5JEAG

Structure of a cytoplasmic 11-subunit rna exosome complex including ski7, bound to rna
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
237
structure length
235
Chain Sequence
DSMSTFIFPGDSFPVDPTTPVKLGPGIYCDPNTQEIRPVNTGVLHVSAKGKVQTAYIDYSSKRYIPSVNDFVIGVIIGTFSDSYKVSLQNFSSSVSLSYMAFPNASKKNRPTLQVGDLVYARVCTAEKELEAEIECFDSTTGRDAGFGILEDGMIIDVNLNFARQLLFNNDFPLLKVLAAHTKFEVAIGLNGKIWVKCEELSNTLACYRTIMECCQKNDTAAFKDIAKRQFKEIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exosome complex component RRP45
publication title Structure of a Cytoplasmic 11-Subunit RNA Exosome Complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule tags Hydrolase/rna
total genus 51
structure length 235
sequence length 237
ec nomenclature
pdb deposition date 2016-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF15985 KH_6 KH domain
G PF18311 Rrp40_N Exosome complex exonuclease Rrp40 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5jeaG01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5jeaG02
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 5jeaG03
1K8AC 3CQZH 2JZXA 1XPUA 2E5LQ 1NY4A 2EDGA 1HR0L 3UDFA 5C0XG 1E1TA 1G291 4KKTA 4B8TA 4GNXA 1N34Q 1I5FA 3CC7A 2QNDA 1YJNA 4A3FH 1XPRA 3OOCA 3EIVA 5M3MG 3KLRA 3NBHB 1M90C 3CW2C 1VQPA 1MJCA 3GTOH 1UE5A 1YI2A 2BH2A 1HNZQ 3GDEA 1LABA 3W1BA 2UUBQ 1Y8PB 4L5TA 4LW1A 1IYUA 1IBLL 3G48A 1K8GA 1VQFA 2WFWA 3PV0A 1Z47A 1E2WA 2GVAA 1S40A 4DR4Q 5IYCH 4GS3A 3A7AB 4OX9Q 5JEAG 1VF7A 4BBRG 1E2VA 4A3JH 3I4MG 1BBUA 1C0AA 1LTLA 3LNNA 1E22A 4A75A 4GOPB 4O2DA 4MZ9A 3KF6A 2VS1A 1QUQB 3S14H 3FPPA 1IBKL 4GN3B 3STBC 4G7HC 4DK1A 4IOAA 2OQKA 1QVFA 4DV4L 4NXML 1RL2A 1U5KA 4L5SA 1HNXQ 2R92H 4EQ5A 5BN5A 4LF7Q 3M4OH 2JVZA 4GN4B 3PSIA 1IBMQ 1LACA 3J7A5 4AH6A 3K8AA 4DR3L 1L2FA 1I94L 3T1HQ 1PMRA 2JA5H 1ZZKA 1SRUA 1VS0A 1CSQA 4RMFA 2KA7A 3HFZB 4AYBE 4OWXB 1N36L 3DLLA 1NMGA 1EQRA 1Y69U 4LWCA 4YWLA 3D4RA 4WJ4A 1N33L 3S24A 2NN6H 1K8OA 3H15A 1Y8OB 2VQEQ 4DK6C 3RN5A 4P73A 2K50A 2UUAQ 4LF5Q 4YHHQ 2R6GA 3B6YA 4C3IH 1JJCB 4HJ5A 3RR5A 2JE6I 1K83H 1B9MA 1UEBA 5K36H 4A3LH 3NEMA 4LFAL 1ZKOA 1XNQL 1PYSB 2AUKA 1W3SA 2UU9L 3UDIA 4B3ML 4QIWE 4KHPL 3F8TA 2A6HD 1PH1A 1Q81C 2WP8J 2B8GA 1PH4A 1E1OA 1EC6A 1JT8A 2BDOA 1BVSA 2E74C 3KDFB 3KOJA 4IQZA 1X3FA 5IP7G 4QGUA 3U50C 2JQOA 1ZZIA 5M3MH 3CCUA 1K3RA 3T51B 4GKKQ 2A68D 3T1YL 2HQLA 1EIYB 4H13C 4B3TQ 4DV2L 3BU2A 4JK1C 1DD2A 4KHZA 2A6EC 4JBWA 2ZTCA 3CCJA 1WFQA 2Q2TA 4AQYQ 2Y0SG 1IW7D 1V9PA 1GUTA 4HR7B 1XNRL 2JA8G 3NELA 3I4LA 5C4JH 1IYVA 4DAYB 2A69C 3GTQH 1H95A 1V43A 3QJYA 3CPWA 1M1KC 2YU9H 4X65L 2CKZB 3TEHB 2JEAI 3I73A 3P20A 3NE5B 1YIJA 1GHJA 3TS0A 5IWAQ 4YWKA 1D8LA 1GD7A 3U58A 4LF6Q 3SDZA 1PA6A 2NVTH 3TS2A 3I4MH 3L7ZC 2F4VL 4X66Q 1G6PA 5GQOA 4LF9L 3GTJH 4JI4L 4R4IA 1TWGH 2PY9A 2HT1A 4LUZA 4DV3L 1SMXA 2DGRA 3RLOA 1VCIA 2A8VA 1YNXA 2GN5A 4H44C 1CI3M 3S17H 3G4SA 1L1OB 1VQEA 4JV5Q 3A74A 2E3UA 2E75C 4YY3L 2CTKA 2PMZE 2ZTDA 3A8JE 4ALPA 4XTCS 4DR6Q 2CTJA 1UE1A 4GKJL 3A5UA 1TUAA 2K4KA 2Q2HA 3VR6A 1KC8C 4JI5L 2IT1A 4G7ZC 4DK3C 2XGTA 1XMQQ 2AMCB 3IRBA 1J5EL 4JI6Q 4DR7Q 4A3JG 4AM3A 4WJ3M 4X62L 1FR3A 1YZ6A 4LF4L 2QF7A 1N32L 2QEXA 4DR2Q 1WOCA 2YTVA 1PH9A 4JG2A 3FMCA 2YTYA 2VY3A 4A3GH 5AJ3L 3CCMA 1EUJA 4PV1C 3W5OA 1VQAA 5KNBA 2Z0SA 3J80i 2NN6I 1J5KA 4K0KL 1H9SA 3UE0A 3FHWA 4OO1I 4G7OC 1HNWL 4IPDA 2UXBL 3PO3G 1X56A 2Q2IA 1VIHA 1ZYRC 1O7IA 2WB1E 2OTLA 4LFCL 3PCOB 2I5MX 3VR5A 2ZTEA 2YYZA 3G71A 3CD6A 4YWMA 1I6HH 1X65A 1YJ9A 3KJOA 1I50H 5HY6A 3VR3A 1VF5C 1HR0Q 2NZOA 4JI7L 3PUZA 3JAMc 3TRZA 1WCMG 3U1KA 4OO1G 5IP7H 4LF8L 4Y52H 2DNEA 1J6QA 2IY5B 4DUYQ 3AQQA 3T56B 4DV6L 1WI5A 2E2HH 1H9RA 3AFPA 2E2JH 4YCUA 3K0XA 1NMFA 1S3OA 5A35A 1IZ6A 3S1QH 3PUYA 4XIGS 3CCRA 1SLJA 5ELOA 4NXNQ 4DUZL 3KLWA 4WALA 4L5RC 1JB7A 2JA8H 1SMYC 2B8FA 1Z6HA 4L8JA 5DLQE 2CPQA 4DKAC 1K73C 1IBLQ 4AYBG 4DR5L 1QZHA 2B29A 3F2CA 4GOPA 2NVXH 1YHAA 4LIJA 3PF4A 4JI8Q 1QUQA 1GUOA 5FLXc 3H3VI 2KCMA 2JA7H 3T53B 1VQ8A 3ERSX 4H02A 1OXSC 1MJEA 4RCNA 4DNIA 3I7FA 3IKJA 1RIPA 2EVBA 3H0GH 1EFWA 3K80C 3GQBA 2N8NA 3ULPA 3A5ZB 4DV4Q 4NXMQ 1VQMA 2PI2A 1FVIA 2E8GA 1PH5A 1FYCA 4QJFA 4UP7A 1BDOA 3NENA 3KF8B 2PQAB 2OWOA 2UXDQ 1TKWB 2E2IH 1H9JA 2ZJPA 1VQ6A 1YHBA 1ASZA 1ONLA 1J4WA 4B3SL 4A3EG 3M4PA 1LYLA 3CCEA 4Y7NH 4DV5L 4DR3Q 1PH8A 1I94Q 1QVCA 3HOXG 4HIOA 1K0RA 4BXXH 1ASYA 2BE5D 1VDZA 4BA1I 4NBQA 1N34L 1CKNB 4IPCA 1IYJB 3J7ZC 1N36Q 4DV7Q 3KJPA 1SN8A 2OQ0A 5IYBG 4KMUC 1N33Q 4JBMA 2EJFC 3CMAA 2K33A 2IHFA 1E3PA 1T9HA 1P8LA 1XMOL 1VQ4A 2CQOA 2MJHA 4OXPA 2B3GA 3K7UC 1JJ2A 1BKBA 1HNZL 3STBD 2NVQH 3LGJA 1W2BA 3PO3H 4QQBX 5C44H 4LFAQ 3RZDH 2CWAA 4BBSG 1KD1C 2UU9Q 2F3IA 4A3DG 3EQLC 1X3GA 2GVBA 3KDFA 4DR4L 3GTKH 2K5VA 4DAMA 3I2ZA 4LFBL 3TREA 1X3EA 1OXUA 1H9MA 3A7LA 3HKZE 4A3GG 1CUKA 1K9MC 2ATWA 2K5HA 3Q8DA 4AIMA 1HQMC 4GLXA 2LXJA 3WWVA 1WCMH 4X64L 4OO1H 4QMFB 3K81C 1HTPA 3OPOA 4DK0A 1NJIC 1KRTA 1ZTGA 4POGA 4DV1L 1XTDA 1VQIA 3W1GA 3T1YQ 2EJGC 4C3JH 2MQHA 2ZT9C 3E9HA 1EOVA 1HNXL 4IJHA 4DR1L 3BDOA 4LNQA 1PH3A 3I4NH 2PNHA 2A6HC 2UXCQ 1HPCA 5GAEC 2HH2A 1IBML 3SE0A 1UWVA 3T1HL 1HH2P 3QIAA 4A3MG 3W3AA 4X65Q 1WYDA 4HJ8A 3HKSA 2EXDA 4KN7C 2R7DA 2RHSB 4GZYC 1Q1BA 4IFDJ 1EIFA 1Q7YC 1D7QA 4MNOA 1VQ9A 2A68C 4JVYA 2VUMG 2ZM6Q 2K32A 2BA1A 1L0WA 1VQDA 1L1OA 1DXMA 4IOCA 4JI4Q 2NZHA 2UUAL 4A3KG 1Q1EA 4LF5L 2ASBA 2KBNA 1YITA 4JI0L 3KFUA 1HZCA 3GTMH 5ELNA 3J81i 2WB1G 1Y1VH 1Z7TA 5BN3A 4JOIC 3ND9A 1C7YA 2Z6KC 4R1JA 1WJJA 4YY3Q 1HCZA 2JA6G 2A1AA 1KIXA 1GUSA 2A6ED 4GKJQ 4A3EH 1HZ9A 2KHIA 1Q90A 4TVAB 3H3VH 3U4ZA 2PI2E 1LUZA 5BR8L 1VQBA 1PH6A 1HR0W 2P2RA 1IXRA 2JA7G 3HOXH 4YCVA 4X62Q 1GUGA 4JI3L 1OXVA 1WVNA 2A69D 1TWCH 3VR2A 2L5TA 3ND8A 4NPSA 1PHJA 1SFOH 3H0GG 1UE6A 2Q8IB 3I4OA 3HOYG 2IX0A 5IYBH 3S2HH 3RZOH 4HIKA 4TKOB 1E7ZA 3D0FA 4APVA 4GKKL 2BH8A 3HGBA 1Y14B 3S16H 4K0KQ 2BL5A 4LUVA 1BBWA 5LMNQ 1PVOA 2RCNA 1C9OA 2LSSA 1KHMA 4A4IA 1NTGA 4KN4C 4A3CH 1Y8NB 2D5DA 4PZ6A 1AE2A 4BBSH 4LFCQ 4R4CA 4A3DH 4BXXG 3GO5A 1CSPA 4L5QA 1HZAA 3BG3A 1Q82C 1B9NA 5IWAL 3OW7A 1YEZA 4JYAL 2AHOB 4LF6L 4A3BG 1DCZA 3CCLA 3AEVB 4X66L 2BA0A 5M5WH 4R4OA 2Q2UA 5FLMH 4JI1L 1TXYA 3L2PA 1VQNA 2O5IC 4P72A 3D31A 5M5YH 4DV6Q 3DM3A 5IYDG 1T5EA 4QY7A 2CCZA 1YBYA 4BY1H 3HOWG 1IL2A 4LUOA 2D62A 4DNRB 2KENA 4P74A 1OXXK 5C44G 4JI2Q 4JC0A 5KNDA 1H9KA 1GJXA 1OTCA 4BA2I 1KHIA 1FL0A 3WDNA 4DUZQ 1EQQA 4IFDI 3CRKC 2V1CC 4DNTB 1VQOA 2VNUD 4PZ7A 1O78A 2RHQB 2EIFA 1SE8A 3CCQA 2PNRC 1SR3A 4HJ7A 3MXNB 4DR7L 4A3MH 2ALYB 3S1NH 1X4NA 1K8MA 2CW0C 1B70B 4DR2L 3MFYA 5J3BA 2K52A 2D2CC 5M5XH 3M4YA 2I5LX 2VUMH 1YJWA 1X55A 2L15A 1CFMA 3BZKA 1GKHA 4IFDG 2PQAA 4A3KH 3CP0A 3GTPH 2CTMA 3I4NG 1X4MA 3PF5A 4GLVB 1MKHA 1QJOA 5M3FH 4IPHA 5GAGC 3OTOL 1A63A 2ANRA 2WAQE 3CPFA 1JE5A 4KKUA 2R7ZH 3J80c 4DV0L 1UE7A 3G6EA 4B3RL 2PPBC 2JA6H 2I5HA 4GNXC 3CXCA 1CKNA 3HKZG 1JMCA 2ZJQA 3M85A 4JVHA 4UP9A 1VQJA 2AWOA 4DV5Q 1E24A 3CAMA 1Y1WG 5IP9H 5LMUL 4JBKA 2QGQA 3F2DA 2O5JC 4UY8C 5EAYA 5JJKA 3HOZG 5KNCA 4PZ8A 2AXYA 2UUCL 2KCCA 2ID0A 3HOYH 1O7LA 1IBKQ 4DUYL 2R7FA 1FJGL 3AFQA 1GHKA 1Y1VG 4LJZC 2VQFL 1XMOQ 1WE8A 4YCWA 3E0EA 4NXNL 3M4QA 1A0IA 1X54A 3S1RH 2HHHL 1JJGA 2NVYH 3F2BA 1N8RC 2F1MA 2A19A 4IPGA 3CMEA 3AYHB 4C2MH 5C3EG 2E5LL 3H94A 4P75A 4J15A 3RLNA 4HJAA 2BE5C 2N49A 3QG1A 3PGZA 4JI8L 3UDGA 4LFBQ 3EN2A 3GD7A 2MO0A 2JXMB 1XJVA 3TQYA 2F52A 4A3BH 1DTJA 3OYYA 2XTIA 3ZJYC 4X6AH 2PCFB 2RF4A 4X64Q 4GNXB 2MNAA 3VA7A 3A0JA 3PUVA 3HOUG 2YTXA 2JK8A 3E9IA 2OTJA 4R4QA 4DV1Q 5IYDH 3VR4A 3HOWH 2JEBI 1VQ7A 3FKIG 1TWAH 2UUBL 2C35B 4A3CG 2YQRA 1TU2B 1PH7A 1XNQQ 1CKMA 2UXDL 4DR1Q 5C4XG 4A93H 2D0PA 4B3MQ 2OPVA 4QL5A 5HGQA 3HOVG 4OX9L 3I56A 4KHPQ 3CC2A 3I72A 3V69A 2EQSA 1VQCA 3L0OA 1PH2A 4DV7L 5FLMG 3GTLH 1Z9FA 4OWTB 4OGQC 2AWNA 4BY1G 2AUJD 2D0OA 1X6OA 2OPUA 1FGUA 1KXLA 2ANNA 3N6RA 4HIMA 5LMNW 4DV2Q 4IFDH 4NB3A 3UDXA 4A3IG 4KLKA 3KF6B 1VQLA 2ZJRA 4JI0Q 1E2ZA 3K7AH 4LF7L 4BY7G 2KCTA 4EX5A 1XNRQ 3OW2A 5GADC 3BJUA 5FJ8G 4H0LC 4JBJA 1A8VA 1PV4A 1Q12A 1GVPA 1KQSA 3PO2H 3VKEA 1P16A 4DPGA 1S72A 4PG3A 2EJMA 5IT9c 5GAHC 2CWPA 5IY0A 2N78A 3UE1A 3M7NA 2LMCB 5BR8Q 2DNCA 3ICEA 3MEFA 4P71A 5C0XH 1Y1WH 2CTLA 3RNUA 1VQKA 2F4VQ 4JI3Q 1NE3A 1L1OC 5H1SE 2VQEL 3GTGH 1Q8KA 3HOZH 4GN5A 3M9BA 2R93G 1MIUA 4LF9Q 4C3HH 3F1ZA 1IW7C 4YHHL 4DV3Q 3PUWA 4PMWA 3PIOA 3J81j 1VQHA 5M3FG 3JC66 2CTFA 2R7ZG 2B63G 4IO9A 2HIVA 3FP9A 3BZCA 5C0XJ 4KKSA 1B8AA 4JI5Q 3KYHC 2UXCL 1GO3E 1SROA 4JOIA 1G51A 1V8QA 5C3EH 2Z6KA 1J5EQ 2DN8A 5IP9G 3AEVA 2FXQA 1TWHH 1EWHA 4LF4Q 2PQUA 1N32Q 1HJPA 4FDBA 3A8KE 4KI0A 5JEAH 3I55A 4A76A 1QZGA 4BBRH 1YVCA 4A3FG 3TZUA 4JYAQ 1I3QH 4IJLA 2OCEA 3EBEA 1GUNA 2ZM6L 1VQ5A 5AJ3Q 4MTNA 4UPAA 4OWWB 1NBWA 3DXJC 2K14A 4B3TL 4JI1Q 4R4TA 1LM0A 3HOUH 3M3YH 3ULJA 2DUDA 2WAQG 5BN4A 1HNWQ 4TQUS 4AQYL 1YNJC 1AH9A 4GLAC 3RLFA 2K75A 2ES2A 4LK1C 3FKIH 2UXBQ 5JJIA 3CC4A 1X9NA 5JEAJ 1OXTA 4UP8A 2LXKA 2MO1A 5C4XH 3JAMi 3AB9A 2E76C 1CKOA 1QVGA 1N9WA 1U0LA 5IYCG 2VL6A 3J81c 3HOVH 1PYBA 2MFIA 2FMRA 3PIPA 3S15H 4ME3A 4JI7Q 1V1QA 2HH3A 2CTEA 1K1GA 3CCSA 2YV5A 1EYGA 1TWFH 4LF8Q 1HZBA 2JA9A 1A6XA 3VDYA 1ZZJA 1R9TH 2H5XA 1CTMA 4WANA 1DT4A 2QA4A 1I6VC 3CRLC 1KAWA 2DGYA 4JV5L 1AE3A 1Q46A 4A3IH 1EWIA 1B7YB 2R92G 5LMNL 1VIGA 2I0QA 3A8IE 4A93G 4HJ9A 3CCVA 4BY7H 4DR6L 1PFSA 3ULLA 3CF5A 5FJ8H 3OTOQ 3S1MH 2CFMA 2HIXA 2Y0SE 1XMQL 4DV0Q 4B3RQ 4DR5Q 3RN2A 4JI6L 2JA5G 2AKWB 5GROA 2N3SA 2JJQA 2VW9A 3U9SA 2V4DA 2K7VA 1XPOA 1YHQA 4O0AA 5IE8A 3IFTA 1A62A 5LMUQ 3LWUA 2VZAA 1DGSA 1VQGA 1KL9A 2NN6G 5C0XI 2R93H 2UUCQ 3S2DH 1GM5A 2IHEA 4JCVE 5E7NA 3MXUA 3ER0A 4HIDA 1FJGQ 3PUXA 2K5NA 5JJLA 3U4VA 3SGIA 2VQFQ 1YNNC 4POFA 4A3LG 5K36G 4JI2L 2KHJA 2B63H 1Q86C 3PO2G 4I7ZC 1H9SB 4GOPC 4RG1A 4B3SQ 2IX1A 1KRSA 4OONA 2HHHQ
chains in the Genus database with same CATH superfamily
1N36H 1K8AC 4DV7H 3CQZH 5T1GA 2JZXA 1EU4A 1X3PA 1SSOA 3IAYA 1XPUA 2E5LQ 1NY4A 1N33H 2EDGA 1HR0L 3UDFA 5C0XG 1E1TA 1G291 3MC0B 3C1EA 3EROA 4C56C 4CJ1B 3L3OC 5JJZA 4KKTA 1ENFA 5ELFA 4B8TA 4GNXA 2OF1A 4NDXA 2FPHX 1EZ8A 1N34Q 1PLFA 1I5FA 1B1ZA 3D6CA 3CC7A 2H4OA 4R8IA 1Y1WB 1M4VA 2AQ2B 2QNDA 1YJNA 4A3FH 1XPRA 1TT2A 3R8BA 3OHXC 3OOCA 3EIVA 1LTRD 5M3MG 2KCNA 3KLRA 3NBHB 3GTGB 1M90C 1PFMA 3R93A 3CW2C 4UDUC 1VQPA 3NTKA 4J8QA 5M3MB 2HUGA 4LFAH 2LS01 1XNQH 2PW5A 3UI2A 1MJCA 2UU9H 3GTOH 1UE5A 1LTID 2LF0A 1YI2A 1EYDA 3R3OA 4EGVA 2BH2A 2Z1CA 1X3QA 1HNZQ 4B3MH 3GDEA 1BOSA 1LABA 3W1BA 3OIPA 1QNUA 3NUCA 2UUBQ 1Y8PB 4L5TA 4LW1A 1IYUA 1IBLL 4E9JA 1MD2D 3G48A 3J80E 5LL6b 1K8GA 2HCIA 3SR1A 1FGBD 1VQFA 1K3BC 3SK5A 2WFWA 3PV0A 1Z47A 1E2WA 2GVAA 1S40A 4DR4Q 1S5DD 5IYCH 4GS3A 2B2VC 4KD3A 3A7AB 4OX9Q 5JEAG 2YU9B 1VF7A 4BBRG 1E2VA 2ICEC 3OMCA 3QR8A 1S5FD 2FFMA 2EXZA 4A3JH 3I4MG 1BBUA 1C0AA 1G91A 4YIJA 1LTLA 1SNPA 2B2YC 2G5DA 3LNNA 3T1YH 1E22A 3S9WA 4BBRB 4A75A 4GOPB 2Z8LA 4O2DA 4TSSA 2JP1A 4ZYSA 4MZ9A 3KF6A 2VS1A 2NVTB 1QUQB 3CU7A 3I4MB 1PTOH 3S14H 3FPPA 1IBKL 4GN3B 3STBC 4G7HC 4FJUA 4Z9CB 4DK1A 1XNRH 2A1SA 4IOAA 2OQKA 1QVFA 4DV4L 3GV6A 4NXML 3M3YB 1RL2A 1V1OA 5I9PA 1BO0A 3ERQA 1U5KA 1BCPC 5G3LF 3Q0AA 4L5SA 1CA6A 1HNXQ 2R92H 1CA5A 1KABA 4EQ5A 1WVLA 5BN5A 4X65H 4LF7Q 3S17B 3M4OH 2KECA 3X3NA 1PRTC 1STBA 2JVZA 1ODHA 4IUTA 3WOFA 4GN4B 3DWAA 5CR3A 2IWHA 3PSIA 1IBMQ 1LACA 3J7A5 3D4WA 4AH6A 3K8AA 4XT3B 4DR3L 1L2FA 1I94L 3T1HQ 1PMRA 2F4VH 1ICFB 4FP5D 1KLUD 2PZTA 5HURA 2JA5H 1SRUA 2KQ3A 1Z2IA 1ZZKA 3X3MA 1VS0A 1CSQA 4RMFA 2KA7A 4Q5VA 3HFZB 1K28A 4AYBE 4OWXB 2KHSA 3NSWA 4JI4H 2K5DA 3S15B 2XWBB 1N36L 2XVSA 3HP3A 3DLLA 1NMGA 2F0FA 3HS0C 1EQRA 2FHTA 1Y69U 4LWCA 1SYCA 4YWLA 3D4RA 4WJ4A 1N33L 3J81L 3S24A 2NN6H 1K8OA 2B2UA 3H15A 1Y8OB 2VQEQ 5C5MA 1R9TB 4RFBA 4DK6C 3RN5A 2EZVA 1CZWA 3EJIA 4P73A 3GP7A 2K50A 1F77A 2UUAQ 4YY3H 2NTTA 4LF5Q 4YHHQ 4J6HA 2R6GA 3B6YA 4C3IH 1STAA 4GKJH 1JJCB 4HJ5A 3RR5A 1EU3A 1XWEA 2JE6I 5LHY1 3FPUB 1K83H 1TVXA 3SB1A 1B9MA 1UEAB 2K5QA 1V1PB 4CBVA 1UEBA 4A3LH 3MVVA 5K36H 1MBYA 3NEMA 4LFAL 1ZKOA 1XNQL 1PYSB 2AUKA 1W3SA 4CDEC 2UU9L 4X62H 3RUZA 1A3UA 4LF4H 1AZQA 3UDIA 2CQAA 3BDCA 4B3ML 4QIWE 1EL0A 3EFXD 3FAUA 4KHPL 3F8TA 2PT7G 2A6HD 3I8ZA 2X06A 3PQIA 1XTCD 1PH1A 1BCPB 4HN7A 4DAVA 3BVZA 4PQXA 1Q81C 2WP8J 2B8GA 4PNYA 1I6HB 1PH4A 1E1OA 3K5LA 1EC6A 5D3IB 1JT8A 2BDOA 1BVSA 3OETA 2E74C 4K6LA 2WINB 3KDFB 4TRDA 3KOJA 2F3VA 1D6EC 3NQIA 4IQZA 1X3FA 4K0KH 5IP7G 5LMNH 4QGUA 1UUPA 3K57A 2IJ0A 3U50C 2Y3MA 2JQOA 3EZJA 1JOQA 2K6AA 1ZZIA 2ENBA 5M3MH 3ZYYX 3CCUA 5DNFA 1K3RA 5I2YA 2EY1A 3T51B 3S2DB 4GKKQ 2A68D 3T1YL 2HQLA 1EIYB 4H13C 1O7YA 4B3TQ 4DV2L 3BU2A 4JK1C 1S03G 3A54A 2E2HB 5LL6S 2XRSD 2E2JB 1DD2A 4KHZA 4LFCH 2A6EC 3H6MA 4JBWA 2ZTCA 3CCJA 1WFQA 4ZQ3A 1B2TA 2Q2TA 4AQYQ 2Y0SG 1IW7D 1V9PA 1GUTA 4HR7B 1XNRL 2JA8G 3NELA 3I4LA 1MI2A 4NZTM 5C4JH 1EY7A 3S1QB 1IYVA 4PDBA 4DAYB 3C1FA 1JORA 2Y0SB 1EQTA 4ODGA 2BDNA 4JI7H 4WORA 2Z9HA 4HTHA 1ET9A 2A69C 4ZLTF 3GTQH 2JA8B 5A2QE 1H95A 4K8IA 2CPMA 1V43A 4C1NK 3QJYA 3FRPB 5NUCA 3CPWA 1M1KC 3CQZB 2YU9H 1PTOC 2LY7A 2HCCA 4X65L 2CKZB 3TEHB 5A2QW 4FJSA 2JEAI 3I73A 3P20A 3NE5B 3DHQA 2ZXRA 3J80L 2Q8RE 1GHJA 2SEBD 1EOTA 1YIJA 3TS0A 2CWFA 5IWAQ 4RGMA 4YWKA 4DV6H 1D8LA 1GD7A 2NVXB 3U58A 4LF6Q 5G3LD 3SDZA 1PA6A 2LTLA 2NVTH 3TS2A 3I4MH 3L7ZC 1S5BD 2F4VL 4X66Q 4B08A 1G6PA 5GQOA 1EZ6A 2RCFA 3OMGA 1BNZA 4KTAA 1SNOA 4JI2H 1PFBA 4LF9L 3GTJH 4JI4L 4R4IA 4DUZH 1TWGH 4CKCA 2PY9A 2HT1A 3T4AC 1GOZA 4LUZA 4DV3L 1WTWA 1KDBA 1QILA 1SMXA 2DGRA 1G2SA 1VCIA 3RLOA 1SAPA 2N55A 2A8VA 1YNXA 2GN5A 1BXTA 1OO9B 3GTOB 4H44C 1X9ZA 1CI3M 3S17H 3G4SA 2ZXOA 1L1OB 1VQEA 4JV5Q 4DR5H 1B53A 4OIKA 3A74A 2E3UA 2E75C 3MXNA 2NZ1D 4YY3L 2CTKA 4IUQA 2PMZE 2ZTDA 1B44D 3A8JE 4ALPA 4XTCS 1JE4A 4DR6Q 2CTJA 1UE1A 1NNXA 4GKJL 3A5UA 1TUAA 2K4KA 1T5XD 2Q2HA 3VR6A 3J7YW 3TDQA 1KC8C 3EVQA 4JI5L 4ULLA 2IT1A 4G7ZC 4DK3C 3U9OA 1WTQA 2XGTA 4U68A 1XXGA 1XMQQ 5K5PA 2AMCB 2X69A 3QB3A 3IRBA 1J5EL 1S4ZA 4JI6Q 2F0LA 4DR7Q 4XDXA 4JVZA 4A3JG 4AM3A 4KHVA 4WJ3M 3BDLA 5CV7A 4X62L 2G8YA 1FR3A 4NZRM 1YZ6A 4LF4L 2QF7A 4Y7NB 1N32L 5DEHA 1WTPA 2QEXA 4BWGB 4DR2Q 1WOCA 2YTVA 1PH9A 4A3JB 4JG2A 3FMCA 2VB3X 5EBCA 3MZ5A 4F88A 3F2UA 2QEJC 2YTYA 2EYLA 2VY3A 4A3GH 1CQFA 5AJ3L 3CCMA 2IW3A 1JC7A 1I4RA 1PTOB 1EUJA 4PV1C 3W5OA 3OIQA 4DAPA 1VQAA 5KNBA 2Z0SA 3J80i 2NN6I 1J5KA 2KEEA 4K0KL 1H9SA 3UE0A 4G08A 2EPBA 3FHWA 1WTRA 4OO1I 4B3SH 4G7OC 1PZKD 1HNWL 1Q3LA 2QW7A 1G8ZD 4H8AA 2BCOA 2R92B 4CKBA 1KDCA 5F2DA 4IPDA 1R4PB 2NTSA 2UXBL 3PO3G 1X56A 2Q2IA 4DV5H 3V2TA 3QOJA 1ZYRC 1VIHA 2WV6D 3VYTA 1O7IA 1LTSD 5IODA 2WB1E 3MAQA 2OTLA 4LFCL 3PCOB 2I5MX 3PO3B 3ITPA 2ZXPA 3VR5A 2ZTEA 2YYZA 2MGSA 4K5VA 2F0KA 3G71A 1B50A 1N34H 3CD6A 4YWMA 1I6HH 4FO2A 5IGBA 1X65A 1YJ9A 3KJOA 1M8AA 3FDTA 1A15A 1I50H 5HY6A 5EBDA 3NBHA 2DY7A 3VR3A 1VF5C 5D3DA 1HR0Q 2NZOA 1C4QA 4JI7L 3G7LA 1EQVA 3PUZA 3JAMc 5I4DA 1EY5A 4R8NA 5HGTA 3TRZA 2MP1A 1XMOH 1WCMG 3U1KA 4OO1G 1BCPF 4ZUIA 2J7ZA 3SVMA 5IP7H 4LF8L 4Y52H 2DNEA 1HA6A 4B8CD 1MHWC 1J6QA 1EYCA 1PYWD 2IY5B 4DUYQ 3AQQA 3T56B 4C3IG 4DV6L 1HNZH 1WI5A 1I4PA 2E2HH 1KAAA 1B3AA 1H9RA 3AFPA 5CYUA 5FKAC 2E2JH 1PRTF 4RKBA 4S3SA 4YCUA 3K0XA 1NMFA 1S3OA 1AEXA 4C3IB 5DT9A 5LL6X 5A35A 1IZ6A 3H3VC 3S1QH 2B2WA 1K83B 3PUYA 4XIGS 3CCRA 1SLJA 5ELOA 4NXNQ 1HUMA 4DUZL 3OSOA 3KLWA 4QB4A 4WALA 4L5RC 1JB7A 1STNA 2JA8H 1RTNA 1SMYC 2B8FA 1MSGA 1Z6HA 4L8JA 2LKVA 4NP5A 5DLQE 1HRJA 2CPQA 4LFBH 4DKAC 2L55A 1CHQD 1K73C 1IBLQ 4AYBG 2VXWA 4MN3A 4DR5L 2F0JA 1KDAA 1QZHA 2B29A 3F2CA 3K5OA 4V0BA 4GOPA 2NVXH 1IL8A 2DY8A 2EYJA 4OHJA 1YHAA 4X64H 2K1BA 4LIJA 1DONA 4AYBB 3PF4A 4JI8Q 1QUQA 5FOBB 5A2QL 5EGTA 1WD1A 2R61A 1GUOA 1CHPD 5FLXc 4JW0A 3H3VI 4DV1H 2KCMA 5IT9L 2CVRA 2JA7H 3T53B 1VQ8A 3I91A 2KJXA 1KLGD 3ERSX 1SYEA 1NXUA 3JAME 4H02A 1OXSC 3RF2A 1MJEA 4RCNA 4DNIA 3I7FA 4F8MA 4ZAIA 4K8JA 3D3RA 1RIPA 3IKJA 5EKLA 3JAMW 1U9RA 5CBEE 1WHRA 1EY4A 2EVBA 5C5LA 4DR1H 3H0GH 1F0XA 4FNFA 2F4IA 1EFWA 1STYA 3K80C 3GQBA 2N8NA 1XYIA 1DYQA 3ULPA 3A5ZB 2H1EA 5CGKA 4DV4Q 2XNAC 1Q8IA 4NXMQ 1VQMA 2PI2A 4KHPH 1FVIA 2E8GA 1IBMH 1PH5A 1FYCA 4OIJA 4QJFA 1EEID 1BDOA 4UP7A 3T1HH 3NENA 3Q22A 3KF8B 2PQAB 2OWOA 2UXDQ 2ZQEA 1TKWB 2E2IH 1H9JA 2ZJPA 5C4JB 1F2MA 1VQ6A 2M6QA 1YHBA 1ASZA 1ONLA 1J4WA 4B3SL 1SNMA 4A3EG 3C3LA 2OEOA 4K5XA 2QDBA 5JPNC 4QIWB 2KUMA 1RCVD 3GTQB 3M4PA 1SBBB 1LYLA 1SDFA 3CCEA 4Y7NH 5ELEA 4DV5L 1II3A 4DR3Q 1QE6A 4A3EB 1PH8A 1I94Q 1QVCA 2A74C 3HOXG 4FYDA 4HIOA 1K0RA 4QF4A 4BXXH 1ASYA 3Q24A 4DV2H 2BE5D 2JYOA 1VDZA 4BA1I 1IKMA 1N34L 1CKNB 3NPPA 4NBQA 4IPCA 1IYJB 2R3ZA 3J7ZC 2UUAH 1N36Q 4DV7Q 3KJPA 1SN8A 4LF5H 1JICA 1MGSA 4JI0H 2HQEA 1F2YA 2OQ0A 1TY2A 1TWCB 5IYBG 5CORA 4KMUC 1N33Q 3P7JA 5J22A 1B3QA 2K05A 4JBMA 3GTJB 5FLXW 4P2CB 2B2YA 2EJFC 3CMAA 2K33A 2IHFA 1SFOB 1E3PA 1TWGB 1V1PA 2F0HA 1T9HA 1P8LA 1XMOL 3S2HB 1RHPA 1VQ4A 1QOHA 2CQOA 2MJHA 4DFAA 4OXPA 4IUUA 2B3GA 2TSSA 3K7UC 4FXKC 1JJ2A 1BKBA 4PMBA 1PTOF 1WTOA 5L37A 1HNZL 2PYKA 3S16B 1PXUA 3GABA 5FO7B 3STBD 2NVQH 5BR8H 3LGJA 1I4XA 5E1FA 1W2BA 3PO3H 1LV9A 4N9PA 4CKEA 4QQBX 3PMFA 5C44H 1SNQA 4LFAQ 3RZDH 5DM63 1F9SA 2CWAA 4BBSG 2M9VA 1BCPD 1KD1C 2UU9Q 3NBIA 4JI3H 4CHTB 2F3IA 4RA8A 1U4PA 4A3DG 2Z4IA 3EQLC 1X3GA 2GVBA 3KDFA 1TR5A 4DR4L 2EYFA 4LF9H 3GTKH 4BBSB 2K5VA 4DAMA 3I2ZA 3QWNA 4LFBL 3TREA 5EPLA 3RD4A 1X3EA 4A3DB 1OXUA 1H9MA 2Z4HA 3A7LA 2QILA 4FXDA 4DV3H 4CDCC 1I4HA 4HSPA 1CK1A 4EQOA 3HKZE 4IUNA 4UHVA 2K01A 4A3GG 4ZK9B 1CUKA 4M8AA 5EKIA 4GKKH 1K9MC 3CHBD 3VA5A 1HFGA 2ATWA 2K5HA 3Q8DA 4AIMA 1GUWA 2K1HA 1HQMC 4GLXA 1I4QA 2LXJA 3DMUA 3WWVA 1WCMH 4X64L 4OO1H 4QMFB 2D9UA 3K81C 4LMQD 4A3GB 1HTPA 3OPOA 4DK0A 2QCPX 1NJIC 1KRTA 3NXWA 1ZTGA 4POGA 1V8CA 2F0SA 2NUCA 1STEA 4DV1L 1XTDA 1VQIA 3Q23A 3W1GA 4JI5H 1DZ1A 2TMPA 4DAYA 3T1YQ 4L6TB 5D65A 2EJGC 4G4KA 4C3JH 3NHHA 2MQHA 2RVLA 2ZT9C 3E9HA 5M5YB 1MSZA 1EOVA 3TP8A 1J5EH 1HNXL 3T16A 1WTXA 4IJHA 2IX3A 2EYOA 3BDOA 1EFID 3SXHA 4DR1L 1BQQT 2QKIC 4LNQA 1PH3A 1PZJD 2PNHA 3I4NH 3NK9A 1N32H 2A6HC 2XSCA 1A3TA 3WOEA 2UXCQ 2CWHA 1HPCA 4JYAH 5GAEC 2HH2A 1IBML 3SE0A 1CQVA 4LF6H 3QO2A 1UWVA 3T1HL 1HH2P 4X66H 4HCSA 3QIAA 4A3MG 3W3AA 4X65Q 1WYDA 1I50B 1EIGA 1A2TA 1PRTB 4OEMB 1EY6A 4HJ8A 4JI1H 3HKSA 2EXDA 1JWUD 4KN7C 4EQPA 2R7DA 1TS3A 2RHSB 4IFDJ 1Q1BA 4GZYC 1EIFA 1Q7YC 3HEJA 4A3MB 1D7QA 3VYSA 5IGFA 1SEBD 4K14A 4MNOA 4X3TA 1HNWH 1VQ9A 5KGUA 4LAAA 1SYDA 1SE3A 2A68C 3S1NB 4JVYA 2VUMG 2ZM6Q 2K32A 4KY6A 5T1IA 3MXGA 2HDMA 5ELBA 2UXBH 4NW2A 2B2TC 2G9DA 2BA1A 4ZUJA 1L0WA 1VQDA 1L1OA 2VB2X 4XT1B 5M5XB 2J4XA 1BF4A 3K59A 1DXMA 5JPMC 3NWTA 4IOCA 4JI4Q 2NZHA 2VUMB 2UUAL 4A3KG 1Q1EA 4LF5L 2HDLA 3C46A 2ASBA 2RDFA 2M8WA 1XX8A 2KBNA 1YITA 4JI0L 2GA4B 3I90A 1I4GA 3KFUA 1HZCA 3GTMH 5ELNA 3J81i 4A3KB 2WB1G 1Y1VH 2EYMA 1HA5A 2OT2A 1Z7TA 2EYPA 4X3UA 2F3WA 4E6IA 3GTPB 3KBXA 4IZ8A 5BN3A 4JOIC 3ND9A 2F0OA 2PW7A 2XWJB 4F87A 1C7YA 2Z6KC 2KEDA 4FF3A 4DR7H 4R1JA 1WJJA 4YY3Q 1HCZA 2JA6G 2A1AA 4ME5A 5CV8A 2WB1B 5IGGA 1KIXA 1CM9A 1R4QB 1GUSA 1AW7A 1U4MA 4HMJA 4ZRZA 2A6ED 3TP5A 4GKJQ 4A3EH 1D5ZC 1HZ9A 2KHIA 1Q90A 2K28A 4TVAB 3H3VH 4LF8H 3U4ZA 2PI2E 3MFGA 3GKUA 1LUZA 5BR8L 1VQBA 2F0EA 1PH6A 1HR0W 1DOLA 2P2RA 1CT1D 1IXRA 2LRRA 1RDPD 4RGOS 3W2DA 2JA7G 2NBFA 3HOXH 1ILQA 4YCVA 4X62Q 1GUGA 4JI3L 5JOBA 1OXVA 4QCLA 3K5MA 1WVNA 2A69D 4RHRA 1TWCH 5I2XA 5CV9A 1F2ZA 1X0AA 4BS9A 2P5ZX 3VR2A 1PTOD 2L5TA 2JA7B 4ABNA 3ND8A 1NSNS 4NPSA 1PHJA 4XQQA 4K2LA 1SFOH 3H0GG 1UE6A 3I4OA 2Q8IB 3HOYG 2IX0A 2SOBA 4K5WA 5IYBH 3S2HH 4CDDC 3RZOH 4WFN3 4HIKA 1SE2A 4XXEA 4TKOB 3NTIA 1E7ZA 2VKCA 3D0FA 4APVA 3OTOH 4GKKL 2BH8A 4H7BA 3BVMA 3H0GB 3MTSA 3HGBA 4HCEA 1Y14B 3S16H 3TMEA 4DV0H 4B3RH 4K0KQ 2BL5A 2FINB 4LUVA 5C4ZA 1BBWA 5LMNQ 1ET6A 1PVOA 2RCNA 1C9OA 2LSSA 5E4XA 1AP0A 1KHMA 1JWSD 2PQEA 4A4IA 1NTGA 4KN4C 4A3CH 1Y8NB 2D5DA 2C9OA 2E2IB 4PZ6A 1YNJD 5J1ZA 1K0SA 1AE2A 2NB0A 5LMUH 4BBSH 2DJFC 4CJ0B 3R2TA 4LFCQ 4R4CA 4A3DH 2SDFA 4BXXG 2RQXA 4DGZA 3GO5A 2L9HA 1DOMA 1CSPA 4L5QA 1HZAA 4U673 3BG3A 4C2MB 5JVG3 1Q82C 2LTMA 2UUCH 5C3WA 1B9NA 2FMCA 5IWAL 3OW7A 1A2UA 1YEZA 4JYAL 2AHOB 3MA2B 4LF6L 4KY7A 1FJGH 4A3BG 1DCZA 3CCLA 3AEVB 5EQ0A 4X66L 3RMHA 4K6DA 4X3SA 2VQFH 2BA0A 3I0PA 4XQJA 1ENCA 5M5WH 4R4OA 2Q2UA 1GXDC 3IFDA 3I3CA 2RSOA 5FLMH 4A3BB 3SK6A 4RHSA 5D14A 4JI1L 1TXYA 3NWSA 3H91A 3L2PA 1C48A 1VQNA 2NYZD 2O5IC 4P72A 3D31A 5M5YH 4DV6Q 3DM3A 3NP8A 1T5EA 4QY7A 4DN4M 1YBYA 5IYDG 2CCZA 2L4NA 4FXGC 4BY1H 3HOWG 2O2LD 2FMMA 2HHHH 1D2BA 1IL2A 1EYAA 4LUOA 1TS2A 2D62A 1HTLD 4DNRB 2KENA 1NR2A 1FD7D 4P74A 1OXXK 2E5LH 5C44G 4JI2Q 4JC0A 1SJED 5KNDA 1H9KA 1AFPA 1GJXA 1OTCA 4BA2I 4N8X1 1KHIA 1FL0A 3WDNA 4DUZQ 1EQQA 4IFDI 2NVQB 1TWAB 3CRKC 3GR5A 3TP6A 5C44B 3NCVA 2MUYA 2V1CC 3RZDB 4MIUA 4OELB 4DNTB 1VQOA 1VMCA 2VNUD 4PZ7A 1SE4A 1UNSA 1O78A 2RHQB 3OSSD 2F0QA 2EIFA 1SE8A 3CCQA 2RSNA 1SR3A 2PNRC 3NQTA 2O4CA 4HJ7A 3GTKB 3MXNB 4DR7L 4V190 1PFNA 4A3MH 2ALYB 5FO9B 4XQNA 3S1NH 1X4NA 3IL8A 1EIHA 1K8MA 2CW0C 1B70B 2L11A 4I7AA 4DR2L 4NMZA 3MFYA 5J3BA 2K52A 2D2CC 5M5XH 5C6AA 3M4YA 4OL7A 1EEFD 1WCMB 2I5LX 2VUMH 4M1UB 2UUBH 1ENAA 3GTLB 1YJWA 1X55A 4O42A 2L15A 1CFMA 3BZKA 4C3JG 1GKHA 4X3KA 4IFDG 1IKLA 1JOKA 5CV4A 4WJWA 3KF8A 2PQAA 2B2WC 4A3KH 3CP0A 2MPMA 1HFNA 4L63B 1ESRA 3GTPH 2OXPA 1RJTA 2CTMA 4DR4H 1STHA 4C3JB 5JVH3 3I4NG 1X4MA 3PF5A 5KYIA 1RKNA 2L0CA 4OX9H 2RA4A 4GLVB 1MKHA 1QJOA 5M3FH 4IPHA 5GAGC 3OTOL 3BZDB 1A63A 3TZDA 2ANRA 2WAQE 3CPFA 5M9OA 1JE5A 4KKUA 5E4WC 4FF2A 2R7ZH 3I4NB 1DJRD 3J80c 4DV0L 1UE7A 3G6EA 4B3RL 3OWEB 1YNND 2PPBC 2JA6H 2I5HA 1LT6D 4GNXC 5ISRA 3CXCA 5I6YA 1CZGA 1CKNA 3HKZG 1ICWA 1JMCA 2ZJQA 3M85A 2BOSA 3KUPA 4JVHA 4UP9A 1VQJA 1QNKA 1UG8A 2PZUA 2AWOA 1SMYD 3HZXA 5E3FA 4QMGA 4DV5Q 1E24A 3HRZC 3CAMA 5CV6A 1Y1WG 5IP9H 3HKZB 5LMUL 4JBKA 2RDGA 4KJNA 3LX0A 2X6GA 1EY0A 2EE1A 3EA6A 2QGQA 4ZCKA 3F2DA 4UY8C 2O5JC 5EAYA 2EY6A 5JJKA 4KJOA 3HOZG 1JR0D 5KNCA 4PZ8A 2AXYA 1HNXH 4C3HG 2UUCL 4CGYB 2KCCA 2ID0A 1U4RA 3HOYH 1O7LA 1IBKQ 4DUYL 4LF7H 1QWYA 2M2LA 3HOZB 2R7FA 2MHVA 1KTKA 1FJGL 3AFQA 4C3HB 2L12A 1GHKA 1Y1VG 4LJZC 4XYQA 4RGTA 2EY5A 5EKKA 4B9XA 2VQFL 1WTHA 1XMOQ 2F0NA 3E6ZX 1TY0A 2K04A 3SK8A 1WE8A 2PZWA 1BUVT 4QUCA 4YCWA 3I70A 3GTMB 3E0EA 1LTAD 4NXNL 4IURA 1D1KA 1Y1VB 2FFKB 3M4QA 1ML0D 1A0IA 1X54A 2JSOA 3S1RH 2AQ3B 4RGNA 4KV6A 3K5NA 3D6WA 1HXYD 4DXGA 2HHHL 1SYBA 1JJGA 2NVYH 3F2BA 1N8RC 5DM73 2LFNA 4NKLA 1W6JA 2A19A 2F1MA 4IPGA 3CMEA 3AYHB 2CH4A 4C2MH 5C3EG 4WRDA 3H94A 4B9WA 2E5LL 2MJ8A 4P75A 1LT4D 4J15A 3RLNA 3TN2A 4HJAA 2BE5C 2N49A 4ID6A 4HEDA 3J80W 3QG1A 2VQEH 3PGZA 3QOLA 4DA2A 3TBIB 4IUVA 5I9OA 3SK4A 5C3EB 4JI8L 3UDGA 2B2VA 5IIFA 3HOXB 4LFBQ 4YHHH 1A3VA 1TWHB 5FLXE 3EN2A 3GD7A 2MO0A 2JXMB 1XJVA 3TQYA 2F52A 4A3BH 4IUPA 4RAUC 5IGEA 4DF7A 1DTJA 3OYYA 1JOOA 2XTIA 5COYA 3ZJYC 5AFWA 4ZKCB 5EJWA 4X6AH 2PCFB 1I6UA 4FF4A 1I3QB 2RF4A 4X64Q 4GNXB 1TS5A 3UOEA 2MNAA 1AN8A 1TQOA 3VA7A 3T13A 3RZOB 3A0JA 3PUVA 4IN3A 3HOUG 2YTXA 2JK8A 3K58A 3E9IA 3SEBA 1NUCA 2AQ1B 4R4QA 1S5CD 4DV1Q 2OTJA 5IYDH 3VR4A 3HOWH 1ILPA 1RD9D 3MWYW 2JEBI 4OD6A 2UXCH 1VQ7A 3FKIG 2IPKD 1WTJA 3HOUB 1TWAH 2UUBL 2B39A 2C35B 4A3CG 2YQRA 1TU2B 1X32A 1U4LA 2E2DC 1PH7A 1SJHD 3E0JA 1XNQQ 5DAUA 1RF2D 1RTOA 1CKMA 2UXDL 4DR1Q 5C4XG 3FKIB 4A93H 5FK9C 5KYLA 1FNVA 2D0PA 2F0IA 4B3MQ 2OPVA 4QL5A 3VYRA 5HGQA 1LT3D 3K6OA 3V05A 1D5XC 3HOVG 4OX9L 3BYTB 3I56A 1PRTD 4KHPQ 5C4XB 5JAVA 1ZXTA 3CC2A 5EPJA 4N9TA 2J0TD 1LT5D 2G9HD 2ZM6H 3QD7X 2HD3A 3I72A 3L9AX 3V69A 3HOVB 2XN9C 2EQSA 4O1NA 2B2UC 1VQCA 4B3TH 3L0OA 2I07B 3AMUA 2RBMA 5KIXA 2HHHQ 1PH2A 1J9OA 1LTBD 4DV7L 5FLMG 1TIID 3GTLH 1Z9FA 4J1MA 4OWTB 2F0WA 2SNMA 4AQYH 4CJ2C 1KNAA 4OGQC 2AWNA 5ELDA 4BY1G 5M5WB 2AUJD 3LWEA 2D0OA 1X6OA 1TWFB 2OPUA 1FGUA 1HHVA 4UAIA 1KXLA 1F9QA 5J39A 3BYYB 1VBIA 2ANNA 1G2TA 3N6RA 4HIMA 5LMNW 4DV2Q 4IFDH 1ZEQX 4BY1B 4NB3A 3UDXA 4A3IG 4KLKA 3KF6B 4JPBW 1VQLA 2ZJRA 4JI0Q 2PMZB 4G57A 1E2ZA 3N52A 3R2IA 3K7AH 4LF7L 4BY7G 2KCTA 4FVMA 2NWGA 4EX5A 4A3IB 1XNRQ 3OW2A 5GADC 4PMCA 3BJUA 5FJ8G 4H0LC 4JBJA 1A8VA 4EQNA 1WD0A 1QCBD 5FO8B 5IWAH 3AU7A 1PV4A 1GVPA 1Q12A 1KQSA 4BY7B 3PO2H 3J7AF 3VKEA 3P75A 1P16A 4DPGA 1S72A 2KVMA 4PG3A 2F0TA 4KY5A 2EJMA 5C3XA 3BS1A 2EYHA 3S1MB 1E0BA 5IT9c 1SEIA 5GAHC 4HAEA 2CWPA 4QUFA 5IY0A 2WACA 4MHEA 1KNEA 2N78A 3GV3A 3UE1A 3M7NA 3E3XA 2LMCB 5BR8Q 2DNCA 3ICEA 3MEFA 5C4HA 4DXFA 4P71A 5C0XH 3DEPA 1Y1WH 4RH6A 2CTLA 5KEEA 3PIO3 3H09A 1EY8A 4C1NI 3RNUA 1VQKA 2WIIB 2F4VQ 4JI3Q 1WTVA 1NE3A 1L1OC 5H1SE 2VQEL 3GTGH 1Q8KA 4JV5H 3HOZH 4GN5A 3M9BA 2R93G 2M00A 1MIUA 4LF9Q 4C3HH 3F1ZA 3JAML 1IW7C 4HSVA 3HG9A 4YHHL 1V9NA 4DV3Q 4DR6H 3PUWA 4PMWA 3MHBA 2R93B 1SYGA 1XRHA 3PIOA 3J81j 1VQHA 4ILWA 2F0DA 2B2TA 5M3FG 1D5MC 1XMQH 3JC66 2CTFA 2D9IA 2R7ZG 1SXTA 4R9WA 2B63G 4JI6H 1S5ED 4IO9A 5CBAE 2HIVA 2RDHA 3FP9A 2K03A 3BZCA 5C0XJ 5M3FB 4KKSA 2R7ZB 1B8AA 2B63B 2F03A 4JI5Q 4DR2H 3KYHC 3A55A 2UXCL 4OCHA 1GO3E 1SROA 2JA6B 4JOIA 4MTKA 1G51A 1V8QA 5C3EH 2Z6KA 2PO4A 3DM1A 1J5EQ 4N8FA 2DN8A 1AZPA 2A73B 5IP9G 3AEVA 5IGDA 2FXQA 5CMDA 1TWHH 5IT9E 1EWHA 2DJGC 4LF4Q 2PQUA 1N32Q 2KOLA 1EY9A 2EY2A 1PQXA 1HJPA 1JWMD 4FDBA 3A8KE 4KI0A 1FNUA 2IL8A 5JEAH 3I55A 1MSHA 4A76A 5IT9W 1O80A 1QZGA 4BBRH 1YVCA 4A3FG 3TZUA 1W6KA 1I3QH 4JYAQ 4IJLA 1FKAH 4FF1A 1L0YB 1HUNA 2OCEA 1F2LA 3EBEA 1QG7A 1GUNA 2ZM6L 1VQ5A 5AJ3Q 2CH4W 1UAPA 2QDLA 4MTNA 4A3FB 2C5CA 4UPAA 5FLXL 3HOYB 4OWWB 1NBWA 1JB3A 2K14A 3DXJC 4B3TL 4JI1Q 3O13A 2JN4A 4R4TA 1LM0A 3HOUH 3M3YH 1LLRD 3ULJA 2DUDA 2WAQG 5BN4A 1HNWQ 3DEOA 4TQUS 4AQYL 1B4OA 2SNSA 1YNJC 1S20A 1AH9A 4GLAC 3RLFA 2K75A 2ES2A 3FKIH 4LK1C 3VYUA 2UXBQ 5JJIA 3CC4A 2WAQB 1X9NA 2WKDA 1NAPA 5JEAJ 1OXTA 1HR0H 1O7ZA 4UP8A 3PIP3 2LXKA 3S1RB 2MO1A 1SNDA 4EC5A 2N88A 5C4XH 3JAMi 1NCVA 3KLSX 2NVYB 3AB9A 3TSSA 3CKIB 2E76C 1CKOA 5CC4A 1QVGA 1BR9A 3MEHA 1N9WA 1U0LA 3TP7A 5IYCG 1F9PA 2O4XA 2VL6A 3J81c 5ELCA 3HOVH 1PYBA 1C8CA 5KRUA 4KD4A 3C2PA 4DUYH 4F7XA 2MFIA 2FMRA 1SYFA 3PIPA 3S15H 5TSSA 4ME3A 4JI7Q 4RCOA 3BVGA 1V1QA 3G6JB 3DUZA 2HH3A 2CTEA 3KBGA 2Z6BA 1K1GA 3CCSA 2FJ2A 2EOTA 2Q8TA 1JCKB 2F0VA 1TWFH 2YV5A 1EYGA 4LF8Q 1HZBA 2JA9A 2A5HA 1A6XA 3VDYA 1ZZJA 3URYA 4NXNH 1FNWA 4K2KA 1R9TH 2H5XA 1IHZA 2F0GA 1CTMA 3A56A 3KDGA 1D1IA 4WANA 3NTHA 1DT4A 3M7GA 2QA4A 1PDQA 3S14B 1DM0B 1I6VC 3DWQA 3CRLC 3OWFA 1KAWA 1IBLH 2DGYA 4JV5L 1AE3A 1Q46A 4A3IH 1EWIA 3HOWB 1B7YB 1SNCA 1EWCA 4Q0FA 2R92G 4DU9A 5LMNL 4HMIA 2ICIA 1VIGA 1G6ZA 1LTTD 2I0QA 3A8IE 3D4DA 4A93G 4HJ9A 3CCVA 4RKLA 4BY7H 5I6WA 4DR6L 1QB5D 3KLSA 1PFSA 4IALA 4JI8H 3ULLA 1BBXC 3CF5A 5FJ8H 3OTOQ 5CV5A 1LO5D 3S1MH 2CFMA 5IGCA 4CDFC 4A93B 2HIXA 3M4OB 3MXPA 2Y0SE 1XMQL 3SHLA 4DV0Q 4B3RQ 4I65A 4DR5Q 3V96A 3RN2A 3P1HA 2X6LA 4JI6L 1VMPA 2JA5G 2AKWB 2K5WA 1ZYRD 2WKCA 5GROA 2F0UA 2RKSA 5EPKA 2N3SA 4RWSC 2XIWA 4XYOA 2JJQA 3J81E 3J7AV 2VW9A 2JA5B 3U9SA 1IBKH 2V4DA 4ZKBB 2K7VA 1XPOA 3J81W 1YHQA 4O0AA 5IE8A 1A62A 3IFTA 5LMUQ 4DV4H 3Q6SA 3LWUA 2VZAA 4NXMH 1DGSA 3KK7A 5IOCA 1VQGA 3D8GA 1KL9A 2NN6G 4EVOA 2CHBD 5C0XI 2R93H 3KDKA 1HQRD 3E5SA 2UUCQ 3S2DH 1GM5A 2IHEA 2UXDH 4JCVE 1L0XB 5E7NA 3J7AK 3FEWX 1RODA 2CW0D 1STGA 3MXUA 3ER0A 4HIDA 1ESFA 3ONAB 1LTGD 1FJGQ 2K5NA 3PUXA 5JJLA 3U4VA 2I46A 1NR4A 3SGIA 2VQFQ 3DWPA 4KK7A 1YNNC 4POFA 2XRQD 1J8IA 1AN7A 1TS4A 4DR3H 3K7AB 4A3LG 5K36G 1I94H 4JI2L 2KHJA 2F0MA 1Q86C 2B63H 3PO2G 4I7ZC 1H9SB 1DOKA 3K0YA 2F0PA 4GOPC 1F9RA 4RG1A 4B3SQ 2L1BA 2IX1A 3FVQA 1KRSA 4OONA 1PZID 1JQYD 3PO2B
chains in the Genus database with same CATH topology
1K8AC 3CQZH 5T1GA 2JZXA 1EU4A 1X3PA 1SSOA 3IAYA 1XPUA 2E5LQ 1NY4A 2EDGA 1HR0L 3UDFA 5C0XG 1E1TA 1G291 3MC0B 3C1EA 3EROA 4C56C 4CJ1B 3L3OC 5JJZA 4KKTA 1ENFA 5ELFA 4B8TA 4GNXA 2OF1A 4NDXA 1EZ8A 1N34Q 1PLFA 1I5FA 1B1ZA 3D6CA 3CC7A 2H4OA 4R8IA 1Y1WB 1M4VA 2AQ2B 2QNDA 1YJNA 4A3FH 1XPRA 1TT2A 3R8BA 3OHXC 3OOCA 3EIVA 1LTRD 5M3MG 2KCNA 3KLRA 3NBHB 3GTGB 1M90C 1PFMA 3R93A 3CW2C 4UDUC 1VQPA 3NTKA 4J8QA 5M3MB 2HUGA 2LS01 2PW5A 3UI2A 1MJCA 3GTOH 1UE5A 1LTID 1YI2A 1EYDA 3R3OA 4EGVA 2BH2A 2Z1CA 1X3QA 1HNZQ 3GDEA 1BOSA 1LABA 3W1BA 3OIPA 1QNUA 3NUCA 2UUBQ 1Y8PB 4L5TA 4LW1A 1IYUA 1IBLL 1MD2D 3G48A 3J80E 1K8GA 2HCIA 3SR1A 1FGBD 1VQFA 3SK5A 2WFWA 3PV0A 1Z47A 1E2WA 2GVAA 1S40A 4DR4Q 1S5DD 5IYCH 4GS3A 2B2VC 4KD3A 3A7AB 4OX9Q 5JEAG 2YU9B 1VF7A 4BBRG 1E2VA 2ICEC 3OMCA 1S5FD 2EXZA 4A3JH 3I4MG 1BBUA 1C0AA 1G91A 4YIJA 1LTLA 1SNPA 2B2YC 3LNNA 1E22A 3S9WA 4BBRB 4A75A 4GOPB 2Z8LA 4TSSA 4O2DA 2JP1A 4ZYSA 4MZ9A 3KF6A 2VS1A 2NVTB 1QUQB 3CU7A 3I4MB 1PTOH 3S14H 3FPPA 1IBKL 4GN3B 3STBC 4G7HC 4Z9CB 4DK1A 4IOAA 2OQKA 1QVFA 4DV4L 3GV6A 4NXML 3M3YB 1RL2A 1V1OA 5I9PA 1BO0A 3ERQA 1U5KA 1BCPC 5G3LF 3Q0AA 4L5SA 1CA6A 1HNXQ 2R92H 1CA5A 1KABA 4EQ5A 1WVLA 5BN5A 4LF7Q 3S17B 3M4OH 2KECA 3X3NA 1PRTC 1STBA 2JVZA 4IUTA 3WOFA 4GN4B 3DWAA 5CR3A 2IWHA 3PSIA 1IBMQ 1LACA 3J7A5 3D4WA 4AH6A 3K8AA 4XT3B 4DR3L 1L2FA 1I94L 3T1HQ 1PMRA 1KLUD 2PZTA 4FP5D 5HURA 2JA5H 1SRUA 2KQ3A 1ZZKA 3X3MA 1VS0A 1CSQA 4RMFA 2KA7A 4Q5VA 3HFZB 4AYBE 4OWXB 2KHSA 3NSWA 2K5DA 3S15B 2XWBB 1N36L 2XVSA 3HP3A 3DLLA 2F0FA 3HS0C 1NMGA 1EQRA 2FHTA 1Y69U 4LWCA 1SYCA 4YWLA 3D4RA 4WJ4A 1N33L 3J81L 3S24A 2NN6H 1K8OA 2B2UA 3H15A 1Y8OB 2VQEQ 5C5MA 1R9TB 4RFBA 4DK6C 2EZVA 3RN5A 1CZWA 3EJIA 4P73A 3GP7A 2K50A 1F77A 2UUAQ 2NTTA 4LF5Q 4YHHQ 4J6HA 2R6GA 3B6YA 4C3IH 1STAA 1JJCB 4HJ5A 3RR5A 1EU3A 1XWEA 2JE6I 5LHY1 3FPUB 1K83H 1TVXA 1B9MA 1UEAB 2K5QA 1V1PB 4CBVA 1UEBA 5K36H 3MVVA 4A3LH 1MBYA 3NEMA 4LFAL 1ZKOA 1XNQL 1PYSB 2AUKA 1W3SA 2UU9L 3RUZA 1A3UA 1AZQA 3UDIA 2CQAA 3BDCA 4B3ML 4QIWE 1EL0A 3EFXD 4KHPL 3F8TA 2A6HD 3I8ZA 1XTCD 1PH1A 1BCPB 4HN7A 4DAVA 3BVZA 4PQXA 1Q81C 2WP8J 2B8GA 4PNYA 1I6HB 1PH4A 1E1OA 3K5LA 1EC6A 5D3IB 1JT8A 2BDOA 1BVSA 2E74C 4K6LA 2WINB 3KDFB 4TRDA 3KOJA 2F3VA 1D6EC 3NQIA 4IQZA 1X3FA 5IP7G 4QGUA 1UUPA 3K57A 2IJ0A 3U50C 2JQOA 1JOQA 2K6AA 1ZZIA 2ENBA 5M3MH 3ZYYX 3CCUA 5DNFA 1K3RA 5I2YA 2EY1A 3T51B 3S2DB 4GKKQ 2A68D 3T1YL 2HQLA 1EIYB 4H13C 1O7YA 4B3TQ 4DV2L 3BU2A 4JK1C 3A54A 2E2HB 5LL6S 2XRSD 2E2JB 1DD2A 4KHZA 2A6EC 3H6MA 4JBWA 2ZTCA 3CCJA 1WFQA 4ZQ3A 1B2TA 2Q2TA 4AQYQ 2Y0SG 1IW7D 1V9PA 1GUTA 4HR7B 1XNRL 2JA8G 3NELA 3I4LA 1MI2A 5C4JH 1EY7A 3S1QB 1IYVA 4DAYB 3C1FA 1JORA 2Y0SB 1EQTA 4ODGA 2BDNA 4WORA 4HTHA 1ET9A 2A69C 4ZLTF 2JA8B 3GTQH 5A2QE 1H95A 4K8IA 1V43A 4C1NK 3QJYA 3FRPB 5NUCA 3CPWA 1M1KC 3CQZB 2YU9H 1PTOC 2LY7A 2HCCA 4X65L 2CKZB 3TEHB 2JEAI 3I73A 3P20A 3NE5B 3DHQA 2ZXRA 3J80L 2Q8RE 1GHJA 2SEBD 1EOTA 1YIJA 3TS0A 5IWAQ 4RGMA 4YWKA 2NVXB 1D8LA 1GD7A 3U58A 4LF6Q 5G3LD 3SDZA 1PA6A 2NVTH 3TS2A 3I4MH 3L7ZC 1S5BD 2F4VL 4X66Q 4B08A 1G6PA 5GQOA 1EZ6A 3OMGA 1BNZA 4KTAA 1SNOA 1PFBA 4LF9L 3GTJH 4JI4L 4R4IA 1TWGH 4CKCA 2PY9A 2HT1A 3T4AC 1GOZA 4LUZA 4DV3L 1WTWA 1KDBA 1QILA 1SMXA 2DGRA 1G2SA 1VCIA 3RLOA 1SAPA 2N55A 2A8VA 1YNXA 2GN5A 1BXTA 1OO9B 3GTOB 4H44C 1CI3M 3S17H 3G4SA 2ZXOA 1L1OB 1VQEA 4JV5Q 1B53A 4OIKA 3A74A 2E3UA 2E75C 3MXNA 2NZ1D 4YY3L 2CTKA 4IUQA 2PMZE 2ZTDA 1B44D 3A8JE 4ALPA 4XTCS 1JE4A 4DR6Q 2CTJA 1UE1A 4GKJL 3A5UA 1TUAA 2K4KA 1T5XD 2Q2HA 3VR6A 3J7YW 3TDQA 1KC8C 3EVQA 4JI5L 4ULLA 2IT1A 4G7ZC 4DK3C 3U9OA 1WTQA 2XGTA 4U68A 1XXGA 1XMQQ 5K5PA 2AMCB 2X69A 3QB3A 3IRBA 1J5EL 1S4ZA 4JI6Q 2F0LA 4DR7Q 4XDXA 4A3JG 4AM3A 4KHVA 4WJ3M 3BDLA 5CV7A 4X62L 1FR3A 1YZ6A 4LF4L 2QF7A 4Y7NB 1N32L 5DEHA 1WTPA 2QEXA 4BWGB 4DR2Q 1WOCA 2YTVA 1PH9A 4A3JB 4JG2A 3FMCA 2VB3X 5EBCA 3MZ5A 4F88A 3F2UA 2QEJC 2YTYA 2EYLA 2VY3A 4A3GH 1CQFA 5AJ3L 3CCMA 2IW3A 1JC7A 1I4RA 1PTOB 1EUJA 4PV1C 3W5OA 3OIQA 4DAPA 1VQAA 5KNBA 2Z0SA 3J80i 2NN6I 1J5KA 2KEEA 4K0KL 1H9SA 3UE0A 2EPBA 3FHWA 1WTRA 4OO1I 4G7OC 1PZKD 1HNWL 1Q3LA 1G8ZD 2BCOA 2R92B 4CKBA 1KDCA 5F2DA 4IPDA 1R4PB 2NTSA 2UXBL 3PO3G 1X56A 2Q2IA 3V2TA 3QOJA 1ZYRC 1VIHA 2WV6D 3VYTA 1O7IA 1LTSD 5IODA 3MAQA 2WB1E 2OTLA 4LFCL 3PCOB 2I5MX 3PO3B 3ITPA 2ZXPA 3VR5A 2ZTEA 2YYZA 2MGSA 4K5VA 2F0KA 3G71A 1B50A 3CD6A 4YWMA 1I6HH 4FO2A 5IGBA 1X65A 1YJ9A 3KJOA 1M8AA 3FDTA 1A15A 1I50H 5HY6A 5EBDA 3NBHA 2DY7A 3VR3A 1VF5C 5D3DA 1HR0Q 2NZOA 1C4QA 4JI7L 3G7LA 1EQVA 3PUZA 3JAMc 5I4DA 1EY5A 4R8NA 5HGTA 3TRZA 2MP1A 1WCMG 3U1KA 4OO1G 1BCPF 4ZUIA 2J7ZA 3SVMA 5IP7H 4LF8L 4Y52H 2DNEA 1HA6A 1J6QA 1EYCA 1PYWD 2IY5B 4DUYQ 3AQQA 3T56B 4C3IG 4DV6L 1WI5A 1I4PA 2E2HH 1KAAA 1B3AA 1H9RA 3AFPA 5CYUA 5FKAC 2E2JH 1PRTF 4RKBA 4S3SA 4YCUA 3K0XA 1NMFA 1S3OA 1AEXA 4C3IB 5LL6X 5A35A 1IZ6A 3H3VC 3S1QH 2B2WA 1K83B 3PUYA 4XIGS 3CCRA 1SLJA 5ELOA 4NXNQ 1HUMA 4DUZL 3OSOA 3KLWA 4QB4A 4WALA 4L5RC 1JB7A 1STNA 2JA8H 1RTNA 1SMYC 2B8FA 1MSGA 1Z6HA 4L8JA 2LKVA 4NP5A 1HRJA 5DLQE 2CPQA 4DKAC 2L55A 1CHQD 1K73C 1IBLQ 4AYBG 2VXWA 4MN3A 4DR5L 2F0JA 1KDAA 1QZHA 2B29A 3F2CA 3K5OA 4V0BA 4GOPA 2NVXH 1IL8A 2DY8A 2EYJA 4OHJA 1YHAA 2K1BA 4LIJA 1DONA 4AYBB 3PF4A 4JI8Q 1QUQA 5FOBB 5A2QL 5EGTA 1WD1A 2R61A 1GUOA 1CHPD 5FLXc 3H3VI 5IT9L 2KCMA 2CVRA 2JA7H 3T53B 1VQ8A 2KJXA 3I91A 1KLGD 3ERSX 1SYEA 3JAME 4H02A 1OXSC 1MJEA 4RCNA 4DNIA 3I7FA 4F8MA 4ZAIA 4K8JA 3D3RA 3IKJA 1RIPA 5EKLA 1U9RA 5CBEE 1EY4A 2EVBA 5C5LA 3H0GH 2F4IA 4FNFA 1EFWA 1STYA 3K80C 3GQBA 1XYIA 2N8NA 1DYQA 3ULPA 3A5ZB 2H1EA 5CGKA 4DV4Q 2XNAC 1Q8IA 4NXMQ 1VQMA 2PI2A 1FVIA 2E8GA 1PH5A 1FYCA 4OIJA 4QJFA 1EEID 1BDOA 4UP7A 3NENA 3Q22A 3KF8B 2PQAB 2OWOA 2UXDQ 1TKWB 2E2IH 1H9JA 2ZJPA 5C4JB 1F2MA 1VQ6A 1YHBA 1ASZA 1ONLA 1J4WA 4B3SL 1SNMA 4A3EG 3C3LA 2OEOA 4K5XA 2QDBA 5JPNC 4QIWB 2KUMA 1RCVD 3GTQB 3M4PA 1SBBB 1LYLA 1SDFA 3CCEA 4Y7NH 5ELEA 4DV5L 1II3A 4A3EB 1QE6A 4DR3Q 1PH8A 1I94Q 1QVCA 2A74C 3HOXG 4FYDA 4HIOA 4QF4A 1K0RA 4BXXH 1ASYA 3Q24A 2BE5D 2JYOA 1VDZA 4BA1I 1IKMA 1N34L 3NPPA 1CKNB 4NBQA 4IPCA 1IYJB 2R3ZA 3J7ZC 1N36Q 4DV7Q 3KJPA 1SN8A 1JICA 1MGSA 2HQEA 1F2YA 2OQ0A 1TY2A 1TWCB 5IYBG 5CORA 4KMUC 1N33Q 3P7JA 5J22A 2K05A 4JBMA 3GTJB 4P2CB 2B2YA 2EJFC 3CMAA 2K33A 1SFOB 2IHFA 1TWGB 1E3PA 1V1PA 2F0HA 1T9HA 1P8LA 3S2HB 1XMOL 1RHPA 1VQ4A 1QOHA 2CQOA 2MJHA 4DFAA 4OXPA 4IUUA 2B3GA 2TSSA 3K7UC 4FXKC 1JJ2A 1BKBA 4PMBA 1PTOF 1WTOA 1HNZL 2PYKA 3S16B 1PXUA 5FO7B 3STBD 2NVQH 3LGJA 1I4XA 5E1FA 1W2BA 3PO3H 1LV9A 4N9PA 4CKEA 4QQBX 3PMFA 5C44H 1SNQA 4LFAQ 3RZDH 5DM63 1F9SA 2CWAA 4BBSG 2M9VA 1BCPD 1KD1C 2UU9Q 3NBIA 4CHTB 2F3IA 4RA8A 1U4PA 4A3DG 2Z4IA 3EQLC 1X3GA 2GVBA 3KDFA 1TR5A 4DR4L 2EYFA 3GTKH 4BBSB 2K5VA 4DAMA 3I2ZA 3QWNA 4LFBL 3TREA 5EPLA 3RD4A 4A3DB 1X3EA 1OXUA 1H9MA 2Z4HA 3A7LA 2QILA 4FXDA 1I4HA 4HSPA 1CK1A 4EQOA 4IUNA 3HKZE 2K01A 4A3GG 4ZK9B 1CUKA 4M8AA 5EKIA 1K9MC 3CHBD 3VA5A 1HFGA 2ATWA 2K5HA 3Q8DA 1GUWA 4AIMA 1HQMC 4GLXA 1I4QA 2LXJA 3DMUA 3WWVA 1WCMH 4X64L 4OO1H 4QMFB 2D9UA 3K81C 4LMQD 4A3GB 1HTPA 3OPOA 4DK0A 2QCPX 1NJIC 1KRTA 3NXWA 1ZTGA 4POGA 2F0SA 2NUCA 1STEA 4DV1L 1XTDA 1VQIA 3Q23A 3W1GA 1DZ1A 2TMPA 4DAYA 3T1YQ 4L6TB 5D65A 2EJGC 4G4KA 4C3JH 3NHHA 2RVLA 2MQHA 2ZT9C 5M5YB 3E9HA 3TP8A 1EOVA 1HNXL 3T16A 1WTXA 4IJHA 2IX3A 2EYOA 3BDOA 1EFID 3SXHA 4DR1L 1BQQT 2QKIC 4LNQA 1PH3A 1PZJD 2PNHA 3I4NH 3NK9A 2A6HC 2XSCA 1A3TA 3WOEA 2UXCQ 1HPCA 5GAEC 2HH2A 1IBML 3SE0A 1CQVA 3QO2A 1UWVA 3T1HL 1HH2P 4HCSA 3QIAA 4A3MG 3W3AA 4X65Q 1WYDA 1I50B 1EIGA 1A2TA 1PRTB 1EY6A 4HJ8A 3HKSA 2EXDA 1JWUD 4KN7C 4EQPA 2R7DA 1TS3A 4IFDJ 4GZYC 1Q1BA 2RHSB 1EIFA 1Q7YC 3HEJA 4A3MB 1D7QA 3VYSA 5IGFA 1SEBD 4K14A 4MNOA 4X3TA 1VQ9A 5KGUA 4LAAA 1SYDA 1SE3A 2A68C 3S1NB 4JVYA 2VUMG 2ZM6Q 2K32A 4KY6A 5T1IA 3MXGA 2HDMA 5ELBA 4NW2A 2B2TC 2G9DA 2BA1A 4ZUJA 1L0WA 1VQDA 2VB2X 4XT1B 5M5XB 1L1OA 2J4XA 1BF4A 3K59A 1DXMA 5JPMC 3NWTA 4IOCA 4JI4Q 2VUMB 2NZHA 2UUAL 4A3KG 1Q1EA 3C46A 2HDLA 4LF5L 2ASBA 2RDFA 1XX8A 2KBNA 1YITA 4JI0L 2GA4B 3I90A 1I4GA 3KFUA 1HZCA 3GTMH 5ELNA 3J81i 4A3KB 2WB1G 2EYMA 1Y1VH 1HA5A 2OT2A 1Z7TA 2EYPA 4X3UA 2F3WA 4E6IA 3GTPB 3KBXA 4IZ8A 5BN3A 4JOIC 3ND9A 2F0OA 2PW7A 2XWJB 4F87A 1C7YA 2Z6KC 2KEDA 4FF3A 4R1JA 1WJJA 4YY3Q 1HCZA 2JA6G 2A1AA 4ME5A 5CV8A 2WB1B 5IGGA 1KIXA 1R4QB 1CM9A 1GUSA 1AW7A 1U4MA 4HMJA 4ZRZA 2A6ED 3TP5A 4GKJQ 4A3EH 1D5ZC 1HZ9A 2KHIA 1Q90A 2K28A 4TVAB 3H3VH 3U4ZA 2PI2E 3MFGA 1LUZA 5BR8L 1VQBA 2F0EA 1PH6A 1HR0W 1DOLA 2P2RA 1CT1D 1IXRA 1RDPD 4RGOS 3W2DA 2JA7G 2NBFA 3HOXH 1ILQA 4YCVA 4X62Q 1GUGA 4JI3L 5JOBA 1OXVA 4QCLA 3K5MA 1WVNA 2A69D 4RHRA 5I2XA 1TWCH 5CV9A 1F2ZA 4BS9A 3VR2A 1PTOD 2L5TA 2JA7B 4ABNA 3ND8A 1NSNS 4NPSA 1PHJA 4XQQA 4K2LA 1SFOH 3H0GG 1UE6A 2Q8IB 3I4OA 3HOYG 2IX0A 2SOBA 4K5WA 5IYBH 3S2HH 3RZOH 4WFN3 4HIKA 1SE2A 4XXEA 4TKOB 3NTIA 1E7ZA 3D0FA 4APVA 4GKKL 4H7BA 2BH8A 3BVMA 3H0GB 3MTSA 3HGBA 4HCEA 1Y14B 3S16H 3TMEA 4K0KQ 2BL5A 2FINB 5C4ZA 4LUVA 1BBWA 5LMNQ 1ET6A 1PVOA 2RCNA 1C9OA 2LSSA 5E4XA 1AP0A 1KHMA 1JWSD 2PQEA 4A4IA 1NTGA 4KN4C 4A3CH 1Y8NB 2D5DA 2C9OA 2E2IB 5J1ZA 1YNJD 4PZ6A 2NB0A 1AE2A 4BBSH 4CJ0B 3R2TA 4LFCQ 4R4CA 4A3DH 2SDFA 4BXXG 2RQXA 4DGZA 3GO5A 2L9HA 1DOMA 1CSPA 4U673 1HZAA 4L5QA 3BG3A 4C2MB 5JVG3 1Q82C 5C3WA 1B9NA 2FMCA 5IWAL 3OW7A 1A2UA 1YEZA 4JYAL 2AHOB 3MA2B 4LF6L 4KY7A 4A3BG 1DCZA 3CCLA 3AEVB 5EQ0A 4X66L 3RMHA 4K6DA 4X3SA 2BA0A 4XQJA 1ENCA 5M5WH 4R4OA 2Q2UA 1GXDC 3IFDA 3I3CA 2RSOA 4A3BB 5FLMH 3SK6A 4RHSA 5D14A 4JI1L 3NWSA 1TXYA 3H91A 3L2PA 1C48A 1VQNA 2NYZD 2O5IC 4P72A 3D31A 5M5YH 4DV6Q 3DM3A 3NP8A 1T5EA 4DN4M 4QY7A 1YBYA 5IYDG 2CCZA 2L4NA 4FXGC 4BY1H 3HOWG 2O2LD 2FMMA 1D2BA 1IL2A 1EYAA 4LUOA 1TS2A 2D62A 1HTLD 4DNRB 2KENA 1NR2A 1FD7D 4P74A 1OXXK 5C44G 4JI2Q 4JC0A 1SJED 5KNDA 1H9KA 1AFPA 1GJXA 1OTCA 4BA2I 2NVQB 1KHIA 1FL0A 3WDNA 4DUZQ 1EQQA 4IFDI 1TWAB 3CRKC 3TP6A 5C44B 2MUYA 2V1CC 3RZDB 4MIUA 4DNTB 1VQOA 1VMCA 2VNUD 4PZ7A 1SE4A 1UNSA 1O78A 2RHQB 2F0QA 2EIFA 1SE8A 3CCQA 2RSNA 2PNRC 3NQTA 1SR3A 4HJ7A 3GTKB 3MXNB 4DR7L 4V190 1PFNA 4A3MH 2ALYB 5FO9B 4XQNA 3S1NH 1X4NA 3IL8A 1EIHA 1K8MA 2CW0C 1B70B 2L11A 4DR2L 4NMZA 3MFYA 5J3BA 2K52A 2D2CC 5M5XH 5C6AA 3M4YA 4OL7A 1EEFD 1WCMB 2I5LX 2VUMH 4M1UB 1ENAA 3GTLB 1YJWA 1X55A 4O42A 2L15A 1CFMA 3BZKA 4C3JG 4X3KA 1GKHA 4IFDG 1IKLA 1JOKA 5CV4A 4WJWA 3KF8A 2PQAA 2B2WC 4A3KH 3CP0A 2MPMA 1HFNA 4L63B 1ESRA 3GTPH 2OXPA 1RJTA 2CTMA 1STHA 4C3JB 5JVH3 3I4NG 1X4MA 3PF5A 5KYIA 1RKNA 2L0CA 2RA4A 4GLVB 1MKHA 1QJOA 5M3FH 4IPHA 5GAGC 3OTOL 3BZDB 1A63A 3TZDA 2ANRA 2WAQE 3CPFA 5M9OA 1JE5A 4KKUA 5E4WC 4FF2A 2R7ZH 3I4NB 1DJRD 3J80c 4DV0L 1UE7A 3G6EA 4B3RL 3OWEB 1YNND 2PPBC 2JA6H 2I5HA 1LT6D 4GNXC 5ISRA 3CXCA 5I6YA 1CZGA 1CKNA 3HKZG 1ICWA 1JMCA 2ZJQA 3M85A 2BOSA 3KUPA 4JVHA 4UP9A 1VQJA 1QNKA 2PZUA 2AWOA 1SMYD 3HZXA 5E3FA 4QMGA 4DV5Q 1E24A 3HRZC 3CAMA 5CV6A 1Y1WG 5IP9H 3HKZB 5LMUL 4JBKA 2RDGA 4KJNA 3LX0A 2X6GA 1EY0A 2EE1A 3EA6A 2QGQA 3F2DA 2O5JC 4UY8C 5EAYA 2EY6A 5JJKA 4KJOA 3HOZG 1JR0D 5KNCA 4PZ8A 2AXYA 4C3HG 2UUCL 4CGYB 2KCCA 2ID0A 1U4RA 3HOYH 1O7LA 1IBKQ 4DUYL 1QWYA 2M2LA 3HOZB 2R7FA 2MHVA 1KTKA 1FJGL 3AFQA 4C3HB 2L12A 1GHKA 1Y1VG 4LJZC 4XYQA 4RGTA 2EY5A 5EKKA 4B9XA 2VQFL 1XMOQ 2F0NA 3E6ZX 1TY0A 2K04A 3SK8A 1WE8A 2PZWA 1BUVT 4QUCA 3GTMB 3I70A 4YCWA 3E0EA 1LTAD 4NXNL 4IURA 1D1KA 1Y1VB 2FFKB 3M4QA 1ML0D 2JSOA 1A0IA 1X54A 3S1RH 2AQ3B 4RGNA 4KV6A 3K5NA 3D6WA 1HXYD 4DXGA 2HHHL 1SYBA 1JJGA 2NVYH 3F2BA 1N8RC 5DM73 2LFNA 4NKLA 1W6JA 2F1MA 2A19A 4IPGA 3CMEA 3AYHB 4C2MH 5C3EG 4WRDA 3H94A 4B9WA 2E5LL 2MJ8A 4P75A 1LT4D 4J15A 3TN2A 3RLNA 4HJAA 2BE5C 2N49A 4ID6A 4HEDA 3QG1A 3QOLA 3PGZA 4DA2A 3TBIB 4IUVA 5I9OA 3SK4A 5C3EB 4JI8L 3UDGA 2B2VA 5IIFA 3HOXB 4LFBQ 1A3VA 1TWHB 5FLXE 3EN2A 3GD7A 2MO0A 2JXMB 1XJVA 3TQYA 2F52A 4A3BH 4IUPA 4RAUC 5IGEA 4DF7A 1DTJA 3OYYA 1JOOA 2XTIA 5COYA 3ZJYC 5AFWA 4ZKCB 5EJWA 4X6AH 2PCFB 4FF4A 1I3QB 2RF4A 4X64Q 4GNXB 1TS5A 2MNAA 1AN8A 1TQOA 3VA7A 3T13A 3RZOB 3A0JA 3PUVA 4IN3A 3HOUG 2YTXA 2JK8A 3K58A 3SEBA 3E9IA 1NUCA 2AQ1B 4R4QA 1S5CD 4DV1Q 2OTJA 5IYDH 3VR4A 1ILPA 3HOWH 1RD9D 3MWYW 2JEBI 1VQ7A 3FKIG 2IPKD 3HOUB 1TWAH 2UUBL 2B39A 2C35B 4A3CG 2YQRA 1TU2B 1X32A 1U4LA 2E2DC 1PH7A 1SJHD 3E0JA 1XNQQ 5DAUA 1RF2D 1RTOA 1CKMA 2UXDL 4DR1Q 5C4XG 3FKIB 4A93H 5FK9C 5KYLA 1FNVA 2F0IA 2D0PA 4B3MQ 2OPVA 4QL5A 3VYRA 5HGQA 1LT3D 3K6OA 3V05A 1D5XC 3HOVG 4OX9L 3BYTB 3I56A 1PRTD 4KHPQ 5C4XB 5JAVA 1ZXTA 3CC2A 5EPJA 4N9TA 2J0TD 1LT5D 2G9HD 3I72A 3L9AX 3V69A 3HOVB 2XN9C 2EQSA 4O1NA 2B2UC 1VQCA 3L0OA 2I07B 3AMUA 2RBMA 5KIXA 2HHHQ 1PH2A 1J9OA 1LTBD 4DV7L 5FLMG 1TIID 3GTLH 1Z9FA 4J1MA 4OWTB 2F0WA 2SNMA 4CJ2C 1KNAA 4OGQC 2AWNA 5ELDA 5M5WB 4BY1G 2AUJD 3LWEA 2D0OA 1X6OA 1TWFB 2OPUA 1FGUA 1HHVA 4UAIA 1KXLA 1F9QA 5J39A 3BYYB 2ANNA 1G2TA 3N6RA 4HIMA 5LMNW 4DV2Q 4IFDH 1ZEQX 4BY1B 4NB3A 3UDXA 4A3IG 4KLKA 3KF6B 1VQLA 2ZJRA 4JI0Q 2PMZB 4G57A 1E2ZA 3N52A 3R2IA 3K7AH 4LF7L 4BY7G 2KCTA 4FVMA 2NWGA 4EX5A 4A3IB 1XNRQ 3OW2A 5GADC 4PMCA 3BJUA 5FJ8G 4H0LC 4EQNA 1A8VA 4JBJA 1WD0A 1QCBD 5FO8B 3AU7A 1PV4A 1Q12A 1GVPA 1KQSA 4BY7B 3PO2H 3J7AF 3VKEA 3P75A 1P16A 4DPGA 1S72A 2KVMA 4PG3A 2F0TA 4KY5A 2EJMA 5C3XA 3BS1A 2EYHA 3S1MB 1E0BA 5IT9c 5GAHC 4HAEA 2CWPA 4QUFA 5IY0A 2WACA 4MHEA 1KNEA 2N78A 3GV3A 3UE1A 3M7NA 2LMCB 5BR8Q 2DNCA 3ICEA 3MEFA 5C4HA 4DXFA 4P71A 5C0XH 3DEPA 1Y1WH 4RH6A 2CTLA 5KEEA 3PIO3 3H09A 1EY8A 4C1NI 3RNUA 1VQKA 2WIIB 2F4VQ 4JI3Q 1WTVA 1NE3A 1L1OC 5H1SE 2VQEL 3GTGH 1Q8KA 3HOZH 4GN5A 3M9BA 2R93G 2M00A 1MIUA 4LF9Q 4C3HH 3F1ZA 3JAML 1IW7C 4HSVA 3HG9A 4YHHL 4DV3Q 3PUWA 4PMWA 3MHBA 2R93B 1SYGA 3PIOA 3J81j 1VQHA 4ILWA 2F0DA 2B2TA 5M3FG 1D5MC 3JC66 2CTFA 2R7ZG 1SXTA 4R9WA 2B63G 1S5ED 4IO9A 5CBAE 2HIVA 2RDHA 3FP9A 2K03A 3BZCA 5C0XJ 5M3FB 4KKSA 2R7ZB 1B8AA 2B63B 2F03A 4JI5Q 3KYHC 3A55A 2UXCL 1GO3E 1SROA 2JA6B 4JOIA 1G51A 1V8QA 5C3EH 2Z6KA 2PO4A 3DM1A 1J5EQ 2DN8A 1AZPA 2A73B 5IP9G 3AEVA 5IGDA 2FXQA 5CMDA 1TWHH 5IT9E 1EWHA 4LF4Q 2PQUA 1N32Q 2KOLA 1EY9A 2EY2A 1HJPA 1JWMD 4FDBA 3A8KE 4KI0A 1FNUA 2IL8A 5JEAH 3I55A 1MSHA 4A76A 1O80A 1QZGA 4BBRH 1YVCA 4A3FG 3TZUA 1W6KA 1I3QH 4JYAQ 4IJLA 4FF1A 1L0YB 1HUNA 2OCEA 1F2LA 3EBEA 1QG7A 1GUNA 2ZM6L 1VQ5A 5AJ3Q 1UAPA 4MTNA 4A3FB 2C5CA 5FLXL 3HOYB 4UPAA 4OWWB 1NBWA 1JB3A 3DXJC 2K14A 4B3TL 4JI1Q 3O13A 4R4TA 1LM0A 3HOUH 3M3YH 1LLRD 3ULJA 2DUDA 2WAQG 5BN4A 1HNWQ 3DEOA 4TQUS 4AQYL 1B4OA 2SNSA