5C0XG

Structure of a 12-subunit nuclear exosome complex bound to structured rna
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
237
structure length
237
Chain Sequence
MSTFIFPGDSFPVDPTTPVKLGPGIYCDPNTQEIRPVNTGVLHVSAKGKSGVQTAYIDYSSKRYIPSVNDFVIGVIIGTFSDSYKVSLQNFSSSVSLSYMAFPNASKKNRPTLQVGDLVYARVCTAEKELEAEIECFDSTTGRDAGFGILEDGMIIDVNLNFARQLLFNNDFPLLKVLAAHTKFEVAIGLNGKIWVKCEELSNTLACYRTIMECCQKNDTAAFKDIAKRQFKEILTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exosome complex component RRP45
publication title RNA degradation paths in a 12-subunit nuclear exosome complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae s288c
molecule tags Hydrolase/rna
total genus 43
structure length 237
sequence length 237
ec nomenclature
pdb deposition date 2015-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF15985 KH_6 KH domain
G PF18311 Rrp40_N Exosome complex exonuclease Rrp40 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5c0xG01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5c0xG02
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 5c0xG03
1HQMC 5FLMG 4B3TQ 4JI8L 1Q1EA 2HIVA 1S72A 4GKKL 4C3JH 3UDGA 4JV5L 3QIAA 4A3FH 4DUZL 3T1YQ 3ULLA 2C35B 3UE1A 3I4MG 2FMRA 1VQGA 1X3GA 4DV3L 2ZJQA 3I4NH 1B8AA 1HR0Q 2YQRA 3W3AA 2CW0C 1Y1VG 2E5LL 1DGSA 1VF5C 1EUJA 3OOCA 2O5IC 5C0XJ 5GQOA 4A3FG 4JI7Q 4WJ3M 5IWAQ 1TU2B 1DT4A 5GAGC 1PYSB 3KJPA 1NMFA 2NN6I 4POGA 3HOZH 2KBNA 1TWCH 3RZOH 3E0EA 3BG3A 1B70B 1UE1A 5LMUL 4OX9L 1UEBA 1GHKA 2VQFL 4LF8L 1M1KC 1ZZJA 3KF6B 2K4KA 2RHQB 3RN2A 1VQEA 1VF7A 1VQMA 4UP9A 1X65A 3HOZG 2KCCA 1YBYA 4JI5L 4OWWB 1CKMA 1SRUA 4HR7B 1VQDA 1X9NA 2AMCB 4C2MH 4G7ZC 1EWIA 2B8FA 1JT8A 1Y1WH 2I5MX 3BDOA 3G71A 4JI0Q 3STBC 3KLRA 1I6VC 3CW2C 1QUQB 2ZT9C 1UE5A 3J81c 1OXTA 1CKNA 1K8AC 1IW7D 1VQ8A 2A19A 1YJ9A 4QIWE 2IX1A 4DR7Q 4P75A 1Q1BA 4HJ8A 4JBMA 4GNXC 5AJ3L 1PH7A 2ZM6L 2F4VL 1JB7A 1Y1WG 3H3VH 2UU9Q 4DK0A 1GJXA 3TRZA 4DR6Q 1E3PA 4DV7L 3TQYA 2CTLA 1VDZA 4LIJA 3CXCA 5M5WH 3AFQA 4DUYL 1YHQA 3AQQA 1Q86C 3KF6A 4DNTB 3HFZB 1GKHA 4GZYC 1DCZA 2JA7H 3A8KE 2CTJA 3CPFA 3PO2H 2MJHA 1GVPA 2VW9A 3PGZA 4ALPA 3I72A 1V9PA 1GO3E 2R6GA 1YNJC 2CFMA 2PMZE 1BBUA 2IX0A 2AKWB 1O7IA 2B63H 1QUQA 4HJ9A 1WCMH 3GTGH 3PO2G 3SDZA 2CPQA 2V1CC 2F52A 4PZ7A 4IPCA 2K5VA 2JA8G 1N36L 2CQOA 2EJGC 5GROA 4TVAB 1Q12A 1HJPA 4R4OA 4RMFA 2KENA 3M4OH 3PUZA 1Y14B 1KRTA 3VDYA 3JAMc 2B63G 1RIPA 1WCMG 5A35A 1ZZIA 1W3SA 4KMUC 1XMQL 2E2JH 5C0XH 4MZ9A 3KLWA 1GUTA 5C3EH 4GS3A 1IBMQ 3LNNA 2H5XA 4KI0A 1XPOA 1H9KA 1IBLQ 2DGRA 5ELNA 1DXMA 1HH2P 5C0XG 5IYBH 1OXXK 3D31A 4H13C 1J6QA 4BXXH 5FJ8H 3S1QH 1EQRA 2F1MA 1IBKQ 2A6EC 3A7AB 1VIHA 3M3YH 2A69D 5JEAH 3J80c 4GOPB 1E1TA 4GLAC 3CRLC 4JI4L 1E2ZA 5IYBG 3PF5A 1NMGA 2UUAQ 2CTFA 4BXXG 4KKTA 4KHPL 1SMYC 2OPUA 1ZYRC 4WANA 3WDNA 3M9BA 4LFCQ 1NY4A 3CD6A 2UXCL 1K0RA 4LF4L 3J81j 2EJFC 3CC2A 4YWKA 2PCFB 4JI2L 4A4IA 3VR4A 3H3VI 2MNAA 1J5EL 4NXML 1YNNC 2QF7A 5KNCA 3GTMH 1DTJA 1IZ6A 1TWGH 4B3SL 2L5TA 3OW7A 4HJ7A 1N33L 3E9IA 2Y0SG 2PI2E 4R4TA 5BR8Q 3OPOA 2PPBC 4LF7Q 1VQ5A 4XIGS 4DR2L 4NXNQ 2BA0A 4Y7NH 4LJZC 4A93G 1L2FA 4QJFA 4AQYL 2MO1A 2KCTA 1TWAH 1Y8NB 2Q2HA 3PIPA 3CCEA 3PIOA 2QNDA 4GOPA 4LFAL 2NVTH 3NEMA 4GLVB 2BL5A 4KKSA 1L1OA 2Q2TA 1YVCA 2I5LX 4EX5A 1I94L 2CKZB 1ASZA 2VZAA 3MEFA 4R1JA 2GVAA 3G4SA 3CCJA 4QMFB 1SMXA 3J7A5 2EIFA 3ERSX 3U50C 5M5YH 3TREA 2JEAI 1JJGA 4YCUA 1JMCA 2UUBL 1A62A 2UXBL 3W1GA 1S40A 1Q8KA 4QY7A 2E75C 5C4XH 2JXMB 1AE3A 4QL5A 3HOWG 2BE5D 3VR5A 3CCUA 2AXYA 3K81C 2NZOA 1UE7A 4GN3B 4JI1L 2DGYA 3F2CA 4A3IH 1OXUA 4JG2A 4A3MG 3DXJC 1XPUA 3W5OA 2R92H 3RLOA 2K5NA 1H9SA 4LFBQ 2R93H 1BBWA 4OWTB 1EWHA 3LGJA 3H94A 4LWCA 2OQ0A 4IFDH 4JOIA 5C0XI 1EIFA 2D5DA 4B3RQ 4LF5Q 4PG3A 3CCLA 4DV6L 4DPGA 4X62L 4A3IG 3CAMA 3K8AA 2Z6KA 4B8TA 1X54A 3K7UC 4DNIA 2AUJD 2EQSA 2R92G 3GO5A 4L8JA 3KYHC 1PA6A 2JA5G 2R93G 4YCVA 1NBWA 3S24A 2PNHA 1A8VA 4IFDG 1Z9FA 4GKKQ 4A75A 1C0AA 3J7ZC 3TS2A 3I55A 3N6RA 1WFQA 4DV1L 2ASBA 4DV4L 1EYGA 3I56A 3BZKA 2E2IH 2R7ZH 1O7LA 2HT1A 2E5LQ 3S15H 2RF4A 5JJIA 1FYCA 2ALYB 1K3RA 3F8TA 2CTKA 2PQUA 4C3IH 1U5KA 2K33A 5ELOA 1Q81C 1JJ2A 2R7DA 4XTCS 2Z0SA 2YU9H 1CKNB 4POFA 4IJHA 1E2VA 2D2CC 1SROA 1IYUA 3E9HA 1XNQL 3STBD 2R7ZG 1ZZKA 1ONLA 2ES2A 3T1YL 2V4DA 2EDGA 3AB9A 1CTMA 1KRSA 3I4NG 3BU2A 4DV5Q 3P20A 4A3EH 1HR0L 4LK1C 3GTJH 4OX9Q 3CCMA 2VQFQ 4A3GH 3S1RH 2P2RA 1X4NA 1V8QA 4UP8A 1KQSA 1IYVA 1N9WA 4KN4C 3JC66 3ER0A 4JI7L 3SGIA 3M7NA 3FKIH 1VQNA 4UPAA 3ND8A 4UP7A 1NJIC 1XMOQ 4YWMA 4UY8C 4OWXB 1LABA 1H95A 1GUOA 5JEAJ 2Q2UA 1XNRL 4A3GG 2EVBA 4X66Q 4WJ4A 5IP9H 5IY0A 1YI2A 4A3CH 1IYJB 4X6AH 3H0GH 1C7YA 2ZJRA 4AH6A 4JVYA 1X6OA 3I7FA 4HIOA 5AJ3Q 2IHFA 3VKEA 4K0KL 3PUWA 3PCOB 3CC4A 4C3HH 1KIXA 2IT1A 5IP9G 1KD1C 1K1GA 4BBSH 3FMCA 4A3CG 3PUVA 3H0GG 1PH6A 3ND9A 1VQ6A 4DV7Q 1HNZQ 3BZCA 5JJLA 3AEVA 2JEBI 4YY3L 4DUYQ 3TZUA 5LMNL 1I50H 1YZ6A 5IT9c 4DV0L 2UXDL 1Y8OB 4R4CA 4HIMA 2D0OA 3S2HH 3KOJA 5GADC 3EQLC 4GOPC 4OO1H 4IFDI 4DR7L 5EAYA 1PHJA 1OXSC 3CCRA 4DR5L 4KKUA 1WJJA 1HNXL 2BH8A 1VQ7A 2YV5A 1VQHA 4JK1C 2UU9L 1E2WA 4DR6L 4X65L 3MXUA 2VUMH 1EC6A 2YTVA 1CFMA 4LUVA 1YHAA 4X64L 1VS0A 5HY6A 1PVOA 1CSPA 1LTLA 2MO0A 2HQLA 4AIMA 4A76A 4RCNA 1K8GA 2JA7G 1VQPA 4OONA 5M3FH 2EJMA 3M4PA 2Y0SE 3GTPH 2NZHA 1WI5A 1IW7C 3D4RA 4BY1H 3UDIA 4HIDA 4DKAC 1NE3A 3U4VA 2PNRC 3IKJA 4JI3L 4IOCA 1O78A 2XTIA 1N34L 3U1KA 1XMQQ 2VQEQ 4JYAL 3I2ZA 5IE8A 3CF5A 3EIVA 2ZTEA 1YITA 5C44H 5M3FG 1KXLA 1MJCA 1PMRA 2Z6KC 4IFDJ 1K8MA 4BY1G 1QVGA 1VQIA 3S16H 3S1MH 2K7VA 2BDOA 2MQHA 2KHIA 1Q7YC 2VL6A 1FR3A 4DV2Q 3SE0A 3J81i 1HTPA 2UUCL 4DR3Q 5C44G 3GTOH 1V1QA 3ULJA 3RLNA 4IPGA 3B6YA 4LUZA 2A8VA 4DAYB 3GTLH 1KHIA 5C3EG 1PV4A 5FLXc 2LXKA 1IBML 1A6XA 2XGTA 4BA2I 4JI4Q 3L0OA 1LM0A 1D7QA 3NELA 4H44C 2A68C 1IBLL 1L1OB 4KHPQ 1KHMA 1YHBA 4BA1I 3AFPA 1VIGA 1VQJA 3CPWA 4PMWA 2N49A 4JBKA 1H9JA 2UXCQ 4DR1L 1Q90A 5FJ8G 1T5EA 1IBKL 4R4IA 3RNUA 5JEAG 3L7ZC 3GQBA 2B3GA 1J5EQ 1PH2A 4NXMQ 1FJGL 4AM3A 3QG1A 4B3SQ 2ATWA 1N33Q 3KJOA 1LUZA 2JA6H 3A8JE 3S2DH 1H9SB 5GAHC 1PH5A 4LFCL 4AQYQ 2K52A 4GN4B 1J4WA 1U0LA 4OO1I 3K0XA 1BKBA 1GUGA 3T56B 3OTOQ 1P16A 1JJCB 3IRBA 3G48A 4LFAQ 4YHHL 2LSSA 2K32A 3A0JA 4GLXA 4GNXA 1UWVA 1I94Q 2R7FA 2A6HD 2JA6G 1XPRA 4BBRH 3RLFA 2N3SA 1CUKA 4A3BH 3RN5A 4GN5A 4LF9L 1I3QH 2OPVA 1B9NA 4B3MQ 1VQCA 1N32Q 2UUBQ 4L5QA 2UXBQ 2WB1E 3MFYA 2A1AA 1Z6HA 2JJQA 1EQQA 4AYBE 4DR4Q 1HNWL 2JVZA 4HIKA 1K73C 3KDFB 3VA7A 4BBRG 4JI1Q 4LF6Q 1J5KA 1FVIA 3I4LA 2HIXA 4YCWA 3S1NH 4A3KH 1VQ9A 1MKHA 3VR3A 3OW2A 3S14H 3T1HQ 4PZ8A 2NVQH 4P74A 1GM5A 1Y8PB 1TWHH 4DV6Q 1G291 4X62Q 1HPCA 4JI6L 2O5JC 3NE5B 1QVFA 5C4XG 1XTDA 3RR5A 4A3KG 3EBEA 2CWPA 2HHHQ 4L5SA 2CTEA 1SN8A 2D62A 3PV0A 4JI8Q 3NENA 4MNOA 4GKJL 4JV5Q 4DUZQ 1YJWA 2OWOA 4LF5L 2K14A 5K36H 1HZBA 3CCQA 1QZGA 3M4YA 5HGQA 3I4MH 2E76C 4DV3Q 3VR6A 2MFIA 2ZJPA 3HOYH 3IFTA 3KDFA 2Q8IB 1X4MA 4KN7C 3F2DA 1TWFH 2CTMA 3ULPA 4IO9A 3UDXA 4OGQC 1XNQQ 1LYLA 3LWUA 2BE5C 1X3EA 5K36G 2CCZA 4B3TL 3MXNB 1OXVA 1IXRA 1BDOA 3CC7A 3WWVA 1CKOA 1WE8A 2PI2A 3HOYG 2N8NA 1SLJA 3A7LA 3GTKH 3L2PA 3CQZH 4OXPA 5LMUQ 2WAQG 3VR2A 3AEVB 1Q82C 2E3UA 4LNQA 4LF8Q 4P73A 4L5TA 3A8IE 1Q46A 4PV1C 2WB1G 2BA1A 4AYBG 3V69A 3FP9A 3HOXH 2B8GA 5IWAL 2E2HH 1XNRQ 4NBQA 1H9RA 1FL0A 4JI5Q 2JA9A 4TQUS 5DLQE 3RZDH 4A3EG 3K80C 1IL2A 3UE0A 4DV5L 3T51B 2EXDA 1LACA 1VQOA 1KL9A 1R9TH 2NVYH 3U4ZA 4QGUA 2IHEA 4I7ZC 3HOXG 2K75A 2K5HA 2DN8A 1NTGA 1HZ9A 4K0KQ 3FKIG 2DNEA 1I6HH 1EOVA 3PSIA 3PUYA 5KNDA 1PH1A 1XMOL 2ZM6Q 4YWLA 2F4VQ 2JQOA 4X66L 3GDEA 4WALA 5BN4A 1P8LA 1QVCA 4YY3Q 1CSQA 1Y69U 4H02A 5LMNQ 2I0QA 4Y52H 3Q8DA 1ZKOA 4DV0Q 1YNXA 2UXDQ 4HJ5A 1SR3A 3KF8B 3HKSA 1MIUA 4JI0L 5H1SE 4IQZA 3I73A 3QJYA 1Z7TA 4DR5Q 1HNXQ 1E24A 1TXYA 4A3LH 4BBSG 4LW1A 1ASYA 2DNCA 1L1OC 1WOCA 1KAWA 4X65Q 4G7HC 1HR0W 5JJKA 2JK8A 4X64Q 4RG1A 1HNZL 1G51A 1EFWA 2D0PA 2KHJA 2PQAB 4O2DA 1RL2A 1TKWB 1CI3M 3CMEA 4A3LG 2OCEA 4OO1G 1HZAA 4LUOA 2GN5A 5IYCH 1L0WA 1W2BA 4JC0A 1V43A 1B9MA 2YTYA 1XJVA 1X55A 2NVXH 3PO3H 2K50A 4JI3Q 4DK3C 1GD7A 1N36Q 1TUAA 2JA8H 1N34Q 3KFUA 1WYDA 4JYAQ 2VUMG 1E7ZA 4KLKA 2VY3A 4BY7H 5M5XH 2A6ED 1HCZA 4JOIC 1B7YB 3M85A 4MTNA 5E7NA 5IYCG 1VCIA 1ZTGA 1YEZA 2HH3A 2A68D 2IY5B 3NBHB 3CCVA 3PO3G 1PH4A 2HH2A 2E74C 3F2BA 3A5ZB 3FHWA 4PZ6A 2UUCQ 4BY7G 4H0LC 4IOAA 2GVBA 1EIYB 2KA7A 3UDFA 2ANRA 4IPDA 2VQEL 3TEHB 1HZCA 2PQAA 5LMNW 1X56A 2JZXA 3PF4A 4QQBX 3HKZE 3CRKC 1VQ4A 3U58A 3AYHB 2LMCB 1BVSA 2B29A 2I5HA 3CCSA 2KCMA 2ID0A 3M4QA 3OYYA 2BH2A 2JE6I 2OQKA 5IYDH 1Z47A 4JBWA 4GNXB 5J3BA 3HOUH 3A5UA 2Q2IA 4DV2L 1AE2A 4DNRB 4DR3L 1G6PA 2RHSB 4R4QA 2RCNA 3U9SA 4DR1Q 1QZHA 4DAMA 4FDBA 1UE6A 1K8OA 2E8GA 2ZTCA 4A3JH 3K7AH 4TKOB 5BN5A 5IYDG 4LF4Q 1FJGQ 4J15A 3HOUG 2N78A 4IPHA 2CWAA 1C9OA 3H15A 3PUXA 4JI2Q 4NB3A 3A74A 2L15A 5M3MH 2DUDA 1YJNA 3DM3A 3ICEA 2PY9A 5GAEC 1AH9A 1PH3A 1K83H 5KNBA 4A3JG 3ZJYC 1M90C 4EQ5A 2ZTDA 4DK1A 1GHJA 2UUAL 1DD2A 4DR2Q 1GUNA 4P71A 1S3OA 1D8LA 4YHHQ 4A93H 5M3MG 3TS0A 4KHZA 2AUKA 2NN6H 1H9MA 3W1BA 2QEXA 2VNUD 1PYBA 3JAMi 4LF9Q 1PH9A 5IP7H 3CMAA 3G6EA 4A3DH 2LXJA 1N8RC 5C4JH 1I5FA 2A69C 4JBJA 4L5RC 4NPSA 5BN3A 2WAQE 1HNWQ 2NN6G 5BR8L 2FXQA 1E1OA 1VQKA 4LF7L 2YTXA 2WP8J 3OTOL 4NXNL 1E22A 1T9HA 2YYZA 3I4OA 2AWOA 1A63A 5IP7G 3HOWH 4A3DG 4JVHA 2AWNA 4A3BG 3GTQH 1WVNA 1X3FA 2QA4A 1SE8A 3HKZG 4A3MH 4B3ML 4ME3A 3BJUA 2AHOB 4APVA 1N32L 4JI6Q 3HOVH 3F1ZA 1QJOA 1OTCA 3HGBA 3J80i 2VS1A 4DR4L 3FPPA 2OTJA 1PFSA 3DLLA 1KC8C 4LF6L 1GUSA 3CP0A 1YIJA 1SFOH 3EN2A 1JE5A 2WFWA 4HJAA 1VQBA 4DK6C 4G7OC 3GD7A 2JA5H 3T1HL 4JCVE 3T53B 4O0AA 4GKJQ 3HOVG 4IJLA 3D0FA 5FLMH 4DV1Q 2A6HC 1A0IA 4DV4Q 4P72A 4LFBL 2OTLA 1VQAA 4B3RL 1FGUA 1VQFA 1K9MC 2HHHL 2ANNA 1PH8A 2QGQA 1MJEA 3S17H 1VQLA 2F3IA 1Y1VH
chains in the Genus database with same CATH superfamily
1HQMC 3P7JA 5FLMG 5LL6S 4G57A 2HUGA 2F0QA 4B3TQ 1PDQA 4JI8L 4A3GB 1Q1EA 5EBCA 2HIVA 3RZOB 1S72A 4GKKL 1GUWA 4C3JH 5C4HA 3UDGA 4JV5L 4JI6H 3QIAA 3NXWA 4A3FH 1ENAA 4DUZL 1KTKA 1PRTF 3T1YQ 3ULLA 3K5MA 2C35B 3UE1A 3I4MG 5FK9C 3VA5A 1A2TA 2FMRA 4L63B 1VQGA 4RWSC 3R3OA 1X3GA 1RD9D 4DV3L 2ZJQA 3I4NH 1B8AA 1HR0Q 4P2CB 2YQRA 3EFXD 3W3AA 2EXZA 1LTID 2CW0C 1Y1VG 2G5DA 3TP7A 4X3TA 5AFWA 1SAPA 2E5LL 2Z8LA 3MWYW 1DGSA 1TR5A 1VF5C 1DOLA 2F0OA 1EEID 1EUJA 4C3JG 1U4PA 3L3OC 3PQIA 3OOCA 2O5IC 5C0XJ 5GQOA 5C5LA 4A3FG 1IKMA 1CZWA 4JI7Q 3K57A 4GKJH 4WJ3M 5IWAQ 3I0PA 2ICIA 1CT1D 1TU2B 3H0GB 1ZXTA 4CDFC 1VMCA 4DV1H 4DV4H 4J8QA 4PQXA 1DT4A 5GAGC 1PYSB 4V0BA 3KJPA 1NMFA 2NN6I 2RDHA 4POGA 3HOZH 2KBNA 1SEBD 1TWCH 3E0EA 3RZOH 2PW7A 2IX3A 1UE1A 1B70B 3BG3A 4C3HB 5LMUL 1JWSD 3I8ZA 4FF2A 4OX9L 1UEBA 1GHKA 3AU7A 2VQFL 4LF8L 1S20A 1M1KC 2XSCA 2CPMA 1ZZJA 3KF6B 2K4KA 1SYEA 2HDMA 2RHQB 5I9OA 3RN2A 4B3TH 1VQEA 1VF7A 4RGMA 1VQMA 2HCCA 4RAUC 2QDBA 4UP9A 1X65A 1QNUA 4HMJA 4KD3A 3SK4A 1RCVD 3HOZG 2KCCA 5IT9L 1YBYA 4JI5L 4OWWB 3T1YH 2HQEA 2K03A 1CKMA 5JPMC 3S2HB 1CQVA 1SRUA 4MIUA 4HR7B 1VQDA 1BCPF 1X9NA 1A3TA 4HSPA 1SE3A 2AMCB 4K14A 4C2MH 1HR0H 4G7ZC 5JOBA 1OO9B 1EWIA 1ZEQX 5K5PA 2B8FA 4OEMB 1Y1WH 2I5MX 4CBVA 1JT8A 1NCVA 3BDOA 1ODHA 3G71A 1R4PB 2LTLA 4JI0Q 3STBC 2JA7B 3KLRA 1TY0A 2OXPA 1PQXA 2F0MA 1I6VC 3CW2C 1QUQB 1S5CD 1UE5A 2ZT9C 3J81c 1OXTA 1CKNA 1K8AC 1D1IA 1IW7D 1VQ8A 4JI7H 2A19A 4IZ8A 5IWAH 1DONA 1YJ9A 2I07B 4QIWE 2IX1A 4DR7Q 4P75A 1Q1BA 4HJ8A 4JBMA 4GNXC 5AJ3L 1PH7A 3QWNA 4HCSA 2ZM6L 2F4VL 2KEEA 1JB7A 3WOFA 1Y1WG 3IFDA 3H3VH 3L9AX 1MBYA 4DXGA 1EQTA 2TMPA 1JOQA 1QB5D 2UU9Q 1DZ1A 4DK0A 3R93A 5M3FB 1GJXA 3TRZA 4DR6Q 1E3PA 4DV7L 3V05A 2WACA 3TQYA 2CTLA 1PTOC 1VDZA 4LIJA 2L0CA 4BY1B 3CXCA 5IGBA 5M5WH 3AFQA 4DUYL 2DY7A 1YHQA 5FLXE 3AQQA 4XT3B 1Q86C 3KF6A 4DNTB 3SB1A 3HFZB 1GKHA 4GZYC 1NUCA 4KK7A 1DCZA 2JA7H 4EC5A 1STHA 3A8KE 3M4OB 2CTJA 5C44B 1CHQD 1V1OA 4XDXA 5ELFA 5FOBB 4ZUIA 2TSSA 3CPFA 3J81W 2KECA 3PO2H 2MJHA 1LT5D 1GVPA 2VW9A 2ZQEA 4Z9CB 3PGZA 4ALPA 3DEOA 1DOKA 3I72A 1V9PA 2E2DC 1GO3E 1F9QA 2R6GA 1EY5A 1YNJC 1EWCA 2CFMA 3TP5A 4XXEA 2F0LA 4YY3H 5C3EB 1V1PB 1BBUA 2PMZE 4PMBA 4JI0H 1PRTC 2IX0A 5LMNH 2AKWB 1O7IA 4LAAA 4C56C 4G08A 4F88A 2IPKD 2B63H 4E6IA 3NUCA 4V190 1QUQA 4HJ9A 1WCMH 3GTGH 3GTOB 4HMIA 1A15A 5IGDA 3I70A 3PO2G 4EQPA 4DR7H 3OHXC 3SDZA 2CPQA 2V1CC 1JC7A 2F52A 4DGZA 1QE6A 4IPCA 4PZ7A 2K5VA 4QF4A 2JA8G 1XX8A 1C4QA 1N36L 1BR9A 2CQOA 2EJGC 4K5XA 1KNEA 5GROA 2K05A 1VMPA 1EEFD 5CYUA 2B2YA 4N9TA 2XWJB 4TVAB 2UU9H 1T5XD 2J0TD 1Q12A 1RKNA 1HJPA 3MHBA 4R4OA 1ESRA 4RMFA 2KENA 4N8X1 3M4OH 3PUZA 5FLXL 1Y14B 4DR6H 1KRTA 3VDYA 3JAMc 2B63G 3M7GA 4I7AA 1AW7A 1RIPA 2MUYA 1WCMG 5A35A 3M3YB 4X64H 1ZZIA 1W3SA 3J80L 4KMUC 1XMQL 2E2JH 3J7YW 4X3UA 2L9HA 4ZRZA 1HHVA 4Q0FA 5C0XH 4MZ9A 3KLWA 1X3QA 2SNMA 4K8JA 1GUTA 5C3EH 4EVOA 3BS1A 2HDLA 2JYOA 4PNYA 1F77A 3SK8A 1I4QA 3NWSA 4GS3A 1IBMQ 3LNNA 1KLGD 3EROA 5L37A 5C6AA 1X0AA 3HP3A 2H5XA 3I91A 1EU4A 4KI0A 3C46A 1XPOA 1H9KA 1IBLQ 3X3MA 2DGRA 3TBIB 5ELNA 2B2WC 2Y0SB 3E6ZX 5I2YA 2CH4A 1N34H 1U4MA 1DXMA 1HH2P 3IL8A 5DAUA 5C0XG 4ZKBB 3FAUA 1IKLA 5IYBH 1B3QA 1NNXA 1OXXK 3MA2B 3NCVA 4XYQA 1EQVA 1V1PA 3D31A 1ML0D 4PMCA 4H13C 4J6HA 1J6QA 3BVMA 5DM73 4BXXH 5FJ8H 2K1HA 2IJ0A 3S1QH 1EQRA 2PT7G 2F1MA 2J4XA 5ELCA 1IBKQ 3MXGA 2A6EC 3A7AB 1U4LA 2G9DA 1VIHA 3S9WA 4O1NA 3M3YH 3S2DB 2A69D 3GABA 5JEAH 5A2QW 4RHSA 3J80c 4GOPB 4OELB 1SYDA 1XWEA 1E1TA 1KDAA 4KD4A 2EY2A 4GLAC 1KDBA 5CORA 3CRLC 1KAAA 4JI4L 1E2ZA 5IYBG 5IGCA 3PF5A 4J1MA 1NMGA 4NMZA 2UUAQ 1HUMA 4RGOS 2CTFA 1STGA 4BXXG 4KKTA 4KHPL 3Q0AA 2KVMA 1SMYC 2OPUA 5I2XA 1ZYRC 4WANA 3WDNA 3M9BA 1PZJD 4LFCQ 1NY4A 4NZRM 3CD6A 2UXCL 1K0RA 1BF4A 5CV6A 2NVTB 5EPKA 4LF4L 1I3QB 3J81j 2EJFC 3CC2A 4YWKA 1WTJA 5KYLA 2PCFB 4JI2L 4A4IA 3VR4A 1IBMH 1EYDA 4K5VA 3H3VI 1WHRA 2MNAA 1XRHA 1J5EL 4NXML 1YNNC 2JN4A 2QF7A 5KNCA 3GTMH 1DTJA 1IZ6A 4IN3A 1IBLH 1B2TA 3K0YA 1TWGH 1MSHA 3GR5A 1SDFA 1EFID 3EA6A 4B3SL 2L5TA 2P5ZX 3OW7A 4ABNA 4HJ7A 1N33L 3E9IA 2Y0SG 2PI2E 4R4TA 5BR8Q 3OPOA 2PPBC 1RJTA 4LF7Q 5C4XB 1LV9A 1ET9A 4XIGS 2WIIB 1VQ5A 1NR4A 1MSZA 4DR2L 4NXNQ 2BA0A 1FNUA 2F0TA 3S14B 4Y7NH 4LJZC 4A93G 1L2FA 1BUVT 4QJFA 5J39A 1IBKH 2SEBD 3Q22A 2F0IA 2XN9C 4AQYL 1SYCA 2MO1A 2X6GA 2KCTA 5KEEA 1TWAH 4RA8A 1Y8NB 2Q2HA 4QUCA 1TWHB 3PIPA 4XQQA 3CCEA 3PIOA 3HRZC 2QNDA 4GOPA 3FVQA 4LFAL 2NVTH 2QEJC 3NEMA 5C3WA 2NTTA 4GLVB 2BCOA 2NWGA 3H09A 4KKSA 2BL5A 1L1OA 2Q2TA 1YVCA 2I5LX 4EX5A 1I94L 2CKZB 4BWGB 1ASZA 1NAPA 3H91A 2UUAH 1STAA 2VZAA 3MEFA 4ZLTF 4R1JA 5CV7A 1PLFA 4ULLA 2GVAA 3G4SA 3CCJA 2WV6D 3TSSA 4QMFB 3Q24A 1SMXA 3J7A5 2EIFA 3ERSX 2WKDA 4K2KA 2PYKA 3U50C 3TREA 5M5YH 1L0YB 4LFCH 2JEAI 2EYOA 1JJGA 4YCUA 1TVXA 1JMCA 2UUBL 2EY6A 3E5SA 4EQNA 1A62A 5KIXA 3W1GA 2UXBL 1S40A 1Q8KA 4QY7A 1F2MA 3DMUA 2H4OA 1LTAD 1ENCA 2E75C 5C4XH 1AE3A 2JXMB 4QL5A 1AZPA 3HOWG 5CBEE 2BE5D 3VR5A 2SNSA 3CCUA 2AXYA 1KDCA 3K81C 2NZOA 1UE7A 4GN3B 2I46A 4JI1L 2DGYA 1SNQA 3F2CA 4A3IH 3H3VC 5IGEA 1EZ6A 1OXUA 2QW7A 4JG2A 2F0EA 4A3MG 2F0SA 2BDNA 3DXJC 1MD2D 1XPUA 2NUCA 1SYBA 2E2IB 3W5OA 4LF9H 2CW0D 2R92H 3A56A 3O13A 2IL8A 3RLOA 3HOYB 2K5NA 1H9SA 4LFBQ 2R93H 1BBWA 4OWTB 5BR8H 1EWHA 4LF7H 3LGJA 3H94A 4LWCA 2OQ0A 1KLUD 3QOLA 4JOIA 4IFDH 1A2UA 3TMEA 5C0XI 4KTAA 4H7BA 1EIFA 1TWFB 2D5DA 4B3RQ 4LF5Q 4NXNH 2NBFA 1EY6A 3T4AC 1WTQA 2WAQB 1JE4A 4PG3A 3G7LA 3CCLA 4DV6L 5TSSA 2KQ3A 4DPGA 4X62L 1HA5A 4A3IG 2YU9B 3CAMA 1K3BC 3K8AA 1B53A 2Z6KA 2WB1B 2RKSA 4B8TA 1X54A 4AYBB 3K7UC 4XT1B 4DNIA 2AUJD 5E3FA 1CK1A 1JCKB 2EQSA 4DN4M 2R92G 3GO5A 1Q3LA 4L8JA 3KYHC 1PA6A 4N9PA 2JA5G 2R93G 3QD7X 1EYAA 2C5CA 2DJFC 2RDFA 4YCVA 1NBWA 2G8YA 2J7ZA 3GTKB 1EIGA 2PNHA 3S24A 1A8VA 4IFDG 1Z9FA 3CQZB 4GKKQ 2AQ3B 4A75A 2VXWA 1C0AA 2EYMA 3J7ZC 4A3EB 3TS2A 5EPLA 1ILQA 3GTJB 3I55A 1G2SA 3N6RA 3DEPA 1WFQA 4DV1L 4QB4A 3Q6SA 4DV4L 2ASBA 4R9WA 3G6JB 3S1RB 1F9SA 2RVLA 2N55A 5E4WC 1AFPA 1EYGA 3I56A 2D9UA 4FJUA 3BZKA 1BNZA 2E2IH 2R7ZH 2Z6BA 1O7LA 2HT1A 4CDDC 1BXTA 1GXDC 3DUZA 1ENFA 2E5LQ 3HOXB 3S15H 1G91A 2RF4A 2PO4A 2FHTA 3GV6A 4ZCKA 5JJIA 1FYCA 2ALYB 1K3RA 3F8TA 2CTKA 3FKIB 3VYSA 4X3SA 2PQUA 3RZDB 4C3IH 4XYOA 1U5KA 2K33A 5ELOA 4BS9A 4JW0A 1CA6A 3LX0A 1TS4A 5HURA 5I6WA 1B44D 1Q81C 2R7DA 1JJ2A 4N8FA 4XTCS 2Z0SA 3SEBA 3MC0B 1KABA 2YU9H 1CKNB 2ICEC 4POFA 4IJHA 1E2VA 2D2CC 1SROA 1IYUA 1R9TB 5ELDA 3E9HA 1XNQL 2C9OA 4LFBH 1AP0A 3STBD 2R7ZG 1ZZKA 1ONLA 2ES2A 4B3RH 3T1YL 4LF5H 2V4DA 2EDGA 3AB9A 1CTMA 1M4VA 1KRSA 3F2UA 3I4NG 3BU2A 4DV5Q 5FO7B 3P20A 4A3EH 1UUPA 3FPUB 2ZXOA 3NTKA 4RKBA 1HR0L 1EY0A 3DWPA 4LK1C 1I6HB 4C3IG 3GTJH 4OX9Q 3CCMA 3LWEA 2VQFQ 2JP1A 4A3GH 3S1RH 2P2RA 2F0JA 1X4NA 1V8QA 3MTSA 4UP8A 1KQSA 1IYVA 1N9WA 4KN4C 3JC66 4BBSB 3MAQA 4GKKH 3ER0A 4JI7L 3SGIA 3M7NA 1LT6D 3FRPB 4ZYSA 3FKIH 1VQNA 4UPAA 1JWMD 4FF1A 2XVSA 1PTOD 3ND8A 4UP7A 1NJIC 4R8IA 1XMOQ 4FJSA 4YWMA 4UY8C 4OWXB 1LABA 1H95A 1GUOA 5JEAJ 2Q2UA 1EU3A 3ITPA 1XNRL 4A3GG 2EVBA 4X66Q 4RCOA 1I50B 4U673 4WJ4A 1WTVA 5IP9H 5IY0A 1YI2A 2E5LH 4OCHA 1WD1A 4A3CH 1IYJB 4X6AH 4DAVA 3H0GH 1F9RA 1RDPD 5CR3A 3K5NA 1C7YA 2ZJRA 2LTMA 3OIQA 4WFN3 1TIID 3NBIA 4AH6A 4JVYA 1X6OA 3I7FA 4ME5A 3MEHA 4HIOA 1WTPA 3NK9A 1YNJD 5AJ3Q 2OT2A 1STBA 1D6EC 2IHFA 1EOTA 2QCPX 3VKEA 4K0KL 3PUWA 1TS5A 1PXUA 3PCOB 3CC4A 1G6ZA 4C3HH 1KIXA 2IT1A 5CV4A 5J22A 5IP9G 2VUMB 2L1BA 1KD1C 2LFNA 5A2QE 1K1GA 1SSOA 4BBSH 2B2TC 3FMCA 4A3CG 4DV5H 2F3WA 3PUVA 3H0GG 4WRDA 1W6KA 1PH6A 2B2UA 3ND9A 3K58A 1VQ6A 4DV7Q 4OX9H 1HNZQ 3BZCA 5C5MA 5JJLA 3AEVA 2JEBI 4YY3L 1LLRD 3HEJA 4DUYQ 2NVXB 1RHPA 3PO3B 2K28A 3TZUA 5LMNL 1PFBA 5F2DA 1I50H 1YZ6A 2XNAC 5IT9c 4DV0L 2UXDL 1Y8OB 4R4CA 4HIMA 3GTPB 5CV8A 1D5ZC 1O7YA 4C3HG 2D0OA 3S2HH 3KOJA 1HFNA 5GADC 1O80A 1K28A 5IGGA 4BY7B 5M5XB 3EQLC 4GOPC 4IFDI 4G4KA 4OO1H 1HFGA 4QMGA 4DR7L 1XTCD 2RSOA 5EAYA 1PHJA 1B4OA 1TS3A 3R2TA 1OXSC 2K04A 3CCRA 4DR5L 4KKUA 1WJJA 3PIP3 1HNXL 4H8AA 1XMOH 2BH8A 4B9XA 1VQ7A 1SE4A 5CC4A 4X66H 2YV5A 1VQHA 1ESFA 1B50A 4JK1C 2UU9L 3HZXA 4DA2A 1E2WA 5NUCA 5ISRA 4DR6L 4X65L 3MXUA 2VUMH 1EC6A 2YTVA 1CFMA 4LUVA 5EBDA 4ODGA 1YHAA 4X64L 1VS0A 1LTTD 5HY6A 5DEHA 2A1SA 2Y3MA 3S16B 1LO5D 1PVOA 3KUPA 4HN7A 3S1MB 3ZYYX 1LTLA 1CSPA 2MO0A 2HQLA 4AIMA 4CJ2C 1WTWA 4A76A 3CKIB 4RCNA 3CHBD 1K8GA 1WTHA 2JA7G 1VQPA 4OONA 3HS0C 2EJMA 5M3FH 1BOSA 3M4PA 4EQOA 1ET6A 4QIWB 1F2YA 2O4CA 2Y0SE 3GTPH 2NZHA 5IT9W 1WI5A 1NR2A 4RGTA 1LT4D 2FMMA 1IW7C 3D4RA 2BOSA 4M8AA 2PZTA 3UDIA 4BY1H 4HIDA 4DKAC 1NE3A 3U4VA 2PNRC 3IKJA 2X69A 4ZAIA 4JI3L 4IOCA 3GTLB 4DV7H 1O78A 3QB3A 2XTIA 1G2TA 4IUQA 1N34L 3QR8A 1HNZH 3U1KA 5D65A 1XMQQ 4TSSA 2A73B 2VQEQ 4JYAL 3I2ZA 5IE8A 3CF5A 4DUYH 3KF8A 3EIVA 3HOUB 2QDLA 2ZTEA 1WVLA 1YITA 5C44H 5M3FG 1KXLA 4IUVA 1HRJA 1MJCA 1PMRA 2Z6KC 4IFDJ 5EJWA 5IODA 1F0XA 3DWAA 4E9JA 1K8MA 4WJWA 4BY1G 1QVGA 2F0PA 1VQIA 3S16H 1F9PA 1SMYD 3OSSD 4HCEA 4A3JB 2CVRA 3S1MH 4IALA 2K7VA 2BDOA 2MQHA 3BYYB 3QO2A 3I3CA 2KHIA 3EJIA 4K6LA 1Q7YC 2VL6A 4KY6A 1FR3A 4DV2Q 3I90A 3SE0A 3J81i 1HTPA 2UUCL 3OMCA 4DR3Q 3C1FA 2MPMA 5C44G 3GTOH 1I4HA 1V1QA 2EYPA 4FO2A 5T1IA 3D8GA 1U9RA 3ULJA 5M3MB 2AQ1B 3RLNA 4IPGA 3B6YA 1YNND 4L6TB 4LUZA 1JQYD 1Z2IA 2A8VA 4DAYB 3GTLH 4CDCC 3KK7A 3A55A 1O7ZA 2X06A 1KHIA 5KRUA 5C3EG 4FF3A 1BCPC 2F0FA 1PV4A 3OIPA 2DJGC 2M2LA 5FLXc 2LXKA 1IBML 1A6XA 2XGTA 4BA2I 2CH4W 4JI4Q 3JAMW 2XRQD 3X3NA 2JA6B 3L0OA 1LM0A 1QCBD 1D7QA 3NELA 4H44C 2A68C 1IBLL 1L1OB 4CJ1B 1R4QB 4KHPQ 4YIJA 3D3RA 1CQFA 5KYIA 1KHMA 1YHBA 4BA1I 3AFPA 1VIGA 1VQJA 3CPWA 1XMQH 4PMWA 2VQEH 1PTOB 1S5DD 2N49A 4JBKA 3FEWX 1TS2A 1H9JA 2M8WA 2UXCQ 1EY8A 4DR1L 1Q90A 5C3XA 1X3PA 5FJ8G 4NZTM 1T5EA 5EKLA 1A3UA 2OF1A 5LHY1 3NBHA 4A3DB 1IBKL 5C4JB 4R4IA 3RNUA 4CDEC 4BBRB 5JEAG 1ICFB 2EYHA 3L7ZC 4A3BB 3GQBA 2B3GA 1J5EQ 5DT9A 1PH2A 4NXMQ 1FJGL 4FYDA 1SNOA 4AM3A 3HKZB 1TQOA 3QG1A 4DV2H 4B3SQ 2ATWA 1N33Q 1X9ZA 2NYZD 4DR3H 4OIKA 3EVQA 1SE2A 3NQIA 4S3SA 3H6MA 3KJOA 1LUZA 2JA6H 3A8JE 1IHZA 3S2DH 1H9SB 5GAHC 4RKLA 1PH5A 3J80W 4LFCL 3K6OA 4AQYQ 4IUPA 3GTQB 2K52A 4GN4B 1NSNS 2F0NA 1J4WA 1U0LA 4OO1I 3K0XA 1BKBA 5DNFA 3S1NB 1EIHA 1GUGA 4A3KB 2Q8RE 4DAYA 4KY7A 3T56B 3OTOQ 4HEDA 1P16A 4ID6A 2EYFA 5EKKA 1JJCB 5CBAE 1FD7D 3IRBA 3G48A 2K1BA 4LFAQ 4ZKCB 5LL6X 4YHHL 2LSSA 2NVQB 2K32A 3A0JA 4GLXA 4JI4H 4GNXA 3HOVB 1C8CA 1UWVA 1I94Q 4IURA 2R7FA 2A6HD 4KV6A 2JA6G 1F2LA 1XPRA 5E4XA 2LF0A 4BBRH 3HG9A 4R8NA 3RLFA 2N3SA 1CUKA 4A3BH 4KHPH 3RN5A 4GN5A 4LF9L 1I3QH 2OPVA 1B9NA 2A5HA 4B3MQ 2ENBA 1VQCA 1SEIA 4CJ0B 2RCFA 2O4XA 1N32Q 2UUBQ 1MSGA 2UXCH 2B2UC 4KHVA 2CWHA 4L5QA 4I65A 2UXBQ 5CMDA 2PW5A 4DAPA 3GKUA 2WB1E 3MFYA 3GV3A 2A1AA 1Z6HA 2JJQA 1EQQA 5D14A 2VKCA 4AYBE 4DR4Q 1HNWL 1ICWA 1FNVA 2JVZA 4HIKA 1K73C 3KDFB 4NXMH 3VA7A 1QILA 4BBRG 4UDUC 2RSNA 4JI1Q 4LF6Q 4Q5VA 1J5KA 3N52A 1FVIA 3I4LA 3BZDB 3J7AF 2HIXA 4YCWA 2WKCA 5E1FA 3S1NH 1VBIA 4A3KH 1VQ9A 1LTGD 1MKHA 4B3SH 3VR3A 1S4ZA 1N33H 3OW2A 3S14H 1PFMA 3T1HQ 2PZWA 4PZ8A 2NVQH 3I4MB 3KDKA 4P74A 5FO9B 3DM1A 4EGVA 1GM5A 1Y8PB 2ZXPA 1TWHH 4DV6Q 4AQYH 1Y1VB 1UG8A 1G291 2K5WA 2A74C 1JWUD 3SHLA 4X62Q 4CKEA 1HPCA 2LS01 3ONAB 4JI6L 2F0VA 2L4NA 2O5JC 2O2LD 2X6LA 3NE5B 3OETA 3OTOH 1MGSA 1QVFA 5C4XG 1CM9A 1XTDA 3KBXA 3RR5A 4A3KG 3OMGA 3OWEB 3EBEA 4LFAH 4NP5A 1HA6A 4A3FB 2CWPA 3D4DA 2HHHQ 5EPJA 3J7AV 1I94H 2F0UA 4RHRA 4PDBA 5I6YA 1I4XA 4L5SA 3RF2A 2CTEA 3SK6A 4MTKA 4FNFA 4K5WA 1SN8A 1EYCA 2D62A 2MGSA 3PV0A 4DFAA 2FINB 1JOOA 4JI8Q 3NENA 1JORA 1EY4A 4MNOA 1RF2D 1PTOF 4B3MH 3Q23A 4OD6A 1U4RA 1N32H 4GKJL 2UUBH 4JV5Q 2UXBH 4DUZQ 1YJWA 1RTNA 2OWOA 4LF5L 2K14A 5K36H 2B2YC 1HZBA 2GA4B 3CCQA 1QZGA 3M4YA 5HGQA 3U9OA 3NQTA 4DR4H 3I4MH 2E76C 4DV3Q 1AN8A 4NKLA 3VR6A 2MFIA 2ZJPA 4HAEA 3J81E 1SNDA 3HOYH 4JI1H 4LF6H 2NTSA 3IFTA 3KDFA 2Q8IB 4DXFA 3NTIA 3PMFA 2Z4HA 1X4MA 2E2HB 4KN7C 3F2DA 1TWFH 2CTMA 3ULPA 4IO9A 3UDXA 3HOZB 4OGQC 1TWCB 1XNQQ 1LYLA 5M9OA 3T1HH 3LWUA 2F0HA 1LT3D 2B2VA 3BYTB 2B2WA 2BE5C 1X3EA 5K36G 3K5LA 1A3VA 1M8AA 2CCZA 4B3TL 3MXNB 1OXVA 1IXRA 1BDOA 3CC7A 1E0BA 2KEDA 3WWVA 4DV6H 3EZJA 2KOLA 1CKOA 1I6UA 1FKAH 2NVYB 4HTHA 4X62H 1WE8A 2PI2A 3HOYG 2F0KA 1LTBD 4FP5D 5IT9E 2N8NA 3BDCA 1SLJA 3A7LA 3KBGA 2RDGA 2RBMA 3GTKH 1KNAA 3L2PA 3CQZH 4OXPA 1SNCA 2CHBD 1PFNA 5LMUQ 2QILA 2WAQG 2HHHH 3VR2A 3AEVB 5G3LD 1Q82C 2E3UA 3RMHA 3NHHA 4B8CD 4LNQA 4LF8Q 4P73A 4KJOA 2D9IA 4L5TA 1DYQA 3A8IE 1Q46A 4C2MB 5IOCA 4PV1C 2WB1G 3E3XA 2BA1A 1SYFA 3SR1A 4AYBG 4JI8H 1Y1WB 4B08A 1BBXC 3V69A 3FP9A 1HTLD 1HXYD 3HOXH 1RODA 3W2DA 2B8GA 4XQNA 5IWAL 2E2HH 1XNRQ 4JV5H 4NBQA 1FL0A 1H9RA 5COYA 4DUZH 1UNSA 4JI5Q 2JA9A 3J81L 4TQUS 5DLQE 5FKAC 3RZDH 4A3EG 3K80C 1IL2A 3UE0A 4DV5L 3T51B 2VB2X 2EXDA 1CHPD 1LACA 4DV3H 4F8MA 4RH6A 1EZ8A 1XYIA 1VQOA 1KL9A 4DF7A 1R9TH 2K5DA 3RUZA 4K6DA 1J9OA 2NVYH 3U4ZA 4QGUA 3UI2A 2IHEA 1LTRD 1WD0A 4I7ZC 2L55A 3HOXG 2K75A 2K5HA 3TZDA 2DN8A 4O42A 4RGNA 1XNQH 3IAYA 1NTGA 1HZ9A 4C1NK 1FGBD 4K0KQ 3FKIG 5JJZA 2DNEA 4KY5A 5J1ZA 3NP8A 1I6HH 1EOVA 3PSIA 3PUYA 5KNDA 4IUNA 1PH1A 1JR0D 1SBBB 1SYGA 1XMOL 5M5WB 2ZM6Q 3MXNA 5EQ0A 4YWLA 5JVG3 2F4VQ 2ZXRA 1PRTD 2JQOA 4X66L 3JAME 3GDEA 4WALA 5BN4A 1P8LA 1B1ZA 1QVCA 4YY3Q 3TN2A 1CSQA 1Y69U 1AEXA 4H02A 5LMNQ 2I0QA 4Y52H 3KLSX 3Q8DA 1ZKOA 5ELBA 4DV0Q 5LMUH 1YNXA 2UXDQ 1STYA 4HJ5A 1SR3A 4CKCA 3PO2B 3KF8B 2VQFH 4LF8H 4F7XA 3HKSA 2XIWA 1MIUA 1S03G 4JI0L 4ZUJA 5H1SE 4IQZA 4OL7A 2PZUA 3CU7A 3UOEA 2K6AA 3I73A 5C4ZA 2JA8B 3RD4A 3QJYA 1Z7TA 4DR5Q 1HNXQ 3BVZA 1BQQT 1E24A 1TXYA 3DHQA 4A3LH 1XNRH 4BBSG 2EYLA 4LW1A 4FXKC 1ASYA 4JI5H 2DNCA 2B63B 1L1OC 4U68A 2EZVA 1WCMB 3GTGB 4FXGC 1D5XC 1WOCA 1KAWA 4X65Q 3PIO3 2EOTA 2FFKB 4G7HC 1HR0W 5JJKA 2JK8A 4X64Q 4RG1A 4JPBW 1HNZL 1G51A 1EFWA 2D0PA 2KHJA 2PQAB 3NPPA 4O2DA 1RL2A 1TKWB 1HQRD 1CI3M 4JVZA 2CQAA 1PZKD 1WTOA 3CMEA 4A3LG 1DJRD 3J80E 3J7AK 2OCEA 4K0KH 4OO1G 4NW2A 2FFMA 2PQEA 1HZAA 4LUOA 2XWBB 3JAML 2GN5A 5IYCH 5KGUA 4CHTB 5A2QL 2DY8A 1L0WA 1W2BA 4JC0A 1V43A 1B9MA 2YTYA 3MZ5A 2RQXA 2E2JB 4ZQ3A 1UAPA 4B9WA 2ZM6H 4ZK9B 2F4VH 1XJVA 1X55A 3K59A 2NVXH 3PO3H 2K50A 4JI3Q 1TT2A 4DK3C 1GD7A 1N36Q 1TUAA 2JA8H 2MHVA 1N34Q 3KFUA 1BCPD 3T13A 5JPNC 1WYDA 1EY7A 4JYAQ 5D3IB 4UHVA 2VUMG 1E7ZA 4KLKA 2VY3A 4BY7H 5M5XH 4DV0H 2A6ED 1HCZA 2UXDH 4JOIC 1B7YB 3M85A 4MTNA 5E7NA 3TP8A 5IYCG 3C1EA 1VCIA 4K2LA 1ZTGA 1YEZA 3URYA 2HH3A 1CA5A 2A68D 5DM63 2IY5B 3AMUA 4WORA 2EY1A 2L11A 2F0DA 3NBHB 3CCVA 2Z9HA 3PO3G 4DR5H 1HNXH 1C48A 1PH4A 2HH2A 2E74C 3F2BA 4IUUA 3A5ZB 3FHWA 4PZ6A 2F03A 1EY9A 2UUCQ 4BY7G 4H0LC 4IOAA 2GVBA 1ZYRD 3S1QB 1I4GA 4X65H 2WINB 1EIYB 2KA7A 5I9PA 3K7AB 3UDFA 2ANRA 2Q8TA 1EL0A 2LY7A 4IPDA 2VQEL 2LKVA 3SXHA 2LRRA 2AQ2B 2KHSA 3TEHB 5IGFA 1STEA 1HZCA 4KJNA 2PQAA 5LMNW 1X56A 2QKIC 2JZXA 3PF4A 4QQBX 3ERQA 3C3LA 1DOMA 5FO8B 2KUMA 3HKZE 2PMZB 1WTRA 3CRKC 4HSVA 4QCLA 1VQ4A 3U58A 3AYHB 2LMCB 1BVSA 2B29A 2I5HA 3CCSA 3P1HA 4DU9A 1K83B 2KCMA 1HUNA 2ID0A 3FDTA 3M4QA 3OYYA 2BH2A 2JE6I 2OQKA 5IYDH 3WOEA 1Z47A 5IIFA 2FPHX 4JBWA 4GNXB 5J3BA 2B2VC 3HOUH 4JI3H 1N36H 1GOZA 3A5UA 2Q2IA 4DV2L 1AE2A 1SJED 4DNRB 4JYAH 3TP6A 2K5QA 4DR3L 1AZQA 5JVH3 1WTXA 4FXDA 1G6PA 2RHSB 1CZGA 1QOHA 4R4QA 4A93B 2RCNA 1BO0A 5I4DA 3U9SA 4DR1Q 2NZ1D 2F0WA 1QZHA 1JB3A 4DAMA 1F2ZA 4FDBA 1X32A 1UE6A 1L0XB 2R3ZA 2E8GA 2ZTCA 4A3JH 4X3KA 3GTMB 1K8OA 1V8CA 3C2PA 3NWTA 1TWGB 3K7AH 4TKOB 5BN5A 5EKIA 2Z4IA 3VYRA 5IYDG 2H1EA 4LF4Q 1FJGQ 1J8IA 4J15A 3HOUG 2N78A 4IPHA 2CWAA 1C9OA 3H15A 3MFGA 3PUXA 4JI2Q 4NB3A 3A74A 4ILWA 4TRDA 2MJ8A 2L15A 1QWYA 5M3MH 3R2IA 4Y7NB 2UUCH 1I4RA 3V2TA 2DUDA 1ILPA 1YJNA 2EE1A 3D6CA 3DM3A 3ICEA 2PY9A 5GAEC 1AH9A 1PH3A 1K83H 5KNBA 4A3JG 3ZJYC 1M90C 2EY5A 1TWAB 4EQ5A 1V9NA 2MP1A 3GP7A 1B3AA 2ZTDA 4DK1A 3D4WA 2L12A 1GHJA 2N88A 2UUAL 1DD2A 5FLXW 4FF4A 1D5MC 1D2BA 4LMQD 1PRTB 4DR2Q 1GUNA 4P71A 3HOWB 1STNA 1G8ZD 3V96A 1S3OA 1D8LA 1JOKA 2EPBA 4YHHQ 4CKBA 4A93H 3KDGA 5M3MG 3TS0A 1SXTA 4KHZA 2AUKA 4M1UB 2NN6H 3VYTA 1H9MA 4A3MB 3K5OA 2Z1CA 2RA4A 5M5YB 1PTOH 3W1BA 2QEXA 2VNUD 3D6WA 5LL6b 1PYBA 1QNKA 4MN3A 2JSOA 2NB0A 3JAMi 2M9VA 2B2TA 4LF9Q 3TDQA 2B39A 2M00A 1NXUA 1PH9A 5IP7H 3NSWA 3CMAA 3G6EA 4A3DH 1SJHD 2LXJA 1N8RC 5C4JH 1I5FA 1K0SA 2FMCA 4CGYB 4DR1H 2A69C 4JBJA 4L5RC 4NPSA 5BN3A 1II3A 4A3IB 2WAQE 1HNWQ 2NN6G 5BR8L 2FXQA 1E1OA 1SFOB 1VQKA 4LF7L 3BDLA 4QUFA 1Q8IA 5D3DA 2YTXA 3A54A 2WP8J 4LF4H 3OTOL 1FJGH 2R92B 4NXNL 2CWFA 1I4PA 1DM0B 1E22A 3NTHA 2KCNA 1T9HA 2F4IA 2R93B 4FVMA 2JA5B 2K01A 2YYZA 3I4OA 2F0GA 2AWOA 1JICA 4JI2H 1D1KA 2SOBA 1A63A 5IP7G 3HOWH 4A3DG 1J5EH 1QG7A 2FJ2A 3KLSA 4JVHA 1SNPA 4UAIA 2AWNA 5EGTA 2IW3A 4IUTA 3OWFA 2M6QA 4A3BG 3GTQH 3BVGA 1WVNA 4RFBA 1X3FA 3VYUA 2QA4A 1SE8A 3HKZG 4A3MH 1PYWD 1S5FD 4B3ML 4ME3A 3BJUA 1UEAB 2AHOB 4APVA 1N32L 1XXGA 4C1NI 4JI6Q 3HOVH 3F1ZA 1QJOA 4DR2H 1OTCA 3SK5A 2SDFA 3HGBA 3J80i 1MHWC 1LTSD 3S17B 2VS1A 1BCPB 5ELEA 3QOJA 4DR4L 4YHHH 1SNMA 3MVVA 1S5BD 3MXPA 3FPPA 1TY2A 2VB3X 2OTJA 1PFSA 3DLLA 4F87A 1KC8C 4LF6L 1S5ED 5G3LF 1GUSA 3CP0A 1YIJA 1SFOH 3EN2A 1JE5A 4C3JB 2WFWA 4HJAA 4XQJA 1VQBA 2KJXA 3P75A 4DK6C 2G9HD 2R7ZB 4G7OC 1PZID 3GD7A 5JAVA 2JA5H 3S15B 3T1HL 4JCVE 3DWQA 4O0AA 3T53B 1FNWA 4GKJQ 3OSOA 3HOVG 2HCIA 3SVMA 2XRSD 4IJLA 3I4NB 2F3VA 2EYJA 3D0FA 2IWHA 4C3IB 3T16A 5FLMH 4DV1Q 2A6HC 1A0IA 4DV4Q 4P72A 3R8BA 4LFBL 1HNWH 5T1GA 2HD3A 5CV5A 1AN7A 2OTLA 1W6JA 1VQAA 4B3RL 2OEOA 4OIJA 5CV9A 4MHEA 5CGKA 1FGUA 1VQFA 1K9MC 3E0JA 2HHHL 4NDXA 4K8IA 2ANNA 1PH8A 2QGQA 1MJEA 3S17H 1VQLA 2F3IA 2R61A 1IL8A 1Y1VH 5HGTA 4OHJA 1RTOA 1MI2A
chains in the Genus database with same CATH topology
1HQMC 3P7JA 5FLMG 5LL6S 4G57A 2HUGA 2F0QA 4B3TQ 1PDQA 4JI8L 4A3GB 1Q1EA 5EBCA 3RZOB 2HIVA 1S72A 4GKKL 1GUWA 4C3JH 5C4HA 3UDGA 4JV5L 3QIAA 3NXWA 4A3FH 1ENAA 4DUZL 1KTKA 1PRTF 3T1YQ 3ULLA 3K5MA 2C35B 3UE1A 3I4MG 5FK9C 3VA5A 1A2TA 2FMRA 4L63B 1VQGA 4RWSC 3R3OA 1X3GA 1RD9D 4DV3L 2ZJQA 3I4NH 1B8AA 1HR0Q 4P2CB 2YQRA 3EFXD 3W3AA 2EXZA 1LTID 2CW0C 3TP7A 1Y1VG 4X3TA 5AFWA 1SAPA 2E5LL 2Z8LA 3MWYW 1TR5A 1DGSA 1VF5C 1DOLA 2F0OA 1EEID 1EUJA 4C3JG 1U4PA 3L3OC 3OOCA 2O5IC 5C0XJ 1IKMA 5C5LA 5GQOA 4A3FG 1CZWA 4JI7Q 3K57A 4WJ3M 5IWAQ 2ICIA 1CT1D 1TU2B 3H0GB 1ZXTA 1VMCA 4J8QA 4PQXA 1DT4A 5GAGC 1PYSB 4V0BA 3KJPA 2RDHA 2NN6I 1NMFA 4POGA 3HOZH 2KBNA 1SEBD 1TWCH 3E0EA 3RZOH 2PW7A 2IX3A 3BG3A 1B70B 1UE1A 4C3HB 5LMUL 1JWSD 3I8ZA 4FF2A 4OX9L 1UEBA 1GHKA 3AU7A 2VQFL 4LF8L 1M1KC 2XSCA 1ZZJA 3KF6B 2K4KA 1SYEA 2HDMA 5I9OA 2RHQB 3RN2A 1VQEA 1VF7A 4RGMA 1VQMA 2HCCA 4RAUC 2QDBA 4UP9A 1X65A 1QNUA 4HMJA 4KD3A 3SK4A 1RCVD 3HOZG 2KCCA 5IT9L 1YBYA 4JI5L 4OWWB 2HQEA 2K03A 1CKMA 5JPMC 3S2HB 1CQVA 4MIUA 1SRUA 4HR7B 1VQDA 1BCPF 1X9NA 1A3TA 4HSPA 1SE3A 2AMCB 4K14A 4C2MH 4G7ZC 5JOBA 1OO9B 1EWIA 1ZEQX 5K5PA 2B8FA 1JT8A 1Y1WH 2I5MX 4CBVA 1NCVA 3BDOA 3G71A 1R4PB 2JA7B 3STBC 4JI0Q 3KLRA 1TY0A 2OXPA 2F0MA 1I6VC 3CW2C 1QUQB 1S5CD 2ZT9C 1UE5A 3J81c 1OXTA 1CKNA 1K8AC 1D1IA 1IW7D 1VQ8A 2A19A 4IZ8A 1DONA 1YJ9A 2I07B 4QIWE 2IX1A 4DR7Q 4P75A 1Q1BA 4HJ8A 4JBMA 4GNXC 5AJ3L 1PH7A 3QWNA 4HCSA 2ZM6L 2F4VL 2KEEA 1JB7A 3WOFA 1Y1WG 3IFDA 3H3VH 3L9AX 1MBYA 4DXGA 1EQTA 2TMPA 1JOQA 1QB5D 2UU9Q 1DZ1A 4DK0A 3R93A 5M3FB 1GJXA 3TRZA 4DR6Q 1E3PA 4DV7L 3V05A 2WACA 3TQYA 2CTLA 1PTOC 1VDZA 4LIJA 2L0CA 4BY1B 3CXCA 5IGBA 5M5WH 3AFQA 4DUYL 2DY7A 1YHQA 5FLXE 4XT3B 3AQQA 1Q86C 3KF6A 4DNTB 3HFZB 1GKHA 4GZYC 1NUCA 4KK7A 1DCZA 2JA7H 1STHA 3A8KE 3M4OB 2CTJA 5C44B 1CHQD 1V1OA 4XDXA 5ELFA 5FOBB 4ZUIA 2TSSA 3CPFA 2KECA 3PO2H 2MJHA 1LT5D 1GVPA 2VW9A 4Z9CB 3PGZA 4ALPA 3DEOA 1DOKA 3I72A 1V9PA 2E2DC 1GO3E 1F9QA 2R6GA 1EY5A 1YNJC 1EWCA 3TP5A 2CFMA 4XXEA 2F0LA 5C3EB 1V1PB 4PMBA 1BBUA 2PMZE 1PRTC 2IX0A 2AKWB 1O7IA 4LAAA 4C56C 4F88A 2IPKD 2B63H 4E6IA 3NUCA 4V190 1QUQA 4HJ9A 1WCMH 3GTGH 3GTOB 4HMIA 1A15A 5IGDA 3I70A 3PO2G 4EQPA 3OHXC 3SDZA 2CPQA 2V1CC 1JC7A 2F52A 4DGZA 1QE6A 4IPCA 4PZ7A 4QF4A 2K5VA 2JA8G 1XX8A 1C4QA 1N36L 1BR9A 2EJGC 4K5XA 2CQOA 1KNEA 5GROA 2K05A 1VMPA 1EEFD 5CYUA 2B2YA 4N9TA 2XWJB 4TVAB 1T5XD 2J0TD 1Q12A 1RKNA 1HJPA 3MHBA 4R4OA 1ESRA 4RMFA 2KENA 3M4OH 3PUZA 5FLXL 1Y14B 1KRTA 3VDYA 3JAMc 2B63G 3M7GA 1AW7A 1RIPA 2MUYA 1WCMG 5A35A 3M3YB 1ZZIA 1W3SA 3J80L 4KMUC 1XMQL 2E2JH 3J7YW 4X3UA 2L9HA 4ZRZA 1HHVA 4Q0FA 5C0XH 4MZ9A 3KLWA 1X3QA 2SNMA 4K8JA 1GUTA 5C3EH 4EVOA 3BS1A 2HDLA 2JYOA 4PNYA 1F77A 3SK8A 1I4QA 3NWSA 4GS3A 1IBMQ 3LNNA 1KLGD 3EROA 5C6AA 3HP3A 2H5XA 3I91A 1EU4A 4KI0A 3C46A 1XPOA 1H9KA 1IBLQ 3X3MA 2DGRA 3TBIB 5ELNA 2B2WC 2Y0SB 3E6ZX 5I2YA 1U4MA 1DXMA 1HH2P 3IL8A 5DAUA 5C0XG 4ZKBB 1IKLA 5IYBH 3MA2B 1OXXK 4XYQA 1EQVA 1V1PA 3D31A 1ML0D 4PMCA 4H13C 4J6HA 3BVMA 1J6QA 5DM73 4BXXH 5FJ8H 2IJ0A 3S1QH 1EQRA 2F1MA 2J4XA 5ELCA 1IBKQ 3MXGA 2A6EC 3A7AB 1U4LA 2G9DA 1VIHA 3S9WA 4O1NA 3M3YH 3S2DB 2A69D 5JEAH 4RHSA 3J80c 4GOPB 1SYDA 1XWEA 1E1TA 1KDAA 4KD4A 2EY2A 4GLAC 1KDBA 5CORA 3CRLC 1KAAA 4JI4L 1E2ZA 5IYBG 5IGCA 3PF5A 4J1MA 1NMGA 4NMZA 2UUAQ 1HUMA 4RGOS 2CTFA 1STGA 4BXXG 4KKTA 4KHPL 3Q0AA 2KVMA 1SMYC 2OPUA 5I2XA 1ZYRC 4WANA 3WDNA 3M9BA 1PZJD 4LFCQ 1NY4A 3CD6A 2UXCL 1BF4A 1K0RA 5CV6A 2NVTB 5EPKA 4LF4L 1I3QB 3J81j 2EJFC 3CC2A 4YWKA 5KYLA 2PCFB 4JI2L 4A4IA 3VR4A 1EYDA 4K5VA 3H3VI 2MNAA 1J5EL 4NXML 1YNNC 2QF7A 5KNCA 3GTMH 1DTJA 1IZ6A 4IN3A 1B2TA 3K0YA 1TWGH 1MSHA 1SDFA 1EFID 3EA6A 4B3SL 2L5TA 3OW7A 4ABNA 4HJ7A 1N33L 3E9IA 2Y0SG 2PI2E 4R4TA 5BR8Q 3OPOA 2PPBC 1RJTA 5C4XB 4LF7Q 1LV9A 1ET9A 4XIGS 2WIIB 1VQ5A 1NR4A 4DR2L 4NXNQ 2BA0A 1FNUA 2F0TA 3S14B 4Y7NH 4LJZC 4A93G 1L2FA 1BUVT 5J39A 4QJFA 2SEBD 3Q22A 2F0IA 2XN9C 4AQYL 1SYCA 2MO1A 2X6GA 2KCTA 5KEEA 1TWAH 4RA8A 1Y8NB 2Q2HA 4QUCA 1TWHB 3PIPA 4XQQA 3CCEA 3PIOA 3HRZC 2QNDA 4GOPA 3FVQA 4LFAL 2NVTH 2QEJC 3NEMA 5C3WA 2NTTA 4GLVB 2BCOA 2NWGA 3H09A 4KKSA 2BL5A 1L1OA 2Q2TA 1YVCA 2I5LX 4EX5A 1I94L 4BWGB 2CKZB 1ASZA 1NAPA 3H91A 1STAA 2VZAA 3MEFA 4ZLTF 4R1JA 5CV7A 1PLFA 4ULLA 2GVAA 3G4SA 3CCJA 2WV6D 3TSSA 4QMFB 3Q24A 1SMXA 3J7A5 2EIFA 3ERSX 2WKDA 4K2KA 2PYKA 3U50C 3TREA 5M5YH 1L0YB 2JEAI 2EYOA 1JJGA 4YCUA 1TVXA 1JMCA 2UUBL 2EY6A 3E5SA 4EQNA 1A62A 5KIXA 3W1GA 2UXBL 1S40A 1Q8KA 4QY7A 1F2MA 3DMUA 2H4OA 1LTAD 1ENCA 2E75C 5C4XH 2JXMB 1AE3A 4QL5A 1AZPA 3HOWG 5CBEE 2BE5D 3VR5A 2SNSA 3CCUA 2AXYA 1KDCA 3K81C 2NZOA 1UE7A 4GN3B 2I46A 4JI1L 2DGYA 1SNQA 3F2CA 4A3IH 3H3VC 5IGEA 1EZ6A 1OXUA 4JG2A 2F0EA 4A3MG 2F0SA 2BDNA 3DXJC 1MD2D 1XPUA 2NUCA 1SYBA 2E2IB 3W5OA 2CW0D 2R92H 3A56A 3O13A 2IL8A 3HOYB 3RLOA 2K5NA 1H9SA 4LFBQ 2R93H 1BBWA 4OWTB 1EWHA 3LGJA 3H94A 4LWCA 2OQ0A 1KLUD 3QOLA 4IFDH 4JOIA 1A2UA 3TMEA 5C0XI 4KTAA 4H7BA 1EIFA 1TWFB 2D5DA 4B3RQ 4LF5Q 2NBFA 1EY6A 3T4AC 1WTQA 2WAQB 1JE4A 4PG3A 3G7LA 3CCLA 4DV6L 5TSSA 2KQ3A 4DPGA 4X62L 1HA5A 4A3IG 2YU9B 3CAMA 3K8AA 1B53A 2Z6KA 2WB1B 2RKSA 4B8TA 1X54A 4AYBB 4XT1B 3K7UC 4DNIA 2AUJD 5E3FA 1CK1A 1JCKB 4DN4M 2EQSA 2R92G 3GO5A 1Q3LA 4L8JA 3KYHC 1PA6A 4N9PA 2JA5G 2R93G 1EYAA 2C5CA 2RDFA 4YCVA 1NBWA 2J7ZA 3GTKB 1EIGA 2PNHA 3S24A 1A8VA 4IFDG 1Z9FA 3CQZB 4GKKQ 2AQ3B 4A75A 2VXWA 1C0AA 2EYMA 3J7ZC 4A3EB 3TS2A 5EPLA 1ILQA 3GTJB 3I55A 1G2SA 3N6RA 3DEPA 1WFQA 4DV1L 4QB4A 3Q6SA 4DV4L 2ASBA 4R9WA 3G6JB 3S1RB 1F9SA 2RVLA 2N55A 5E4WC 1AFPA 1EYGA 3I56A 2D9UA 1BNZA 3BZKA 2E2IH 2R7ZH 1O7LA 2HT1A 1BXTA 1GXDC 3DUZA 1ENFA 3HOXB 1G91A 2E5LQ 3S15H 2PO4A 3GV6A 2FHTA 2RF4A 5JJIA 1FYCA 2ALYB 1K3RA 3F8TA 2CTKA 3FKIB 3VYSA 4X3SA 2PQUA 3RZDB 4C3IH 4XYOA 1U5KA 2K33A 4BS9A 5ELOA 1CA6A 3LX0A 5HURA 1TS4A 5I6WA 1B44D 1Q81C 2R7DA 1JJ2A 4XTCS 2Z0SA 3SEBA 3MC0B 1KABA 2YU9H 1CKNB 2ICEC 4POFA 4IJHA 1E2VA 2D2CC 1SROA 1IYUA 1R9TB 5ELDA 3E9HA 1XNQL 2C9OA 1AP0A 3STBD 2R7ZG 1ZZKA 1ONLA 2ES2A 3T1YL 2V4DA 2EDGA 3AB9A 1CTMA 1M4VA 1KRSA 3F2UA 3I4NG 3BU2A 4DV5Q 5FO7B 3P20A 4A3EH 1UUPA 3FPUB 2ZXOA 3NTKA 4RKBA 1HR0L 1EY0A 3DWPA 4LK1C 1I6HB 4C3IG 3GTJH 4OX9Q 3CCMA 3LWEA 2VQFQ 2JP1A 4A3GH 3S1RH 2P2RA 2F0JA 1X4NA 1V8QA 3MTSA 4UP8A 1KQSA 1IYVA 1N9WA 4KN4C 3JC66 4BBSB 3MAQA 3ER0A 4JI7L 3SGIA 3M7NA 1LT6D 3FRPB 4ZYSA 3FKIH 1VQNA 4UPAA 1JWMD 4FF1A 2XVSA 1PTOD 3ND8A 4UP7A 1NJIC 4R8IA 1XMOQ 4YWMA 4UY8C 4OWXB 1LABA 1H95A 1GUOA 5JEAJ 2Q2UA 1EU3A 3ITPA 1XNRL 4A3GG 2EVBA 4X66Q 4RCOA 1I50B 4U673 4WJ4A 1WTVA 5IP9H 5IY0A 1YI2A 1WD1A 4A3CH 1IYJB 4X6AH 4DAVA 3H0GH 1F9RA 1RDPD 5CR3A 3K5NA 1C7YA 2ZJRA 3OIQA 4WFN3 1TIID 3NBIA 4AH6A 4JVYA 1X6OA 3I7FA 4ME5A 3MEHA 1WTPA 4HIOA 3NK9A 1YNJD 5AJ3Q 2OT2A 1STBA 1D6EC 2IHFA 1EOTA 2QCPX 3VKEA 4K0KL 3PUWA 1TS5A 1PXUA 3PCOB 1G6ZA 3CC4A 4C3HH 1KIXA 2IT1A 5CV4A 5J22A 5IP9G 2VUMB 2L1BA 1KD1C 2LFNA 5A2QE 1K1GA 1SSOA 4BBSH 2B2TC 3FMCA 4A3CG 2F3WA 3PUVA 3H0GG 4WRDA 1W6KA 1PH6A 2B2UA 3ND9A 3K58A 1VQ6A 4DV7Q 1HNZQ 5C5MA 3BZCA 5JJLA 3AEVA 2JEBI 4YY3L 1LLRD 3HEJA 4DUYQ 2NVXB 1RHPA 3PO3B 2K28A 3TZUA 5LMNL 1PFBA 5F2DA 1I50H 2XNAC 1YZ6A 5IT9c 4DV0L 2UXDL 1Y8OB 3GTPB 4R4CA 4HIMA 5CV8A 1D5ZC 1O7YA 4C3HG 2D0OA 3S2HH 3KOJA 1HFNA 5GADC 1O80A 5IGGA 4BY7B 5M5XB 3EQLC 4IFDI 4OO1H 4G4KA 4GOPC 1HFGA 4QMGA 4DR7L 1XTCD 2RSOA 5EAYA 1PHJA 1B4OA 1TS3A 3R2TA 1OXSC 2K04A 3CCRA 4DR5L 4KKUA 3PIP3 1WJJA 1HNXL 2BH8A 4B9XA 1VQ7A 1SE4A 5CC4A 2YV5A 1VQHA 1ESFA 1B50A 4JK1C 2UU9L 3HZXA 4DA2A 1E2WA 5NUCA 5ISRA 4DR6L 4X65L 3MXUA 2VUMH 1EC6A 2YTVA 1CFMA 5EBDA 4LUVA 4ODGA 1YHAA 4X64L 1VS0A 1LTTD 5HY6A 5DEHA 3S16B 1LO5D 1PVOA 3KUPA 4HN7A 3S1MB 3ZYYX 1CSPA 1LTLA 2MO0A 2HQLA 4AIMA 4CJ2C 1WTWA 4A76A 3CKIB 4RCNA 3CHBD 1K8GA 2JA7G 1VQPA 4OONA 3HS0C 2EJMA 5M3FH 1BOSA 3M4PA 4EQOA 1ET6A 4QIWB 1F2YA 2Y0SE 3GTPH 2NZHA 1WI5A 1NR2A 4RGTA 1LT4D 2FMMA 1IW7C 3D4RA 2BOSA 4M8AA 2PZTA 3UDIA 4BY1H 4HIDA 4DKAC 1NE3A 3U4VA 2PNRC 3IKJA 2X69A 4ZAIA 3GTLB 4JI3L 4IOCA 1O78A 3QB3A 2XTIA 1G2TA 4IUQA 1N34L 3U1KA 5D65A 1XMQQ 4TSSA 2A73B 2VQEQ 4JYAL 3I2ZA 5IE8A 3CF5A 3KF8A 3EIVA 3HOUB 2ZTEA 1WVLA 1YITA 5C44H 5M3FG 1KXLA 4IUVA 1HRJA 1MJCA 1PMRA 2Z6KC 4IFDJ 5EJWA 5IODA 3DWAA 1K8MA 4WJWA 4BY1G 1QVGA 2F0PA 1VQIA 3S16H 1F9PA 1SMYD 4HCEA 4A3JB 2CVRA 3S1MH 4IALA 2K7VA 2BDOA 2MQHA 3BYYB 3QO2A 3I3CA 3EJIA 4K6LA 2KHIA 1Q7YC 2VL6A 4KY6A 1FR3A 4DV2Q 3I90A 3SE0A 3J81i 1HTPA 2UUCL 3OMCA 4DR3Q 3C1FA 2MPMA 5C44G 3GTOH 1I4HA 1V1QA 2EYPA 4FO2A 5T1IA 3D8GA 1U9RA 5M3MB 3ULJA 2AQ1B 3RLNA 4IPGA 3B6YA 1YNND 4L6TB 4LUZA 1JQYD 2A8VA 4DAYB 3GTLH 3KK7A 3A55A 1O7ZA 5KRUA 1KHIA 5C3EG 4FF3A 1BCPC 2F0FA 1PV4A 3OIPA 2M2LA 5FLXc 2LXKA 1IBML 1A6XA 2XGTA 4BA2I 4JI4Q 2XRQD 3X3NA 2JA6B 3L0OA 1QCBD 1LM0A 1D7QA 3NELA 4H44C 2A68C 1IBLL 1L1OB 4CJ1B 1R4QB 4KHPQ 4YIJA 3D3RA 1CQFA 5KYIA 1KHMA 1YHBA 4BA1I 3AFPA 1VIGA 1VQJA 3CPWA 4PMWA 1PTOB 1S5DD 2N49A 4JBKA 3FEWX 1TS2A 1H9JA 2UXCQ 1EY8A 4DR1L 1Q90A 5C3XA 1X3PA 5FJ8G 1T5EA 5EKLA 1A3UA 2OF1A 5LHY1 3NBHA 4A3DB 1IBKL 5C4JB 4R4IA 3RNUA 4BBRB 5JEAG 2EYHA 3L7ZC 4A3BB 3GQBA 2B3GA 1J5EQ 1PH2A 4NXMQ 1FJGL 4FYDA 1SNOA 4AM3A 3HKZB 1TQOA 3QG1A 4B3SQ 2ATWA 1N33Q 2NYZD 4OIKA 3EVQA 1SE2A 3NQIA 4S3SA 3H6MA 3KJOA 1LUZA 2JA6H 3A8JE 1IHZA 3S2DH 1H9SB 5GAHC 4RKLA 1PH5A 4LFCL 3K6OA 4AQYQ 4IUPA 3GTQB 2K52A 4GN4B 1NSNS 2F0NA 1J4WA 1U0LA 4OO1I 3K0XA 1BKBA 5DNFA 3S1NB 1EIHA 1GUGA 4A3KB 2Q8RE 4DAYA 4KY7A 3T56B 3OTOQ 4HEDA 1P16A 4ID6A 2EYFA 5EKKA 1JJCB 5CBAE 1FD7D 3IRBA 2NVQB 2K1BA 4ZKCB 3G48A 5LL6X 4LFAQ 2LSSA 4YHHL 2K32A 3A0JA 4GLXA 4GNXA 3HOVB 1C8CA 1UWVA 1I94Q 4IURA 2R7FA 2A6HD 4KV6A 2JA6G 1F2LA 1XPRA 5E4XA 4BBRH 3HG9A 4R8NA 3RLFA 2N3SA 1CUKA 4A3BH 3RN5A 4GN5A 4LF9L 1I3QH 2OPVA 1B9NA 2A5HA 4B3MQ 2ENBA 1VQCA 4CJ0B 2O4XA 1N32Q 2UUBQ 1MSGA 2B2UC 4KHVA 4L5QA 4I65A 2UXBQ 5CMDA 2PW5A 4DAPA 2WB1E 3MFYA 3GV3A 2A1AA 1Z6HA 2JJQA 1EQQA 5D14A 4AYBE 4DR4Q 1HNWL 1ICWA 1FNVA 2JVZA 4HIKA 1K73C 3KDFB 3VA7A 1QILA 4BBRG 4UDUC 2RSNA 4JI1Q 4LF6Q 4Q5VA 1J5KA 3N52A 1FVIA 3I4LA 3BZDB 3J7AF 2HIXA 4YCWA 2WKCA 5E1FA 3S1NH 4A3KH 1VQ9A 1LTGD 1MKHA 3VR3A 1S4ZA 3OW2A 3S14H 1PFMA 3T1HQ 2PZWA 4PZ8A 2NVQH 3I4MB 4P74A 5FO9B 3DM1A 4EGVA 1GM5A 1Y8PB 2ZXPA 1TWHH 4DV6Q 1Y1VB 1G291 2K5WA 2A74C 1JWUD 3SHLA 4X62Q 4CKEA 1HPCA 2LS01 3ONAB 4JI6L 2F0VA 2L4NA 2O5JC 2O2LD 2X6LA 3NE5B 1MGSA 1QVFA 5C4XG 1CM9A 3KBXA 1XTDA 3RR5A 4A3KG 3OMGA 3OWEB 3EBEA 4NP5A 1HA6A 4A3FB 2CWPA 3D4DA 2HHHQ 5EPJA 3J7AV 2F0UA 4RHRA 5I6YA 1I4XA 4L5SA 2CTEA 3SK6A 4FNFA 4K5WA 1SN8A 1EYCA 2D62A 2MGSA 3PV0A 4DFAA 2FINB 1JOOA 4JI8Q 3NENA 1JORA 1EY4A 4MNOA 1RF2D 1PTOF 3Q23A 1U4RA 4GKJL 4JV5Q 4DUZQ 1YJWA 1RTNA 2OWOA 4LF5L 2K14A 5K36H 2B2YC 1HZBA 2GA4B 3CCQA 1QZGA 3M4YA 5HGQA 3U9OA 3NQTA 3I4MH 2E76C 4DV3Q 1AN8A 4NKLA 3VR6A 2MFIA 2ZJPA 4HAEA 3J81E 1SNDA 3HOYH 2NTSA 3IFTA 3KDFA 2Q8IB 4DXFA 3NTIA 3PMFA 2Z4HA 1X4MA 2E2HB 4KN7C 3F2DA 1TWFH 2CTMA 3ULPA 4IO9A 3HOZB 3UDXA 4OGQC 1TWCB 1XNQQ 5M9OA 1LYLA 3LWUA 2F0HA 1LT3D 2B2VA 3BYTB 2B2WA 2BE5C 1X3EA 5K36G 3K5LA 1A3VA 1M8AA 2CCZA 4B3TL 3MXNB 1OXVA 1IXRA 1BDOA 3CC7A 1E0BA 2KEDA 3WWVA 2KOLA 1CKOA 2NVYB 4HTHA 1WE8A 2PI2A 3HOYG 2F0KA 1LTBD 4FP5D 5IT9E 2N8NA 3BDCA 1SLJA 3A7LA 3KBGA 2RDGA 2RBMA 3GTKH 1KNAA 3L2PA 3CQZH 4OXPA 1SNCA 2CHBD 1PFNA 5LMUQ 2QILA 2WAQG 3VR2A 3AEVB 5G3LD 1Q82C 2E3UA 3RMHA 3NHHA 4LNQA 4LF8Q 4P73A 4KJOA 4L5TA 1DYQA 3A8IE 4C2MB 1Q46A 5IOCA 4PV1C 2WB1G 2BA1A 1SYFA 3SR1A 4AYBG 1Y1WB 4B08A 1BBXC 3V69A 3FP9A 1HTLD 1HXYD 3HOXH 1RODA 3W2DA 2B8GA 4XQNA 5IWAL 2E2HH 1XNRQ 4NBQA 1H9RA 1FL0A 5COYA 1UNSA 4JI5Q 2JA9A 3J81L 4TQUS 5FKAC 5DLQE 3RZDH 4A3EG 3K80C 1IL2A 3UE0A 4DV5L 3T51B 2VB2X 2EXDA 1CHPD 1LACA 4F8MA 4RH6A 1EZ8A 1XYIA 1VQOA 1KL9A 4DF7A 1R9TH 2K5DA 3RUZA 4K6DA 1J9OA 2NVYH 3U4ZA 4QGUA 3UI2A 2IHEA 1LTRD 1WD0A 4I7ZC 2L55A 3HOXG 2K75A 2K5HA 3TZDA 2DN8A 4O42A 4RGNA 3IAYA 4C1NK 1HZ9A 1NTGA 1FGBD 4K0KQ 5JJZA 3FKIG 2DNEA 4KY5A 5J1ZA 3NP8A 1I6HH 1EOVA 3PSIA 3PUYA 5KNDA 4IUNA 1PH1A 1JR0D 1SBBB 1SYGA 1XMOL 5M5WB 2ZM6Q 3MXNA 5EQ0A 4YWLA 5JVG3 2F4VQ 2ZXRA 1PRTD 3JAME 2JQOA 4X66L 3GDEA 4WALA 5BN4A 1P8LA 1B1ZA 1QVCA 4YY3Q 3TN2A 1CSQA 1Y69U 1AEXA 4H02A 5LMNQ 2I0QA 4Y52H 3KLSX 3Q8DA 1ZKOA 5ELBA 4DV0Q 1YNXA 2UXDQ 1STYA 4HJ5A 1SR3A 4CKCA 3PO2B 3KF8B 4F7XA 3HKSA 2XIWA 1MIUA 4JI0L 4ZUJA 5H1SE 4IQZA 4OL7A 2PZUA 3CU7A 2K6AA 3I73A 5C4ZA 2JA8B 3RD4A 3QJYA 1Z7TA 4DR5Q 1HNXQ 3BVZA 1BQQT 1E24A 1TXYA 3DHQA 4A3LH 4BBSG 2EYLA 4LW1A 4FXKC 1ASYA 2DNCA 2B63B 4U68A 1L1OC 2EZVA 1WCMB 3GTGB 4FXGC 1D5XC 1WOCA 1KAWA 4X65Q 3PIO3 2EOTA 2FFKB 4G7HC 1HR0W 5JJKA 2JK8A 4X64Q 4RG1A 1HNZL 1G51A 1EFWA 2D0PA 2KHJA 2PQAB 3NPPA 4O2DA 1RL2A 1TKWB 1HQRD 1CI3M 2CQAA 1PZKD 1WTOA 3CMEA 4A3LG 1DJRD 3J80E 2OCEA 4OO1G 4NW2A 2PQEA 1HZAA 4LUOA 2XWBB 3JAML 2GN5A 5IYCH 5KGUA 4CHTB 5A2QL 2DY8A 1L0WA 1W2BA 4JC0A 1V43A 1B9MA 3MZ5A 2YTYA 2RQXA 2E2JB 4ZQ3A 1UAPA 4B9WA 4ZK9B 1XJVA 1X55A 3K59A 2NVXH 3PO3H 2K50A 4JI3Q 1TT2A 4DK3C 1GD7A 1N36Q 1TUAA 2JA8H 2MHVA 1N34Q 3KFUA 1BCPD 3T13A 5JPNC 1WYDA 1EY7A 4JYAQ 5D3IB 2VUMG 1E7ZA 4KLKA 2VY3A 4BY7H 5M5XH 2A6ED 1HCZA 4JOIC 1B7YB 3M85A 4MTNA 5E7NA 3TP8A 5IYCG 3C1EA 1VCIA 4K2LA 1ZTGA 1YEZA 3URYA 2HH3A 1CA5A 2A68D 5DM63 2IY5B 3AMUA 4WORA 2EY1A 2L11A 2F0DA 3NBHB 3CCVA 3PO3G 1C48A 1PH4A 2HH2A 2E74C 3F2BA 4IUUA 3A5ZB 3FHWA 2F03A 4PZ6A 1EY9A 2UUCQ 4BY7G 4H0LC 4IOAA 2GVBA 1ZYRD 3S1QB 1I4GA 2WINB 1EIYB 2KA7A 5I9PA 3K7AB 3UDFA 2ANRA 2Q8TA 1EL0A 2LY7A 4IPDA 2VQEL 2LKVA 3SXHA 2AQ2B 2KHSA 3TEHB 5IGFA 1STEA 1HZCA 4KJNA 2PQAA 5LMNW 2QKIC 1X56A 2JZXA 3PF4A 4QQBX 3ERQA 3C3LA 1DOMA 5FO8B 2KUMA 3HKZE 2PMZB 1WTRA 3CRKC 4HSVA 4QCLA 1VQ4A 3U58A 3AYHB 2LMCB 1BVSA 2B29A 2I5HA 3CCSA 3P1HA 4DU9A 1K83B 2KCMA 1HUNA 2ID0A 3FDTA 3M4QA 3OYYA 2BH2A 2JE6I 2OQKA 5IYDH 3WOEA 1Z47A 5IIFA 4JBWA 4GNXB 5J3BA 2B2VC 3HOUH 1GOZA 3A5UA 2Q2IA 4DV2L 1AE2A 1SJED 4DNRB 3TP6A 2K5QA 4DR3L 1AZQA 5JVH3 1WTXA 4FXDA 1G6PA 2RHSB 1CZGA 1QOHA 4R4QA 4A93B 2RCNA 1BO0A 5I4DA 3U9SA 4DR1Q 2NZ1D 2F0WA 1QZHA 1JB3A 4DAMA 1F2ZA 4FDBA 1X32A 1UE6A 1L0XB 2R3ZA 1K8OA 3GTMB 2E8GA 4X3KA 2ZTCA 4A3JH 3C2PA 3NWTA 1TWGB 3K7AH 4TKOB 5BN5A 5EKIA 2Z4IA 3VYRA 5IYDG 2H1EA 4LF4Q 1FJGQ 1J8IA 4J15A 3HOUG 2N78A 4IPHA 2CWAA 1C9OA 3H15A 3MFGA 3PUXA 4JI2Q 4NB3A 4ILWA 3A74A 4TRDA 2MJ8A 2L15A 1QWYA 5M3MH 3R2IA 4Y7NB 1I4RA 3V2TA 2DUDA 1ILPA 1YJNA 2EE1A 3D6CA 3DM3A 3ICEA 2PY9A 5GAEC 1AH9A 1PH3A