5JEAG

Structure of a cytoplasmic 11-subunit rna exosome complex including ski7, bound to rna
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
237
structure length
235
Chain Sequence
DSMSTFIFPGDSFPVDPTTPVKLGPGIYCDPNTQEIRPVNTGVLHVSAKGKVQTAYIDYSSKRYIPSVNDFVIGVIIGTFSDSYKVSLQNFSSSVSLSYMAFPNASKKNRPTLQVGDLVYARVCTAEKELEAEIECFDSTTGRDAGFGILEDGMIIDVNLNFARQLLFNNDFPLLKVLAAHTKFEVAIGLNGKIWVKCEELSNTLACYRTIMECCQKNDTAAFKDIAKRQFKEIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a Cytoplasmic 11-Subunit RNA Exosome Complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule tags Hydrolase/rna
molecule keywords Exosome complex component RRP45
total genus 51
structure length 235
sequence length 237
ec nomenclature
pdb deposition date 2016-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF15985 KH_6 KH domain
G PF18311 Rrp40_N Exosome complex exonuclease Rrp40 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5jeaG01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5jeaG02
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 5jeaG03
2JEBI 2VUMG 5JJKA 3BDOA 1BVSA 5IE8A 1IBLL 4JYAQ 3PO2G 2AUJD 1GVPA 2N49A 3STBC 2AWOA 3PSIA 4GS3A 2JQOA 1B8AA 4JI3L 3CQZH 2R7ZH 3VR4A 1A0IA 3A7AB 5C0XH 4A93G 2NN6I 2EVBA 2EXDA 1GUGA 1XMOQ 3BG3A 3U50C 2PCFB 1OTCA 4TVAB 4G7OC 4HR7B 4QY7A 3K7AH 3A8KE 1EQQA 4JI0Q 3I4MG 4DR7L 2Y0SG 4P71A 3I2ZA 1I50H 3PGZA 4GLXA 2WAQG 1IXRA 3U58A 4J15A 1Y1VG 2K75A 1NMGA 4LFAL 4A3DG 2R93H 4LFAQ 3AQQA 4LIJA 5C44G 4R4QA 2CPQA 1HZ9A 1R9TH 1GHKA 3EIVA 4LJZC 1XNQQ 4A3IH 3UE1A 4YCUA 4NB3A 3ND9A 4C3HH 2JK8A 3RR5A 3J7ZC 2UUCL 1PH1A 4A3GG 2B8GA 2DNCA 3G48A 5LMNL 1KHMA 3H3VI 3I4NH 4AH6A 1QVFA 4IPGA 1G291 1KRSA 3GD7A 3OOCA 2EJGC 2VQEQ 4KKTA 2E2HH 5K36H 1JMCA 1HTPA 4DV1L 1PFSA 1VQOA 3FKIG 5BN4A 2VQFQ 2Z0SA 4DR2L 4LWCA 3CMEA 2HIVA 2I0QA 1KQSA 1NBWA 1WCMH 1SR3A 3AYHB 3NEMA 1KAWA 4L5QA 3S24A 5FLMG 4OWTB 2N8NA 5E7NA 5C0XI 2JA9A 3IRBA 1Q46A 3RZDH 3QJYA 1CSPA 1P8LA 1GM5A 5HY6A 4C3IH 4JI6Q 4A3CG 5M5YH 2A68D 1TWGH 4A75A 1PYBA 1C0AA 2L15A 3JC66 2UXCQ 4K0KL 1H9SA 4A4IA 1QUQA 4K0KQ 4IFDH 2DUDA 3J80c 4NXML 2O5JC 2ZM6L 2QF7A 2ZTEA 5JEAG 2ZJRA 1SMXA 2ASBA 1I3QH 3KFUA 1IYUA 4DUZQ 3GTKH 1Z7TA 4MZ9A 3OPOA 2BH2A 4JI3Q 2FXQA 3A74A 2JVZA 1KC8C 4JI2Q 1U0LA 2PMZE 4JK1C 1FYCA 4ALPA 4A3BH 4DR6L 1K3RA 2K52A 2ZJQA 2VNUD 4A3MG 4BBRG 1PVOA 1GO3E 4GNXC 4JG2A 4BY7H 3PIOA 3E0EA 2LMCB 1LYLA 1TWHH 2IX0A 4KN7C 1AE2A 2WB1E 2VW9A 2K7VA 1SROA 4DR3L 4JBWA 4KHZA 4OO1I 2NZHA 3KLWA 2HH3A 4LF6Q 2LSSA 1XPRA 2YTVA 3U4ZA 3UDXA 3KOJA 3F8TA 3KF6B 1PH5A 1OXTA 2KA7A 3CD6A 4JV5Q 1VIHA 1K0RA 3L7ZC 4KHPQ 4IPCA 2XTIA 4JBMA 1OXUA 1K8OA 2CWPA 2H5XA 5LMNQ 3GTQH 2GN5A 4A3JG 1MJEA 3CCVA 1E2ZA 2HIXA 2I5HA 2OQ0A 2EDGA 2PI2E 4JI5L 4OX9L 1IBML 2F3IA 4OO1G 1IBMQ 3NELA 1OXXK 4A3KG 1WFQA 2Q2TA 2Q2UA 3HGBA 2FMRA 1Y1VH 1WJJA 2CTJA 1GHJA 1CTMA 3W3AA 4JI1L 4LF9Q 4IQZA 2HH2A 2VUMH 1VDZA 3KF8B 3CCRA 2ANNA 1X4NA 2OPVA 4B3RL 4NXNQ 3OYYA 1NY4A 1JT8A 1H9RA 1A6XA 3S16H 5A35A 1H95A 1RL2A 4YCWA 2RF4A 4X64Q 1QJOA 1YIJA 3M4QA 3J7A5 2UXBQ 3ND8A 5KNDA 1NMFA 4MTNA 4PZ7A 1NE3A 1VQDA 4DV2L 3S2DH 2UXBL 4AM3A 2E76C 2Q8IB 3A0JA 2CQOA 3HKSA 4DR1L 4JYAL 4QQBX 1DGSA 5IYBG 1KD1C 2DNEA 4LK1C 4ME3A 5IP7H 1EOVA 1Q7YC 2UU9Q 3IKJA 1WOCA 2V1CC 3CAMA 1I94L 1JB7A 2D0OA 1CI3M 3VR6A 4GNXB 4DNIA 4DV6L 4DV5L 3T51B 2YU9H 5KNCA 3GTOH 4LF9L 1H9MA 4JC0A 3J81c 1Y1WH 3ZJYC 5M3MG 1Z6HA 1VCIA 2BL5A 5ELNA 4LW1A 3U4VA 4YHHQ 4DR7Q 2YV5A 2NN6H 4KI0A 3KJOA 1TXYA 1EWHA 3TZUA 1UE7A 4GOPA 2R7ZG 3S17H 2P2RA 1I5FA 3TRZA 1XTDA 4BBSH 4A3CH 1J4WA 1PMRA 4JI8Q 1X55A 4IPDA 1HR0Q 4EQ5A 1XJVA 4DKAC 1N32Q 1EUJA 2QGQA 4LUOA 4P72A 3HOZG 4EX5A 2KHIA 2KCTA 5JEAH 3KDFB 2EJFC 1IYVA 1TWCH 1IBLQ 1N33Q 3F2BA 3GTPH 1PH2A 5C4XH 1PH7A 2JA8H 4OGQC 5C0XJ 3CCEA 4A3FG 2CTLA 3D31A 4HJ5A 1IBKL 2A8VA 3RZOH 1E22A 4BY1H 4DV7Q 2OQKA 4FDBA 4UP9A 4X62Q 4L5SA 1TWAH 1SRUA 3HOVG 5GROA 2EIFA 4O2DA 2A19A 5H1SE 2R93G 2YQRA 1LTLA 2OTLA 2WB1G 1LABA 5BN3A 2HHHL 2IT1A 4JI7Q 4KKSA 2VY3A 1VQHA 4GKJQ 4WANA 3MFYA 1G51A 1N36L 1V9PA 3EQLC 4IFDG 1YBYA 1EQRA 4DAYB 3I4NG 1SN8A 4R4TA 4YCVA 3Q8DA 1E2VA 4GOPC 4JI0L 4LF5L 2UUAL 3JAMc 2OWOA 3BZCA 1L2FA 3KDFA 5ELOA 4AYBE 5HGQA 4P75A 4DUYQ 3CCUA 2YTYA 2NVXH 2HQLA 4A3JH 2JA5H 1VQ9A 1E2WA 4JCVE 2XGTA 4LF7L 4HJ9A 4IJHA 3PUXA 4A3BG 2JXMB 3I4OA 1DTJA 4A3KH 4A3MH 2O5IC 1HNZQ 3M7NA 1H9SB 4GKKQ 1UEBA 1W3SA 4OWWB 2JE6I 3K0XA 2QNDA 2ZTDA 2AKWB 5LMUQ 2RCNA 3FMCA 2MNAA 2JEAI 1Y69U 4DUZL 2PNRC 1S3OA 1VQGA 3GTGH 4TQUS 3I4LA 4R4IA 3W1GA 1UWVA 4A93H 2KCCA 2K5NA 4NXNL 5IP9H 3RLNA 1EFWA 2K33A 1L1OB 1Q81C 1HQMC 3CCSA 2QEXA 1OXSC 2VS1A 4L8JA 1X3GA 4PMWA 3ERSX 5IP7G 1VF5C 4JBKA 3CP0A 1EWIA 1ASZA 2E2IH 3GTMH 1LACA 3WWVA 4OXPA 5EAYA 1Q12A 3HOYG 2PI2A 1D8LA 2I5LX 5AJ3L 3D4RA 1YNXA 1N34Q 1XNQL 1XNRL 2YYZA 4JBJA 2K5VA 2NZOA 2F1MA 4DV5Q 2KBNA 5IY0A 3F1ZA 4KHPL 1I94Q 1P16A 1EIYB 2PQAA 2ZTCA 2WAQE 1QVGA 2VQFL 4Y52H 1CKMA 3L0OA 3CCJA 4UP7A 1Y8OB 2WFWA 5FLXc 2K4KA 3STBD 3ULPA 4GKJL 1NJIC 4H13C 1HZBA 4RMFA 1PH8A 2HHHQ 4LFCQ 2F4VQ 1VQ6A 4DR4L 2A69C 3MEFA 4X65L 2NVTH 1V8QA 4GOPB 4WALA 1DT4A 1C7YA 2ZT9C 4DV0Q 2A6HD 1VQNA 3M3YH 3GO5A 1O78A 3QIAA 4H0LC 3OTOL 2RHQB 1IW7C 3VA7A 4OO1H 2UUCQ 2CTFA 4JVYA 4BBRH 5M5WH 1SE8A 2UXDQ 1VQBA 2E75C 1NTGA 2CWAA 5IYCH 1VQAA 1XNRQ 3SE0A 1N34L 2D62A 5J3BA 3S1RH 2AUKA 1DCZA 1ZZKA 2UXCL 3PIPA 3EBEA 1RIPA 3GQBA 4IJLA 4GLAC 1X65A 2E8GA 4GN3B 3KLRA 4P74A 4DV3Q 1S40A 1PA6A 1H9KA 2K5HA 4YHHL 1VQJA 3T56B 3NBHB 3BZKA 3NENA 1B70B 3WDNA 1IYJB 3CRKC 3I72A 3M4YA 1J6QA 2N78A 1V43A 3K81C 4QJFA 5DLQE 3W1BA 5M3FG 4NBQA 2A6HC 1MJCA 4WJ3M 4B8TA 1L1OC 4YY3Q 4DR6Q 1X6OA 4H02A 4YY3L 1S72A 2AHOB 1GUOA 2A69D 1A62A 4HIDA 1Y1WG 4BA2I 1CUKA 2CKZB 1K73C 1E7ZA 4OWXB 2K32A 2YTXA 1BDOA 2JZXA 5BR8L 5JEAJ 2NN6G 2VQEL 4LF7Q 1JJCB 4DV4L 3K7UC 3TS0A 1FL0A 4A3EG 4POGA 2Z6KA 4RG1A 3LWUA 3S1NH 1T9HA 2ZM6Q 1KHIA 2E74C 4NXMQ 4Y7NH 3CC2A 2BE5C 5IP9G 3HOZH 3TS2A 1E3PA 1E1TA 1O7LA 3KYHC 2JJQA 1YJWA 1BKBA 3PUVA 4LF8Q 1X54A 2K50A 3PF5A 5IWAL 1HCZA 1K8GA 1FJGL 1FJGQ 3QG1A 2B63H 2HT1A 3HKZG 5C4XG 1GUTA 2Q2IA 4HJ7A 2MO1A 4X66Q 1YNJC 2OCEA 5GQOA 1ASYA 2UUAQ 4A3LG 4NPSA 2MFIA 3M85A 4AIMA 2DGYA 4UPAA 1ZZIA 3IFTA 4OX9Q 3HOVH 1K8MA 1AE3A 1GJXA 1HNXQ 2C35B 2VL6A 4DR1Q 1TU2B 4YWLA 4B3SQ 3JAMi 3BU2A 1H9JA 5BN5A 1VQIA 3UDIA 4BBSG 3N6RA 1CFMA 1YNNC 1HZCA 1QUQB 2UUBL 1N33L 1J5KA 5GAHC 1K8AC 4JI4L 3AEVB 1SFOH 4DV1Q 1XPUA 3LNNA 4IO9A 1VQEA 2K14A 3HFZB 3TREA 2Z6KC 3J81j 2BA1A 4LF4L 2VZAA 2IHEA 4A3FH 3OW7A 1GUNA 3B6YA 4X6AH 4IOCA 4BXXG 2R6GA 4BY1G 1XPOA 1BBWA 4JI2L 1VIGA 3A8JE 4X66L 1Q86C 2B8FA 1VS0A 4DK6C 2A6EC 2BDOA 3K8AA 1FGUA 3LGJA 3CF5A 3S1QH 1ONLA 1GD7A 4HIKA 2A6ED 2B29A 2AMCB 3E9IA 2R7FA 3RLOA 1VQFA 3F2DA 4DUYL 2R92G 3HOUG 1FR3A 1L1OA 2PNHA 1VQLA 1HNWL 3H94A 1N9WA 4OONA 5C3EG 2KCMA 3I73A 3OTOQ 3G71A 4AQYL 3PO2H 1A8VA 5JJIA 2NVQH 3ULLA 4LF6L 3A5ZB 1YJNA 2KHJA 4JI4Q 1OXVA 3KF6A 1C9OA 4DV2Q 2UUBQ 3M9BA 1UE1A 5LMNW 2JA5G 3CCLA 3GTJH 2UU9L 2QA4A 2DGRA 3DXJC 4KN4C 3H0GH 4DK3C 4GKKL 4X62L 5KNBA 4C2MH 2JA6G 1GKHA 2PQAB 3VR3A 3CMAA 2CTKA 3G6EA 3T53B 4YWKA 4DR2Q 3HOWG 3S14H 1PH9A 4RCNA 4LUVA 4POFA 4A3IG 1KL9A 1DXMA 2GVBA 1Q1BA 5IWAQ 5GAEC 4DNTB 1FVIA 3CC4A 2E5LQ 1GUSA 2L5TA 4IFDJ 3BJUA 2MJHA 2PQUA 1N32L 4B3RQ 4R4OA 1A63A 4LF5Q 3T1HQ 4JI8L 1X9NA 2F52A 2MQHA 2PPBC 3K80C 1HR0L 3VDYA 1VQCA 4B3TQ 1PHJA 1B7YB 4B3TL 2JA7G 4GN5A 2EJMA 1Y8NB 5K36G 1PYSB 2A68C 2ID0A 4G7HC 5AJ3Q 3PUYA 3CPWA 5M3FH 4AYBG 1X3EA 2RHSB 4DV4Q 5BR8Q 4JV5L 2UXDL 3FKIH 4JI5Q 5FJ8H 3PF4A 2PY9A 1XMQL 1VQ5A 3HOYH 2V4DA 2DN8A 1MIUA 4GN4B 2KENA 3E9HA 4DPGA 1PV4A 2B63G 2JA7H 1QZHA 4DV7L 4GNXA 4H44C 5LMUL 1CKNB 2NVYH 1XMOL 4A3LH 3PO3H 5FLMH 2R7DA 2E2JH 3J81i 1BBUA 5IYCG 1VQ4A 3PCOB 2E3UA 4XTCS 4B3ML 4DR4Q 4QIWE 4A3EH 4G7ZC 3U1KA 4QGUA 2F4VL 4DR3Q 1YVCA 3I7FA 3CW2C 4GLVB 4P73A 3GDEA 3J80i 4DR5L 4X64L 1PH6A 1HR0W 4UY8C 4IOAA 1HNXL 5IYDH 1TKWB 1YEZA 3W5OA 1MKHA 3VR2A 2D5DA 1E1OA 1HH2P 1UE6A 3ER0A 3I55A 4PZ6A 3CCQA 2D0PA 4L5RC 1JE5A 2AXYA 1HZAA 1YI2A 1LUZA 1WCMG 1CKOA 1K83H 1YHBA 3FHWA 4HJ8A 1EIFA 2IX1A 4C3JH 3RN5A 4JI6L 3M4OH 1VQMA 4BXXH 4HIMA 3HOXG 1ZKOA 1CKNA 3OW2A 3V69A 3I56A 2AWNA 3GTLH 2ES2A 2ALYB 4JI7L 1B9NA 2CTMA 5C44H 4JVHA 2ZJPA 3S15H 4LUZA 1M1KC 1IW7D 3TEHB 1Q82C 1N36Q 4DAMA 3HOUH 5M5XH 4BY7G 4LF4Q 4WJ4A 2GVAA 4X65Q 4DK1A 3ULJA 4A3GH 1Y8PB 1Z9FA 2OPUA 1SLJA 4QL5A 4PV1C 4LFCL 1IZ6A 4UP8A 2ATWA 3S1MH 3DLLA 1HPCA 1I6HH 3VKEA 3CRLC 3FPPA 1X3FA 3PV0A 5C0XG 2WP8J 3MXUA 1J5EL 1J5EQ 4B3MQ 3CPFA 1Y14B 1D7QA 5GADC 3RN2A 1K1GA 1ZZJA 3PO3G 3UE0A 2CFMA 2IHFA 4B3SL 3I4MH 4LFBQ 4AQYQ 5JJLA 2EQSA 3SGIA 1HNWQ 1JJ2A 4A3DH 3M4PA 1Z47A 1TUAA 2Q2HA 4QMFB 3CCMA 1VQPA 1QZGA 3SDZA 3VR5A 1B9MA 2BA0A 4BA1I 3PUZA 1WI5A 1XMQQ 1YHQA 3AEVA 1VQ8A 3HOWH 3UDGA 1I6VC 1Q8KA 1VF7A 3EN2A 4YWMA 4DV3L 1V1QA 3A8IE 3DM3A 4HJAA 1W2BA 3CC7A 2OTJA 1O7IA 3ICEA 2BE5D 2Y0SE 3UDFA 4DV6Q 2CCZA 4LNQA 3T1HL 4R1JA 2CW0C 2I5MX 1WVNA 1T5EA 3U9SA 4GZYC 3L2PA 4IPHA 4IFDI 1JJGA 1KXLA 2D2CC 2B3GA 1KRTA 1E24A 4R4CA 2MO0A 4DR5Q 1Q90A 1VQKA 3NE5B 4I7ZC 3KJPA 2JA6H 2LXJA 4DV0L 4MNOA 1SMYC 1UE5A 4O0AA 1Q1EA 4PG3A 1L0WA 1EYGA 1YJ9A 1HNZL 1IL2A 3TQYA 4APVA 5IT9c 1WYDA 1IBKQ 5C4JH 3RLFA 1X56A 1YHAA 4L5TA 5M3MH 4A76A 3P20A 1U5KA 3AFQA 1PH4A 2IY5B 4TKOB 1N8RC 2R92H 2LXKA 3H15A 4DNRB 3HKZE 4DK0A 4LF8L 2ANRA 5C3EH 3AFPA 1TWFH 3AB9A 4JOIC 3G4SA 3F2CA 1ZYRC 5IYDG 2BH8A 3A5UA 3RNUA 4PZ8A 1VQ7A 4KLKA 4JI1Q 5IYBH 1KIXA 1K9MC 1X4MA 4JOIA 1AH9A 3FP9A 1CSQA 5FJ8G 3MXNB 3T1YQ 1G6PA 2CTEA 4HIOA 4LFBL 3H3VH 5GAGC 2E5LL 1DD2A 2A1AA 3T1YL 1WE8A 2N3SA 1YITA 3S2HH 3H0GG 1YZ6A 1HJPA 1EC6A 4KMUC 3CXCA 2JA8G 3A7LA 3D0FA 3HOXH 1ZTGA 1M90C 3PUWA 1LM0A 1PH3A 1QVCA 4XIGS 4KKUA
chains in the Genus database with same CATH superfamily
1WHRA 3LWEA 5JJKA 4YY3H 2K5QA 3PO2G 2N49A 3STBC 4K8JA 5C4XB 3CQZH 1A0IA 1HA5A 1BOSA 2EVBA 1EZ6A 4G7OC 4HR7B 4QY7A 3I4MG 3GTKB 2DJFC 5CORA 4GLXA 5LMNH 1BCPB 4A3DG 1J9OA 2K75A 4LIJA 4R4QA 4LJZC 4LF8H 1STGA 4FXDA 2UUCL 3J7ZC 3Q6SA 4RKLA 3G48A 2DNCA 4K5XA 5IOCA 3I4NH 1BQQT 1KRSA 3GD7A 1EY7A 1R4PB 2UUBH 4QMGA 1HTPA 1EYCA 2G9DA 4MIUA 1PFSA 1SNDA 2GA4B 3I8ZA 1VQOA 2R3ZA 2BCOA 2Z9HA 4LWCA 2HIVA 1NBWA 1WCMH 3K0YA 4C3JG 3SXHA 1KAWA 3MZ5A 1ZEQX 1VMPA 4IUPA 5C0XI 2JA9A 1SNQA 3IRBA 2K05A 1HA6A 1Q46A 1SEIA 4RH6A 1JB3A 5HY6A 2F4IA 4C3IH 4JI6Q 1ENFA 2F3VA 2PT7G 4JI1H 4Q5VA 2VB3X 2O5JC 1TWHB 2ZM6L 2F0LA 3D6WA 1EWCA 4MZ9A 2BH2A 1EL0A 4NZRM 2JVZA 1KC8C 3NK9A 4OEMB 1EYAA 4ALPA 3Q0AA 4A3MG 4BBRG 1PVOA 3UOEA 4GNXC 3GP7A 3BDLA 3PIOA 4BY7H 1LYLA 1BCPC 1TWHH 2IX0A 1AE2A 4DR3L 4DV1H 1SROA 2HDMA 4ZRZA 4LF6Q 1VIHA 3CD6A 3S15B 1K0RA 2M8WA 4KHPQ 1FNUA 4RGMA 2XTIA 1STHA 1OXUA 1B4OA 1SYDA 4HTHA 2X06A 1LT5D 2OQ0A 2I5HA 1KAAA 1TWGB 4LFAH 4A3KG 1WFQA 3IAYA 2FMRA 3OTOH 2CHBD 4IQZA 2HH2A 2SEBD 2F03A 2EYLA 3QWNA 4B3RL 1NY4A 1X3PA 3SEBA 1XX8A 4OIJA 3K7AB 5LMUH 2QCPX 3M4QA 4J6HA 5KNDA 4PZ7A 4RA8A 2VQFH 5C5MA 3S2DH 2UXBL 4AM3A 4DR1L 4JYAL 5IYBG 3SK8A 4ME3A 2UU9Q 3IKJA 1I94L 4GNXB 5IGDA 3T51B 3NQIA 1LTTD 4C1NK 4LF9L 3ZJYC 2NVYB 3KF8A 2M9VA 4X3UA 1HUMA 1Z6HA 5ELNA 1RTOA 3U4VA 4WORA 2YV5A 2SNSA 1L0YB 3V2TA 4DR7Q 2R7ZG 3TZUA 1I4HA 3TBIB 4QF4A 1XTDA 4A3CH 4BWGB 4MHEA 4DKAC 2QGQA 4P72A 3S2DB 4EX5A 2KJXA 5JEAH 4DV2H 1N33Q 1BCPF 3F2BA 2HHHH 5CV9A 5HGTA 5C0XJ 3CCEA 4A3FG 3H0GB 3RZOH 2O4CA 3V05A 2OQKA 2XRSD 1I4PA 4O2DA 1IHZA 2R93G 1EZ8A 1LABA 5BN3A 4KKSA 5M5XB 3P1HA 1G51A 4X3KA 1N36L 1SN8A 1E2VA 3A55A 4XQJA 4AYBE 1XNQH 4P75A 3I3CA 4DUYQ 1FKAH 1STAA 1B3QA 4KV6A 4A3JH 1VQ9A 2K04A 4A3BG 3WOFA 3AMUA 4JI4H 4A3KH 4A3MH 4OL7A 1HNZQ 4NXNH 1H9SB 3EROA 3K0XA 2ZTDA 1D6EC 4UDUC 2WKDA 1Y69U 3GTGH 2Y0SB 5EPLA 4R4IA 2K5NA 2KVMA 2JA7B 4KY7A 4DXFA 1Q81C 1HQMC 1Q8IA 1OXSC 4PMWA 4B3RH 5IGFA 1ASZA 4JI6H 3S17H 1NCVA 2G8YA 4DV4H 2K5VA 2F1MA 2KBNA 1B1ZA 4HAEA 2ZTCA 2WAQE 3X3NA 3L0OA 4UP7A 4K5WA 2KECA 1WTQA 4RMFA 2DY7A 1PH8A 2QW7A 1TIID 5HURA 4JW0A 1V8QA 4ZKBB 4DV7H 1RTNA 1DT4A 4WALA 4DV0Q 3OTOL 2RHQB 2UUCQ 5M5WH 4E9JA 3DEPA 1NTGA 2TMPA 2Z4IA 5IYCH 3OWEB 2D9IA 3DM1A 1R9TB 3S1RH 1BO0A 1HRJA 1JOOA 2MJ8A 3PIPA 3GQBA 1PA6A 4GN3B 4P74A 3CU7A 3C46A 2K5HA 2WAQB 5C5LA 1VQJA 4YHHL 1B70B 3WDNA 3TRZA 3CRKC 1J6QA 1KNAA 5M3FG 3RZDB 1V43A 4YY3Q 3KUPA 1X6OA 1BR9A 1U4RA 1S72A 1GUOA 1Y1WG 1CUKA 1E7ZA 5CV4A 2K28A 2EYHA 1BDOA 4RHSA 4CHTB 2JZXA 2VQEL 4K2KA 1JJCB 4A3EG 4F8MA 4RG1A 2E5LH 1RODA 3LWUA 4A3GB 2DJGC 5EJWA 1E3PA 2F0MA 3KYHC 2B63B 1KABA 1HQRD 5IWAL 1HCZA 3PF5A 2MO1A 4X66Q 1YNJC 2OCEA 4CDEC 4A3LG 4RKBA 1EIGA 4IUQA 1ZZIA 2CH4W 1AE3A 1HNXQ 2C35B 3BDCA 1TU2B 4LFBL 3KBXA 1H9JA 5BN5A 1WTVA 4ZKCB 2UUBL 1N33L 4DXGA 1X3QA 3GV3A 4P2CB 5FLXE 4IO9A 2K14A 3TREA 4X6AH 4A3FH 2F0GA 5FK9C 3L3OC 1SNPA 1Q3LA 3EFXD 2QEJC 1ONLA 3F2DA 3HOUG 1GOZA 2F0PA 5DAUA 2PNHA 2KCMA 3J80W 1II3A 3PO2H 2LY7A 3NBIA 3ULLA 2NVQH 4PDBA 4IZ8A 3Q22A 1C9OA 3H09A 1TVXA 5LMNW 2JA5G 1QG7A 3T4AC 2DGRA 4GKKL 2ENBA 2NVXB 1Y1VB 3S14H 3EJIA 2F0FA 5IWAQ 3CC4A 1EY0A 2E5LQ 1GUSA 2LTMA 3ONAB 4JI8L 1X9NA 2MQHA 2F0DA 1HR0L 4B3TQ 2E2IB 3VDYA 1B7YB 5K36G 1O7YA 1NSNS 2JYOA 4WRDA 5M3FH 4G7HC 4DV4Q 4JV5L 2RHSB 1BBXC 3FKIH 4JI5Q 3PF4A 2YU9B 3HOYH 2KENA 3N52A 5DM73 1PV4A 1PRTB 4GNXA 4H44C 2CVRA 3GKUA 2NVYH 4A3LH 3ZYYX 5COYA 2E2JH 1JE4A 2KOLA 4B3ML 5FLXL 4JPBW 4DR5L 2D5DA 3ER0A 1HH2P 3J7AK 4PZ6A 2D0PA 3K58A 1YI2A 1LUZA 1WCMG 4YHHH 4C3JH 1EYDA 3M4OH 4QCLA 1ZKOA 1CKNA 1V1PB 2AWNA 3GTLH 2ES2A 4JI7L 2M6QA 2G5DA 3EA6A 1Q82C 1N36Q 4DAMA 5IT9L 2NTSA 4DK1A 4A3GH 2DY8A 1Z9FA 2SOBA 4F87A 2ATWA 2SDFA 2EXZA 3DLLA 2AQ1B 4DAYA 5EQ0A 1YNND 1J5EL 1J5EQ 1Y14B 1D7QA 5GADC 2L0CA 1ZZJA 5FO7B 2CFMA 4DV0H 3KK7A 5JJLA 2EQSA 3SGIA 4HSPA 3M4PA 1TUAA 2D9UA 2Q2HA 3E3XA 4QMFB 1JQYD 3VR5A 5G3LD 4BA1I 1YHQA 2K1HA 4C3HG 1XWEA 1VQ8A 3UDGA 1I50B 1VF7A 4DV3L 3SVMA 1EEFD 4KY6A 3UDFA 4KHVA 4A3IB 4TSSA 2J4XA 4R1JA 5EKLA 5D3DA 2D2CC 3J81W 1E24A 1QCBD 3LX0A 1D1KA 2KHSA 1Q90A 1X32A 4I7ZC 2JA6H 1RCVD 2CWFA 4QUCA 1L0WA 1HNZL 1WYDA 5C4JH 4EGVA 4L5TA 5E1FA 1FD7D 1JORA 2LF0A 3H15A 1SXTA 4DK0A 2L1BA 2IL8A 1WTWA 1TWFH 3AB9A 5I6WA 1PTOB 1VQ7A 4PZ8A 4KLKA 1CZWA 2PW7A 1KIXA 1K9MC 3JAME 5FJ8G 3M4OB 3O13A 2E5LL 4BBSB 2K01A 3S2HH 1YITA 2B2UA 5D14A 3KDGA 4JI3H 1N36H 1JCKB 1LM0A 2R7ZH 2B2UC 4KKUA 2VUMG 2WIIB 3W2DA 5IE8A 2JQOA 1B8AA 3L9AX 4Z9CB 3H6MA 1F9SA 4AQYH 5C0XH 5JVG3 2NN6I 2B2VA 2F0NA 3C3LA 1XMOQ 2SNMA 3BG3A 2PCFB 4TVAB 4JI0Q 3BYYB 1MSZA 3I2ZA 3PGZA 3TZDA 1HFNA 3K59A 1Y1VG 1NMGA 2R93H 2EY2A 5C44G 2EPBA 1XNQQ 1GHKA 2L4NA 4A3IH 1UEAB 1XTCD 4YCUA 4NB3A 3UE1A 2JK8A 3RR5A 3TMEA 1ZYRD 3K57A 3E0JA 2E2DC 3H3VI 1EY4A 1QVFA 1PZJD 2F0WA 3OOCA 1CHPD 5E4WC 2VQEQ 2HD3A 5K36H 5I9PA 3FKIG 2VQFQ 1ET6A 4QUFA 3CMEA 1KQSA 4WJWA 1SR3A 3R2IA 2VB2X 4XYQA 2MPMA 1AEXA 1WTRA 2FFKB 2N8NA 2F3WA 2X69A 3NTHA 1F9QA 5E7NA 3QJYA 4IUUA 4A3CG 2A68D 1STNA 3JC66 5CV8A 4A4IA 2QF7A 2H4OA 1IYUA 1Z7TA 1BCPD 1U0LA 2PMZE 1NXUA 1K3RA 4FXKC 5T1GA 4JG2A 2QILA 3E0EA 2LMCB 2VW9A 2HCIA 2YTVA 3U4ZA 2KA7A 5AFWA 1LT6D 1K8OA 3S1MB 3MWYW 2GN5A 4NP5A 3GTQH 3CCVA 2HIXA 3R2TA 4LF5H 2EYJA 4A93B 1RDPD 1IBML 5C4ZA 1IBMQ 2Q2TA 2Q2UA 3HGBA 4DV3H 1GHJA 3W3AA 1TQOA 3RF2A 3TP6A 2ANNA 2OPVA 3OYYA 4UHVA 3G7LA 2LKVA 5A35A 2RF4A 4HEDA 4OD6A 3E6ZX 4DV2L 3A0JA 2Q8IB 4CDFC 1DGSA 4S3SA 1WTJA 4LK1C 1WTOA 2RDHA 3CAMA 3VYUA 1CI3M 2A1SA 4DV6L 2NTTA 5KNCA 4JC0A 1LTSD 3J81c 1Y1WH 1UUPA 5M5YB 4LW1A 3IL8A 1SJHD 2NN6H 1EWHA 3K5MA 4XQNA 4ZCKA 3MXPA 1I5FA 4BBSH 4C3IG 1PDQA 1J4WA 4JI8Q 4IPDA 1HR0Q 2UUAH 4EQ5A 1XJVA 1N32Q 1EUJA 4DUZH 4LUOA 3PIP3 2A74C 2EJFC 2I46A 1TWFB 1IYVA 2ZQEA 1I4QA 1OO9B 1DOKA 1LT3D 1IBKL 4HJ5A 1SRUA 5GROA 2MUYA 5H1SE 1U4MA 2VUMB 1LTLA 1HNWH 2WB1G 4JI7Q 2IT1A 2VY3A 1VQHA 3TP7A 1V9PA 3I4NG 4DAYB 1STEA 4IFDG 4YCVA 3BZDB 3BZCA 4B3TH 3KDFA 5HGQA 5DEHA 5I6YA 2YTYA 2HQLA 1E2WA 3BVGA 2Z1CA 4JCVE 4LF7L 4IJHA 2JXMB 1Y1WB 3M7NA 1UEBA 2L12A 2JE6I 2L55A 2AKWB 4A3EB 4EQNA 2MNAA 1SYFA 3D4DA 2PNRC 2CPMA 3W1GA 3KDKA 2KCCA 4J8QA 1T5XD 2Z4HA 3MVVA 1EFWA 3FKIB 4IN3A 1L1OB 2K33A 1M4VA 4IURA 4NXMH 2QEXA 3MHBA 5IP7G 1EWIA 4HCSA 2E2IH 3HOYG 1LACA 1Q12A 4FJSA 1CM9A 1D8LA 2I5LX 2PI2A 1N34Q 2B2TC 4NW2A 1S5DD 5IY0A 4KHPL 1SYCA 1EIYB 1Z2IA 2VQFL 2XVSA 1CKMA 5IGEA 4GKJL 3ULPA 1C0AA 1NJIC 1W6KA 3GR5A 3MEFA 4X65L 5E4XA 4LFBH 1BF4A 4FF1A 3PO2B 3A56A 1SE8A 2ICIA 2N55A 1VQBA 2E75C 2RDFA 1EY9A 2LFNA 1ML0D 2UXCL 3HS0C 3EBEA 1S40A 1TY2A 1U4LA 4A3DB 3NBHB 2F0SA 3BZKA 3NENA 4QJFA 1ICWA 2VQEH 3W1BA 4NBQA 4CKBA 2A6HC 1MJCA 4WJ3M 4GKKH 1L1OC 4H02A 4X64H 4NZTM 4YY3L 2A69D 4BA2I 2HQEA 3OETA 3S14B 2AQ2B 4F88A 5JVH3 3BVZA 4HMJA 3K7UC 3TS0A 4R9WA 3SK4A 4A3KB 3S1NH 1T9HA 2ZM6Q 1KHIA 1S5ED 2A73B 3HOZH 1KTKA 2JJQA 5ELBA 4LF8Q 1X54A 4WFN3 2N88A 1V9NA 1LTRD 2MP1A 2PO4A 2UUAQ 1HR0H 1ASYA 4JI8H 2C5CA 2MFIA 4AIMA 3IFTA 3HOVH 4YWLA 1F77A 1CFMA 1YNNC 1QUQB 3I0PA 5GAHC 5JPMC 2VZAA 3OW7A 2R7ZB 2R6GA 4BY1G 1XPOA 1HXYD 4XT1B 2NWGA 4JI0H 4G08A 3SB1A 3OSOA 4DK6C 2A6EC 2BDOA 2BDNA 1FGUA 3T13A 3CF5A 4DR7H 2WB1B 3E9IA 4KTAA 4DUYL 4K0KH 1L1OA 3OIPA 1SFOB 1STYA 1HNWL 2PW5A 4A3FB 1OXVA 3U9OA 2RBMA 3K5NA 1UE1A 1G2SA 2EYMA 3GTJH 2UU9L 2UXDH 1PZKD 2WACA 1ICFB 5KNBA 5EGTA 1IKLA 3VR3A 3CMAA 4U68A 5A2QW 3G6EA 4QIWB 4YWKA 1PH9A 4A3IG 1KL9A 1SNOA 2PQUA 2QKIC 2FHTA 4OELB 2EY6A 3S17B 3I90A 3K80C 1PHJA 4B3TL 1DZ1A 2EJMA 3T1HL 2A68C 3PUYA 3RUZA 5BR8Q 3ERQA 1CQFA 1PYWD 1I4GA 5J1ZA 5FJ8H 4C56C 2V4DA 1A2UA 3MXGA 3KLSA 4GN4B 3VYSA 1UAPA 1E0BA 5FLMH 3J81i 1BBUA 1CHQD 1VQ4A 3PCOB 1IBKH 4DR4Q 4QIWE 4A3EH 4CGYB 4EVOA 2F4VL 3C1FA 1G6ZA 4P73A 5IYDH 1HNXL 5TSSA 3W5OA 1UE6A 1B53A 3FVQA 2AXYA 1SSOA 1CKOA 2X6GA 1NR4A 4BXXH 3GTLB 2K5WA 3HOXG 1SYGA 3OMCA 2ALYB 2M2LA 1B9NA 4LF9H 4JVHA 3UI2A 2ZJPA 4I7AA 4LUZA 5D3IB 1IW7D 5CV6A 4NDXA 1G2TA 2R92B 1SLJA 5FO8B 4DR6L 1IZ6A 4UP8A 3OWFA 4N9TA 1RD9D 4I65A 4CKEA 3NHHA 1SE3A 3PO3G 3UE0A 4LF6H 1M8AA 4A3DH 4J1MA 4LF7H 4C1NI 3PUZA 4L63B 4OX9Q 1TR5A 1V1QA 4IUNA 1W2BA 3DWAA 3CC7A 2FJ2A 1O7IA 3ICEA 1EU4A 5M3FB 1I3QB 1WVNA 3U9SA 3TN2A 2F0UA 1G91A 2B3GA 1KRTA 1QNUA 1B44D 2HDLA 1X9ZA 3KJPA 2E2JB 4B3SH 3NP8A 5LL6X 1UE5A 1EYGA 4PG3A 1YJ9A 5I2YA 1X56A 1YHAA 1PH4A 3FDTA 3AFQA 2UU9H 3DEOA 4TKOB 4DNRB 1AW7A 3BS1A 2RDGA 1F9RA 3G4SA 3RNUA 3A5UA 5IGGA 5EPKA 3HOZB 1CSQA 3D8GA 3J81L 3H3VH 4DUYH 4B08A 3HZXA 3T1YL 4L6TB 1XYIA 1I94H 1EC6A 4FO2A 4KMUC 4FP5D 5K5PA 1CA5A 1HNXH 3QR8A 3PUWA 1M90C 4J15A 4DR1H 2JEBI 2TSSA 1BVSA 1IBLL 3RZOB 1SE4A 2AUJD 1GVPA 4ID6A 2P5ZX 2NB0A 4GS3A 3M7GA 4JI3L 1PFMA 5ELCA 4DA2A 4A93G 2EXDA 1GUGA 3K7AH 3A8KE 1EQQA 3U58A 1IXRA 3AQQA 2CPQA 1N34H 4C3HH 4A3GG 3NWTA 2B8GA 1KHMA 4AH6A 2B2TA 4IPGA 4NKLA 4FF4A 2H1EA 1DONA 1HNZH 2E2HH 1JMCA 5CYUA 4DV1L 1R4QB 2IX3A 2Z0SA 4KY5A 4DR2L 3OIQA 1MGSA 3DUZA 2I0QA 3AYHB 4LMQD 1EQTA 3DWPA 1TWCB 1PTOH 3RZDH 1XNRH 1CSPA 1NNXA 1P8LA 5M5YH 1TWGH 3Q23A 1GUWA 2UXCQ 4K0KL 1QUQA 4IFDH 5CBAE 3J80c 3QO2A 3D4WA 5BR8H 5JEAG 1V1OA 1SMXA 4UAIA 2ASBA 4JI5H 5IT9W 1QNKA 4ZAIA 3J80E 4ZUJA 1U4PA 1U9RA 4JI3Q 5M5WB 1QILA 4JI2Q 3G6JB 4JK1C 1FYCA 4KD3A 1LTID 4DR6H 1QE6A 1GO3E 4G57A 1SEBD 2K7VA 1WCMB 4OO1I 3EVQA 3KLWA 1TY0A 4JI7H 2LSSA 4GKJH 1XPRA 3UDXA 1DOLA 3F8TA 1HHVA 1EY6A 1OXTA 4JV5Q 2R61A 3L7ZC 4IPCA 1A15A 2EYPA 3PO3H 2XWJB 2CQAA 5LMNQ 4A93H 4A3JG 1PLFA 1E2ZA 2PI2E 2EDGA 2F0VA 5CMDA 4OX9L 2F3IA 3NELA 1OXXK 2CTJA 1WJJA 4LF9Q 1CTMA 4JI1L 3SK6A 4HSVA 1X0AA 2VUMH 1VDZA 3KF8B 3CCRA 1J8IA 1X4NA 4NXNQ 1H9RA 2F0HA 3QOJA 5CR3A 3SHLA 2O2LD 4V190 3S16H 4CDDC 1H95A 1YIJA 4YCWA 4X64Q 3J7A5 2UXDQ 2UXBQ 2CWHA 1GXDC 1NE3A 1NAPA 2E76C 4C3HB 2CQOA 4QQBX 1O80A 1KD1C 4B9WA 2DNEA 5IP7H 3NTKA 1WOCA 2V1CC 2YU9H 4DNIA 4XXEA 3VA5A 2J7ZA 5M3MG 2BL5A 4YHHQ 5EKIA 4KI0A 4GOPA 1TXYA 4QB4A 1X55A 2Q8TA 4PMBA 2RA4A 3HOZG 1BNZA 1EIHA 5C3EB 4CDCC 2MGSA 5C4XH 5IT9E 1PH2A 1PH7A 2JA8H 3GTPH 5M9OA 2A8VA 2NVTB 4B3MH 4B8CD 1TWAH 3HOVG 2EIFA 2PZUA 2YQRA 2OTLA 2Z6BA 4FF3A 3CHBD 3MFYA 5FOBB 1YBYA 4ME5A 1EQRA 4OX9H 4R4TA 4JI0L 2UUAL 2OWOA 1F0XA 1L2FA 5ELOA 3CCUA 1DYQA 5L37A 3IFDA 2NVXH 1SE2A 1DTJA 1AN8A 2O5IC 3HOWB 1W3SA 3RMHA 1W6JA 5LMUQ 1J5EH 2RCNA 3FMCA 1VQGA 3I4LA 1UWVA 1QOHA 1LO5D 5IWAH 3CCSA 2VS1A 1X3GA 3ERSX 3GTMH 5EAYA 5AJ3L 3D4RA 1BUVT 1XNRL 2YYZA 3VYRA 4JBJA 2NZOA 4BS9A 1D5MC 4DV5Q 2L9HA 3F1ZA 1CT1D 1EQVA 5CV7A 2PQAA 4DR5H 4Y52H 5IODA 2LS01 1EEID 1Y8OB 5FLXc 2K4KA 3STBD 2LRRA 1HZBA 1VQ6A 5G3LF 2A69C 4BY1B 4IALA 2A5HA 2ZT9C 1S5BD 2A6HD 3GO5A 1EFID 1O78A 3QIAA 4OO1H 2CTFA 4BBRH 1JC7A 2NVQB 1XNRQ 3SE0A 2D62A 5J3BA 2AUKA 1DCZA 2K6AA 1K83B 1RIPA 4IJLA 4GLAC 1X65A 3KLRA 5KRUA 2QDBA 4K2LA 1A3VA 4K5VA 5C4XG 3K81C 3JAMc 2N78A 3I72A 5DLQE 2K1BA 2HCCA 1A62A 2NBFA 3MEHA 1K73C 4OWXB 1FNVA 5JEAJ 2NN6G 4DV4L 3SK5A 4OIKA 4POGA 2Z6KA 3OHXC 4RGOS 2E74C 1S5CD 4NXMQ 3TS2A 2BE5C 2RQXA 3HRZC 1E1TA 1YJWA 3NUCA 1BKBA 3K5LA 3KFUA 4DFAA 2B63H 3QG1A 3HKZG 2WKCA 1GUTA 2Q2IA 4B9XA 4ZLTF 2XWBB 3K6OA 4K14A 4RGTA 2C9OA 3M85A 4O42A 2DGYA 3MFGA 3NWSA 4UPAA 1K8MA 4DR1Q 3JAMi 3ITPA 1HTLD 3N6RA 3R8BA 1HZCA 1K8AC 4JI4L 3J7YW 1SFOH 1XPUA 2I07B 3HFZB 4V0BA 5CV5A 1UNSA 2BA1A 4LF4L 1GUNA 4DAPA 4KK7A 4BXXG 4JI2L 1BBWA 1LLRD 4K6LA 3A8JE 4X66L 1Q86C 1VS0A 3K8AA 1WD1A 1GD7A 1HFGA 4HIKA 2F0IA 1KLGD 2R7FA 1TS5A 5FO9B 2R92G 4PMCA 1N9WA 4OONA 3G71A 2B2WA 3NSWA 1A8VA 1WD0A 5JJIA 4LF6L 5J22A 1UG8A 3J80L 4JI4Q 1CQVA 4JI2H 2UUBQ 1K28A 3M9BA 1EY5A 3CCLA 1JWSD 3H0GH 1PTOC 4DK3C 5J39A 4X62L 5CBEE 2PQAB 2CTKA 3HOWG 3T53B 2PYKA 4DR2Q 1JR0D 2GVBA 5GAEC 3S1NB 2MJHA 1N32L 1A63A 4C3JB 4LF5Q 3T1HQ 4XYOA 5FKAC 2PPBC 2EY5A 1VQCA 4DV6H 4GN5A 2ID0A 1PFBA 1PYSB 4HJ8A 5AJ3Q 1FJGH 3PMFA 4HN7A 1X3EA 2PY9A 3CKIB 5JPNC 2G9HD 4XT3B 1MBYA 2DN8A 1MIUA 3E9HA 2JA7H 1XRHA 4DV7L 1CKNB 1V1PA 4EQOA 5ELFA 2PZTA 3MTSA 4CJ0B 5IYCG 5ISRA 1K0SA 2E3UA 1FGBD 3BYTB 3GV6A 2EOTA 3C2PA 4G7ZC 3U1KA 4QGUA 1PXUA 3M3YB 1YVCA 3I7FA 3CW2C 2OXPA 4GLVB 3GDEA 3HOYB 4IOAA 1PH6A 1LTGD 4A3MB 1TKWB 1YEZA 3VR2A 3CCQA 3I55A 4RAUC 1HZAA 1ET9A 4RGNA 2IX1A 3FHWA 5CGKA 1EIFA 1C8CA 4JI6L 2RKSA 1VQMA 4HIMA 3OW2A 3I56A 4ZK9B 3PQIA 3J81E 1JOKA 3S15H 1M1KC 1FNWA 4PQXA 4H8AA 5M5XH 3ULJA 1Y8PB 4PV1C 1I6HH 1HPCA 4Q0FA 4JYAH 1X3FA 2WP8J 1A3UA 3CRLC 3I91A 4B3MQ 3MXUA 5JAVA 3RN2A 2IHFA 4B3SL 4AQYQ 3GABA 4K8IA 3H91A 1HNWQ 1JJ2A 3EZJA 3R93A 3MAQA 3CCMA 1VQPA 3SDZA 1B9MA 1WI5A 1TS3A 1I6VC 4IUTA 1WTHA 3JAMW 3A8IE 3S1RB 1I4RA 1F2YA 1V8CA 2Y0SE 1AZQA 4DV6Q 2CCZA 4LNQA 1LV9A 4MN3A 4R8IA 5EBCA 3L2PA 4GZYC 4IFDI 3NXWA 5ELDA 1KXLA 4R4CA 4FF2A 2MO0A 4DR5Q 1WVLA 1AP0A 5IIFA 2LXJA 4AYBB 1EOTA 4MNOA 1CK1A 2JA7G 1Q1EA 2EE1A 1SMYD 2J0TD 4APVA 5IT9c 2JN4A 3S2HB 5M3MH 2IY5B 3P20A 3URYA 1B50A 2FPHX 1N8RC 4DN4M 4LF8L 4XDXA 3VYTA 1ENAA 2ANRA 4RWSC 4JOIC 3F2CA 1ZYRC 5IYDG 2BH8A 2CW0D 4JI1Q 1X4MA 5DT9A 1MSHA 4JOIA 1G6PA 1G8ZD 1DOMA 2A1AA 2N3SA 2KUMA 4R8NA 1F2ZA 5C4JB 1YZ6A 1HJPA 3D0FA 1ZTGA 5JJZA 5C6AA 3DWQA 1MHWC 2F4VH 3BDOA 4JYAQ 4A3BB 2AWOA 3PSIA 4BY7B 2NYZD 2XNAC 3VR4A 5KGUA 3A7AB 3MA2B 1OTCA 3U50C 2JA8G 4KD4A 4HMIA 1RF2D 3H3VC 4DR7L 2Y0SG 4P71A 1I50H 2WAQG 1NR2A 4LFAL 4LFAQ 3T1HH 1HZ9A 1R9TH 3EIVA 2KEDA 2FMCA 3ND9A 1ESRA 1PH1A 2PZWA 5LMNL 2RVLA 4PNYA 2PMZB 1G291 1AZPA 2EJGC 4KKTA 4RHRA 5BN4A 3P75A 4HCEA 1A2TA 4ZYSA 2MHVA 3R3OA 2FFMA 3NEMA 4L5QA 3S24A 5FLMG 4OWTB 5FLXW 2K5DA 4DF7A 2ZM6H 1GM5A 2RCFA 5ELEA 4Y7NB 4A75A 1PYBA 3I70A 2L15A 5KEEA 1H9SA 4K0KQ 2DUDA 4NXML 2ZTEA 4N9PA 2ZJRA 1I3QH 4DUZQ 3GTKH 3OPOA 4X3SA 4DU9A 1S4ZA 2FXQA 3A74A 4A3BH 4LFCH 1PRTD 1F2MA 2K52A 2ZJQA 2VNUD 1AN7A 1KDAA 5DNFA 5T1IA 4KN7C 2WB1E 2IJ0A 2PQEA 4JBWA 4KHZA 2HH3A 2NZHA 5I9OA 5C3XA 4OCHA 3KOJA 3KF6B 1PH5A 3J7AF 3HOXB 3HOUB 3S16B 3HP3A 3C1EA 2ZXOA 1D1IA 1MSGA 2CWPA 2H5XA 4JBMA 2NUCA 1MJEA 1TT2A 3AU7A 3NPPA 4JI5L 5E3FA 4OO1G 3I4MB 1Y1VH 1ENCA 4N8FA 2VKCA 4X65H 3PO3B 1JT8A 1SNCA 1KNEA 1A6XA 1RL2A 1QJOA 1XXGA 1NMFA 3ND8A 4MTNA 1VQDA 4F7XA 5A2QE 2WINB 3HKSA 2KEEA 1RKNA 4DR2H 1EOVA 5EKKA 4EQPA 1Q7YC 1JB7A 2D0OA 3OMGA 1WTXA 3VR6A 4DV5L 3GTOH 1H9MA 1C4QA 5A2QL 1VCIA 5F2DA 2KQ3A 3KJOA 2B2WC 1UE7A 2UXCH 1AFPA 2P2RA 1PMRA 4ZQ3A 1S03G 1SAPA 2KHIA 3SR1A 2KCTA 3KDFB 3WOEA 1TWCH 3KBGA 1IBLQ 2NZ1D 1O7ZA 4OGQC 2CTLA 1PRTC 3D31A 1KDBA 1E22A 4BY1H 4DV7Q 4FDBA 4UP9A 3RD4A 4X62Q 4L5SA 2A19A 4CJ2C 2JA5B 2HHHL 4GKJQ 2M00A 2B2VC 4WANA 1XMQH 3HG9A 2XN9C 4O1NA 3EQLC 3E5SA 3GTJB 1D2BA 4KHPH 3HEJA 1PQXA 4GOPC 3Q8DA 4LF5L 5EPJA 3T1YH 4RFBA 5I4DA 3S9WA 2JA5H 4C2MB 2EYFA 2XGTA 4HJ9A 1PFNA 3PUXA 3I4OA 1L0XB 2JA6B 3GTOB 5D65A 3QB3A 4GKKQ 5KYLA 2QNDA 3PIO3 2JEAI 4DUZL 2CH4A 1S3OA 4TRDA 3TDQA 3F2UA 4TQUS 3NTIA 4NXNL 4DAVA 4H7BA 5IP9H 3RLNA 1D5XC 1C48A 1YNJD 4ZUIA 1CZGA 4L8JA 1I4XA 4JBKA 1VF5C 3CP0A 5EBDA 3WWVA 4OXPA 1XNQL 1YNXA 1SBBB 1LT4D 2EYOA 4X66H 2LTLA 1RJTA 1I94Q 3X3MA 1P16A 2WV6D 1QVGA 4LF4H 2IPKD 3D6CA 4EC5A 1ILPA 3CCJA 2WFWA 2XSCA 2F4VQ 4H13C 2HHHQ 4LFCQ 3KLSX 3BVMA 4DR4L 3T16A 2NVTH 4GOPB 4DR3H 1C7YA 2X6LA 3M3YH 1VQNA 4H0LC 1IW7C 3VA7A 4JVYA 1SJED 1SYEA 2CWAA 3J7AV 1VQAA 2JP1A 1MI2A 1N34L 5KIXA 1ZZKA 2Q8RE 3S1QB 4N8X1 2E8GA 4DGZA 4DV3Q 1BXTA 5DM63 1H9KA 2K03A 2VXWA 3T56B 1EY8A 3FPUB 2HUGA 1IYJB 4OWWB 3M4YA 2Z8LA 3A54A 3DMUA 4DR6Q 1KDCA 2OEOA 2UXBH 2AHOB 4CJ1B 4KJOA 4XQQA 4HIDA 2CKZB 5LHY1 2K32A 2YTXA 4FYDA 4A3JB 2QDLA 5BR8L 4LF7Q 5C44B 1FL0A 1SYBA 2L11A 2FMMA 3NBHA 3NQTA 4CBVA 4Y7NH 5IP9G 3CC2A 1KLUD 1O7LA 1PZID 3PUVA 1IBMH 2K50A 1FJGL 1K8GA 2HT1A 1FJGQ 1B2TA 1IL8A 1LTBD 4HJ7A 5GQOA 4NPSA 1N32H 1K3BC 1NUCA 1GJXA 2F0JA 2F0KA 2VL6A 1I6UA 4M1UB 3K5OA 4B3SQ 3BU2A 4BBSG 1VQIA 1SNMA 3UDIA 1CA6A 1JWMD 1TWAB 1J5KA 4DR4H 4X3TA 4JVZA 3AEVB 4KJNA 4DV1Q 4X62H 1F2LA 3LNNA 1VQEA 1ODHA 4LAAA 2Z6KC 3J81j 4MTKA 2IHEA 3B6YA 4RCOA 4IOCA 1A3TA 1VIGA 1HUNA 2B8FA 2ZXPA 3LGJA 3S1QH 2B29A 2A6ED 1ESFA 2AMCB 4ULLA 3RLOA 1VQFA 2O4XA 2Y3MA 1FR3A 3MC0B 1QWYA 1VQLA 3H94A 4NMZA 5NUCA 5C3EG 3I73A 3OTOQ 4AQYL 3QOLA 1B3AA 4FJUA 3A5ZB 1YJNA 2KHJA 1ILQA 3KF6A 1DM0B 1S5FD 4DV2Q 1WTPA 2IWHA 1IBLH 2B39A 3JAML 2QA4A 2AQ3B 3NCVA 3DXJC 4KN4C 4ODGA 2JA6G 4C2MH 1GKHA 5CC4A 4U673 3FEWX 2OF1A 4G4KA 3QD7X 3MXNA 2F0EA 4LUVA 4RCNA 4YIJA 4POFA 1DXMA 1Q1BA 4DNTB 1FVIA 4IFDJ 2L5TA 3BJUA 3P7JA 4B3RQ 4R4OA 3TSSA 2F52A 5C4HA 3GTMB 4CKCA 1LTAD 1Y8NB 2ZXRA 5KYIA 1WE8A 3CPWA 4AYBG 1PRTF 5M3MB 1XMQL 1VQ5A 5IGCA 2B63G 4DPGA 1QZHA 1JOQA 5LMUL 1PTOD 2ICEC 1XMOL 2R7DA 2F0OA 4XTCS 1JICA 4DR3Q 1S20A 3TP5A 1HR0W 3J80i 4UY8C 4IUVA 4X64L 1IKMA 1MKHA 1E1OA 4JV5H 4L5RC 2F0TA 4E6IA 4C3IB 1JE5A 3HOVB 1TS4A 4B8TA 1K83H 1YHBA 3RN5A 2XRQD 2RSNA 3D3RA 1JWUD 3V69A 1VBIA 2CTMA 2IW3A 3FAUA 5C44H 2FINB 4BBRB 2EY1A 5C3WA 4K6DA 1SDFA 3TEHB 4BY7G 3HOUH 4WJ4A 4LF4Q 2GVAA 4X65Q 1EU3A 2OPUA 4QL5A 4LFCL 3GTQB 3S1MH 1DJRD 3VKEA 1I6HB 1QB5D 1RHPA 3FPPA 2UXDL 3PV0A 1MD2D 5C0XG 2JA8B 3CPFA 1K1GA 3I4NB 3I4MH 4LFBQ 3DHQA 1Z47A 1TS2A 1XMOH 5LL6S 2E2HB 2B2YC 1QZGA 1XMQQ 2BA0A 2F0QA 3AEVA 2B2YA 3HOWH 1F9PA 1Q8KA 3EN2A 2OT2A 4YWMA 4HJAA 4FXGC 3DM3A 2OTJA 2BE5D 1VMCA 3GTGB 2CW0C 5LL6b 2I5MX 1T5EA 4M8AA 1JJGA 3V96A 4IPHA 3CQZB 2XIWA 1D5ZC 1ZXTA 1VQKA 3NE5B 4FVMA 1N33H 1PTOF 4DV0L 2JSOA 1SMYC 4O0AA 1IL2A 3TQYA 1IBKQ 3FRPB 4ILWA 3RLFA 4A76A 1U5KA 4OHJA 2R92H 2LXKA 5I2XA 5IGBA 3HKZE 2UUCH 3OSSD 2BOSA 3AFPA 2RSOA 3HKZB 5C3EH 3GTPB 3TP8A 5IYBH 1STBA 1AH9A 3FP9A 3MXNB 3T1YQ 2CTEA 4HIOA 4FNFA 2EZVA 4ABNA 5JOBA 5GAGC 4DV5H 1DD2A 3H0GG 3CXCA 3A7LA 3HOXH 3Q24A 2KCNA 2R93B 1PH3A 1QVCA 4XIGS
chains in the Genus database with same CATH topology
3LWEA 5JJKA 2K5QA 3PO2G 2N49A 3STBC 4K8JA 5C4XB 3CQZH 1HA5A 1A0IA 1BOSA 2EVBA 1EZ6A 4G7OC 4HR7B 3GTKB 4QY7A 3I4MG 5CORA 4GLXA 1BCPB 4A3DG 1J9OA 2K75A 4LIJA 4R4QA 4LJZC 1STGA 4FXDA 2UUCL 3J7ZC 3Q6SA 4RKLA 3G48A 2DNCA 4K5XA 5IOCA 3I4NH 1BQQT 1KRSA 3GD7A 1EY7A 1R4PB 4QMGA 1HTPA 1EYCA 2G9DA 4MIUA 1PFSA 1SNDA 2GA4B 3I8ZA 1VQOA 2R3ZA 2BCOA 4LWCA 2HIVA 1NBWA 1WCMH 3K0YA 4C3JG 3SXHA 1KAWA 3MZ5A 1ZEQX 1VMPA 4IUPA 5C0XI 2JA9A 1SNQA 1HA6A 2K05A 3IRBA 1Q46A 4RH6A 1JB3A 5HY6A 2F4IA 4C3IH 4JI6Q 1ENFA 2F3VA 4Q5VA 2VB3X 2O5JC 1TWHB 2ZM6L 2F0LA 3D6WA 1EWCA 1EL0A 4MZ9A 2BH2A 2JVZA 1KC8C 3NK9A 1EYAA 4ALPA 3Q0AA 4A3MG 4BBRG 1PVOA 4GNXC 3GP7A 3BDLA 3PIOA 4BY7H 2IX0A 1BCPC 1LYLA 1TWHH 1AE2A 4DR3L 1SROA 2HDMA 4ZRZA 4LF6Q 1VIHA 3CD6A 3S15B 1K0RA 4KHPQ 1FNUA 4RGMA 2XTIA 1STHA 1OXUA 1B4OA 1SYDA 4HTHA 1LT5D 2OQ0A 2I5HA 1KAAA 1TWGB 4A3KG 1WFQA 3IAYA 2FMRA 2CHBD 4IQZA 2HH2A 2SEBD 2F03A 2EYLA 3QWNA 4B3RL 1X3PA 3SEBA 1NY4A 1XX8A 4OIJA 3K7AB 2QCPX 4J6HA 3M4QA 5KNDA 4PZ7A 4RA8A 5C5MA 3S2DH 2UXBL 4AM3A 4DR1L 4JYAL 5IYBG 3SK8A 4ME3A 2UU9Q 3IKJA 1I94L 4GNXB 5IGDA 3T51B 3NQIA 1LTTD 4C1NK 4LF9L 3ZJYC 2NVYB 3KF8A 2M9VA 4X3UA 1HUMA 1Z6HA 5ELNA 1RTOA 3U4VA 4WORA 3V2TA 2SNSA 1L0YB 2YV5A 4DR7Q 2R7ZG 3TZUA 1I4HA 3TBIB 4QF4A 1XTDA 4A3CH 4BWGB 4MHEA 4DKAC 2QGQA 4P72A 3S2DB 4EX5A 2KJXA 5JEAH 1N33Q 1BCPF 3F2BA 5CV9A 5HGTA 5C0XJ 3CCEA 4A3FG 3H0GB 3RZOH 3V05A 2OQKA 2XRSD 1I4PA 4O2DA 1IHZA 2R93G 1EZ8A 1LABA 5BN3A 4KKSA 5M5XB 3P1HA 4X3KA 1G51A 1N36L 1SN8A 1E2VA 3A55A 4XQJA 4AYBE 4P75A 3I3CA 4DUYQ 1STAA 4A3JH 4KV6A 1VQ9A 2K04A 4A3BG 3WOFA 3AMUA 4A3KH 4A3MH 4OL7A 1HNZQ 1H9SB 3EROA 3K0XA 2ZTDA 1D6EC 4UDUC 2WKDA 1Y69U 3GTGH 2Y0SB 5EPLA 4R4IA 2K5NA 2KVMA 2JA7B 4KY7A 4DXFA 1Q81C 1HQMC 1Q8IA 1OXSC 4PMWA 5IGFA 1ASZA 3S17H 1NCVA 2K5VA 2F1MA 2KBNA 1B1ZA 4HAEA 2ZTCA 2WAQE 3X3NA 3L0OA 4UP7A 4K5WA 2KECA 1WTQA 4RMFA 2DY7A 1PH8A 1TIID 5HURA 4ZKBB 1V8QA 1RTNA 1DT4A 4WALA 4DV0Q 3OTOL 2RHQB 2UUCQ 5M5WH 3DEPA 2TMPA 2Z4IA 1NTGA 5IYCH 3OWEB 3DM1A 1R9TB 3S1RH 1BO0A 1HRJA 1JOOA 2MJ8A 3PIPA 3GQBA 1PA6A 4GN3B 4P74A 3CU7A 3C46A 2K5HA 2WAQB 5C5LA 1VQJA 4YHHL 1B70B 3WDNA 3TRZA 3CRKC 3RZDB 1KNAA 1J6QA 5M3FG 1V43A 4YY3Q 3KUPA 1X6OA 1BR9A 1U4RA 1S72A 1GUOA 1Y1WG 1CUKA 1E7ZA 5CV4A 2K28A 2EYHA 1BDOA 4RHSA 4CHTB 2JZXA 2VQEL 4K2KA 1JJCB 4A3EG 4F8MA 4RG1A 1RODA 3LWUA 4A3GB 5EJWA 2F0MA 2B63B 1E3PA 3KYHC 1KABA 1HQRD 5IWAL 1HCZA 3PF5A 2MO1A 4X66Q 1YNJC 2OCEA 4A3LG 4RKBA 1EIGA 4IUQA 1ZZIA 1AE3A 1HNXQ 3BDCA 2C35B 1TU2B 4LFBL 3KBXA 1H9JA 5BN5A 1WTVA 4ZKCB 2UUBL 1N33L 4DXGA 1X3QA 3GV3A 4P2CB 5FLXE 4IO9A 2K14A 3TREA 4X6AH 4A3FH 2F0GA 5FK9C 3L3OC 1SNPA 1Q3LA 3EFXD 2QEJC 1ONLA 3F2DA 3HOUG 1GOZA 2F0PA 5DAUA 2PNHA 2KCMA 1II3A 3PO2H 2LY7A 3NBIA 3ULLA 2NVQH 4IZ8A 3Q22A 1C9OA 3H09A 1TVXA 5LMNW 2JA5G 1QG7A 3T4AC 2DGRA 4GKKL 2ENBA 2NVXB 1Y1VB 3S14H 3EJIA 2F0FA 5IWAQ 3CC4A 1EY0A 2E5LQ 1GUSA 3ONAB 4JI8L 1X9NA 2MQHA 2F0DA 1HR0L 4B3TQ 2E2IB 3VDYA 1B7YB 5K36G 1O7YA 1NSNS 2JYOA 4G7HC 4WRDA 5M3FH 4DV4Q 4JV5L 2RHSB 1BBXC 3FKIH 4JI5Q 3PF4A 2YU9B 3HOYH 5DM73 3N52A 2KENA 1PV4A 1PRTB 4GNXA 4H44C 2CVRA 2NVYH 4A3LH 3ZYYX 5COYA 2E2JH 1JE4A 2KOLA 4B3ML 5FLXL 4DR5L 2D5DA 3ER0A 1HH2P 4PZ6A 2D0PA 3K58A 1YI2A 1LUZA 1WCMG 4C3JH 1EYDA 3M4OH 4QCLA 1ZKOA 1V1PB 1CKNA 2AWNA 3GTLH 2ES2A 4JI7L 3EA6A 1Q82C 1N36Q 4DAMA 5IT9L 2NTSA 4DK1A 4A3GH 2DY8A 4F87A 2SOBA 1Z9FA 2ATWA 2SDFA 2EXZA 3DLLA 2AQ1B 4DAYA 5EQ0A 1YNND 1J5EL 1J5EQ 1Y14B 1D7QA 5GADC 2L0CA 1ZZJA 5FO7B 2CFMA 3KK7A 5JJLA 2EQSA 3SGIA 4HSPA 3M4PA 1TUAA 2D9UA 2Q2HA 4QMFB 1JQYD 3VR5A 5G3LD 4BA1I 1YHQA 4C3HG 1XWEA 1VQ8A 3UDGA 1I50B 1VF7A 4DV3L 3SVMA 1EEFD 4KY6A 3UDFA 4KHVA 4A3IB 4TSSA 2J4XA 5EKLA 4R1JA 5D3DA 2D2CC 1E24A 1QCBD 3LX0A 1D1KA 2KHSA 1Q90A 1X32A 4I7ZC 2JA6H 1RCVD 4QUCA 1L0WA 1HNZL 1WYDA 5C4JH 4EGVA 4L5TA 5E1FA 1FD7D 1JORA 3H15A 1SXTA 4DK0A 2L1BA 2IL8A 1WTWA 5I6WA 3AB9A 1TWFH 1PTOB 1VQ7A 4PZ8A 4KLKA 1CZWA 2PW7A 1KIXA 1K9MC 3JAME 5FJ8G 3M4OB 3O13A 2E5LL 4BBSB 2K01A 3S2HH 1YITA 2B2UA 5D14A 1JCKB 1LM0A 2R7ZH 2B2UC 4KKUA 2VUMG 2WIIB 3W2DA 5IE8A 2JQOA 1B8AA 3L9AX 4Z9CB 3H6MA 1F9SA 5C0XH 5JVG3 2NN6I 2B2VA 2F0NA 3C3LA 1XMOQ 2SNMA 3BG3A 2PCFB 4TVAB 4JI0Q 3BYYB 3I2ZA 1HFNA 3TZDA 3PGZA 3K59A 1Y1VG 1NMGA 2R93H 2EY2A 5C44G 2EPBA 1XNQQ 1GHKA 2L4NA 4A3IH 1UEAB 1XTCD 4YCUA 4NB3A 3UE1A 2JK8A 3RR5A 3TMEA 1ZYRD 3K57A 3E0JA 2E2DC 3H3VI 1EY4A 1QVFA 1PZJD 2F0WA 3OOCA 1CHPD 5E4WC 2VQEQ 5K36H 5I9PA 3FKIG 2VQFQ 1ET6A 4QUFA 3CMEA 1KQSA 4WJWA 1SR3A 3R2IA 2VB2X 4XYQA 2MPMA 1AEXA 1WTRA 2FFKB 2N8NA 2F3WA 2X69A 3NTHA 1F9QA 5E7NA 3QJYA 4IUUA 4A3CG 2A68D 1STNA 5CV8A 3JC66 4A4IA 2QF7A 2H4OA 1IYUA 1Z7TA 1BCPD 1U0LA 2PMZE 1K3RA 4FXKC 5T1GA 4JG2A 2QILA 3E0EA 2LMCB 2VW9A 2HCIA 2YTVA 3U4ZA 2KA7A 5AFWA 1LT6D 1K8OA 3S1MB 3MWYW 4NP5A 2GN5A 3GTQH 3CCVA 2HIXA 3R2TA 2EYJA 4A93B 1RDPD 1IBML 5C4ZA 1IBMQ 2Q2TA 2Q2UA 3HGBA 1GHJA 3W3AA 1TQOA 3TP6A 2ANNA 2OPVA 3OYYA 3G7LA 2LKVA 5A35A 2RF4A 4HEDA 3E6ZX 4DV2L 2Q8IB 3A0JA 1DGSA 4S3SA 4LK1C 1WTOA 2RDHA 3VYUA 3CAMA 1CI3M 4DV6L 2NTTA 5KNCA 4JC0A 1LTSD 3J81c 1Y1WH 1UUPA 5M5YB 4LW1A 3IL8A 1SJHD 2NN6H 1EWHA 3K5MA 4XQNA 3MXPA 1I5FA 4BBSH 4C3IG 1PDQA 1J4WA 4JI8Q 4IPDA 1HR0Q 4EQ5A 1XJVA 1N32Q 1EUJA 4LUOA 3PIP3 2A74C 2EJFC 2I46A 1TWFB 1IYVA 1I4QA 1OO9B 1DOKA 1LT3D 1IBKL 4HJ5A 1SRUA 5GROA 2MUYA 5H1SE 1U4MA 2VUMB 1LTLA 2WB1G 4JI7Q 2IT1A 2VY3A 1VQHA 3TP7A 1V9PA 3I4NG 4IFDG 1STEA 4DAYB 4YCVA 3BZDB 3BZCA 3KDFA 5HGQA 5DEHA 5I6YA 2YTYA 2HQLA 1E2WA 3BVGA 2Z1CA 4JCVE 4LF7L 4IJHA 2JXMB 1Y1WB 3M7NA 2L12A 1UEBA 2JE6I 2L55A 2AKWB 4A3EB 4EQNA 2MNAA 1SYFA 3D4DA 2PNRC 3W1GA 2KCCA 4J8QA 1T5XD 2Z4HA 3MVVA 1EFWA 3FKIB 4IN3A 2K33A 1L1OB 1M4VA 4IURA 2QEXA 3MHBA 5IP7G 4HCSA 1EWIA 2E2IH 3HOYG 1LACA 1Q12A 1CM9A 1D8LA 2I5LX 2PI2A 1N34Q 2B2TC 4NW2A 1S5DD 5IY0A 4KHPL 1SYCA 1EIYB 2VQFL 2XVSA 1CKMA 5IGEA 4GKJL 3ULPA 1C0AA 1NJIC 1W6KA 3MEFA 4X65L 5E4XA 1BF4A 4FF1A 3PO2B 3A56A 1SE8A 2ICIA 2N55A 2RDFA 2E75C 1VQBA 1EY9A 2LFNA 1ML0D 2UXCL 3HS0C 3EBEA 1S40A 1TY2A 1U4LA 4A3DB 3NBHB 2F0SA 3BZKA 3NENA 4QJFA 1ICWA 3W1BA 4NBQA 4CKBA 2A6HC 1MJCA 4WJ3M 1L1OC 4H02A 4YY3L 2A69D 4BA2I 2HQEA 3S14B 2AQ2B 4F88A 5JVH3 3BVZA 4HMJA 3K7UC 3TS0A 4R9WA 3SK4A 4A3KB 3S1NH 1T9HA 2ZM6Q 1KHIA 1S5ED 2A73B 3HOZH 1KTKA 2JJQA 5ELBA 4LF8Q 1X54A 4WFN3 2N88A 1LTRD 2MP1A 2PO4A 2UUAQ 1ASYA 2C5CA 2MFIA 4AIMA 3IFTA 3HOVH 4YWLA 1F77A 1CFMA 1YNNC 1QUQB 5GAHC 5JPMC 2VZAA 3OW7A 2R7ZB 2R6GA 4BY1G 1XPOA 1HXYD 4XT1B 2NWGA 3OSOA 4DK6C 2A6EC 2BDOA 2BDNA 3T13A 1FGUA 3CF5A 2WB1B 4KTAA 3E9IA 4DUYL 1L1OA 3OIPA 1SFOB 1STYA 1HNWL 2PW5A 4A3FB 1OXVA 3U9OA 2RBMA 3K5NA 1UE1A 1G2SA 2EYMA 3GTJH 2UU9L 1PZKD 2WACA 5KNBA 5EGTA 1IKLA 3VR3A 3CMAA 4U68A 3G6EA 4QIWB 4YWKA 1PH9A 4A3IG 1KL9A 1SNOA 2PQUA 2QKIC 2FHTA 3S17B 2EY6A 3I90A 3K80C 1DZ1A 1PHJA 4B3TL 2EJMA 3T1HL 2A68C 3PUYA 3RUZA 5BR8Q 3ERQA 1CQFA 1PYWD 1I4GA 5J1ZA 5FJ8H 4C56C 2V4DA 1A2UA 3MXGA 3KLSA 3VYSA 4GN4B 1UAPA 1E0BA 5FLMH 3J81i 1CHQD 1BBUA 1VQ4A 3PCOB 4DR4Q 4QIWE 4A3EH 4CGYB 4EVOA 2F4VL 3C1FA 1G6ZA 4P73A 5IYDH 1HNXL 5TSSA 3W5OA 1UE6A 1B53A 3FVQA 2AXYA 1SSOA 1CKOA 2X6GA 1NR4A 4BXXH 3GTLB 2K5WA 3HOXG 1SYGA 3OMCA 2ALYB 2M2LA 1B9NA 4JVHA 3UI2A 2ZJPA 4LUZA 5D3IB 1IW7D 5CV6A 4NDXA 1G2TA 2R92B 1SLJA 5FO8B 4DR6L 1IZ6A 4UP8A 3OWFA 4N9TA 1RD9D 4I65A 4CKEA 3NHHA 1SE3A 3PO3G 3UE0A 1M8AA 4A3DH 4J1MA 4C1NI 3PUZA 4L63B 4OX9Q 1TR5A 1V1QA 4IUNA 1W2BA 3DWAA 3CC7A 2FJ2A 1O7IA 3ICEA 1EU4A 5M3FB 1I3QB 1WVNA 3U9SA 3TN2A 2F0UA 1G91A 2B3GA 1KRTA 1QNUA 1B44D 2HDLA 2E2JB 3KJPA 3NP8A 5LL6X 1UE5A 1EYGA 4PG3A 1YJ9A 5I2YA 1X56A 1YHAA 1PH4A 3FDTA 3AFQA 3DEOA 4TKOB 4DNRB 1AW7A 3BS1A 2RDGA 1F9RA 3G4SA 3RNUA 3A5UA 5IGGA 5EPKA 3HOZB 1CSQA 3D8GA 3J81L 3H3VH 4B08A 3HZXA 3T1YL 4L6TB 1XYIA 1EC6A 4FO2A 4KMUC 4FP5D 5K5PA 1CA5A 1M90C 3PUWA 4J15A 2JEBI 2TSSA 1BVSA 3RZOB 1IBLL 1SE4A 2AUJD 4ID6A 1GVPA 2NB0A 4GS3A 3M7GA 4JI3L 1PFMA 5ELCA 4DA2A 4A93G 2EXDA 1GUGA 3K7AH 3A8KE 1EQQA 3U58A 1IXRA 3AQQA 2CPQA 4C3HH 4A3GG 3NWTA 2B8GA 1KHMA 4AH6A 2B2TA 4IPGA 4NKLA 4FF4A 2H1EA 1DONA 2E2HH 1JMCA 5CYUA 4DV1L 1R4QB 2IX3A 2Z0SA 4KY5A 4DR2L 3OIQA 1MGSA 3DUZA 2I0QA 3AYHB 4LMQD 1EQTA 3DWPA 1TWCB 1PTOH 3RZDH 1CSPA 1P8LA 5M5YH 1TWGH 3Q23A 1GUWA 2UXCQ 4K0KL 1QUQA 4IFDH 5CBAE 3J80c 3QO2A 3D4WA 5JEAG 1V1OA 4UAIA 1SMXA 2ASBA 1QNKA 4ZAIA 3J80E 4ZUJA 1U4PA 1U9RA 4JI3Q 5M5WB 1QILA 4JI2Q 3G6JB 4JK1C 1FYCA 4KD3A 1LTID 1QE6A 4G57A 1GO3E 1SEBD 2K7VA 1WCMB 4OO1I 3EVQA 3KLWA 1TY0A 2LSSA 1XPRA 3UDXA 1DOLA 3F8TA 1HHVA 1EY6A 1OXTA 4JV5Q 2R61A 3L7ZC 4IPCA 1A15A 2EYPA 3PO3H 2XWJB 2CQAA 5LMNQ 4A93H 4A3JG 1PLFA 1E2ZA 2PI2E 2EDGA 2F0VA 5CMDA 4OX9L 2F3IA 3NELA 1OXXK 2CTJA 1WJJA 4LF9Q 1CTMA 4JI1L 3SK6A 4HSVA 1J8IA 1VDZA 3KF8B 3CCRA 2VUMH 1X4NA 4NXNQ 1H9RA 2F0HA 3QOJA 5CR3A 3SHLA 2O2LD 4V190 3S16H 1H95A 1YIJA 4YCWA 4X64Q 3J7A5 2UXDQ 2UXBQ 1GXDC 1NE3A 1NAPA 2E76C 4C3HB 2CQOA 4QQBX 1O80A 1KD1C 4B9WA 2DNEA 5IP7H 3NTKA 1WOCA 2V1CC 2YU9H 4DNIA 4XXEA 3VA5A 2J7ZA 5M3MG 2BL5A 4YHHQ 5EKIA 4KI0A 4GOPA 1TXYA 4QB4A 1X55A 2Q8TA 4PMBA 2RA4A 3HOZG 1BNZA 1EIHA 5C3EB 5IT9E 2MGSA 5C4XH 1PH2A 1PH7A 2JA8H 3GTPH 5M9OA 2NVTB 2A8VA 1TWAH 3HOVG 2EIFA 2PZUA 2YQRA 2OTLA 4FF3A 3CHBD 3MFYA 5FOBB 4ME5A 1YBYA 1EQRA 4R4TA 4JI0L 2UUAL 2OWOA 1L2FA 5ELOA 3CCUA 1DYQA 2NVXH 3IFDA 1SE2A 1DTJA 1AN8A 2O5IC 3HOWB 1W3SA 3RMHA 1W6JA 5LMUQ 2RCNA 3FMCA 1VQGA 3I4LA 1UWVA 1QOHA 1LO5D 3CCSA 2VS1A 1X3GA 3ERSX 3GTMH 5EAYA 5AJ3L 3D4RA 1BUVT 1XNRL 2YYZA 3VYRA 4JBJA 2NZOA 4BS9A 1D5MC 4DV5Q 2L9HA 3F1ZA 1CT1D 1EQVA 5CV7A 2PQAA 4Y52H 5IODA 2LS01 1EEID 1Y8OB 5FLXc 2K4KA 3STBD 1HZBA 1VQ6A 5G3LF 2A69C 4BY1B 4IALA 2A5HA 2ZT9C 1S5BD 2A6HD 3GO5A 1EFID 1O78A 3QIAA 4OO1H 2CTFA 4BBRH 1JC7A 2NVQB 1XNRQ 3SE0A 2D62A 5J3BA 2AUKA 1DCZA 2K6AA 1K83B 1RIPA 4IJLA 4GLAC 1X65A 5KRUA 3KLRA 2QDBA 4K2LA 1A3VA 4K5VA 5C4XG 3K81C 3JAMc 3I72A 2N78A 5DLQE 2K1BA 2HCCA 1A62A 2NBFA 3MEHA 1K73C 4OWXB 1FNVA 5JEAJ 2NN6G 4DV4L 3SK5A 4OIKA 4POGA 2Z6KA 3OHXC 4RGOS 2E74C 1S5CD 4NXMQ 3TS2A 2BE5C 2RQXA 3HRZC 1E1TA 1YJWA 3NUCA 1BKBA 3K5LA 3KFUA 4DFAA 2B63H 3QG1A 3HKZG 2WKCA 1GUTA 2Q2IA 4B9XA 4ZLTF 2XWBB 3K6OA 4K14A 4RGTA 2C9OA 3M85A 4O42A 3MFGA 3NWSA 2DGYA 4UPAA 1K8MA 4DR1Q 3JAMi 3ITPA 1HTLD 3N6RA 3R8BA 1HZCA 1K8AC 4JI4L 3J7YW 1SFOH 1XPUA 2I07B 4V0BA 5CV5A 3HFZB 1UNSA 2BA1A 4LF4L 1GUNA 4DAPA 4KK7A 4BXXG 4JI2L 1BBWA 1LLRD 4K6LA 3A8JE 4X66L 1Q86C 1VS0A 3K8AA 1WD1A 1HFGA 1GD7A 4HIKA 2F0IA 1KLGD 2R7FA 1TS5A 5FO9B 2R92G 4PMCA 1N9WA 4OONA 3G71A 2B2WA 3NSWA 1A8VA 1WD0A 5JJIA 4LF6L 5J22A 3J80L 4JI4Q 1CQVA 2UUBQ 3M9BA 1EY5A 3CCLA 1JWSD 3H0GH 1PTOC 4DK3C 5J39A 4X62L 5CBEE 2PQAB 2CTKA 3HOWG 3T53B 2PYKA 4DR2Q 1JR0D 2GVBA 5GAEC 3S1NB 2MJHA 1N32L 1A63A 4C3JB 4LF5Q 3T1HQ 4XYOA 5FKAC 2PPBC 2EY5A 1VQCA 4GN5A 2ID0A 1PFBA 1PYSB 4HJ8A 5AJ3Q 3PMFA 4HN7A 1X3EA 2PY9A 3CKIB 5JPNC 2G9HD 4XT3B 1MBYA 2DN8A 1MIUA 3E9HA 2JA7H 4DV7L 1V1PA 1CKNB 4EQOA 5ELFA 2PZTA 3MTSA 4CJ0B 5IYCG 5ISRA 2E3UA 1FGBD 3BYTB 3GV6A 2EOTA 3C2PA 4G7ZC 3U1KA 4QGUA 1PXUA 3M3YB 1YVCA 3I7FA 3CW2C 2OXPA 3HOYB 3GDEA 4GLVB 4IOAA 1PH6A 1LTGD 4A3MB 1TKWB 1YEZA 3VR2A 3CCQA 3I55A 4RAUC 1HZAA 1ET9A 4RGNA 2IX1A 5CGKA 3FHWA 1EIFA 1C8CA 4JI6L 2RKSA 1VQMA 4HIMA 3OW2A 3I56A 4ZK9B 3J81E 1JOKA 3S15H 1M1KC 1FNWA 4PQXA 5M5XH 3ULJA 1Y8PB 4PV1C 1I6HH 1HPCA 4Q0FA 3CRLC 2WP8J 1A3UA 3I91A 1X3FA 4B3MQ 3MXUA 5JAVA 3RN2A 2IHFA 4B3SL 4AQYQ 4K8IA 3H91A 1HNWQ 1JJ2A 3R93A 3MAQA 3CCMA 1VQPA 3SDZA 1B9MA 1WI5A 1TS3A 1I6VC 4IUTA 3A8IE 3S1RB 1I4RA 1F2YA 2Y0SE 1AZQA 4DV6Q 2CCZA 4LNQA 1LV9A 4MN3A 4R8IA 5EBCA 4GZYC 3L2PA 4IFDI 3NXWA 5ELDA 1KXLA 4FF2A 4R4CA 2MO0A 4DR5Q 1WVLA 1AP0A 5IIFA 2LXJA 4AYBB 1EOTA 4MNOA 1CK1A 2JA7G 1Q1EA 2EE1A 1SMYD 2J0TD 4APVA 5IT9c 3S2HB 5M3MH 2IY5B 3P20A 3URYA 1B50A 1N8RC 4DN4M 4LF8L 4XDXA 3VYTA 1ENAA 2ANRA 4RWSC 4JOIC 3F2CA 1ZYRC 5IYDG 2BH8A 2CW0D 4JI1Q 1X4MA 1MSHA 4JOIA 1G6PA 1G8ZD 1DOMA 2A1AA 2N3SA 2KUMA 4R8NA 1F2ZA 5C4JB 1YZ6A 1HJPA 3D0FA 1ZTGA 5JJZA 5C6AA 3DWQA 3BDOA 4JYAQ 4A3BB 2AWOA 4BY7B 3PSIA 2NYZD 2XNAC 3VR4A 5KGUA 3A7AB 3MA2B 1OTCA 3U50C 2JA8G 4KD4A 4HMIA 1RF2D 3H3VC 4DR7L 2Y0SG 4P71A 1I50H 2WAQG 1NR2A 4LFAL 4LFAQ 1HZ9A 1R9TH 3EIVA 2KEDA 2FMCA 3ND9A 1ESRA 1PH1A 2PZWA 5LMNL 2RVLA 4PNYA 2PMZB 1G291 1AZPA 2EJGC 4KKTA 4RHRA 5BN4A 3P75A 4HCEA 1A2TA 4ZYSA 2MHVA 3R3OA 3NEMA 4L5QA 3S24A 5FLMG 4OWTB 2K5DA 4DF7A 1GM5A 5ELEA 4Y7NB 4A75A 3I70A 1PYBA 2L15A 5KEEA 1H9SA 4K0KQ 2DUDA 4NXML 2ZTEA 4N9PA 2ZJRA 1I3QH 4DUZQ 3GTKH 3OPOA 4X3SA 4DU9A 1S4ZA 2FXQA 3A74A 4A3BH 1PRTD 1F2MA 2K52A 2VNUD 2ZJQA 1KDAA 5DNFA 5T1IA 4KN7C 2WB1E 2IJ0A 2PQEA 4JBWA 4KHZA 2HH3A 2NZHA 5I9OA 5C3XA 3KOJA 3J7AF 3HOUB 3KF6B 3HOXB 1PH5A 3S16B 3HP3A 3C1EA 2ZXOA 1D1IA 1MSGA 2CWPA 2H5XA 4JBMA 2NUCA 1MJEA 1TT2A 3AU7A 3NPPA 4JI5L 5E3FA 4OO1G 3I4MB 1Y1VH 1ENCA 3PO3B 1JT8A 1SNCA 1KNEA 1A6XA 1RL2A 1QJOA 1XXGA 3ND8A 1NMFA 4MTNA 4F7XA 5A2QE 1VQDA 2WINB 3HKSA 2KEEA 1RKNA 5EKKA 4EQPA 1EOVA 1Q7YC 1JB7A 1WTXA 3OMGA 2D0OA 3VR6A 4DV5L 3GTOH 1H9MA 1C4QA 5A2QL 1VCIA 5F2DA 2KQ3A 3KJOA 2B2WC 1UE7A 1AFPA 2P2RA 1PMRA 4ZQ3A 1SAPA 3SR1A 2KHIA 2KCTA 3KDFB 3WOEA 3KBGA 1TWCH 1IBLQ 2NZ1D 1O7ZA 4OGQC 2CTLA 1PRTC 3D31A 1KDBA 1E22A 4BY1H 4DV7Q 4FDBA 3RD4A 4UP9A 4X62Q 4L5SA 2A19A 4CJ2C 2JA5B 2HHHL 4GKJQ 2M00A 2B2VC 4WANA 3HG9A 2XN9C 4O1NA 3EQLC 3E5SA 3GTJB 1D2BA 3HEJA 4GOPC 3Q8DA 4LF5L 5EPJA 4RFBA 5I4DA 3S9WA 2JA5H 4C2MB 2EYFA 2XGTA 4HJ9A 1PFNA 3PUXA 3I4OA 1L0XB 2JA6B 3GTOB 5D65A 3QB3A 4GKKQ 5KYLA 2QNDA 3PIO3 2JEAI 4DUZL 4TRDA 3TDQA 1S3OA 3F2UA 4TQUS 3NTIA 4NXNL 4DAVA 4H7BA 5IP9H 3RLNA 1D5XC 1C48A 1YNJD 4ZUIA 1CZGA 4L8JA 1I4XA 4JBKA 1VF5C 3CP0A 5EBDA 3WWVA 4OXPA 1XNQL 1YNXA 1SBBB 1LT4D 2EYOA 1RJTA 1I94Q 3X3MA 1P16A 2WV6D 1QVGA 2IPKD 3D6CA 1ILPA 3CCJA 2WFWA 2XSCA 2F4VQ 4H13C 2HHHQ 4LFCQ 3KLSX 3BVMA 4DR4L 3T16A 2NVTH 4GOPB 1C7YA 2X6LA 3M3YH 1VQNA 4H0LC 1IW7C 3VA7A 4JVYA 1SJED 1SYEA 2CWAA 3J7AV 1VQAA 2JP1A 1MI2A 1N34L 5KIXA 1ZZKA 2Q8RE 3S1QB 2E8GA 4DGZA 4DV3Q 1BXTA 5DM63 1H9KA 2K03A 2VXWA 3T56B 1EY8A 3FPUB 2HUGA 1IYJB 4OWWB 3M4YA 2Z8LA 3A54A 3DMUA 4DR6Q 1KDCA 2OEOA 2AHOB 4CJ1B 4KJOA 4XQQA 4HIDA 2CKZB 5LHY1 2K32A 2YTXA 4FYDA 4A3JB 5BR8L 4LF7Q 5C44B 1FL0A 1SYBA 2L11A 2FMMA 3NBHA 3NQTA 4CBVA 4Y7NH 5IP9G 3CC2A 1KLUD 1O7LA 1PZID 3PUVA 2K50A 1FJGL 1K8GA 2HT1A 1FJGQ 1B2TA 1IL8A 1LTBD 4HJ7A 5GQOA 4NPSA 1NUCA 1GJXA 2F0JA 2F0KA 2VL6A 4M1UB