VA 2NVTH 3B6YA 2E74C 4NBQA 4L5TA 3EIVA 4GOPA 1NMFA 2UUBQ 4KHPL 1U0LA 4QY7A 4DV5L 1QVFA 1E2ZA 3FPPA 1VQNA 1NJIC 3W5OA 2K7VA 1GJXA 1X55A 1VQDA 3CCUA 5ELOA 4JCVE 2CTKA 2A19A 3A74A 5KNDA 1HZCA 4DR5Q 4LF6L 1HJPA 2NN6H 1BVSA 1JJ2A 3ULLA 1EYGA 2EQSA 1AH9A 1YBYA 3VKEA 4A3KG 5FLMG 2NZHA 5IP7H 1HNXQ 4B3TQ 1GM5A 3U4ZA 2OCEA 3TZUA 4GOPC 2Z0SA 4YWKA 4PZ7A 5GAEC 2JK8A 3OW2A 4LUVA 3RR5A 4MNOA 3KLWA 4HJ5A 4LFAQ 1KXLA 1NTGA 4JG2A 3CQZH 2A68D 4PG3A 4A3CG 2I5LX 2R7FA 4BXXG 4IOCA 1YIJA 2UUCQ 2RHSB 2MO1A 2Q2IA 1T9HA 3T1HL 4P75A 1DT4A 2E5LQ 1HTPA 1GD7A 2NVQH 4IFDG 2HT1A 4WALA 1JT8A 2PI2E 1SMXA 3F2DA 3CCRA 1LTLA 4LFAL 4HJ7A 1TWCH 1Y1WH 3K7AH 4BBRG 4QMFB 4DK6C 2BH2A 3JAMc 2YV5A 3U50C 4BA1I 1FJGQ 3AYHB 3S16H 2AWOA 3HOUH 2VQEL 1NMGA 4BBSH 4JBMA 3HOYH 3VR4A 2YQRA 1A63A 1VQ7A 3PUYA 1X4NA 1I3QH 2A1AA 3PSIA 4A3GH 2GVAA 2K75A 2A6HD 1CKNB 1EUJA 1HH2P 3GTJH 2JA8H 5IYBH 1Q12A 5IYCG 1FJGL 1QZHA 1O7IA 2AUJD 1A0IA 3FMCA 2VL6A 3OPOA 2PCFB 1TWGH 2QNDA 4LF5Q 3P20A 1Y1WG 2B29A 4LF9L 2RF4A 5JEAG 5FLXc 1CSPA 3ND8A 4JI8L 4DV0L 3ZJYC 5K36G 2QEXA 3CCLA 3Q8DA 4LUOA 4IOAA 1O7LA 4LF7Q 4DV6L 2PI2A 3M4YA 1PH8A 2CWAA 4YCWA 4YHHQ 1WI5A 1Q81C 1YVCA 2JZXA 4LF5L 2A8VA 2CTFA 4DR1Q 3JAMi 1SROA 4GLAC 1EQRA 2WP8J 4IJHA 2PQAB 3PF4A 3GDEA 1HNWL 4JVHA 4A93G 4KHZA 4TKOB 3CC7A 2CTEA 1N34L 2QA4A 4KKUA 3H15A 1VQMA 2KCCA 5M3MH 2L5TA 2H5XA 2KA7A 1YJ9A 3H3VI 1Q8KA 3S2DH 3MXUA 5E7NA 1VQEA 3AFQA 4OO1H 1FYCA 5M5XH 5JJIA 5C0XH 3A5ZB 1YJNA 1L1OA 4UP7A 3CCJA 4DR2L 3ICEA 5IP9H 3HOXH 2KHJA 5C4XH 4DUZL 3ER0A 2ID0A 4QGUA 4DV2Q 2NN6I 3CMEA 4R4QA 2MNAA 1X56A 2HHHL 4X66Q 1CKOA 1VQLA 4WJ3M 1Y69U 1H9RA 2WAQG 1G51A 4LUZA 1FVIA 1UE5A 2VQFQ 3OYYA 2ZJPA 2F1MA 4BY1G 4POFA 1P16A 4A3JG 2WFWA 4JK1C 4B3SL 1YITA 3BDOA 3K8AA 4AIMA 2DGRA 4X66L 2CKZB 1L1OC 1O78A 4R1JA 3WDNA 1PH2A 4GKJQ 5JJKA 2BE5D 5C4XG 2VW9A 1E1OA 2Y0SE 3NE5B 1PH6A 4NB3A 1OXTA 4LW1A 4OWTB 4LFCL 3I4NG 1MJEA 4YY3Q 1UEBA 1KC8C 4QL5A 3I55A 2RHQB 4LFBL 4LF4Q 3U58A 4DR6Q 3E9IA 4JOIA 3LWUA 2UU9Q 4DV7Q 5ELNA 4EQ5A 4JI0L 1Z47A 1QVCA 4LF8Q 3K0XA 1HZ9A 3S1NH 1WCMH 3K7UC 1A8VA 3DXJC 3M85A 1Y14B 3CCVA 3I4MH 1Z7TA 3SE0A 4LF4L 3S2HH 1I94Q 2PPBC 1V1QA 1KL9A 2BH8A 1VS0A 3CF5A 2UU9L 4PV1C 3VDYA 1VQIA 2ZTCA 3J80i 1X3EA 1I6HH 3H0GH 4HJ8A 1Q86C 4LF8L 4OX9L 3F2CA 2XGTA 4A4IA 1QZGA 2ZM6L 3UDXA 1J4WA 1VQOA 5IYDG 1PMRA 3S1MH 1G291 2VZAA 2PQAA 4OWXB 4A3BH 2R92H 1K8AC 1YZ6A 3HOWG 2PQUA 4Y7NH 1I94L 3CMAA 3LNNA 4X62L 2N49A 2UXDQ 3CRLC 4A3EH 4J15A 1LACA 5GROA 1U5KA 2YU9H 3FHWA 2B63G 4LNQA 4XIGS 1W2BA 2PY9A 3ND9A 4DK3C 5GQOA 4H0LC 1PH7A 3I72A 4DNRB 1TUAA 4WJ4A 5IWAQ 4L8JA 4AYBG 3I2ZA 2WB1G 3GD7A 1KRSA 3M7NA 2YTXA 1VF7A 1VDZA 2K32A 3MXNB 4AM3A 1N32L 1N36L 1KIXA 3GTKH 4HR7B 4IO9A 4B3MQ 4RCNA 2JA5H 1JB7A 4IPHA 4OO1I 4DV5Q 1KQSA 2R6GA 2VUMH 2OQKA 2JA6G 1V9PA 1BDOA 1LYLA 4JI5L 3GO5A 1JMCA 1BKBA 5C0XI 1XPUA 4BY7H 1CUKA 3V69A 4BA2I 4LF6Q 5GADC 4DV3L 3G48A 1PVOA 4GN3B 1QVGA 4B3ML 1CFMA 2UUAL 3H3VH 2D2CC 2FXQA 1JJCB 3T51B 4JI1L 3KF6B 3STBD 1HCZA 1PH4A 2A69D 2JEBI 4RMFA 1C7YA 3AEVA 3A8JE 1EFWA 3HOVG 4JI7Q 4LWCA 1M1KC 4HJAA 2PMZE 3UE1A 4AH6A 2JA5G 5HY6A 1WVNA 4MTNA 3UDIA 1SFOH 2OTLA 3PUVA 4GNXA 3UE0A 4R4OA 3S1QH 1ZZIA 3T1HQ 1Y1VG 4GKKL 3M3YH 2VY3A 1TU2B 4KI0A 4JI7L 4QJFA 1HR0W 3UDFA 1IXRA 3EN2A 1DXMA 4YWMA 2JXMB 1HZBA 4DNTB 5LMNQ 2IX0A 5GAGC 3J7A5 3J81j 1J5EL 1IW7C 4G7ZC 2NN6G 2VQEQ 3FKIH 1GUOA 4JI3Q 3IFTA 4DV4L 4GNXC 3W3AA 4JYAQ 2K33A 5IE8A 1BBWA 1Y8NB 4A76A 2E8GA 5IP7G 5LMNL 3CC2A 1XNQL 2PNHA 1YJWA 1VQCA 2E75C 4DR7L 5GAHC 2A6ED 3T53B 2IY5B 2EJFC 4YCVA 2OPVA 3KJOA 2Q2TA 4JI3L 3J81c 3T1YL 2NVXH 4JYAL 3KDFA 2IHEA 3FP9A 1VQFA 4TVAB 4LF9Q 1B8AA 2Y0SG 1X6OA 2JA9A 3PCOB 4JI8Q 3G6EA 1X3GA 4DV0Q 3H94A 5HGQA 1Q82C 4GS3A 3FKIG 1UE7A 1DCZA 2BL5A 4DV6Q 1OTCA 2KHIA 4X6AH 3WWVA 4DKAC 2IHFA 1X3FA 1K9MC 3E9HA 3PO2H 1S3OA 2D0OA 1OXSC 2JJQA 1OXUA 1HNWQ 2ALYB 1N8RC 1B70B 3HOUG 1WFQA 4B3RQ 1PH9A 4BBSG 3HOYG 3J7ZC 1VQHA 1N34Q 2I5HA 5FJ8H 1IBMQ 4LK1C 3U9SA 4A3GG 1ZZKA 1SN8A 3DLLA 1QUQB 3S14H 3HOZH 1MIUA 2JA8G 4NXNL 5IYBG 4X65L 2MO0A 2LXJA 3CP0A 2B8FA 4DR4L 1VF5C 1K0RA 4B3RL 4JBWA 4DR2Q 3J81i 4B8TA 3K80C 4DUZQ 1HNZL 1IBML 4A3FH 3PUXA 2KCMA 2HHHQ 3PO2G 2OPUA 2EDGA 1I5FA 4L5RC 4A3LH 3BZKA 1HR0L 2UXBL 1EC6A 1B7YB 2CQOA 4EX5A 4PMWA 1GUTA 2JQOA 1SE8A 5EAYA 1N33L 1VQ5A 3KJPA 4KLKA 4P71A 4B3SQ 1GUGA 1E3PA 5M3FH 3HOZG 4QQBX 3VR3A 1L2FA 1NY4A 1YHAA 3G4SA 1PHJA 4C2MH 1K1GA 2BE5C 1HZAA 3KF8B 1DGSA 4R4CA 1JJGA 1FR3A 3PO3H 2OQ0A 3PUZA 4PZ8A 1S40A 1NBWA 2GVBA 2R7ZH 1Q46A 3VR6A 2JE6I 5M3MG 2EIFA 4NPSA 4DR3L 1YHQA 4DK1A 1SRUA 1LABA 4KMUC 1TWFH 4OO1G 1PV4A 4LFCQ 2F4VL 2YYZA 3I4LA 1VQJA 4DAYB 4JI6Q 1GO3E 4XTCS 5C0XG 1X9NA 1VQ6A 5IP9G 3HOXG 3CD6A 4LFBQ 4A3MH 3BJUA 2D5DA 4GLVB 3CAMA 3CW2C 1PH1A 3KYHC 2FMRA 2BDOA 3QJYA 2OWOA 4JI0Q 3I73A 3D31A 4JI6L 3U1KA 5DLQE 3M4OH 1UE6A 4YCUA 2R7ZG 3W1BA 2CFMA 4H02A 4YWLA 1CKNA 1VQAA 1FGUA 3PF5A 1IBLL 1ZYRC 1Z9FA 1ZKOA 4A3IH 3NEMA 2QF7A 1NE3A 4JBJA 1KHIA 4OX9Q 4K0KL 3D0FA 1CKMA 2ZM6Q 2ASBA 2NZOA 2UXCL 4C3JH 3CCQA 3HKZE 2K14A 1IYJB 2MQHA 4JV5Q 2I0QA 3M4QA 1Q7YC 2JEAI 3HFZB 4X62Q 1HQMC 1A62A 2AUKA 3I4OA 3EQLC 1Y8PB 1KD1C 1A6XA 2KBNA 2BA1A 3PGZA 4AQYQ 2OTJA 3NENA 2P2RA 1GUSA 1BBUA 1I6VC 1L0WA 1C9OA 1QUQA 2AWNA 5C0XJ 1H95A 4JV5L 3M4PA 2B3GA 3UDGA 4A3IG 5IT9c 1D8LA 4HIOA 1XJVA 1VCIA 1EQQA 5AJ3L 2ZTEA 4DPGA 2ES2A 2ATWA 4X64Q 3M9BA 1WCMG 3BU2A 1VQ9A 1N32Q 2K50A 1N36Q 3OOCA 4RG1A 2DNEA 4HJ9A 1K8GA 3RNUA 4AQYL 1CTMA 3I4MG 2DNCA 4JVYA 4JI5Q 3CCEA 1RL2A 4Y52H 4L5SA 2CWPA 3TREA 2O5JC 4WANA 3RLFA 4IQZA 2NVYH 2ZT9C 3H0GG 4DV3Q 3TQYA 4X64L 1XPRA 3CPWA 1TWAH 3PUWA 3STBC 1IBKQ 2UUAQ 3GTQH 2A69C 4A3BG 2R92G 4JI1Q 1E2VA 5BN5A 1PH5A 5BN3A 1M90C 2WAQE 1TXYA 4A3EG 1XTDA 1VQKA 2HH3A 3A5UA 3OTOL 1VIGA 3VA7A 1SLJA 1CSQA 2N78A 1W3SA 3HKSA 1KRTA 1IBKL 4A3KH 5FLMH 1E22A 1B9NA 3I56A 3LGJA 3S17H 1C0AA 5LMUL 3VR2A 4L5QA 4GN5A 1JE5A 3L2PA 5IY0A 2D62A 4GKKQ 2K52A 2B8GA 4DV1L 2YTYA 1GHJA 2EXDA 3ERSX 4JI4L 2A68C 3CPFA 1AE2A 1TKWB 1MJCA 2VUMG 4A3CH 1J5KA 4BXXH 2KCTA 4G7OC 1S72A 2ZJRA 1YNJC 4BY7G 2D0PA 4C3HH 4IFDH 1J5EQ 3SGIA 1H9SB 2UUBL 1IL2A 1EIFA 4IPDA 4DUYQ 4TQUS 5KNBA 1L1OB 4DV4Q 5BN4A 4GN4B 3AQQA 3A7LA 4BBRH 2EJMA 2CTMA 2A6EC 5M5YH 1XNQQ 4IJLA 2V1CC 1Q90A 4DR5L 3I7FA 3TRZA 3S24A 4KKSA 4DR7Q 2C35B 4DUYL 2LXKA 3N6RA 3T1YQ 2A6HC 1PYSB 1UWVA 3GQBA 4KKTA 1GKHA 1HNXL 4B3TL 1QJOA 4UY8C 3KFUA 5IYCH 3ULPA 3GTGH 3CCMA 3TS2A 2EJGC 4HIKA 1H9MA 1H9JA 1K8OA 2E2IH 5JEAH 1E24A 4GZYC 1EIYB 2UUCL 3A8KE 2HQLA 1YNXA 1LUZA 1VQPA 2E5LL 1X54A 1J6QA 5K36H 1T5EA 3VR5A 4GLXA 2E76C 1IW7D 4OXPA 1G6PA 2Q2UA 2PNRC 1UE1A 1K83H 3IRBA 1HPCA 3A8IE 4AYBE 2DN8A 2WB1E 2EVBA 4A75A 2IX1A 1I50H 4G7HC 1X65A 1XNRQ 2DUDA 3SDZA 4A93H 3QIAA 4NXNQ 4X65Q 2ANNA 2K4KA 2ZTDA 2RCNA 4DR4Q 1ZZJA 4H44C 2L15A 1D7QA 4A3DH 3W1GA 1HNZQ 1IYUA 1VQBA 3HKZG 1XNRL 1E2WA 5H1SE 3GTLH 1OXVA 3E0EA 2GN5A 3S15H 1HR0Q 2UXBQ 3RZOH 1MKHA 1Q1EA 2CCZA 3GTOH 4IFDJ 4OGQC 3F2BA 4PZ6A 4POGA 1X4MA 1N33Q 3KF6A 2HIVA 1XMQQ 1RIPA 4OWWB 1EWIA 3KLRA 1K3RA 3L7ZC 3AFPA
chains in the Genus database with same CATH superfamily
4KK7A 1LTAD 1ENAA 1JQYD 2NVQB 2D9IA 2Q8RE 1D5MC 4LF7L 2MFIA 4OONA 3S1RH 3KDGA 3FKIB 1GHKA 5ELBA 5A2QW 3H91A 2DGYA 2MJHA 4BY1H 2Z6KA 2AQ3B 4YHHL 1DTJA 4A3DG 3HGBA 4A3JH 4APVA 4DAMA 5FJ8G 2O5IC 1GUNA 1KAWA 5C3EH 1SYBA 4DR1L 1MSGA 2N3SA 1AP0A 3BG3A 3QOJA 1XMQL 4DR3Q 1TWCB 1CM9A 3BZCA 1YNNC 2XIWA 1EWHA 1H9SA 3Q23A 1J5EH 4H13C 1P8LA 3MFYA 3OW7A 4CKEA 4IPGA 3RZDH 2CTJA 3RLNA 1PYWD 3OMGA 3S16B 3A0JA 4QIWE 2AMCB 2F4VQ 2JVZA 4DUYH 3BYYB 4LJZC 1QNUA 3HOUB 2SDFA 1X32A 4BBSB 3D4DA 4DV4H 3NWSA 3HOYB 2QKIC 3I8ZA 4IFDI 4CDFC 1PTOC 3T56B 2F3VA 2B2UC 4CJ2C 1EOVA 1C4QA 2RDFA 1WOCA 4A3FG 2MP1A 1I3QB 4IALA 2E2HH 2B39A 4A3GB 4O2DA 5EBCA 2LSSA 1YI2A 1V9NA 1O7ZA 2I07B 3EBEA 3F1ZA 4UHVA 4I7ZC 3P75A 3TP8A 3ULJA 4KN7C 4DR7H 3I4NH 2JA8B 5JEAJ 2Q8IB 1OO9B 3F8TA 3IKJA 2J0TD 1VIHA 2Z6KC 5J3BA 2ANRA 4RGMA 4A3LG 5ELEA 3QG1A 2ZJQA 1VQ8A 2E3UA 3L9AX 2LMCB 3PIPA 2A5HA 3KOJA 2CTLA 2I5MX 4GOPB 3T1YH 1PQXA 2N8NA 3JAMW 2Q2HA 3CC4A 1BR9A 4ALPA 5C3EG 4DV2L 4HIMA 2K5HA 1E7ZA 1EY5A 1YEZA 1D2BA 1AE3A 5EQ0A 1LTRD 1IBLQ 1I4RA 2EY5A 5M3FG 3HZXA 2JA7H 3AB9A 1TY2A 2HIXA 1CZWA 5FKAC 1WJJA 5C5MA 3RUZA 3SK5A 1ASZA 3V96A 1V43A 3TP5A 1CA6A 3PO2B 2KQ3A 1I4PA 3J80c 2EY6A 1GXDC 2QDBA 3CCSA 1H9KA 1B9MA 3AEVB 4KJNA 3GKUA 2NTSA 2F0WA 4K2KA 2E2JH 5C4JH 1AN7A 2VQFL 4FDBA 2IT1A 4LIJA 1SMYC 4K0KQ 3OMCA 3PO3G 1I4HA 4CKCA 2R7DA 1XMOQ 5KEEA 2UXCQ 3QO2A 1YHBA 5D65A 1FNWA 5T1GA 1QOHA 2G8YA 2K5VA 3K59A 4ME3A 2GA4B 4GNXB 2VS1A 2XTIA 3J7AK 4O0AA 1SNOA 2XWJB 3A7AB 4QCLA 4K6LA 1WTJA 3W2DA 4GKJL 2QCPX 3KBXA 1XPOA 4RHRA 5ELDA 4N8X1 2KOLA 1SYGA 5CMDA 5FLXW 2BA0A 5DM63 2B2WA 5IYDH 2AHOB 3NBHB 1LM0A 1SYDA 2O2LD 5CBAE 2KENA 1BBXC 2K05A 4IPCA 3PIOA 4DXGA 1XMOL 2Z1CA 1ONLA 5M9OA 1EIGA 2CW0C 2EYMA 4A3MG 5KNCA 1V8QA 4XT3B 1XNRH 4NZTM 3K57A 4M1UB 5M3MB 3HOWH 1Q1BA 2JA7G 2HH2A 1PH3A 3OWEB 4C3IH 3MXGA 1K73C 4NXNH 3ERQA 2QGQA 4X65H 1XX8A 1IZ6A 3DEPA 3S2DB 4YY3L 4B8CD 4NXMQ 2HCCA 5AFWA 1UEAB 4DR4H 3SK6A 4OIKA 5AJ3Q 1FL0A 1U4LA 1OXXK 2F3WA 2NWGA 2YTVA 1BCPD 5M5XB 1VQGA 4P72A 5BR8Q 1PYBA 2I46A 2B63H 3G6JB 3HOXB 4HCEA 2V4DA 1Y8OB 3D4RA 4IUUA 1HNZH 3PIP3 1R9TH 4DR6L 1TWHH 4I65A 2PZTA 2F0DA 1DD2A 3EVQA 1IKLA 5FOBB 1WYDA 4DV7L 1PFSA 1A3VA 1N9WA 3K81C 3OSOA 4P73A 3H3VC 4J6HA 2AKWB 4R4TA 1ZTGA 5FO9B 2QDLA 4NXML 1HR0H 2UXBH 2R93H 5ELCA 2NUCA 1IYVA 4JC0A 1PA6A 2X6GA 5BR8L 3GTPH 3IFDA 4JOIC 2JA6H 1N33H 1CK1A 3C1FA 2R7ZB 1XMQH 1AW7A 4C3JG 3KDFB 1Z6HA 5C44H 2F0HA 4JBKA 1DJRD 5LMNW 1BO0A 2K5NA 5G3LF 4UP9A 3EROA 1F2LA 3PV0A 4R4IA 3TEHB 2K1HA 2VNUD 4C1NK 1WTHA 2HUGA 4RKLA 1LTGD 2BDNA 1ASYA 2F3IA 5D14A 3MVVA 3IAYA 3E3XA 4UPAA 3OTOQ 3CRKC 3MEFA 5DEHA 5IGCA 4ZCKA 5JPNC 2FPHX 2CQAA 3RN2A 3RLOA 3DM3A 3D6WA 3CXCA 2KEEA 1GVPA 2RDHA 4DR3H 1FGBD 1K8MA 4DK0A 4WRDA 3WOEA 1SR3A 4JI2Q 5LMUQ 3RN5A 2UXDL 1T5XD 3L0OA 4FF1A 3TS0A 4P74A 4HIDA 1WE8A 3T16A 4MZ9A 2F4VH 1CI3M 3HOVH 2IX3A 2R93G 2F52A 4KHPQ 4DV1Q 4LMQD 2CPQA 5A35A 5JJLA 1HFNA 2DJGC 3GTMH 4UP8A 3VYSA 4DNIA 1B3AA 5M5WH 1VQ4A 2CH4A 4FO2A 2AXYA 2MHVA 4JI4Q 2X06A 3JC66 3G71A 1F77A 2F0EA 5C44G 4CDDC 3NWTA 1KHMA 5IWAL 1E1TA 2F0KA 3NELA 3KUPA 2IL8A 3FEWX 4ZUJA 4KN4C 1Y1VH 4JI2L 3U4VA 4RGOS 2NVTH 4A3IB 3B6YA 4DAYA 2E74C 4NBQA 4BS9A 1TVXA 4L5TA 3EIVA 3NXWA 4H7BA 4GOPA 2MGSA 1NMFA 4FYDA 2UUBQ 3WOFA 4KHPL 1U0LA 3NTIA 3P7JA 4QY7A 1B3QA 3HG9A 1A3UA 3S1NB 1WCMB 4DV5L 4EQOA 1QVFA 1E2ZA 1QCBD 5CV6A 3FPPA 1VQNA 1NJIC 3W5OA 1EY8A 2K7VA 1GJXA 1X55A 5C6AA 1VQDA 3I4MB 1HRJA 1IBLH 1TS3A 3CCUA 1U4RA 2Y3MA 5ELOA 1S5BD 1PLFA 4JCVE 2CTKA 1SXTA 4CJ0B 5I4DA 3S2HB 2A19A 3A74A 5KNDA 1HZCA 4DR5Q 4LF6L 2L55A 1WVLA 1HJPA 2NN6H 2RA4A 3KLSX 1I6HB 2DJFC 1BVSA 4DN4M 3H0GB 2A74C 1JJ2A 4K0KH 1EFID 3ULLA 1JORA 1EYGA 4EQNA 1XMOH 2EQSA 1AZPA 2UXCH 5TSSA 1AH9A 1YBYA 3VKEA 4A3KG 5FLMG 2ZQEA 2NZHA 5IP7H 1XRHA 1HNXQ 4B3TQ 1GM5A 3S1MB 2K6AA 1M8AA 3D3RA 3U4ZA 4A3BB 2OCEA 2R92B 3TZUA 2RBMA 4GOPC 3GR5A 4Y7NB 2Z0SA 4KD3A 4YWKA 4Q5VA 4PZ7A 5GAEC 2JK8A 4A3EB 3I3CA 3Q24A 3OW2A 1WTQA 4LUVA 4ILWA 5E4XA 3RR5A 4MNOA 3KLWA 4HJ5A 2F0OA 5EGTA 4LFAQ 1KXLA 1NTGA 1LT3D 1SNDA 1S03G 1BCPB 3EFXD 2YU9B 4JG2A 1EY6A 4ZYSA 3CQZH 2A68D 4PG3A 4A3CG 2I5LX 1DZ1A 2R7FA 2TSSA 4BXXG 4IOCA 1YIJA 2UUCQ 3KLSA 5LL6b 2RHSB 2Q2IA 2MO1A 1T9HA 3T1HL 1EQTA 1ESFA 4P75A 1DT4A 2F03A 2E5LQ 1GD7A 1HTPA 3U9OA 4G57A 2NVQH 2NVYB 4NXMH 2HT1A 4IFDG 4WALA 1W6JA 1JT8A 2PI2E 1VBIA 5BR8H 1SMXA 3F2DA 3BVMA 3CCRA 1WD1A 4XT1B 1LTLA 1EYAA 4F7XA 3GTKB 4LFAL 2IWHA 1JCKB 4HJ7A 1TWCH 1Y1WH 2VUMB 2NBFA 3K7AH 3V05A 2JP1A 1PRTD 4BBRG 4QMFB 4DK6C 2BH2A 2OEOA 3JAMc 2P5ZX 2YV5A 3U50C 1KTKA 4BA1I 2CVRA 3BVGA 1FJGQ 3AYHB 4NZRM 3S16H 2XRQD 4BY7B 4XYOA 1TY0A 2AWOA 3EA6A 3HOUH 2IW3A 2VQEL 1NMGA 4OCHA 4BBSH 1RTOA 4JBMA 4PMBA 3HOYH 3VR4A 4ZK9B 2YQRA 1A63A 3GP7A 4OELB 2E2DC 1VQ7A 3PUYA 1X4NA 2WKCA 1I3QH 5C4ZA 2A1AA 3PSIA 4A3GH 2GVAA 2K75A 4O1NA 4DGZA 2A6HD 1CKNB 1EUJA 1HH2P 3GTJH 4ABNA 2JA8H 5IYBH 1Q12A 1STGA 1SYFA 5IYCG 1S5ED 2F0MA 3MC0B 1FJGL 1QZHA 4RFBA 1O7IA 2AUJD 3FVQA 1A0IA 4U68A 3FMCA 1HA6A 3OTOH 2VL6A 3OPOA 2PCFB 1TWGH 4ULLA 1LV9A 1B1ZA 2QNDA 4LF5Q 3P20A 3DM1A 2ICIA 5LHY1 3J80L 1IL8A 2B29A 1Y1WG 4LF9L 1IKMA 4IUTA 5IWAH 2RF4A 4QUFA 4PNYA 4X3TA 5JEAG 1JC7A 5FLXc 1CSPA 4JI2H 5LMUH 5L37A 3ND8A 4JI8L 3GABA 4DV0L 3NUCA 4V190 2WACA 3S1QB 4C3HB 3ZJYC 5K36G 4KY7A 2QEXA 3CCLA 4CJ1B 1EIHA 3Q8DA 4KHPH 2EZVA 4DV1H 3DMUA 4LUOA 4IOAA 1C48A 3M3YB 2R3ZA 5T1IA 1O7LA 4LF7Q 4DV6L 2PI2A 3K0YA 2A73B 3M4YA 1CHQD 1PH8A 4JI4H 2CWAA 2LTLA 4YCWA 2X69A 4YHHQ 1WI5A 4KD4A 1Q81C 2IPKD 4MHEA 2F0IA 1YVCA 1I4XA 2JZXA 4LF5L 2A8VA 2CTFA 4DR1Q 3A54A 3JAMi 1SROA 4GLAC 1EQRA 2WP8J 2QW7A 2N55A 4OEMB 2B2VC 4IJHA 2PQAB 1FNVA 5EPJA 3PF4A 3GDEA 1HNWL 4MIUA 4JVHA 3Q22A 4A93G 4KHZA 2UUBH 4TKOB 4FJSA 3CC7A 1XYIA 2L11A 1EZ6A 5I6WA 2CTEA 1JR0D 1FD7D 1U4MA 2QA4A 1N34L 4KKUA 2NTTA 3H15A 2F4IA 1VQMA 2KCCA 4G08A 5M3MH 1EU4A 1KDCA 2L5TA 2H5XA 3GV3A 4IUPA 2KA7A 2R61A 3MFGA 3NTHA 3K6OA 1YJ9A 3H3VI 1Q8KA 3S2DH 3MXUA 5E7NA 4DR5H 1PFNA 1VQEA 3AFQA 4OO1H 3LX0A 1FYCA 3E6ZX 3CHBD 5M5XH 3R2IA 5JJIA 5C0XH 3A5ZB 3TP7A 2EYJA 1YJNA 1L1OA 4UP7A 3CCJA 4DR2L 1RTNA 3ICEA 5IP9H 3HOXH 1F2MA 2ZXOA 2KHJA 1DOMA 5C4XH 3ER0A 4DUZL 1AFPA 4WJWA 2ID0A 2E2IB 4HTHA 4QGUA 4DV2Q 1G2SA 2NN6I 1HNXH 3VYRA 4B3TH 2NVXB 3CMEA 4R4QA 2MNAA 1X56A 3DWQA 2K1BA 2HHHL 5KIXA 2KECA 4S3SA 4X66Q 1CKOA 3PMFA 3HKZB 1VQLA 1RDPD 4WJ3M 1TS4A 1Y69U 4UDUC 1H9RA 4IUQA 1NR2A 4CDEC 2WAQG 1G51A 4LUZA 1HUNA 1FVIA 1UE5A 2VQFQ 4LFAH 1V1PB 3OYYA 5HGTA 5JOBA 2F1MA 2ZJPA 1AN8A 4BY1G 1EWCA 4POFA 1P16A 4A3JG 2A1SA 2WFWA 1SE2A 5C3WA 2VB2X 4JK1C 1KNEA 4B3SL 1YITA 2D9UA 5IIFA 2UUCH 3BDOA 5COYA 3MTSA 2L0CA 3K8AA 2E5LH 3SHLA 4AIMA 4ID6A 2DGRA 1PRTB 4X66L 2CKZB 1L1OC 1YNND 1I4GA 1O78A 4R1JA 5D3DA 3WDNA 1PH2A 1NXUA 3OIQA 4RA8A 3CU7A 4GKJQ 1AEXA 4B08A 5JJKA 2BE5D 4HMJA 3HS0C 5C4XG 4DU9A 2VW9A 1E1OA 2Y0SE 1SE4A 2FFKB 4XQNA 3NE5B 1PH6A 4NB3A 1OXTA 1EOTA 1UAPA 1PTOF 1FNUA 1FJGH 4LW1A 5A2QE 3I90A 1DOLA 4OWTB 3GTLB 1D5XC 1BCPC 5KYIA 3S14B 4LFCL 2VB3X 3HOZB 3I4NG 1ZXTA 2FMMA 1MJEA 4YY3Q 2Z6BA 5DNFA 1UEBA 1KC8C 1KLGD 4FXDA 2PT7G 5EKKA 5I9OA 3RZOB 3MHBA 4QL5A 3I55A 3KDKA 1PFBA 3C46A 1BOSA 3F2UA 2RHQB 1PZID 2EY2A 4ODGA 4LFBL 1D1KA 4FXKC 4RHSA 4LF4Q 2Z4IA 3U58A 4DR6Q 4A3FB 4DV0H 1EY0A 2F0JA 3E9IA 4JOIA 3LWUA 2UU9Q 4XYQA 3P1HA 4CGYB 1PTOH 4DV7Q 5ELNA 4EQ5A 4JI0L 1Z47A 1SEIA 1QVCA 1W6KA 4TSSA 4LF8Q 1U9RA 3K0XA 1B2TA 1HZ9A 4PQXA 3S1NH 1WCMH 4FJUA 1B44D 3K7UC 1A8VA 3DXJC 1V1OA 3M85A 4LF5H 1Y14B 4F87A 3CCVA 1SJED 5KGUA 3I4MH 1Z7TA 2NYZD 5C3EB 3SE0A 4DFAA 4LF4L 3S2HH 1I94Q 2PPBC 2F0PA 1V1QA 1KL9A 2BH8A 5M3FB 4E9JA 1VS0A 4DXFA 3CF5A 2UU9L 1KAAA 4PV1C 1ZYRD 3JAME 3VDYA 1VQIA 2ZTCA 3J80i 1X3EA 1I6HH 4M8AA 1FKAH 3H0GH 4HJ8A 4C2MB 1Q86C 4LF7H 4LF8L 1N34H 1NSNS 3NCVA 4OX9L 3TDQA 1F2YA 3F2CA 5A2QL 2DY8A 4YHHH 2XGTA 4A4IA 1QZGA 2ZM6L 4ZLTF 2HDMA 3UDXA 1VQOA 1J4WA 5IYDG 1PMRA 1PXUA 1WTWA 3PO3B 1F9RA 4F8MA 2Z4HA 3S1MH 1G291 4DR1H 2VZAA 2PQAA 4OWXB 1TS2A 4A3BH 2R92H 2PMZB 1K8AC 2OF1A 1YZ6A 1Q8IA 3HOWG 2PQUA 4XQQA 4Y7NH 1I94L 3C1EA 3CMAA 3LNNA 3ZYYX 4X62L 5E3FA 2N49A 5G3LD 1D1IA 2UXDQ 4C3IG 3CRLC 4A3EH 3BDLA 4J15A 5DT9A 4HSVA 1TWFB 4DR2H 1LACA 5GROA 4CDCC 1LT6D 1ICFB 1U5KA 2K04A 2YU9H 2F0FA 3FHWA 2B63G 3SEBA 4LNQA 4XIGS 1TIID 1W2BA 2QILA 2PY9A 3ND9A 4DK3C 5GQOA 4H0LC 1PH7A 3I72A 4J8QA 4DNRB 2HHHH 2H1EA 1TUAA 2F0NA 4WJ4A 4A3MB 1KLUD 2PZWA 5IWAQ 3J7AV 1V8CA 2QEJC 4L8JA 4OL7A 4AYBG 3I2ZA 5FLXE 1ODHA 2JYOA 2WB1G 3GD7A 3PIO3 1KRSA 4R9WA 1NUCA 3VYTA 3QR8A 3M7NA 2YTXA 4B9XA 5FK9C 1VF7A 1VDZA 3UOEA 2K32A 3MXNB 4AM3A 3VYUA 1N32L 1N36L 1KIXA 3GTKH 4HR7B 4IO9A 4B3MQ 4RCNA 2K5QA 4RGTA 3JAML 1JB7A 2JA5H 4IPHA 4OO1I 4DV5Q 1KQSA 2R6GA 3M4OB 1F9PA 2OQKA 2VUMH 4K14A 4DV2H 2JA6G 1V9PA 1BDOA 1LYLA 4JI5L 3GO5A 1JMCA 1BKBA 5C0XI 1DM0B 1MHWC 2WINB 1XPUA 3QOLA 4X66H 1PZKD 4BY7H 1CUKA 3J81L 5CR3A 1WHRA 3V69A 2C5CA 4BA2I 4LF6Q 1Z2IA 1V1PA 5GADC 4DV3L 5D3IB 3G48A 2VQFH 1RF2D 1PVOA 3K5OA 4GN3B 1QVGA 4B3ML 1CFMA 2UUAL 3H3VH 2D2CC 2FXQA 1JJCB 3D6CA 2WKDA 3SB1A 4C3JB 3T51B 4JI1L 3OSSD 3KF6B 3STBD 2L4NA 2ENBA 1HCZA 1PH4A 1JOKA 1PZJD 2K01A 2A69D 2JEBI 4RMFA 1C7YA 3AEVA 3A8JE 5FO8B 3DUZA 1EFWA 4B9WA 3HOVG 4JI7Q 4GKJH 3T4AC 4LWCA 1M1KC 3DWAA 4HJAA 2PMZE 2JN4A 3UE1A 5FLXL 4AH6A 2JA5G 5HY6A 1WVNA 4MTNA 3UDIA 1SFOH 2OTLA 1JOQA 3PUVA 4GNXA 3UE0A 4R4OA 4X3UA 4ZQ3A 3S1QH 1QE6A 2XWBB 4K5WA 3OETA 1ZZIA 4DAPA 5JVG3 3T1HQ 1Y1VG 1E0BA 4GKKL 4YY3H 3M3YH 1L0YB 2VY3A 4QB4A 1QG7A 1TU2B 1SDFA 1DYQA 1S4ZA 1QB5D 4KI0A 4JI7L 2R93B 5ISRA 4RKBA 4QJFA 3NBHA 5CORA 1CQVA 1HR0W 1RODA 2AQ1B 3UDFA 1PRTC 3GTPB 1B4OA 1IXRA 2F0VA 4Q0FA 3EN2A 1STYA 1DXMA 4LF4H 4YWMA 1HZBA 2JXMB 4DR6H 4DNTB 3DEOA 5LMNQ 5C44B 2IX0A 1X3QA 1UG8A 2UU9H 5GAGC 3J7A5 4HCSA 1O7YA 4DV7H 3J81j 1J5EL 1IW7C 4FXGC 4OIJA 1SE3A 4G7ZC 1MI2A 2Z9HA 3TBIB 2SNSA 4LF8H 4OX9H 1J8IA 2NN6G 1YNJD 1F9QA 2VQEQ 1BF4A 3FKIH 1GUOA 3J80E 4JI3Q 5CV4A 2ZXRA 3IFTA 4DV4L 3BZDB 4GNXC 4V0BA 3W3AA 1JWUD 4JYAQ 2K33A 3SK8A 1BBWA 1TWAB 5IE8A 1Y8NB 1WTPA 2RSNA 5IT9W 4A76A 3KBGA 4L6TB 5DAUA 2E8GA 1I94H 5IP7G 5LMNL 1GOZA 3CC2A 1XNQL 2PNHA 1YJWA 4KHVA 3GTQB 3M7GA 3NBIA 1ILQA 4P2CB 1VQCA 2E75C 2PZUA 4DR7L 5GAHC 2A6ED 3H6MA 3T53B 2HQEA 1LLRD 5CV5A 2B2TA 2RCFA 2IY5B 2EJFC 2F0LA 4YCVA 1SYEA 1WTOA 2G5DA 2OPVA 1Q3LA 3KJOA 2Q2TA 4JI3L 4QUCA 3J81c 3T1YL 2EE1A 3D4WA 2NVXH 4JYAL 3KDFA 1SJHD 4HSPA 2IHEA 3FP9A 1VQFA 4XDXA 4TVAB 4LF9Q 1B8AA 2Y0SG 1X6OA 4A3KB 2JA9A 3NPPA 1PDQA 2UXDH 3S17B 3LWEA 1F0XA 3PCOB 4DF7A 5EPLA 4JI8Q 1EYDA 3G6EA 1X3GA 4DV0Q 1MD2D 2XNAC 1SAPA 2AQ2B 3H94A 4R8NA 3SVMA 5HGQA 1Q82C 4GS3A 4EVOA 3FKIG 2B2VA 1UE7A 1DCZA 2BL5A 4IUNA 4DV6Q 5IOCA 5ELFA 1VMPA 1OTCA 2KHIA 4QIWB 1BQQT 4X6AH 3WWVA 1LTID 1G6ZA 4DKAC 2K28A 2IHFA 4N8FA 1DONA 4X3KA 1X3FA 2FJ2A 4KJOA 2HD3A 2B2TC 1K9MC 2VKCA 4RCOA 3E9HA 3PO2H 1S3OA 1NCVA 3MXNA 3QB3A 2D0OA 1OXSC 2JJQA 1KDBA 5LL6S 4DV3H 1OXUA 1STAA 1HNWQ 3N52A 3G7LA 4FF2A 2ALYB 1N8RC 1B70B 3HOUG 1WFQA 4B3RQ 1ENFA 1PH9A 4BBSG 4B3MH 3URYA 3HOYG 4EC5A 3J7ZC 1VQHA 4MTKA 4DV5H 2OXPA 1N34Q 4K2LA 2I5HA 5FJ8H 1IBMQ 4LK1C 5EKIA 4NKLA 3U9SA 4A3GG 1ZZKA 3HEJA 3TN2A 1SN8A 4BBRB 4DA2A 3DLLA 1QUQB 3S14H 3HOZH 1MIUA 5M5YB 2JA8G 2PW7A 4NXNL 5IYBG 3C3LA 4X65L 2LY7A 2MO0A 5C3XA 2XRSD 5I6YA 4LF6H 2LXJA 4RGNA 1JICA 2PYKA 4HEDA 3CP0A 2B8FA 4OD6A 4DR4L 1VF5C 3NK9A 4HN7A 2KVMA 1K0RA 2KHSA 3R93A 1WD0A 4B3RL 4JBWA 2VXWA 3RF2A 2X6LA 4DR2Q 2CWFA 3J81i 2H4OA 2G9HD 4B8TA 5C5LA 3K80C 4DUZQ 5CYUA 1HNZL 1IBML 4A3FH 3MWYW 3PUXA 2XSCA 2KCMA 3HRZC 1RKNA 1S5FD 3ITPA 2HHHQ 3PO2G 4KY6A 1WTRA 2OPUA 2EDGA 2BCOA 1I5FA 4L5RC 1QNKA 4JI7H 2F0UA 1CZGA 1EY9A 4A3LH 3BZKA 1HR0L 2UXBL 1EU3A 4XXEA 2MUYA 3GTGB 1D6EC 1EC6A 2M00A 1B7YB 3K58A 2CQOA 4EX5A 4PMWA 2KCNA 1GUTA 5E1FA 2JQOA 1SE8A 5EAYA 1N33L 1VQ5A 3KJPA 1LT5D 3MXPA 4KLKA 2WV6D 4P71A 1Y1WB 4B3SQ 1GUGA 1E3PA 2WIIB 3K7AB 5M3FH 4IZ8A 2MPMA 3HOZG 4QQBX 3VR3A 3T1HH 1L2FA 1NY4A 1YHAA 3G4SA 3NQIA 1PHJA 4K6DA 3T13A 1I4QA 4C2MH 2EYHA 1K1GA 2BE5C 1HZAA 2PQEA 4ME5A 2CWHA 3MA2B 1EEID 1A2UA 2RKSA 1DGSA 3KF8B 4R4CA 4I7AA 4PDBA 1JJGA 5JVH3 1FR3A 3TP6A 1UNSA 4H8AA 3PO3H 2OQ0A 3PUZA 4PZ8A 5IT9L 1S40A 2B2YA 1NBWA 2GVBA 1K83B 2R7ZH 2L9HA 1Q46A 2JE6I 3VR6A 5LMNH 1XNQH 5M3MG 2EIFA 4NPSA 2PO4A 4DR3L 2F0SA 4PMCA 3X3MA 1YHQA 1EY7A 2CH4W 4DK1A 1SRUA 1I50B 3GTJB 1LABA 4KMUC 1HHVA 1TWFH 4OO1G 3K5MA 1B50A 1PV4A 1ET6A 4LFCQ 2F4VL 2YYZA 3I4LA 4A93B 2TMPA 2VQEH 1VQJA 4DAYB 4JI6Q 2F0QA 1GO3E 1TS5A 2ZXPA 4XTCS 5CC4A 4JI3H 5C0XG 1EL0A 1X9NA 1VQ6A 5IP9G 1TWGB 4JYAH 3HOXG 3CD6A 4MN3A 3VA5A 2J4XA 2M6QA 4LFBQ 4BWGB 3BJUA 4A3MH 4A3DB 4JVZA 2D5DA 4GLVB 4QF4A 1PTOD 3C2PA 2M9VA 3CAMA 3CW2C 4NMZA 3E0JA 3KYHC 1PH1A 5I9PA 1EQVA 1L0XB 2FMRA 1G2TA 1XXGA 2BDOA 3QJYA 2OWOA 4JI0Q 3I73A 3D31A 1X3PA 3RD4A 3BS1A 2B2YC 4JI6L 2NZ1D 5DLQE 1WTXA 3S15B 1ET9A 3U1KA 1K3BC 3NHHA 1UE6A 4YCUA 1A15A 3M4OH 2L12A 2R7ZG 4NW2A 3W1BA 3GTOB 2CFMA 1KDAA 1MSHA 4H02A 4N9TA 4WORA 4LF9H 3NTKA 4YWLA 1CKNA 1JE4A 1FGUA 1LTBD 1SSOA 1VQAA 1ZYRC 3PF5A 1IBLL 1ESRA 1ILPA 4JI8H 1JOOA 1Z9FA 1ZKOA 4A3IH 3OIPA 4JW0A 3NEMA 5DM73 2QF7A 1SEBD 1NE3A 4C56C 4JBJA 1SNCA 1KHIA 4DV6H 3IL8A 1UUPA 3MZ5A 4OX9Q 2WAQB 3D0FA 5EPKA 3BVZA 4K0KL 3S1RB 5J1ZA 1CKMA 4CKBA 4TRDA 4ZUIA 2ZM6Q 2ASBA 5I2XA 4G4KA 4BY1B 2NZOA 2UXCL 4CHTB 1SNPA 2M2LA 4C3JH 3CCQA 4A3JB 3BYTB 2K14A 2KUMA 3HKZE 3V2TA 1X0AA 1IYJB 1SMYD 2MQHA 3SK4A 5IGFA 4JV5Q 1A2TA 2I0QA 2K5DA 3M4QA 1Q7YC 2JEAI 3HFZB 4X62Q 1HQMC 5F2DA 1HNWH 1A62A 4B3RH 2AUKA 3NSWA 3QWNA 3RZDB 1LT4D 3I70A 1KNAA 1BCPF 3I4OA 3EQLC 1Y8PB 4L63B 1KD1C 1A6XA 2KJXA 2PW5A 3ONAB 1IBMH 2KBNA 2BA1A 3PGZA 4AQYQ 2OTJA 3NENA 5C4XB 1GUSA 2P2RA 1BBUA 2K03A 3SXHA 1I6VC 1ICWA 2EOTA 1L0WA 1C9OA 1QUQA 3BDCA 3J81E 4HMIA 1IHZA 2AWNA 5C0XJ 4K5XA 1H95A 4JV5L 3M4PA 2DY7A 2E2HB 2B3GA 3GV6A 3UDGA 4A3IG 5IT9c 3Q6SA 1D8LA 2CW0D 4HIOA 4UAIA 4ZRZA 2K5WA 2B2WC 4ZAIA 1XJVA 3I4NB 1VCIA 1EQQA 5AJ3L 2ZTEA 2XVSA 4DPGA 2ES2A 2ATWA 4X64Q 4FF4A 3M9BA 2RSOA 1WCMG 2LRRA 3BU2A 1VQ9A 1N32Q 2K50A 1N36Q 1EZ8A 3OOCA 4RG1A 2DNEA 4KV6A 4HJ9A 4DUZH 1K8GA 4WFN3 3RNUA 3Q0AA 4AQYL 1CTMA 2G9DA 3I4MG 1J9OA 3K5LA 1S20A 2DNCA 4FP5D 4JVYA 3AMUA 4JI5Q 3TZDA 3CCEA 1RL2A 4Y52H 4EQPA 1X9ZA 3L3OC 4L5SA 2CWPA 2FMCA 2NB0A 3TREA 2O5JC 2CPMA 4WANA 3RLFA 4IQZA 2JA7B 2NVYH 2ZT9C 5CV9A 1EYCA 1STHA 4IURA 4RAUC 1TT2A 3H0GG 1RCVD 4DV3Q 3TQYA 3X3NA 4X64L 1XPRA 3CPWA 1BNZA 1TWAH 5IODA 3PUWA 1ZEQX 4NDXA 5C4JB 2E2JB 3STBC 1IBKQ 2UUAQ 4ZKCB 5JJZA 5E4WC 3E5SA 4B3SH 4R8IA 1G8ZD 1G91A 1SBBB 3GTQH 2A69C 3UI2A 4A3BG 2R92G 3D8GA 3TMEA 4JI1Q 1E2VA 1PFMA 5BN5A 1PH5A 5BN3A 3KF8A 1CA5A 1M90C 2WAQE 5KYLA 1D5ZC 1CQFA 1TXYA 4A3EG 1XTDA 1VQKA 2HH3A 3A5UA 3HP3A 1O80A 1GUWA 3OTOL 2LFNA 1II3A 4E6IA 1VIGA 3VA7A 1SLJA 1CSQA 3AU7A 1CT1D 2N78A 5J39A 4XQJA 1W3SA 2EY1A 2EYLA 3HKSA 3OWFA 1KRTA 1IBKL 4A3KH 5FLMH 5IGBA 1E22A 3J80W 1B9NA 3I56A 3LGJA 2N88A 3S17H 2OT2A 1C0AA 3TSSA 1S5DD 5LMUL 3VR2A 4L5QA 4GN5A 1ENCA 1JE5A 3HOWB 2EYPA 3L2PA 5IY0A 5EBDA 2RQXA 1QILA 2Z8LA 1PTOB 4LFCH 2D62A 4C3IB 4GKKQ 1LTSD 4K5VA 4JI6H 1SYCA 2K52A 5CV8A 3K5NA 2B8GA 4DV1L 2YTYA 1GHJA 2F0TA 1EEFD 1LO5D 2EXDA 5LL6X 2LKVA 3ERSX 4FVMA 2A68C 4JI4L 4KY5A 1B53A 1AE2A 3CPFA 3MEHA 1STBA 2Q8TA 3R8BA 4LFBH 4J1MA 1TKWB 2B63B 4HAEA 1MJCA 2VUMG 4A3CH 3O13A 2L1BA 2F0GA 1J5KA 5K5PA 4BXXH 2KCTA 1NNXA 4G7OC 4FNFA 1R9TB 1TWHB 1S72A 4C1NI 3FDTA 2ZJRA 3FAUA 1YNJC 1HXYD 1XWEA 4BY7G 4F88A 2D0PA 4ZKBB 4C3HH 5I2YA 4AYBB 1J5EQ 4IFDH 4JI0H 1VMCA 2WB1B 3SGIA 5CGKA 4O42A 2SNMA 1H9SB 2UUBL 5FO7B 4U673 1IL2A 1EIFA 4IPDA 1CHPD 4DUYQ 3MAQA 4TQUS 5KNBA 2IJ0A 4OHJA 1L1OB 1K28A 4DV4Q 1BUVT 3J7YW 1STNA 1EY4A 5BN4A 4GN4B 3A56A 1A3TA 2EYFA 4X3SA 3AQQA 2JA6B 5J22A 1F2ZA 3A7LA 4BBRH 2EJMA 2CTMA 2A6EC 5M5YH 2RVLA 1SNQA 2MJ8A 1XNQQ 4IJLA 2ICEC 2V1CC 1Q90A 4DR5L 3I7FA 1C8CA 3TRZA 3S24A 4KKSA 2SEBD 4DR7Q 2O4CA 1WTVA 1DOKA 4N9PA 2C35B 3NP8A 4DUYL 4K8IA 2LXKA 2JSOA 2ZM6H 1RD9D 2HDLA 3N6RA 3T1YQ 4EGVA 2LTMA 1UWVA 1PYSB 2A6HC 3GQBA 4KKTA 4JV5H 2RDGA 1GKHA 1HNXL 4NP5A 5CV7A 4B3TL 1QJOA 4Z9CB 4UY8C 4X62H 3KFUA 5IYCH 4C3HG 2LS01 3ULPA 5JAVA 5EKLA 2FFMA 1LTTD 3GTGH 5KRUA 3HOVB 3CCMA 2C9OA 3TS2A 2EJGC 4HIKA 1H9MA 3DHQA 1H9JA 4YIJA 1K8OA 4AQYH 1HFGA 4FF3A 2JA5B 1F9SA 3GTMB 1QWYA 2E2IH 5M5WB 1R4PB 5JEAH 3FRPB 1MSZA 1E24A 1PRTF 4GZYC 1RJTA 1EIYB 1R4QB 3I0PA 2UUCL 3A8KE 2HQLA 1YNXA 1LUZA 1VQPA 2E5LL 1X54A 1J6QA 4CBVA 2FHTA 3DWPA 2J7ZA 3S9WA 1T5EA 5K36H 3VR5A 1Y1VB 5NUCA 2NVTB 4GLXA 1ML0D 5IGDA 2E76C 1KABA 4X64H 1IW7D 4OXPA 1MGSA 1MBYA 3KK7A 1G6PA 1N32H 2Q2UA 1N36H 2PNRC 1UE1A 1RHPA 5EJWA 1K83H 3R2TA 1HQRD 3IRBA 1HPCA 1XTCD 3A8IE 5CBEE 4AYBE 2SOBA 4JI5H 2DN8A 2WB1E 2EVBA 3OHXC 4A75A 1HA5A 1I50H 2IX1A 4G7HC 1JWMD 1X65A 1XNRQ 2DUDA 4K8JA 2HCIA 3SDZA 3PQIA 3CKIB 4QMGA 4DAVA 4A93H 3QIAA 4NXNQ 4X65Q 2ANNA 3R3OA 3NQTA 1BXTA 4IUVA 3J7AF 1M4VA 2K4KA 2ZTDA 2RCNA 4DR4Q 3A55A 1I6UA 1ZZJA 2L15A 4H44C 1IBKH 3EJIA 1D7QA 2UUAH 5C4HA 3EZJA 4A3DH 1NAPA 2EPBA 1HTLD 1SFOB 3SR1A 3W1GA 2FINB 1HNZQ 5HURA 1IYUA 3RMHA 4JI1H 1VQBA 3H09A 2XN9C 2CHBD 2M8WA 3HKZG 1XNRL 1E2WA 5H1SE 3GTLH 1K0SA 1OXVA 3E0EA 5IT9E 3QD7X 2GN5A 1JWSD 1NR4A 1TR5A 4RWSC 1S5CD 3S15H 5IGEA 2KEDA 3I91A 4IN3A 1HR0Q 2UXBQ 3RZOH 4JPBW 1MKHA 1Q1EA 2CCZA 3J81W 3GTOH 4IFDJ 2BOSA 2EYOA 1TQOA 2LF0A 4OGQC 3F2BA 1HUMA 1STEA 4PZ6A 1U4PA 4POGA 1X4MA 1SNMA 1N33Q 3KF6A 2EXZA 2O4XA 1JB3A 2HIVA 1XMQQ 3CQZB 1RIPA 5IGGA 4OWWB 1EWIA 2B2UA 2Y0SB 3KLRA 4LAAA 5JPMC 1K3RA 4KTAA 1AZQA 4RH6A 4GKKH 3L7ZC 3AFPA 3FPUB
chains in the Genus database with same CATH topology
4KK7A 1LTAD 1ENAA 1JQYD 2NVQB 2Q8RE 1D5MC 4LF7L 2MFIA 4OONA 3S1RH 3FKIB 1GHKA 5ELBA 3H91A 2DGYA 2MJHA 4BY1H 2Z6KA 2AQ3B 4YHHL 1DTJA 4A3DG 3HGBA 4A3JH 4APVA 4DAMA 2O5IC 5FJ8G 1GUNA 1KAWA 5C3EH 1SYBA 4DR1L 1MSGA 1AP0A 2N3SA 3BG3A 3QOJA 1XMQL 4DR3Q 1TWCB 1CM9A 3BZCA 1YNNC 2XIWA 1EWHA 1H9SA 3Q23A 4H13C 3OW7A 3MFYA 1P8LA 4CKEA 4IPGA 3RZDH 2CTJA 3RLNA 1PYWD 3OMGA 3S16B 3A0JA 4QIWE 2AMCB 2F4VQ 2JVZA 3BYYB 4LJZC 1QNUA 3HOUB 2SDFA 1X32A 4BBSB 3D4DA 3NWSA 3HOYB 2QKIC 3I8ZA 4IFDI 1PTOC 3T56B 2F3VA 2B2UC 4CJ2C 1EOVA 1C4QA 2RDFA 1WOCA 4A3FG 2MP1A 1I3QB 4IALA 2E2HH 2B39A 4A3GB 4O2DA 5EBCA 2LSSA 1YI2A 1O7ZA 2I07B 3EBEA 3F1ZA 4I7ZC 3P75A 3TP8A 3ULJA 4KN7C 3I4NH 2JA8B 5JEAJ 2Q8IB 1OO9B 3F8TA 3IKJA 2J0TD 1VIHA 2Z6KC 5J3BA 2ANRA 4RGMA 4A3LG 5ELEA 3QG1A 2ZJQA 1VQ8A 2E3UA 3L9AX 2LMCB 3PIPA 2A5HA 3KOJA 2CTLA 2I5MX 4GOPB 2N8NA 2Q2HA 3CC4A 1BR9A 4ALPA 5C3EG 4DV2L 4HIMA 2K5HA 1E7ZA 1EY5A 1D2BA 1YEZA 1AE3A 5EQ0A 1LTRD 1IBLQ 1I4RA 2EY5A 5M3FG 3HZXA 2JA7H 3AB9A 1TY2A 3SK5A 1CZWA 5FKAC 5C5MA 1WJJA 3RUZA 2HIXA 1ASZA 3V96A 1V43A 3TP5A 1CA6A 3PO2B 2KQ3A 1I4PA 3J80c 2EY6A 1GXDC 2QDBA 3CCSA 1H9KA 1B9MA 3AEVB 4KJNA 2NTSA 2F0WA 4K2KA 2E2JH 5C4JH 2VQFL 4FDBA 2IT1A 4LIJA 1SMYC 4K0KQ 3OMCA 3PO3G 1I4HA 4CKCA 2R7DA 1XMOQ 5KEEA 2UXCQ 3QO2A 5D65A 5T1GA 1FNWA 1YHBA 1QOHA 2K5VA 3K59A 4ME3A 2GA4B 4GNXB 2VS1A 2XTIA 4O0AA 1SNOA 2XWJB 3A7AB 4QCLA 4K6LA 3W2DA 4GKJL 2QCPX 3KBXA 1XPOA 4RHRA 5ELDA 2KOLA 1SYGA 5CMDA 2BA0A 5DM63 2B2WA 5IYDH 2AHOB 3NBHB 2O2LD 1SYDA 5CBAE 1LM0A 2KENA 1BBXC 2K05A 4IPCA 3PIOA 4DXGA 1XMOL 2Z1CA 1ONLA 5M9OA 1EIGA 2CW0C 2EYMA 4A3MG 5KNCA 1V8QA 4XT3B 3K57A 4M1UB 5M3MB 3HOWH 1Q1BA 2JA7G 2HH2A 1PH3A 3OWEB 4C3IH 3MXGA 1K73C 3ERQA 2QGQA 1XX8A 1IZ6A 3DEPA 3S2DB 4YY3L 4NXMQ 2HCCA 5AFWA 1UEAB 3SK6A 4OIKA 5AJ3Q 1FL0A 1U4LA 1OXXK 2F3WA 2NWGA 2YTVA 1BCPD 5M5XB 1VQGA 4P72A 5BR8Q 1PYBA 2I46A 2B63H 3G6JB 3HOXB 4HCEA 2V4DA 1Y8OB 3D4RA 4IUUA 3PIP3 1R9TH 4DR6L 1TWHH 4I65A 2PZTA 2F0DA 1DD2A 3EVQA 1IKLA 5FOBB 1WYDA 4DV7L 1PFSA 1A3VA 1N9WA 3K81C 3OSOA 4P73A 3H3VC 4J6HA 2AKWB 4R4TA 1ZTGA 5FO9B 4NXML 2R93H 5ELCA 2NUCA 1IYVA 4JC0A 1PA6A 2X6GA 5BR8L 3GTPH 3IFDA 4JOIC 2JA6H 1CK1A 3C1FA 2R7ZB 1AW7A 4C3JG 3KDFB 1Z6HA 5C44H 2F0HA 4JBKA 1DJRD 5LMNW 1BO0A 2K5NA 5G3LF 4UP9A 3EROA 1F2LA 3PV0A 4R4IA 3TEHB 2VNUD 4C1NK 2HUGA 4RKLA 1LTGD 2BDNA 1ASYA 2F3IA 5D14A 3MVVA 3IAYA 4UPAA 3OTOQ 3CRKC 3MEFA 5DEHA 5IGCA 5JPNC 2CQAA 3RN2A 3RLOA 3DM3A 3D6WA 3CXCA 2KEEA 2RDHA 1GVPA 1FGBD 1K8MA 4DK0A 4WRDA 3WOEA 1SR3A 4JI2Q 5LMUQ 3RN5A 2UXDL 1T5XD 3L0OA 4FF1A 3TS0A 4P74A 4HIDA 1WE8A 3T16A 4MZ9A 1CI3M 3HOVH 2IX3A 2R93G 2F52A 4KHPQ 4DV1Q 4LMQD 2CPQA 5A35A 5JJLA 1HFNA 3GTMH 4UP8A 3VYSA 4DNIA 1B3AA 5M5WH 1VQ4A 4FO2A 2AXYA 2MHVA 4JI4Q 3JC66 3G71A 1F77A 2F0EA 5C44G 3NWTA 1KHMA 5IWAL 1E1TA 2F0KA 3NELA 3KUPA 2IL8A 3FEWX 4ZUJA 4KN4C 1Y1VH 4JI2L 3U4VA 4RGOS 2NVTH 4A3IB 3B6YA 4DAYA 2E74C 4NBQA 4BS9A 1TVXA 4L5TA 3NXWA 3EIVA 4H7BA 4GOPA 2MGSA 4FYDA 1NMFA 2UUBQ 3WOFA 4KHPL 1U0LA 3NTIA 3P7JA 4QY7A 3HG9A 1A3UA 3S1NB 1WCMB 4DV5L 4EQOA 1QVFA 1E2ZA 1QCBD 5CV6A 3FPPA 1VQNA 1NJIC 3W5OA 1EY8A 2K7VA 1GJXA 1X55A 5C6AA 3I4MB 1HRJA 1VQDA 1TS3A 3CCUA 1U4RA 5ELOA 1S5BD 1PLFA 4JCVE 2CTKA 1SXTA 4CJ0B 5I4DA 3S2HB 2A19A 3A74A 5KNDA 1HZCA 4DR5Q 4LF6L 2L55A 1WVLA 1HJPA 2NN6H 2RA4A 3KLSX 1I6HB 4DN4M 1BVSA 3H0GB 2A74C 1JJ2A 1EFID 3ULLA 1JORA 1EYGA 4EQNA 1AZPA 2EQSA 5TSSA 1AH9A 1YBYA 3VKEA 4A3KG 5FLMG 2NZHA 5IP7H 1HNXQ 4B3TQ 1GM5A 3S1MB 2K6AA 1M8AA 3D3RA 3U4ZA 4A3BB 2R92B 2OCEA 3TZUA 2RBMA 4GOPC 4Y7NB 4KD3A 2Z0SA 4YWKA 4Q5VA 4PZ7A 5GAEC 2JK8A 4A3EB 3I3CA 3Q24A 1WTQA 3OW2A 4LUVA 4ILWA 5E4XA 3RR5A 4MNOA 3KLWA 4HJ5A 2F0OA 5EGTA 4LFAQ 1KXLA 1NTGA 1LT3D 1SNDA 1BCPB 3EFXD 2YU9B 4JG2A 1EY6A 4ZYSA 3CQZH 2A68D 4PG3A 4A3CG 2I5LX 1DZ1A 2R7FA 2TSSA 4BXXG 4IOCA 1YIJA 2UUCQ 3KLSA 2RHSB 2MO1A 2Q2IA 1T9HA 3T1HL 1EQTA 1ESFA 4P75A 1DT4A 2F03A 2E5LQ 1HTPA 1GD7A 3U9OA 4G57A 2NVQH 2NVYB 4IFDG 2HT1A 4WALA 1W6JA 1JT8A 2PI2E 1SMXA 3F2DA 3BVMA 3CCRA 1WD1A 4XT1B 1LTLA 1EYAA 4F7XA 3GTKB 4LFAL 2IWHA 1JCKB 4HJ7A 1TWCH 2VUMB 1Y1WH 2NBFA 3V05A 3K7AH 2JP1A 1PRTD 4BBRG 4QMFB 4DK6C 2BH2A 2OEOA 3JAMc 2YV5A 3U50C 1KTKA 4BA1I 2CVRA 3BVGA 1FJGQ 3AYHB 3S16H 2XRQD 4BY7B 4XYOA 1TY0A 2AWOA 3EA6A 3HOUH 2IW3A 2VQEL 1NMGA 4BBSH 1RTOA 4JBMA 4PMBA 3HOYH 3VR4A 4ZK9B 2YQRA 1A63A 3GP7A 2E2DC 1VQ7A 3PUYA 1X4NA 2WKCA 1I3QH 5C4ZA 2A1AA 3PSIA 4A3GH 2GVAA 2K75A 4O1NA 4DGZA 2A6HD 1CKNB 1EUJA 1HH2P 3GTJH 4ABNA 2JA8H 5IYBH 1Q12A 1STGA 1SYFA 5IYCG 1S5ED 2F0MA 3MC0B 1FJGL 1QZHA 4RFBA 1O7IA 2AUJD 3FVQA 1A0IA 4U68A 3FMCA 1HA6A 2VL6A 3OPOA 2PCFB 1TWGH 4ULLA 1LV9A 1B1ZA 2QNDA 4LF5Q 3P20A 3DM1A 2ICIA 5LHY1 3J80L 1IL8A 2B29A 1Y1WG 1IKMA 4LF9L 4IUTA 4QUFA 2RF4A 4PNYA 4X3TA 5JEAG 1JC7A 5FLXc 1CSPA 3ND8A 4JI8L 4V190 3NUCA 4DV0L 2WACA 3S1QB 4C3HB 3ZJYC 5K36G 4KY7A 2QEXA 3CCLA 4CJ1B 1EIHA 3Q8DA 2EZVA 3DMUA 4LUOA 4IOAA 1C48A 3M3YB 2R3ZA 5T1IA 1O7LA 4LF7Q 4DV6L 2PI2A 3K0YA 2A73B 3M4YA 1CHQD 1PH8A 2CWAA 4YCWA 2X69A 4YHHQ 4KD4A 1WI5A 1Q81C 2IPKD 4MHEA 2F0IA 1YVCA 1I4XA 2JZXA 4LF5L 2A8VA 2CTFA 4DR1Q 3A54A 3JAMi 1SROA 4GLAC 1EQRA 2WP8J 2N55A 2B2VC 4IJHA 2PQAB 1FNVA 5EPJA 3PF4A 3GDEA 1HNWL 4MIUA 4JVHA 3Q22A 4A93G 4KHZA 4TKOB 3CC7A 1XYIA 2L11A 1EZ6A 5I6WA 2CTEA 1JR0D 1FD7D 1U4MA 2QA4A 1N34L 4KKUA 2NTTA 3H15A 2F4IA 1VQMA 2KCCA 5M3MH 1EU4A 1KDCA 2L5TA 2H5XA 3GV3A 4IUPA 2KA7A 2R61A 3MFGA 3NTHA 3K6OA 1YJ9A 3H3VI 1Q8KA 3S2DH 3MXUA 5E7NA 1PFNA 1VQEA 3AFQA 4OO1H 3LX0A 1FYCA 3E6ZX 3CHBD 5M5XH 3R2IA 5JJIA 5C0XH 3A5ZB 3TP7A 2EYJA 1YJNA 1L1OA 4UP7A 3CCJA 4DR2L 1RTNA 3ICEA 5IP9H 3HOXH 1F2MA 2ZXOA 2KHJA 1DOMA 5C4XH 3ER0A 4DUZL 1AFPA 4WJWA 2ID0A 2E2IB 4HTHA 4QGUA 4DV2Q 1G2SA 2NN6I 3VYRA 2NVXB 3CMEA 4R4QA 2MNAA 1X56A 3DWQA 2K1BA 2HHHL 5KIXA 2KECA 4S3SA 4X66Q 1CKOA 3PMFA 3HKZB 1VQLA 1RDPD 4WJ3M 1TS4A 1Y69U 4UDUC 1H9RA 4IUQA 1NR2A 2WAQG 1G51A 4LUZA 1HUNA 1FVIA 1UE5A 2VQFQ 1V1PB 5HGTA 3OYYA 5JOBA 2F1MA 2ZJPA 1AN8A 4BY1G 1EWCA 4POFA 1P16A 4A3JG 2WFWA 1SE2A 5C3WA 2VB2X 4JK1C 1KNEA 4B3SL 1YITA 2D9UA 5IIFA 3BDOA 5COYA 3MTSA 2L0CA 3K8AA 3SHLA 4AIMA 4ID6A 2DGRA 1PRTB 4X66L 2CKZB 1YNND 1L1OC 1I4GA 1O78A 4R1JA 5D3DA 3WDNA 1PH2A 3OIQA 4RA8A 3CU7A 4GKJQ 1AEXA 4B08A 5JJKA 2BE5D 4HMJA 3HS0C 5C4XG 4DU9A 2VW9A 1E1OA 2Y0SE 1SE4A 2FFKB 4XQNA 3NE5B 1PH6A 4NB3A 1OXTA 1EOTA 1UAPA 1PTOF 1FNUA 4LW1A 5A2QE 3I90A 1DOLA 4OWTB 3GTLB 1D5XC 1BCPC 5KYIA 3S14B 3HOZB 2VB3X 4LFCL 3I4NG 1ZXTA 2FMMA 1MJEA 4YY3Q 5DNFA 1UEBA 1KC8C 1KLGD 4FXDA 5EKKA 5I9OA 3RZOB 3MHBA 4QL5A 3I55A 1PFBA 3C46A 1BOSA 3F2UA 2RHQB 1PZID 2EY2A 4ODGA 4LFBL 1D1KA 4FXKC 4RHSA 4LF4Q 2Z4IA 3U58A 4DR6Q 4A3FB 1EY0A 2F0JA 3E9IA 4JOIA 3LWUA 2UU9Q 4XYQA 3P1HA 4CGYB 1PTOH 4DV7Q 5ELNA 4EQ5A 4JI0L 1Z47A 1QVCA 1W6KA 4TSSA 4LF8Q 1U9RA 1B2TA 3K0XA 1HZ9A 4PQXA 3S1NH 1WCMH 1B44D 3K7UC 1A8VA 3DXJC 1V1OA 3M85A 1Y14B 4F87A 3CCVA 1SJED 5KGUA 3I4MH 1Z7TA 2NYZD 5C3EB 3SE0A 4DFAA 4LF4L 3S2HH 1I94Q 2PPBC 2F0PA 1V1QA 1KL9A 2BH8A 5M3FB 1VS0A 4DXFA 3CF5A 2UU9L 1KAAA 4PV1C 1ZYRD 3JAME 3VDYA 1VQIA 2ZTCA 3J80i 1X3EA 1I6HH 4M8AA 3H0GH 4HJ8A 4C2MB 1Q86C 4LF8L 1NSNS 4OX9L 3TDQA 1F2YA 3F2CA 5A2QL 2DY8A 2XGTA 4A4IA 1QZGA 2ZM6L 4ZLTF 2HDMA 3UDXA 1VQOA 1J4WA 5IYDG 1PMRA 1PXUA 1WTWA 3PO3B 1F9RA 4F8MA 2Z4HA 3S1MH 1G291 2VZAA 2PQAA 4OWXB 1TS2A 4A3BH 2R92H 2PMZB 1K8AC 2OF1A 1YZ6A 1Q8IA 3HOWG 2PQUA 4XQQA 4Y7NH 1I94L 3C1EA 3CMAA 3LNNA 3ZYYX 4X62L 5E3FA 5G3LD 2N49A 1D1IA 2UXDQ 4C3IG 3CRLC 4A3EH 3BDLA 4J15A 4HSVA 1TWFB 1LACA 5GROA 1LT6D 1U5KA 2K04A 2YU9H 2F0FA 3FHWA 2B63G 3SEBA 4LNQA 4XIGS 1TIID 1W2BA 2QILA 2PY9A 3ND9A 4DK3C 5GQOA 4H0LC 1PH7A 3I72A 4J8QA 4DNRB 2H1EA 1TUAA 2F0NA 4WJ4A 4A3MB 1KLUD 2PZWA 5IWAQ 3J7AV 2QEJC 4L8JA 4OL7A 4AYBG 5FLXE 3I2ZA 2JYOA 2WB1G 3GD7A 3PIO3 1KRSA 4R9WA 1NUCA 3VYTA 3M7NA 2YTXA 4B9XA 5FK9C 1VF7A 1VDZA 2K32A 3MXNB 4AM3A 3VYUA 1N32L 1N36L 1KIXA 3GTKH 4HR7B 4IO9A 4B3MQ 4RCNA 2K5QA 4RGTA 3JAML 1JB7A 2JA5H 4IPHA 4OO1I 4DV5Q 1KQSA 2R6GA 3M4OB 1F9PA 2OQKA 2VUMH 4K14A 2JA6G 1V9PA 1BDOA 1LYLA 4JI5L 3GO5A 1JMCA 1BKBA 5C0XI 1DM0B 2WINB 1XPUA 3QOLA 1PZKD 4BY7H 1CUKA 3J81L 5CR3A 3V69A 2C5CA 4BA2I 4LF6Q 1V1PA 5GADC 4DV3L 5D3IB 3G48A 1RF2D 1PVOA 3K5OA 4GN3B 1QVGA 4B3ML 1CFMA 2UUAL 3H3VH 2D2CC 2FXQA 1JJCB 3D6CA 2WKDA 4C3JB 3T51B 4JI1L 3KF6B 3STBD 2L4NA 2ENBA 1HCZA 1PH4A 1JOKA 1PZJD 2K01A 2A69D 2JEBI 4RMFA 1C7YA 3AEVA 3A8JE 5FO8B 3DUZA 1EFWA 4B9WA 3HOVG 4JI7Q 3T4AC 4LWCA 1M1KC 3DWAA 4HJAA 2PMZE 3UE1A 5FLXL 4AH6A 2JA5G 5HY6A 1WVNA 4MTNA 3UDIA 1SFOH 2OTLA 1JOQA 3PUVA 4GNXA 3UE0A 4R4OA 4X3UA 4ZQ3A 3S1QH 1QE6A 2XWBB 4K5WA 1ZZIA 4DAPA 5JVG3 3T1HQ 1Y1VG 1E0BA 4GKKL 3M3YH 1L0YB 4QB4A 2VY3A 1QG7A 1TU2B 1SDFA 1DYQA 1S4ZA 1QB5D 4KI0A 2R93B 4JI7L 5ISRA 4RKBA 4QJFA 3NBHA 5CORA 1CQVA 1HR0W 1RODA 2AQ1B 3UDFA 1PRTC 3GTPB 1B4OA 2F0VA 4Q0FA 1IXRA 3EN2A 1STYA 1DXMA 4YWMA 2JXMB 1HZBA 4DNTB 3DEOA 5LMNQ 5C44B 2IX0A 1X3QA 5GAGC 3J7A5 4HCSA 1O7YA 3J81j 1J5EL 1IW7C 4FXGC 4OIJA 1SE3A 4G7ZC 1MI2A 3TBIB 2SNSA 1J8IA 2NN6G 1YNJD 1F9QA 2VQEQ 1BF4A 3FKIH 1GUOA 3J80E 4JI3Q 5CV4A 2ZXRA 3IFTA 4DV4L 3BZDB 4GNXC 4V0BA 3W3AA 1JWUD 4JYAQ 2K33A 3SK8A 1BBWA 1TWAB 5IE8A 1Y8NB 1WTPA 2RSNA 4A76A 3KBGA 4L6TB 5DAUA 2E8GA 5IP7G 5LMNL 1GOZA 3CC2A 1XNQL 2PNHA 1YJWA 4KHVA 3GTQB 3M7GA 1ILQA 4P2CB 3NBIA 1VQCA 2E75C 2PZUA 4DR7L 5GAHC 2A6ED 3H6MA 3T53B 2HQEA 1LLRD 5CV5A 2B2TA 2IY5B 2EJFC 2F0LA 4YCVA 1SYEA 1WTOA 2OPVA 1Q3LA 3KJOA 2Q2TA 4JI3L 4QUCA 3J81c 3T1YL 2EE1A 3D4WA 2NVXH 4JYAL 3KDFA 1SJHD 4HSPA 2IHEA 3FP9A 4XDXA 1VQFA 4TVAB 4LF9Q 1B8AA 4A3KB 1X6OA 2Y0SG 2JA9A 3NPPA 1PDQA 3S17B 3LWEA 3PCOB 4DF7A 5EPLA 4JI8Q 1EYDA 3G6EA 1X3GA 4DV0Q 1MD2D 2XNAC 1SAPA 2AQ2B 3H94A 4R8NA 3SVMA 5HGQA 1Q82C 4EVOA 4GS3A 3FKIG 2B2VA 1UE7A 1DCZA 2BL5A 4IUNA 4DV6Q 5IOCA 5ELFA 1VMPA 1OTCA 2KHIA 4QIWB 1BQQT 4X6AH 3WWVA 1LTID 1G6ZA 4DKAC 2K28A 2IHFA 1DONA 4X3KA 2FJ2A 1X3FA 4KJOA 2B2TC 1K9MC 4RCOA 3E9HA 3PO2H 1S3OA 1NCVA 3MXNA 3QB3A 5LL6S 1OXSC 2D0OA 1KDBA 2JJQA 1OXUA 1STAA 1HNWQ 3N52A 3G7LA 4FF2A 2ALYB 1N8RC 1B70B 3HOUG 1WFQA 4B3RQ 1ENFA 1PH9A 4BBSG 3URYA 3HOYG 3J7ZC 1VQHA 2OXPA 1N34Q 4K2LA 2I5HA 5FJ8H 1IBMQ 4LK1C 5EKIA 4NKLA 3U9SA 4A3GG 1ZZKA 3HEJA 3TN2A 1SN8A 4BBRB 4DA2A 3DLLA 1QUQB 3S14H 3HOZH 1MIUA 5M5YB 2JA8G 2PW7A 4NXNL 3C3LA 5IYBG 4X65L 2LY7A 2MO0A 5C3XA 2XRSD 5I6YA 4RGNA 2LXJA 1JICA 2PYKA 4HEDA 3CP0A 2B8FA 4DR4L 1VF5C 3NK9A 4HN7A 2KVMA 2KHSA 1K0RA 3R93A 1WD0A 4B3RL 4JBWA 2VXWA 2X6LA 4DR2Q 3J81i 2H4OA 2G9HD 4B8TA 5C5LA 3K80C 4DUZQ 5CYUA 1HNZL 1IBML 4A3FH 3MWYW 3PUXA 2XSCA 2KCMA 3HRZC 1RKNA 1S5FD 3ITPA 2HHHQ 3PO2G 4KY6A 1WTRA 2OPUA 2EDGA 2BCOA 1I5FA 4L5RC 1QNKA 2F0UA 1CZGA 1EY9A 4A3LH 3BZKA 1HR0L 2UXBL 1EU3A 4XXEA 2MUYA 3GTGB 1D6EC 1EC6A 2M00A 1B7YB 3K58A 2CQOA 4EX5A 4PMWA 2KCNA 1GUTA 5E1FA 2JQOA 1SE8A 5EAYA 1N33L 1VQ5A 3KJPA 1LT5D 3MXPA 4KLKA 2WV6D 4P71A 1Y1WB 4B3SQ 1GUGA 2WIIB 3K7AB 1E3PA 5M3FH 4IZ8A 2MPMA 3HOZG 4QQBX 3VR3A 1L2FA 1NY4A 1YHAA 3G4SA 3NQIA 1PHJA 4K6DA 3T13A 1I4QA 4C2MH 2EYHA 1K1GA 2BE5C 2PQEA 1HZAA 4ME5A 3MA2B 1EEID 1A2UA 2RKSA 1DGSA 3KF8B 4R4CA 1JJGA 5JVH3 1FR3A 3TP6A 1UNSA 3PO3H 2OQ0A 3PUZA 4PZ8A 5IT9L 1S40A 2B2YA 1NBWA 2GVBA 1K83B 2R7ZH 2L9HA 1Q46A 2JE6I 3VR6A 5M3MG 2EIFA 4NPSA 2PO4A 4DR3L 2F0SA 4PMCA 3X3MA 1YHQA 1EY7A 4DK1A 1SRUA 1I50B 3GTJB 1LABA 4KMUC 1HHVA 1TWFH 4OO1G 3K5MA 1B50A 1PV4A 1ET6A 4LFCQ 2F4VL 2YYZA 3I4LA 4A93B 2TMPA 1VQJA 4DAYB 4JI6Q 2F0QA 1TS5A 5CC4A 2ZXPA 4XTCS 1GO3E 5C0XG 1EL0A 1X9NA 1VQ6A 5IP9G 1TWGB 3HOXG 3CD6A 4MN3A 3VA5A 2J4XA 4LFBQ 4BWGB 3BJUA 4A3MH 4A3DB 2D5DA 4GLVB 4QF4A 1PTOD 3C2PA 2M9VA 3CAMA 3CW2C 4NMZA 3E0JA 3KYHC 1PH1A 5I9PA 1EQVA 1L0XB 2FMRA 1G2TA 1XXGA 2BDOA 3QJYA 2OWOA 4JI0Q 3I73A 3D31A 1X3PA 3RD4A 3BS1A 2B2YC 4JI6L 2NZ1D 1WTXA 3S15B 5DLQE 1ET9A 3U1KA 3NHHA 1UE6A 4YCUA 1A15A 3M4OH 2L12A 2R7ZG 4NW2A 3W1BA 3GTOB 2CFMA 1KDAA 1MSHA 4N9TA 4WORA 4H02A 3NTKA 4YWLA 1LTBD 1JE4A 1SSOA 1CKNA 1FGUA 1ZYRC 1VQAA 3PF5A 1IBLL 1ESRA 1ILPA 1JOOA 1Z9FA 1ZKOA 4A3IH 3OIPA 3NEMA 5DM73 2QF7A 1SEBD 1NE3A 4C56C 4JBJA 1SNCA 1KHIA 3IL8A 1UUPA 3MZ5A 4OX9Q 2WAQB 5EPKA 3D0FA 3BVZA 4K0KL 3S1RB 5J1ZA 1CKMA 4CKBA 4TRDA 4ZUIA 2ZM6Q 2ASBA 5I2XA 4G4KA 4BY1B 2NZOA 2UXCL 4CHTB 1SNPA 2M2LA 4A3JB 4C3JH 3CCQA 3BYTB 3V2TA 2KUMA 2K14A 3HKZE 1SMYD 3SK4A 5IGFA 1IYJB 2MQHA 4JV5Q 1A2TA 2I0QA 2K5DA 3M4QA 1Q7YC 2JEAI 3HFZB 4X62Q 1HQMC 5F2DA 1A62A 2AUKA 3NSWA 3QWNA 3RZDB 1LT4D 3I70A 1KNAA 1BCPF 3I4OA 3EQLC 1Y8PB 4L63B 1KD1C 1A6XA 2KJXA 2PW5A 3ONAB 2KBNA 2BA1A 3PGZA 5C4XB 4AQYQ 3NENA 2OTJA 1GUSA 2P2RA 1BBUA 2K03A 3SXHA 1I6VC 1ICWA 2EOTA 1L0WA 1C9OA 3BDCA 1QUQA 3J81E 4HMIA 1IHZA 2AWNA 5C0XJ 4K5XA 1H95A 4JV5L 3M4PA 2DY7A 2E2HB 2B3GA 3GV6A 3UDGA 4A3IG 5IT9c 3Q6SA 1D8LA 2CW0D 4HIOA 4UAIA 4ZRZA 2K5WA 2B2WC 4ZAIA 1XJVA 3I4NB 1VCIA 1EQQA 5AJ3L 2ZTEA 2XVSA 4DPGA 2ES2A 2ATWA 4X64Q 4FF4A 3M9BA 2RSOA 1WCMG 3BU2A 1VQ9A 1N32Q 2K50A 1N36Q 1EZ8A 3OOCA 4RG1A 2DNEA 4KV6A 4HJ9A 1K8GA 4WFN3 3RNUA 3Q0AA 4AQYL 1CTMA 2G9DA 3I4MG 1J9OA 3K5LA 2DNCA 4FP5D 4JVYA 3AMUA 4JI5Q 3TZDA 3CCEA 1RL2A 4Y52H 4EQPA 3L3OC 4L5SA 2CWPA 2FMCA 2NB0A 3TREA 2O5JC 4WANA 3RLFA 4IQZA 2JA7B 2NVYH 2ZT9C 5CV9A 1EYCA 1STHA 4IURA 4RAUC 1TT2A 3H0GG 1RCVD 4DV3Q 3TQYA 3X3NA 4X64L 1XPRA 3CPWA 1BNZA 1TWAH 5IODA 3PUWA 1ZEQX 4NDXA 5C4JB 2E2JB 3STBC 1IBKQ 2UUAQ 4ZKCB 5JJZA 5E4WC 3E5SA 4R8IA 1G8ZD 1G91A 1SBBB 3GTQH 2A69C 3UI2A 4A3BG 2R92G 3D8GA 3TMEA 4JI1Q 1E2VA 1PFMA 5BN5A 1PH5A 5BN3A 3KF8A 1CA5A 1M90C 5KYLA 2WAQE 1D5ZC 1CQFA 1TXYA 4A3EG 1XTDA 1VQKA 2HH3A 3A5UA 3HP3A 1O80A 1GUWA 3OTOL 2LFNA 1II3A 4E6IA 1VIGA 3VA7A 1SLJA 1CSQA 3AU7A 1CT1D 2N78A 5J39A 4XQJA 1W3SA 2EY1A 2EYLA 3HKSA 3OWFA 1KRTA 1IBKL 4A3KH 5FLMH 5IGBA 1E22A 1B9NA 3I56A 3LGJA 2N88A 3S17H 2OT2A 1C0AA 3TSSA 1S5DD 5LMUL 3VR2A 4L5QA 4GN5A 1ENCA 3HOWB 1JE5A 2EYPA 3L2PA 5IY0A 5EBDA 1QILA 2RQXA 2Z8LA 1PTOB 2D62A 4C3IB 4GKKQ 1LTSD 4K5VA 1SYCA 5CV8A 3K5NA 2K52A 2B8GA 4DV1L 2YTYA 1GHJA 2F0TA 1EEFD 1LO5D 5LL6X 2EXDA 2LKVA 3ERSX 4FVMA 2A68C 4JI4L 4KY5A 1B53A 1AE2A 3CPFA 3MEHA 1STBA 2Q8TA 3R8BA 4J1MA 1TKWB 2B63B 4HAEA 1MJCA 2VUMG 4A3CH 3O13A 2L1BA 2F0GA 1J5KA 5K5PA 4BXXH 2KCTA 4G7OC 4FNFA 1R9TB 1TWHB 1S72A 4C1NI 3FDTA 2ZJRA 1YNJC 1HXYD 1XWEA 4BY7G 4F88A 2D0PA 4ZKBB 4C3HH 5I2YA 4AYBB 4IFDH 1J5EQ 1VMCA 2WB1B 3SGIA 5CGKA 4O42A 2SNMA 1H9SB 2UUBL 5FO7B 4U673 1IL2A 1EIFA 4IPDA 1CHPD