5C0XG

Structure of a 12-subunit nuclear exosome complex bound to structured rna
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
237
structure length
237
Chain Sequence
MSTFIFPGDSFPVDPTTPVKLGPGIYCDPNTQEIRPVNTGVLHVSAKGKSGVQTAYIDYSSKRYIPSVNDFVIGVIIGTFSDSYKVSLQNFSSSVSLSYMAFPNASKKNRPTLQVGDLVYARVCTAEKELEAEIECFDSTTGRDAGFGILEDGMIIDVNLNFARQLLFNNDFPLLKVLAAHTKFEVAIGLNGKIWVKCEELSNTLACYRTIMECCQKNDTAAFKDIAKRQFKEILTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title RNA degradation paths in a 12-subunit nuclear exosome complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae s288c
molecule tags Hydrolase/rna
molecule keywords Exosome complex component RRP45
total genus 43
structure length 237
sequence length 237
ec nomenclature
pdb deposition date 2015-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF15985 KH_6 KH domain
G PF18311 Rrp40_N Exosome complex exonuclease Rrp40 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5c0xG01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5c0xG02
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 5c0xG03
2UUBQ 5LMNW 2I0QA 4LF4L 2DN8A 1QUQB 3KDFA 3M9BA 3KDFB 4IPCA 4DR4L 1D8LA 3I4OA 3OW2A 3HOYG 1RIPA 3L0OA 4DKAC 2KCTA 2O5JC 4BXXG 3E0EA 3G48A 4DR1L 1BDOA 4BBSH 1FL0A 4DR7L 1K3RA 5FLMG 4A75A 1KXLA 3L7ZC 1I50H 4NXNQ 1B9MA 3CCVA 2ZJPA 3NE5B 2DNCA 3UE0A 1Q1BA 2E8GA 1Q81C 1H9RA 4LF5Q 4HJ5A 3DM3A 2UUCL 1AE3A 4GKKL 1K8MA 4IFDG 1GUTA 5IYCG 5AJ3L 3KF6A 1O78A 3U4VA 1ASYA 4DV4Q 3I73A 4DR3Q 1XPRA 4DV4L 4DR3L 1HNXQ 1HNXL 1T9HA 4JI2L 4H02A 2Q2HA 3J81j 3G71A 4JBMA 1JJCB 3HKZG 2ALYB 3E9IA 4LFCQ 5LMNL 3GTKH 2D0PA 3QG1A 1VQAA 2L15A 1E22A 1MJCA 3CF5A 4QL5A 3HOWH 1Y1VG 5IP9H 1DGSA 1VQNA 1EIFA 1KHIA 1SLJA 3WDNA 1W3SA 4IPHA 1IBLL 3CMAA 2JA8H 2NZHA 3CD6A 2CTEA 1YIJA 1I6VC 1FGUA 1HR0L 2PQAB 1QJOA 4G7HC 3UDFA 3A8KE 1FYCA 1GM5A 1S40A 3PO2G 1I5FA 1B9NA 2Q8IB 1PH3A 2JQOA 4DV0L 1IYUA 1VQOA 1MKHA 2F1MA 1K8OA 1X55A 3ULLA 4C3IH 1XMOL 2E5LQ 3A7AB 3QJYA 5M5YH 1DCZA 3JAMc 3GO5A 1XPOA 3NENA 1PH9A 4JYAQ 1AH9A 2NN6I 1BVSA 4OWXB 3U9SA 1H9JA 1V9PA 4AIMA 2EQSA 1KIXA 2EIFA 4LJZC 1CKOA 3EQLC 4FDBA 1YHQA 1B7YB 3A8JE 2R93H 3BZCA 4DAYB 4JI0L 4DV6L 4A3JG 1N33Q 1FVIA 1IW7C 2EXDA 2JA9A 2YTYA 3OPOA 4GNXA 4LF7L 2RHQB 3CAMA 2B29A 3TRZA 2E74C 2WB1G 2A19A 3FHWA 3CCEA 1PH1A 3PO3H 1JMCA 4DR6Q 3I4LA 3J81c 3RZDH 4JV5L 2VL6A 4KLKA 1Z6HA 4R4CA 2A8VA 3CC2A 3HOZG 2OPVA 2WB1E 4LF9L 1HR0Q 4YWLA 1UE6A 5LMUQ 2F3IA 1C0AA 3FKIH 1IW7D 1Q46A 1GUGA 5JEAG 1NMFA 1EOVA 1M90C 3PO2H 4GKJQ 1VIHA 5C44H 3HOUH 3S17H 1Z9FA 1YI2A 5E7NA 4B3RQ 4IFDJ 3M4QA 4Y7NH 4P74A 1N36Q 4QJFA 1O7LA 1G51A 1VIGA 3M4OH 3CQZH 4EX5A 1ZTGA 2A6EC 3PF4A 2XTIA 3BZKA 3S15H 1SMXA 4BBRG 2A6HC 1XTDA 4NPSA 4TKOB 3AB9A 5H1SE 2UXCQ 5C0XG 2JEBI 5BN5A 2JJQA 2OQKA 1LM0A 4GZYC 3H0GG 1KRTA 4P72A 3UE1A 3KJOA 1EFWA 3F2DA 4IFDH 1A6XA 2DGYA 1HPCA 2CFMA 1OXUA 3EIVA 5C0XJ 4A3KH 1IL2A 4HIMA 2PPBC 5IYCH 3S2HH 3TEHB 2PNHA 4BA1I 4ME3A 1YZ6A 4DR1Q 2VY3A 1N8RC 1VQ5A 4JBWA 4R4IA 2E2IH 1XJVA 1GUSA 4YCWA 4XTCS 4X65L 4LF9Q 4A93G 2CWAA 5JJIA 1Z7TA 4G7OC 2WFWA 3F8TA 4HJAA 3I56A 3IFTA 2R92G 4JVHA 3CPFA 3I4NH 2R7FA 1GVPA 2PQUA 4DR2L 3ULPA 4IJLA 2UXDL 2K52A 3OW7A 2KCMA 4B3TL 4LF6Q 1WCMH 4JI8Q 1IYJB 4OO1G 2NVTH 1HZCA 3F2CA 3HOVH 2MQHA 4OX9L 2HHHL 3BDOA 2YTXA 1BBWA 4UY8C 2R7ZG 4JOIA 1PH8A 3I4NG 3NBHB 1QVCA 4KI0A 1BBUA 2WAQG 1HZBA 1IBKL 2E2HH 1R9TH 1IBML 4DV1L 3FP9A 1VQKA 1XNQQ 4YCVA 4YY3Q 4OO1H 5GQOA 1W2BA 3CC4A 4NXML 2JA6G 3WWVA 4C3HH 1A62A 1SROA 2PI2A 1PA6A 4A93H 2ZT9C 1KRSA 2HH2A 4OGQC 2A6HD 4JI6Q 5FLXc 1YBYA 4X64Q 5C4XH 3OTOQ 4LF8Q 3PUYA 1WFQA 1SE8A 4RCNA 1SFOH 3KJPA 1Q7YC 4QGUA 4DV0Q 1E7ZA 2KENA 1UE1A 3IKJA 5FJ8G 4LF6L 1DTJA 4OO1I 4A4IA 1I6HH 2IT1A 3OOCA 2ID0A 4JC0A 4JI2Q 3JAMi 2V1CC 5BN3A 2YV5A 1EYGA 2JXMB 2PMZE 1Y8NB 4JCVE 3RLOA 4JI4Q 5C0XH 4YWKA 1FJGQ 2LXJA 2HQLA 1GKHA 3RNUA 4JI7Q 2K50A 1YNNC 1TUAA 2QF7A 3ER0A 3GDEA 3IRBA 2QA4A 4JK1C 1Z47A 3GQBA 3U50C 2IX1A 1EWIA 3NEMA 3HGBA 1VQDA 3DLLA 1E2VA 4A76A 3H94A 5IP7H 1H95A 3MFYA 4YY3L 3S2DH 4X66L 4POGA 2QEXA 2LXKA 2YTVA 3S1MH 4KKUA 3T51B 3STBC 1VQJA 1U0LA 4X62L 1B70B 4LUVA 4A3MH 1YHBA 4C2MH 2OTLA 1WOCA 4X64L 3OTOL 3CCUA 4L5TA 4R4OA 2MJHA 2L5TA 4AQYQ 2PY9A 4GKJL 2BDOA 4APVA 4DAMA 4Y52H 2KHJA 2RHSB 3CXCA 1M1KC 4LUOA 1S3OA 5FJ8H 1Q90A 3L2PA 4TQUS 2HT1A 3AFQA 2IHFA 1VQ6A 4IOAA 4BY7H 4G7ZC 1VQ4A 1K9MC 4DR4Q 1HQMC 1VQFA 4A3JH 1Q12A 4GLVB 4MNOA 3FPPA 2A1AA 1BKBA 2Y0SE 4A3EG 1SR3A 1XMQQ 3VR3A 1V1QA 4DR7Q 4KMUC 4LIJA 2E3UA 2IX0A 4JBJA 5JEAJ 1X6OA 3F2BA 2C35B 1VQIA 1L2FA 1N34Q 1EQRA 1EIYB 4UP8A 3I72A 3I7FA 5IWAQ 1CTMA 3DXJC 1HCZA 4DUYL 4GKKQ 2E2JH 3M4YA 5JJLA 1B8AA 3CCMA 3W5OA 2CTFA 3UDIA 1VQLA 3HOXH 3TS0A 2ZM6Q 2JZXA 2PCFB 5KNDA 3CMEA 1ZZIA 2YYZA 1Y1VH 5IP9G 2JA8G 1KHMA 4JI8L 1VDZA 3MEFA 1U5KA 3D31A 2AMCB 1A0IA 1H9KA 3M4PA 1WI5A 1X54A 5GAEC 4IJHA 5AJ3Q 3J80i 1CUKA 3U1KA 2A69D 2OCEA 4GLAC 2KHIA 4DNIA 5M3MH 1CSPA 2Q2IA 3A5UA 2UU9L 4QQBX 5C4XG 1GD7A 4GNXB 4KN7C 2K5VA 1KC8C 4R4QA 3KF6B 2QGQA 1GO3E 4DV2L 1JJ2A 1A63A 2UU9Q 2KA7A 2N78A 5IE8A 5C4JH 3AFPA 1UE5A 3S1RH 2UUAL 4OWWB 4A3CH 2BH2A 3W1BA 3GTQH 5JJKA 4KKSA 4L8JA 2KCCA 2GVAA 3M3YH 2EJGC 1J6QA 1VQBA 1HTPA 4HJ7A 1K73C 3PIPA 1I3QH 4QMFB 3K0XA 1Y1WH 1LYLA 1OXSC 4KN4C 1Y14B 3V69A 4DUZL 3TS2A 2BL5A 1XMOQ 1YITA 3HOVG 1DT4A 2JEAI 2RCNA 1OXVA 3J7ZC 2K32A 5ELOA 4BXXH 1WCMG 4O2DA 4HIDA 1OXXK 1J4WA 1S72A 2JVZA 4WANA 2E75C 5IYDH 3A5ZB 2B3GA 2R6GA 5HY6A 3KF8B 4LK1C 3GTPH 2GVBA 4H44C 2GN5A 2NVYH 1LABA 3K8AA 3NELA 3A74A 3RR5A 5M5WH 3BG3A 1MIUA 2HIVA 4R1JA 5C3EH 4IQZA 3CPWA 5LMNQ 4BY1G 4JBKA 4WALA 3P20A 4GN3B 2D2CC 4X66Q 3PCOB 4DV5L 4MTNA 4GOPB 3PF5A 1PH7A 3H0GH 2BH8A 5IY0A 4OWTB 1IBLQ 2LMCB 4DV3L 3H3VI 5KNCA 3H15A 3K7UC 4KKTA 1T5EA 3PUVA 2A68C 4OONA 1YJ9A 1PH5A 1YEZA 3PSIA 1EQQA 3RN2A 5IT9c 2V4DA 1SRUA 2K33A 4X62Q 4YHHQ 2PI2E 5K36H 4RG1A 4DV7Q 3S1NH 4UP9A 4HJ9A 2FXQA 2I5HA 1E1TA 3ULJA 2UXBL 1GUNA 2JA5G 2ZTEA 3VKEA 3LWUA 3G6EA 4JI5L 5GAGC 1EC6A 1XPUA 2JK8A 2OTJA 1XMQL 4DK1A 4PG3A 1PHJA 4JI7L 3PUWA 1GHJA 1E24A 1RL2A 3KLWA 4O0AA 4DV6Q 3A8IE 1QZGA 1Q8KA 1XNRL 1UWVA 2WP8J 5HGQA 2K7VA 4A3BG 4NB3A 2VUMG 4WJ4A 3LNNA 3B6YA 4QIWE 1N34L 2R93G 4BY1H 1E3PA 3VR5A 4P71A 4L5QA 2A6ED 2CW0C 5M3MG 3TQYA 3K81C 1SN8A 4A3IG 5BN4A 1TXYA 1Q82C 2CCZA 3GTLH 4GS3A 4MZ9A 4PZ8A 2CTJA 4GOPA 1HZ9A 4UPAA 3G4SA 1I94L 2CTKA 5ELNA 1I94Q 3PUXA 3TZUA 2K4KA 1TWHH 2B63G 1L0WA 3GD7A 1VQCA 5IYDG 2B8FA 1PH6A 3U4ZA 1HNZL 4L5SA 2ASBA 3VA7A 3I4MH 3CCSA 3K7AH 3RLNA 2VQFL 4GN4B 1KAWA 2VQFQ 3SE0A 1HH2P 1L1OA 5C0XI 1YHAA 2ZTCA 2EJFC 2Z6KA 2UXCL 3J80c 2OPUA 2XGTA 2ZJRA 1C9OA 2ANNA 2UUAQ 3ERSX 1G291 1WJJA 2CWPA 1JE5A 4IPGA 1NE3A 4P75A 4JYAL 5A35A 2A69C 1EUJA 5IYBH 1JB7A 2R92H 3OYYA 2I5MX 1ASZA 4LUZA 1Y8PB 3RLFA 3LGJA 3CCQA 2IY5B 3SDZA 1J5KA 1JJGA 4LWCA 5GROA 4B3RL 1Y69U 4IPDA 3HOXG 4JI6L 2OQ0A 4L5RC 3U58A 5FLMH 4HIKA 1CI3M 3CW2C 2VW9A 1VQPA 2ATWA 2VNUD 3N6RA 2O5IC 4A3MG 2YU9H 3GTGH 1VF7A 1CKNB 2NN6H 3JC66 2CQOA 4UP7A 1VQEA 4DK3C 1PV4A 4GLXA 1VQ8A 1VS0A 2N8NA 4KHPQ 3CCRA 5K36G 1KQSA 3ICEA 3W3AA 4JI3Q 1UE7A 4R4TA 2VQEL 4LFCL 2HHHQ 4B3SQ 2JA5H 3ND8A 5KNBA 4J15A 5IP7G 4DV5Q 2JA7G 2PQAA 5GADC 4NXMQ 1H9SB 4IO9A 2D0OA 2AUKA 3SGIA 2CKZB 5M5XH 1IBMQ 1Q1EA 1WE8A 2F52A 2N3SA 4DR5L 1K8AC 1K8GA 1YVCA 2BE5C 1HNWL 3HOWG 1NTGA 3PV0A 3GTJH 4AH6A 3VDYA 1WYDA 2IHEA 3A0JA 3HKZE 3T1HL 4RMFA 1X65A 1PMRA 3K80C 4A3EH 1N33L 5M3FG 2CTMA 1DD2A 2EDGA 1ONLA 1ZYRC 3KLRA 4GNXC 2K5NA 1E2ZA 3T1YL 3EBEA 1Y8OB 1VCIA 1GHKA 2LSSA 2VUMH 4JV5Q 2Z0SA 1VQ9A 3S1QH 4HR7B 1X4NA 2DGRA 3RN5A 3F1ZA 5LMUL 2OWOA 2CTLA 1DXMA 2DNEA 2FMRA 3AEVB 3AEVA 1Q86C 1ZKOA 4A3KG 1V43A 1PYSB 3BU2A 3E9HA 1HJPA 2NVXH 3RZOH 4X6AH 4AYBG 2Y0SG 4LFAQ 1VQMA 1N32L 4DR2Q 2UXDQ 2AXYA 1H9SA 4H13C 4BBSG 2R7ZH 1QUQA 3KOJA 1EWHA 1CKMA 2PNRC 2Z6KC 4HIOA 1J5EL 4A3GH 2AWOA 4YWMA 1OTCA 2QNDA 4GN5A 3T56B 2NZOA 1PH2A 4HJ8A 3I55A 2AUJD 4K0KL 1D7QA 3D4RA 1PH4A 4A3CG 5J3BA 2MNAA 5C44G 4LF4Q 3HOUG 2UXBQ 1A8VA 4GOPC 5JEAH 1VQGA 2NN6G 3J7A5 4XIGS 3FKIG 3Q8DA 3J81i 4DV1Q 1XNQL 4A3LG 3EN2A 4A3FG 2UUBL 1NY4A 5EAYA 4PZ6A 1HNZQ 1CFMA 4WJ3M 4JG2A 4NXNL 2CPQA 1UEBA 4EQ5A 1CSQA 4PMWA 1V8QA 4LFBQ 1G6PA 3MXUA 3HFZB 1CKNA 3D0FA 4DPGA 5GAHC 1TWGH 3GTOH 2VZAA 2JA6H 4IOCA 1IXRA 4B3TQ 1VF5C 3FMCA 3UDXA 1NJIC 2F4VQ 1TKWB 4A3GG 1Y1WG 3H3VH 2HH3A 1K1GA 1E1OA 1PYBA 1E2WA 1NMGA 5IWAL 3PGZA 3HOYH 4DK6C 2R7DA 4DNTB 2A68D 4PV1C 2RF4A 4I7ZC 1IZ6A 1X3EA 1HR0W 1ZZJA 1VQ7A 1TWCH 2MO0A 2BE5D 3I4MG 4IFDI 4DUZQ 3PIOA 2BA1A 3BJUA 1IBKQ 2UUCQ 2AWNA 2EVBA 3CCJA 2B63H 1OXTA 2EJMA 2BA0A 1N9WA 1PFSA 2MFIA 2YQRA 1QVGA 2AHOB 5DLQE 2E76C 4JI3L 1H9MA 4OX9Q 1YNXA 4A3LH 1L1OB 4BY7G 2DUDA 5C3EG 3UDGA 2Q2TA 1X9NA 1P8LA 4KHPL 1FR3A 3W1GA 4C3JH 4POFA 4LFBL 4AM3A 2D62A 1K0RA 5M3FH 1O7IA 4OXPA 3AQQA 2I5LX 4TVAB 2VQEQ 4AQYL 1YJWA 1YJNA 1MJEA 4LF8L 4A3DH 3I2ZA 4B3SL 3A7LA 4DV7L 3CP0A 2VS1A 3VR4A 4JI1L 2E5LL 1N36L 4JI1Q 1C7YA 4B3ML 4B3MQ 2F4VL 3S16H 1P16A 4JOIC 1LACA 4LW1A 2Q2UA 1FJGL 1ZZKA 3ZJYC 2ANRA 2N49A 4BBRH 4LF7Q 1L1OC 2KBNA 3STBD 3CRKC 2H5XA 3HKSA 4YCUA 3MXNB 4QY7A 3T1HQ 4JI0Q 4A3BH 2P2RA 1SMYC 4DNRB 1XNRQ 3PUZA 1KD1C 1LUZA 1NBWA 4AYBE 3QIAA 3TREA 1QVFA 1HNWQ 1PVOA 4BA2I 1X3GA 3T1YQ 4JI4L 4DK0A 3M85A 4JI5Q 3KFUA 1X3FA 4KHZA 4DUYQ 1GUOA 2D5DA 3VR2A 1AE2A 2AKWB 3CC7A 2JA7H 3M7NA 4B8TA 2K75A 3S24A 3CRLC 2ZTDA 1KL9A 4LFAL 4NBQA 1VQHA 4X65Q 4DR6L 2JE6I 2ZM6L 4JVYA 2K5HA 4A3FH 4A3DG 1J5EQ 4DR5Q 1TWFH 4LF5L 3S14H 1HZAA 1LTLA 4A3IH 3AYHB 1IYVA 1X56A 4H0LC 2MO1A 2B8GA 1K83H 4DV3Q 3HOZH 1YNJC 1N32Q 3KYHC 3PO3G 4K0KQ 3T53B 1X4MA 3ND9A 5BR8Q 1GJXA 4P73A 1TU2B 5BR8L 3GTMH 3VR6A 2NVQH 1QZHA 2K14A 4YHHL 5IYBG 1WVNA 4DV2Q 2ES2A 2WAQE 2ZJQA 4LNQA 1JT8A 1TWAH 4PZ7A 4ALPA 3CCLA 2HIXA
chains in the Genus database with same CATH superfamily
5LMNW 3KDFA 2H1EA 2NVXB 3R2IA 1RIPA 2F0GA 4LF6H 3GTKB 1KXLA 4R9WA 4NXNQ 2B2UA 3CCVA 3I3CA 1DYQA 2LF0A 1HNZH 1UUPA 1H9RA 2CHBD 5J1ZA 1X3QA 4PQXA 4LF9H 2NVYB 1QE6A 3KF6A 1HNXQ 4X3TA 4B8CD 3S16B 4DR3L 2M8WA 1T9HA 5I2XA 1I4QA 2B2YA 4H02A 4BBRB 5KYLA 2KECA 2ALYB 2F0JA 3E9IA 1KDBA 2KCNA 4RGNA 5IP9H 2KQ3A 1VQNA 1SLJA 3WDNA 2X69A 1YIJA 1HR0L 4DUZH 3A8KE 1RTOA 1UAPA 1S40A 1I5FA 4C3IH 1K83B 5I2YA 1XMOL 5I6WA 1JR0D 2E5LQ 1XPOA 3JAMc 1DCZA 1ICFB 1AH9A 4QUCA 2QKIC 2LTLA 2EQSA 2NZ1D 2L9HA 2L11A 3BZCA 5IGCA 3NWSA 1ET9A 1N33Q 4LFBH 3PIP3 2CPMA 4Y7NB 4CDEC 4K8JA 4LF7L 3TRZA 2E74C 4HEDA 5LL6S 4ZLTF 3CCEA 1B2TA 5C6AA 2R61A 3J81c 1SNDA 5KGUA 1QWYA 3T1HH 1LTTD 3I8ZA 1WTQA 4LF9L 1HR0Q 1UE6A 1C0AA 2BOSA 1NMFA 3L3OC 3HOUH 1ZYRD 1YI2A 2A1SA 5DNFA 4C3IG 4B08A 4QJFA 4QIWB 4OELB 2C9OA 1ZTGA 2ICEC 5TSSA 2F0LA 3AB9A 1WTJA 2UXCQ 3BZDB 3FPUB 4C3HB 2JEBI 4XXEA 4GZYC 4DV3H 1EQTA 3S2HB 2PW7A 1MSGA 4IFDH 2DGYA 2CFMA 1OXUA 5IYCH 2PNHA 4BA1I 4I7AA 4BY7G 2ANNA 2VY3A 4IURA 4LF9Q 2CTMA 1XJVA 1GUSA 4LF7H 5ELBA 4DR3H 4OHJA 1AW7A 3S15B 3F8TA 4HJAA 3MTSA 4JVHA 1GVPA 2PQUA 2PZWA 1CK1A 1AN7A 3IL8A 4JI8Q 1IYJB 1TS2A 1HZCA 3F2CA 2MQHA 2HQEA 2YTXA 1BBWA 3GABA 4M8AA 3LX0A 3I4NG 5JPMC 3NBHB 1QVCA 1VQKA 1RHPA 4OO1H 5GQOA 3WWVA 1PA6A 3DEOA 1I6UA 1A3VA 2HH2A 2L4NA 1YNJD 3KJPA 5C4XB 3OIQA 5FJ8G 4OO1I 1UNSA 5E1FA 4JI2Q 2V1CC 2YV5A 3NBHA 1KLGD 5CGKA 4JI7Q 2K50A 1YNNC 2QF7A 3IRBA 1AEXA 2QA4A 3U50C 3GQBA 2PYKA 3HOUB 4DR6L 1HA6A 1E2VA 1EEFD 3H94A 3VA5A 3WOEA 1I4HA 3MFYA 3S2DH 4POGA 2QEXA 4FP5D 2LY7A 1U0LA 3F2UA 1B70B 4A3MH 1YHBA 1WOCA 5C3EB 1V1PA 4KHPH 2ENBA 1UEAB 2RHSB 4RA8A 4A3KB 3V05A 1M1KC 1PYWD 2CH4W 2HT1A 4IOAA 2IHFA 3ITPA 2F3WA 1VQ4A 1SSOA 4NXMH 1JOKA 4KJOA 4LIJA 3Q6SA 1X6OA 3DM1A 1LTRD 2C35B 1EIYB 1EQRA 3S17B 4LMQD 3A54A 5IWAQ 1TWCB 3I90A 2E2JH 3GKUA 4JV5H 4A93B 1VQLA 2JZXA 4ZCKA 3CMEA 2L12A 3OWFA 1D5XC 5IGBA 1U5KA 1A0IA 4C2MB 5AJ3Q 3U1KA 4DNIA 3A5UA 4QQBX 1HUMA 2QGQA 1BNZA 4JI8H 1GO3E 4DV2L 4B9WA 3K5NA 1A63A 2KA7A 3E3XA 5COYA 4L8JA 2B39A 3K57A 1HFNA 2GVAA 3M3YH 4DN4M 4JI4H 4QUFA 3K0XA 1Y1WH 3V69A 4DF7A 1OXVA 1J4WA 1OXXK 1S72A 2JVZA 1W6KA 2B3GA 3GTPH 1I3QB 2GN5A 3NELA 3RR5A 2UUCL 3A74A 1MIUA 4R1JA 2K5DA 4JBKA 1K0SA 4X66Q 4GOPB 3H0GH 2BH8A 5IY0A 3H3VI 2LMCB 1U9RA 5EPLA 2F0OA 5KNCA 3H15A 1T5EA 1FNUA 3PUVA 1YEZA 2PMZB 3PSIA 3SK5A 2K33A 4YHHQ 4A3BB 4RG1A 3S1NH 4UP9A 2I5HA 1E1TA 2UXBL 1GUNA 2ZTEA 3SB1A 4JI5L 3NQIA 3HKZB 1B3QA 2OTJA 3HS0C 1PHJA 1RL2A 3KLWA 3R8BA 4FF1A 1QZGA 1SYDA 1XNRL 1TS5A 2WP8J 4NB3A 1SXTA 4WJ4A 3LNNA 1N34L 4O1NA 1E0BA 4ILWA 1E3PA 5NUCA 4L5QA 4RH6A 2MHVA 3FRPB 4PMCA 3TQYA 3K81C 1SN8A 1TXYA 1SBBB 2XVSA 3MHBA 4NZTM 4PZ8A 2F0TA 3KLSA 3G4SA 1I94L 4X3KA 2CTKA 1STGA 1L0WA 1VQCA 1HNZL 2NVTB 3U4ZA 4YIJA 5FO9B 3PQIA 3SE0A 2EYHA 1HH2P 2K1BA 1C9OA 2UUAQ 1G291 1WJJA 3RMHA 2A69C 5IYBH 2R92H 3OYYA 1ASZA 4LUZA 3CCQA 5FOBB 2UUCH 5K5PA 1RCVD 5GROA 1GOZA 2EY2A 1QCBD 1Y69U 3HOXG 2PZUA 3U58A 5FLMH 5FLXW 1PRTC 1VQPA 2ATWA 3DWPA 1CKNB 3JC66 1EOTA 2ZQEA 4UP7A 4KHPQ 1AP0A 1VQ8A 2Z1CA 2RVLA 2J7ZA 4HCEA 1G91A 3VYSA 2HHHQ 4B3SQ 3ND8A 5KNBA 4DV5Q 2WV6D 4YHHH 2D0OA 3SGIA 1IBMQ 1VMPA 1X0AA 2BE5C 1EYDA 3S9WA 5LMNH 3HKZE 1T5XD 1W6JA 2O4XA 1PMRA 2CWFA 5M3FG 1ONLA 2X06A 3KLRA 2K5NA 4A3EB 1E2ZA 1Y8OB 1GHKA 2H4OA 1PRTB 1BQQT 1PLFA 3T4AC 2Z0SA 1QB5D 4JV5Q 3HOVB 4HR7B 3D8GA 1X4NA 3G7LA 3F1ZA 2OWOA 2DNEA 1B50A 2D9IA 4A3DB 2L0CA 4X6AH 1YNND 1VQMA 1N32L 4ODGA 2AXYA 2HCIA 1H9SA 1CM9A 3NSWA 4H13C 2R7ZH 1QUQA 3KOJA 4JI5H 1Q8IA 2CWHA 1OTCA 4H8AA 5J3BA 1SYEA 4LF4Q 1A8VA 5JEAH 3DUZA 2SEBD 3KDKA 4ZK9B 1NY4A 3BDCA 1HNZQ 1UEBA 3D6CA 3J80E 4PMWA 1V8QA 1B53A 1G6PA 5GAHC 2JA6H 1ET6A 4B3TQ 4G08A 4DXFA 1TKWB 3D3RA 3H3VH 1E2WA 1NMGA 3HOYH 3W2DA 1G2TA 4C56C 2A68D 1AZPA 3BYYB 3LWEA 3VYTA 4RGTA 1VQ7A 4XYOA 5KIXA 3CCJA 1OXTA 2BA0A 4DV7H 1PFNA 2B2WA 4KHPL 3D6WA 5JJZA 3MA2B 1XYIA 4POFA 5LL6X 1CQVA 2RDHA 4A3DH 4B3SL 1QNUA 3A7LA 2E5LL 1UG8A 4B3ML 1PRTD 1C7YA 4JOIC 2K28A 4LW1A 3ZJYC 2N49A 2KBNA 3OMGA 2HD3A 2TMPA 3MXNB 4YY3H 4DNRB 3PUZA 2A73B 2B2TA 1KD1C 1NBWA 3TREA 1QVFA 1MSHA 2F0KA 1EY6A 4JI4L 4IN3A 2D5DA 3CC7A 3VR2A 3HOXB 4B8TA 1SNOA 4LFAL 2HDLA 4A3FH 2K1HA 1KDCA 1TWFH 4DR5Q 4LF5L 4A3IH 1N32Q 1IYVA 4H0LC 3O13A 3PO3G 1GJXA 4P73A 3RD4A 2WB1B 1C8CA 4DR1H 5IYBG 5C5LA 4DV2Q 2ES2A 3GTQB 1JT8A 2UUBQ 4LF4L 3S1NB 4IPCA 3I4OA 3PMFA 3CKIB 3L0OA 2KCTA 1NAPA 5EBDA 4BXXG 4XYQA 2R92B 2EYOA 3KBGA 1R9TB 2DNCA 3UE0A 4LF5Q 4HJ5A 5DEHA 3DM3A 4GKKL 1K8MA 4K5VA 1GUTA 4OIJA 3U4VA 4DR3Q 2MUYA 4DV4L 4NW2A 1V1OA 1JICA 3NK9A 3J81j 1PVOA 3HKZG 3GTKH 2D0PA 2L15A 4MHEA 3CF5A 1E22A 4QL5A 3HP3A 1Y1VG 1SYFA 3K6OA 5CV9A 4CBVA 1EIFA 1W3SA 2RKSA 2NZHA 3C46A 1I6VC 1FGUA 2PQAB 3UDFA 1FYCA 4ZYSA 3AU7A 4JVZA 2E2IB 1VQOA 3ULLA 5KRUA 3A7AB 3NENA 1NXUA 3S14B 1BVSA 2NN6I 4OWXB 1V9PA 4RAUC 1KIXA 4FDBA 5LL6b 5C4ZA 4A3JG 1FVIA 2MJ8A 2EXDA 2RSNA 3OPOA 3QD7X 3NCVA 2G9DA 4N8X1 4DR6Q 2VL6A 4A3IB 3M7GA 4CDDC 5LMUQ 3SR1A 3FKIH 3J7AK 4RKBA 3PO2H 5JEAG 4GKJQ 1EOVA 1TY0A 1ILPA 5C44H 2VUMB 3S17H 1Z9FA 2K04A 4IFDJ 1AZQA 3EZJA 2Z6BA 2EOTA 3K59A 1G51A 1O7LA 1SE3A 4DXGA 1TVXA 4IUUA 4EX5A 2A6EC 4X3UA 3QB3A 1I4RA 2MGSA 5FO7B 2FMMA 3DWQA 2Z4HA 5ELCA 5IIFA 5C0XG 2OQKA 3H0GG 2JJQA 5BN5A 1KRTA 2UU9Q 1G8ZD 1LV9A 3EIVA 3TSSA 2IX3A 4A3KH 1S5FD 2NBFA 5C0XJ 1IL2A 1U4RA 4QB4A 5J39A 1VQ5A 3GTGH 4JBWA 4R4IA 4A93G 4YCWA 4XTCS 1U4PA 4X65L 1HNXH 2CWAA 2WFWA 2R92G 3I56A 3IFTA 4BY1B 1LLRD 2R7FA 1R4PB 3IAYA 5IT9E 1WCMH 4RGMA 2RCFA 1MD2D 2K03A 3HOVH 4OX9L 2HHHL 2NVQB 4JOIA 3SK8A 1JOQA 4KI0A 1BBUA 2ZXRA 1HZBA 3V2TA 1R9TH 1IBML 1BO0A 4YCVA 3T13A 2NB0A 4A3GB 5BR8H 1HNWH 4HMIA 1YBYA 3OTOQ 4PNYA 4LF8Q 1SE8A 1SFOH 4HN7A 1E7ZA 4RKLA 2QILA 1DTJA 4WALA 3JAMi 4JC0A 3RUZA 1WHRA 3GP7A 3RLOA 4X66H 5C0XH 3FKIB 3TP7A 2JA8B 2MPMA 1V9NA 2IX1A 1EWIA 3HGBA 1HQRD 4A76A 1H95A 4X66L 2LXKA 3T51B 3STBC 1VQJA 3CCUA 3OTOL 4AYBB 2L5TA 4GKJL 4APVA 4DAMA 4Y52H 1A3UA 5LMUH 5I6YA 4PMBA 1WD1A 1Q90A 4TQUS 1K28A 1TWAB 4H7BA 4OCHA 2K5WA 5EKLA 1K9MC 5E4WC 3GTGB 3H6MA 4DR4Q 3RF2A 1A2TA 4QCLA 3FPPA 1NUCA 2A1AA 2Y0SE 1SR3A 3VR3A 4DR7Q 4KMUC 2LKVA 3F2BA 1L2FA 1N34Q 1D5ZC 4UP8A 3DXJC 4L63B 1SDFA 3CCMA 3EVQA 1D1IA 3UDIA 2PCFB 3N52A 5KNDA 5IP9G 1KHMA 2XWBB 1BBXC 1F2LA 1WI5A 1X54A 5LHY1 1OO9B 3J80i 1CUKA 2OCEA 2F0EA 4GLAC 4C3HG 4NBQA 1TT2A 1GD7A 1KC8C 3KF6B 4X64H 1EEID 3K5OA 1JJ2A 2I07B 5C4JH 2UUAL 4A3CH 4C3IB 2BH2A 3GTQH 1J6QA 2EJGC 1EZ6A 1K73C 3PIPA 5CV4A 5ISRA 1X9ZA 1G2SA 3QOJA 4DUZL 3TS2A 2BL5A 1HR0H 3HOVG 1FGBD 4KY7A 5ELOA 4B3SH 3BDLA 5IYDH 3A55A 4KY5A 3KF8B 4K2LA 3MXGA 4LK1C 2GVBA 4H44C 2NVYH 1BR9A 1LABA 2FFKB 3K8AA 3CQZB 2HIVA 3BG3A 3CPWA 5LMNQ 5C3WA 1CHQD 3NHHA 4DV5L 3E5SA 5CV6A 1IKMA 4O42A 4JW0A 4KKTA 4CDCC 1YJ9A 1PH5A 1IBKH 5EPKA 1SRUA 5K36H 4K5XA 4CKEA 3SXHA 2JA5G 3LWUA 3KLSX 4N9TA 1F0XA 5IWAH 3NXWA 4DK1A 1E24A 2JA5B 3A8IE 2JP1A 4CKCA 3VR5A 4FF4A 1J9OA 3SVMA 4CKBA 1XTCD 2CCZA 3GTLH 1PFBA 2CTJA 4MZ9A 3R2TA 4UPAA 4DUYH 3PUXA 1STHA 2K4KA 1TWHH 2B63G 3GD7A 2KEEA 3CHBD 5IYDG 3BYTB 3RLNA 1KAWA 2VQFQ 1IL8A 1LO5D 3KUPA 3VYUA 1J5EH 1L1OA 5C0XI 2ZTCA 2EJFC 2Z6KA 3HZXA 1WD0A 1FJGH 4K14A 5A35A 2FINB 2N55A 2I5MX 3LGJA 2IY5B 1I50B 3SDZA 5CV5A 3MFGA 1PTOF 1JWUD 4IPDA 4JI6L 1TQOA 4HIKA 1CI3M 1RJTA 2JYOA 3CW2C 2O5IC 4M1UB 1IKLA 2YU9H 1VF7A 4OIKA 3NP8A 2NN6H 3U9OA 1HNWL 1PV4A 4GLXA 3J7AF 2N8NA 4WORA 1JE4A 5ELFA 3ICEA 1UE7A 4R4TA 3MZ5A 5IP7G 1LT3D 1L0XB 1JORA 3K0YA 5M9OA 4IO9A 1Q1EA 3J81L 1ESRA 4OX9H 3HOYB 3PV0A 2F03A 3A0JA 1V8CA 4RMFA 1N33L 4NXNH 4GNXC 3EBEA 2LSSA 1VCIA 2VUMH 4Q0FA 4LF5H 1VQ9A 4DGZA 4X62H 3AEVA 1Q86C 2HDMA 3BU2A 1PXUA 1HJPA 5FLXL 1RF2D 4AYBG 4LFAQ 4ABNA 3GTMB 4B9XA 1SFOB 1CKMA 2PNRC 5D3IB 4YWMA 2ICIA 4CJ1B 4GN5A 3SHLA 4ULLA 1PH2A 5EPJA 1LTSD 4CGYB 2E2HB 3D4RA 3NTIA 4BWGB 1PH4A 4A3CG 4WFN3 2QDLA 5IGFA 1VQGA 2NN6G 4GOPC 3FKIG 3Q8DA 2UUBL 4QMGA 1A2UA 1KABA 4WJ3M 2K5QA 3VYRA 1QOHA 1CSQA 5AFWA 3HFZB 1BOSA 3D0FA 2FFMA 2VZAA 1PZKD 3UDXA 1PTOD 4RFBA 4RHRA 4A3GG 4DK6C 4DNTB 3BS1A 1IZ6A 1X3EA 2L1BA 4XQJA 2F0PA 1FD7D 1TR5A 4IUVA 3DEPA 2EVBA 5D3DA 1DOLA 1PFSA 1N9WA 1HA5A 3EA6A 1H9MA 5G3LD 2DUDA 3ONAB 5C3EG 4Z9CB 4C3JH 1G6ZA 1O7IA 4TVAB 3RZOB 4DV6H 2FJ2A 1EWCA 4DV7L 1SNQA 2VB2X 1F2ZA 3CP0A 2RDGA 3VR4A 1SYCA 5T1IA 3S16H 2Q2UA 4K5WA 4FYDA 3STBD 2H5XA 4YCUA 3H0GB 4I65A 3G6JB 2B2VC 4DR2H 4ZRZA 2PT7G 2UXDH 4BA2I 1X3GA 2ZXOA 4C1NK 5DM73 1X3FA 1GUOA 1AE2A 1U4LA 2F0MA 1WVLA 3M7NA 3URYA 2ZTDA 2X6LA 3CRLC 2CQAA 3Q23A 1RDPD 2WKCA 4KHVA 3J7YW 2JE6I 2Z9HA 3S14H 2F0UA 1QNKA 2F4IA 2UU9H 4DV1H 4DV3Q 2VXWA 3KYHC 3I4NB 1X4MA 3GV3A 4C1NI 4FXDA 5A2QW 2NVQH 1QZHA 3K5LA 1WVNA 2ZJQA 2WAQE 1TWAH 1TIID 2BCOA 4DV0H 2HIXA 2I0QA 2F0HA 1SNPA 1QUQB 4B3TH 1FNVA 3HOYG 1A3TA 4DKAC 1KNEA 2RBMA 3G48A 1SE4A 5FLMG 1I50H 2ZJPA 3NE5B 4EQOA 1S5DD 1Q1BA 2E8GA 4QF4A 1Q81C 1S20A 2SDFA 4RCOA 3SK4A 1AE3A 3S1RB 2FMRA 5AJ3L 4F87A 1O78A 4A93H 1ASYA 1I4PA 4DV4Q 3QR8A 4JI2L 1MGSA 1Y1VB 3E6ZX 1JWSD 4KTAA 4LFCQ 5LMNL 3QG1A 4GKKH 1WTVA 4CDFC 3TZDA 1KHIA 4IPHA 2JA8H 2CTEA 5I9PA 4F88A 1QJOA 4G7HC 1RKNA 1GM5A 3NWTA 1WTOA 1B9NA 2UXBH 2Q8IB 1PH3A 2JQOA 1XMQH 1B4OA 1X55A 1K8OA 2D9UA 3P75A 5M5YH 3GO5A 1KNAA 2EIFA 4LJZC 2VQEH 1YHQA 1B7YB 4FJUA 1EQVA 2R93H 2B63B 2YTYA 1PFMA 2ZXPA 4GNXA 4B3MH 4LF8H 2RHQB 3KF8A 2WB1G 3FHWA 3PO3H 1DOMA 4R4CA 4WJWA 2A8VA 3PO3B 2OPVA 2WB1E 2B2UC 1X3PA 2KUMA 4YWLA 3PIO3 2F3IA 4V190 3ERQA 4E6IA 3J80L 1GUGA 1M90C 1VIHA 2RSOA 1X32A 2A74C 2Y3MA 5E7NA 2Q8TA 4MTKA 1RTNA 4DR4H 4Y7NH 1VMCA 1N36Q 4RHSA 2CW0D 3CQZH 2KOLA 3QO2A 2XTIA 3BZKA 3QWNA 4BBRG 1XTDA 3KDGA 3A56A 5H1SE 1N32H 4P72A 3UE1A 1HPCA 4XQQA 4HIMA 2PPBC 1YZ6A 5A2QL 4DR1Q 4NXMQ 3M4OB 1Z7TA 4KD3A 3CPFA 3EROA 3GTOB 4DA2A 3ULPA 4IJLA 3OW7A 4LF6Q 2K05A 3IFDA 4KY6A 1CZGA 4UY8C 2R7ZG 3S1MB 2WAQG 1IBKL 3FP9A 4NXML 1I4GA 1SROA 4C3HH 4EQPA 2FMCA 3T1YH 1WTWA 4OGQC 4DU9A 4X64Q 5C4XH 4OL7A 1WFQA 1Z2IA 2IWHA 4J6HA 2YU9B 1PTOH 1SEBD 4LF6L 4A4IA 2UXBQ 2IT1A 2ID0A 1EYGA 4TRDA 5EKIA 4DR5H 2JXMB 1Y8NB 2QW7A 4F7XA 1FJGQ 3GR5A 5J22A 3RNUA 1D2BA 1DOKA 5IGGA 3ER0A 4JK1C 1Z47A 3NEMA 1VQDA 1A15A 2KEDA 1TWGB 3SK6A 2FPHX 3S1MH 4KKUA 2F0DA 2SOBA 3NTHA 4C2MH 2WINB 5M5XB 4X64L 2NTSA 2JA6B 2PY9A 1TWHB 4LUOA 1S3OA 4IZ8A 5FJ8H 1LTGD 3KK7A 3L2PA 5C5MA 1VQ6A 4G7ZC 1HQMC 2KJXA 1VQFA 1Q12A 2PW5A 4GLVB 4J1MA 5FLXE 4A3EG 5EQ0A 3WOFA 5I9OA 3GTJB 2E3UA 2IX0A 4DAVA 5M3FB 1VQIA 4P2CB 1LTID 3I72A 1CTMA 4DUYL 3M4YA 4G4KA 1B8AA 1M4VA 4TSSA 3HOXH 2OT2A 2NUCA 1ZZIA 2JA8G 1Y1VH 1ILQA 3D31A 1EFID 2AMCB 1QILA 3M4PA 4IJHA 2A69D 2P5ZX 2KHIA 5M3MH 1CSPA 2Q2IA 4GNXB 1HTLD 4R4QA 3S2DB 3OTOH 3L9AX 5C4HA 2EY6A 1QG7A 3D4WA 2N78A 4OEMB 4OWWB 2Z8LA 5JJKA 2Y0SB 4KKSA 2B2VA 2KCCA 4XT1B 1STNA 3MAQA 2VQFH 4QMFB 1HTPA 5CR3A 4LF4H 4DR6H 1XXGA 2F0VA 4KN4C 1Y14B 4R8NA 2G9HD 2EYFA 3BVZA 5IGEA 1BXTA 1XMOQ 1YITA 4BXXH 2RCNA 2YQRA 2K32A 4HIDA 4O2DA 1DM0B 1MBYA 4DV5H 5DAUA 2E75C 2PQEA 2XNAC 1BCPD 2R6GA 5HY6A 1EIHA 1EZ8A 1KLUD 5M5WH 4BY1G 4GN3B 2D2CC 1PH7A 3PCOB 4MTNA 1F2YA 1NCVA 1IBLQ 4XQNA 2EYPA 4DV3L 3D4DA 2Z4IA 3E0JA 4BBSB 4OONA 3PO2B 3RN2A 5IT9c 1KAAA 2L55A 2PI2E 3ZYYX 4BS9A 3T16A 5M5WB 1ENAA 2FXQA 2WKDA 4A3MB 1B3AA 3G6EA 4KV6A 4MIUA 1DJRD 4ZAIA 4U673 4PG3A 1XMQL 4JI7L 3PUWA 4O0AA 4DV6Q 1Q8KA 4PDBA 5HGQA 2K7VA 4A3BG 2VUMG 3B6YA 4K6LA 1S5BD 5E4XA 3JAML 4BY1H 1PTOB 4P71A 2A6ED 2CW0C 4A3IG 4FF2A 1PRTF 1Q82C 4JI7H 1EYAA 3NQTA 4GS3A 1HZ9A 4ME5A 4A3JB 2DJFC 3TZUA 1EYCA 1HUNA 2B8FA 4L5SA 3I4MH 3DWAA 2VQFL 4GN4B 1YHAA 5HURA 4KK7A 3J80c 2XGTA 2ZJRA 2XWJB 4IPGA 1NE3A 4P75A 4FXGC 1EU4A 3Q24A 5IT9L 1JB7A 2R93B 4CJ2C 1FKAH 2C5CA 4DV2H 1BUVT 1JJGA 4FXKC 1J5KA 5IT9W 4L5RC 2F3VA 3C3LA 1GUWA 4ZQ3A 4KJNA 5A2QE 1F77A 3EFXD 2CVRA 1NSNS 1XWEA 1VQEA 4Q5VA 5K36G 1XMOH 5C4JB 5CYUA 2JA5H 5C3XA 4J15A 1ODHA 1H9SB 5M5XH 3J7AV 1WE8A 3MXPA 1SNMA 2EY1A 4DR5L 1K8AC 1YVCA 3HOWG 1NTGA 1PZJD 3M3YB 1AN8A 2TSSA 1WYDA 4AH6A 3VDYA 1KTKA 1EU3A 1IBLH 4EGVA 2EDGA 3FEWX 1ZYRC 4EQNA 3T1YL 1WCMB 1CA5A 3S1QH 2ZM6H 1SYBA 3DMUA 1K3BC 5LMUL 3AEVB 4XDXA 1ZKOA 4A3KG 4KD4A 4K2KA 2G5DA 4JI0H 2B2WC 2NVXH 4K0KH 2AQ2B 2F0WA 2Q8RE 3TP6A 2K01A 1EWHA 2EXZA 2M2LA 2QNDA 2K6AA 2B2TC 3T56B 3JAME 2NZOA 2EYLA 4HJ8A 3I55A 4DAYA 1B44D 1O7ZA 2MNAA 3HOUG 2UUAH 2RDFA 3Q22A 1I6HB 3J81i 5EBCA 4A3LG 1F9PA 3EN2A 1ESFA 1CFMA 3SEBA 4JG2A 2CPQA 3MXUA 1CKNA 1TWFB 1SMYD 3GTOH 1ML0D 4IOCA 1IXRA 1VBIA 1VF5C 1NJIC 2HH3A 1K1GA 1Y1WG 4IUQA 4DFAA 1E1OA 2R7DA 1CQFA 2RF4A 4PV1C 4I7ZC 1ZZJA 2XRQD 3I4MG 2LFNA 2UUCQ 3BJUA 2AWNA 1N36H 4LAAA 1JOOA 1JQYD 2EJMA 2MFIA 1HHVA 1QVGA 4MN3A 1I4XA 2E76C 4JI3L 4OX9Q 2PO4A 4A3LH 2E5LH 1U4MA 3UDGA 1X9NA 1XRHA 2E2DC 4AM3A 1WTRA 2D62A 4OXPA 3AQQA 4LF8L 1ENCA 1AFPA 3HOWB 3I2ZA 2VS1A 4JI1Q 1SJED 1P16A 2ANRA 1EIGA 1IBMH 4OD6A 1XNRQ 2EE1A 3HRZC 1MI2A 2DJGC 3QIAA 3T1YQ 4DK0A 2NYZD 3M85A 4XT3B 1NNXA 4JI5Q 1SAPA 4DUYQ 1M8AA 2AKWB 3TBIB 1KL9A 4JPBW 4X65Q 2K5HA 4A3DG 1J5EQ 3QOLA 2CH4A 4NP5A 1XNQH 1X56A 2MO1A 4R8IA 1K83H 2B8GA 1YNJC 3GV6A 5EJWA 5CV8A 4ZUJA 2NWGA 3ND9A 4K0KQ 4LFAH 1TU2B 5BR8L 2I46A 3GTMH 5JPNC 1F9QA 3C2PA 4LNQA 3MVVA 2DN8A 4DR4L 3M9BA 3KDFB 1D8LA 3NUCA 3OW2A 3J80W 2O5JC 3E0EA 4DR1L 1BDOA 4BBSH 1FL0A 4DR7L 1K3RA 4A75A 3L7ZC 1B9MA 3NPPA 4UDUC 1XX8A 3KBXA 4HSVA 1ZXTA 2DY7A 1JC7A 2SNSA 5IYCG 4IFDG 3MWYW 3I73A 1XPRA 1HNXL 3OSOA 3CU7A 2Q2HA 3TP8A 3I91A 4JBMA 3G71A 1JJCB 4AQYH 3HOWH 1VQAA 1MJCA 1DGSA 1EY9A 4ZKCB 3J81W 4IUPA 1IBLL 3CD6A 3J81E 3CMAA 2G8YA 3FVQA 1ENFA 3MEHA 2AQ1B 3PO2G 4BBSG 4DV0L 1IYUA 2RA4A 1MKHA 2F1MA 3HOZB 4B3RL 3DHQA 2P2RA 3QJYA 2F0QA 1PH9A 2J4XA 4JYAQ 2XIWA 4IUNA 3U9SA 1H9JA 2PZTA 3C1EA 4AIMA 5M5YB 1Q3LA 3JAMW 1CKOA 3EQLC 3OMCA 3A8JE 1J8IA 4N9PA 4DAYB 1PDQA 1RD9D 4DV6L 4JI0L 3FAUA 1IW7C 2JA9A 1ZEQX 2O2LD 4X65H 4JI1H 1F9SA 3CAMA 1C48A 2B29A 2A19A 1PH1A 1JMCA 3I4LA 3RZDH 4JV5L 4KLKA 5DM63 1CHPD 1Z6HA 3CC2A 3HOZG 2J0TD 1WTHA 1IW7D 1Q46A 4L6TB 1WTPA 1HRJA 1BCPF 4B3RQ 3M4QA 4P74A 2M00A 2NTTA 2M9VA 3M4OH 4J8QA 3PF4A 3S15H 1SMXA 2A6HC 4NPSA 3I70A 4TKOB 4ZUIA 5CBEE 2EZVA 1LM0A 3KJOA 1EFWA 2MP1A 1EY4A 3F2DA 1A6XA 4FJSA 2WACA 3S2HH 1JCKB 3TEHB 4ME3A 1N8RC 2E2IH 1S4ZA 2EPBA 5JJIA 4DV4H 2WIIB 4G7OC 3I4NH 1XNRH 1EY7A 4DR2L 2UXDL 2O4CA 2K52A 1SNCA 2KCMA 2BDNA 4B3TL 2NVTH 4OO1G 1L0YB 3S1QB 4ZKBB 3BDOA 1B1ZA 1PH8A 4WRDA 2E2HH 4DV1L 1XNQQ 1STYA 4YY3Q 3OETA 1W2BA 2VKCA 1BCPC 3CC4A 2JA6G 1R4QB 5CC4A 1A62A 2PI2A 3K5MA 1KRSA 2ZT9C 2A6HD 4DAPA 5FLXc 4JI6Q 4NKLA 3TMEA 3PUYA 1Q7YC 4RCNA 3R93A 1KDAA 4QGUA 2KENA 4DV0Q 1UE1A 3IKJA 1I6HH 3OOCA 4A3FB 5BN3A 2PMZE 4JCVE 3NBIA 4JI4Q 1O7YA 4S3SA 4YWKA 3I0PA 4N8FA 2LXJA 2HQLA 1GKHA 4JYAH 3BVMA 1TUAA 3GDEA 2QCPX 4F8MA 2R3ZA 5C44B 1VIGA 3DLLA 3C1FA 3H09A 2QEJC 1SYGA 1V1PB 3H3VC 1I94H 5IP7H 4YY3L 2XRSD 5E3FA 2YTVA 4X62L 4LUVA 2OTLA 5G3LF 1JWMD 4L5TA 4R4OA 3K58A 4AQYQ 2MJHA 2BDOA 1D6EC 2KHJA 3CXCA 2X6GA 3AFQA 3I4MB 3P7JA 4BY7H 2R7ZB 4A3JH 1S5ED 2VB3X 3X3NA 4MNOA 1XMQQ 1BKBA 1V1QA 2SNMA 1Y1WB 4JBJA 5JEAJ 2IW3A 1ICWA 3I7FA 4FF3A 1HCZA 4GKKQ 2HCCA 5I4DA 5JJLA 1STBA 2HHHH 3W5OA 2CTFA 2JA7B 3TS0A 2ZM6Q 2YYZA 5FKAC 5D14A 4JI8L 1VDZA 3MEFA 3TDQA 3X3MA 3Q0AA 4K6DA 1H9KA 1CZWA 5GAEC 4EC5A 2UU9L 1EY5A 5C4XG 4KN7C 2K5VA 1IHZA 2LTMA 1D1KA 3S1RH 5IE8A 3AFPA 1UE5A 3W1BA 1FNWA 4IUTA 1VQBA 4HJ7A 1I3QH 5F2DA 2UXCH 1LYLA 1OXSC 1EY0A 4CJ0B 1DT4A 2JEAI 3J7ZC 1WCMG 4WANA 1LTBD 3A5ZB 4UAIA 2IJ0A 5C3EH 2QDBA 4JI2H 5CMDA 4IQZA 1CA6A 3P20A 3PF5A 4X3SA 1S03G 4OWTB 5M3MB 4G57A 3K7UC 4BY7B 2A68C 1EQQA 4IALA 1S5CD 5DT9A 2V4DA 2IPKD 4X62Q 4HSPA 4DV7Q 4DR7H 4HJ9A 3ULJA 5HGTA 3VKEA 1PZID 5GAGC 1SJHD 4NZRM 4NMZA 1EC6A 5ELEA 2JK8A 1WTXA 1XPUA 1DONA 5CBAE 1GHJA 2EYMA 2OXPA 4JI6H 2JSOA 3OIPA 1UWVA 5CV7A 2EY5A 2KHSA 4QIWE 2R93G 5CORA 2LRRA 2LS01 5M3MG 5L37A 5BN4A 1STEA 1N34H 5KYIA 1SEIA 4GOPA 5ELNA 1I94Q 3K7AB 5T1GA 1PH6A 2ASBA 3VA7A 3CCSA 3K7AH 4HAEA 2DY8A 2UXCL 2F4VH 2OPUA 3UI2A 3ERSX 1LTAD 2CWPA 3RZDB 1JE5A 3H91A 4FNFA 2M6QA 4JYAL 1EUJA 2F0SA 2A5HA 5JVG3 1Y8PB 3RLFA 5JOBA 4LWCA 2UUBH 4ID6A 2OQ0A 2B2YC 1EL0A 1F9RA 2KVMA 3EJIA 5IOCA 2VW9A 3OHXC 2VNUD 4EVOA 3N6RA 4A3MG 2CQOA 2AQ3B 4DK3C 2RQXA 4E9JA 1VS0A 3CCRA 1LT4D 1KQSA 3W3AA 3HEJA 4JI3Q 5IGDA 2VQEL 1TS4A 4LFCL 3V96A 2JA7G 2PQAA 5GADC 5IODA 4HTHA 2AUKA 3UOEA 2CKZB 3OSSD 2F52A 2N3SA 1K8GA 1LT5D 1MHWC 3GTJH 2IHEA 3T1HL 1X65A 3K80C 4A3EH 1RODA 1DD2A 2OF1A 3MC0B 1TY2A 1PTOC 1HXYD 3BVGA 1MSZA 5JAVA 2DGRA 4NDXA 5JVH3 5KEEA 3RN5A 2CTLA 1DXMA 1BCPB 3HG9A 3FDTA 1PYSB 1V43A 3GTPB 1D5MC 3E9HA 3RZOH 2Y0SG 1BF4A 1PQXA 3R3OA 4HCSA 4DR2Q 2UXDQ 4C3JB 1J5EL 2XSCA 4HIOA 2Z6KC 4A3GH 2AWOA 3TP5A 1GXDC 2AUJD 4K0KL 1D7QA 5C44G 3J7A5 4XIGS 5ELDA 4DV1Q 1XNQL 4GKJH 4A3FG 2OEOA 5EAYA 1LT6D 4PZ6A 4NXNL 4RGOS 1CT1D 4EQ5A 1F2MA 4LFBQ 1N33H 4DPGA 1TWGH 2F0IA 1NR2A 3FMCA 5FK9C 2F4VQ 4LFCH 5IWAL 1PYBA 5FO8B 2EYJA 3PGZA 1HFGA 2F0NA 3MXNA 1HR0W 1TWCH 2MO0A 2E2JB 2BE5D 4V0BA 4IFDI 4DUZQ 3PIOA 2BA1A 2XN9C 4U68A 1IBKQ 4B3RH 2HUGA 4HMJA 2B63H 4FVMA 5EGTA 1C4QA 2AHOB 5DLQE 1YNXA 1L1OB 2Q2TA 1P8LA 4UHVA 1TS3A 1FR3A 3GTLB 1DZ1A 3W1GA 1O80A 3NTKA 4LFBL 1K0RA 5M3FH 1YJNA 1MJEA 1JB3A 2I5LX 2VQEQ 4AQYL 1YJWA 4K8IA 4JI3H 2GA4B 1SE2A 4JI1L 4CHTB 1N36L 4B3MQ 2F4VL 1EY8A 1II3A 1ZZKA 1LACA 1FJGL 1NR4A 4BBRH 4LF7Q 1L1OC 3CRKC 3HKSA 3T1HQ 4A3BH 4JI0Q 4QY7A 1SMYC 1LUZA 4AYBE 1HNWQ 3KFUA 2F0FA 4KHZA 2JA7H 5EKKA 2IL8A 2K75A 3S24A 4C3JG 1VQHA 3P1HA 2ZM6L 4JVYA 1HZAA 1LTLA 5D65A 3AYHB 4FO2A 2WAQB 3HOZH 2JN4A 3T53B 5BR8Q 3AMUA 2N88A 4RWSC 3VR6A 2FHTA 2K14A 3TN2A 4YHHL 1STAA 4PZ7A 3OWEB 4ALPA 3CCLA
chains in the Genus database with same CATH topology
5LMNW 3KDFA 2H1EA 2NVXB 3R2IA 1RIPA 2F0GA 3GTKB 1KXLA 4R9WA 4NXNQ 2B2UA 3CCVA 3I3CA 1DYQA 1UUPA 1H9RA 2CHBD 5J1ZA 1X3QA 4PQXA 2NVYB 1QE6A 3KF6A 1HNXQ 4X3TA 3S16B 4DR3L 5I2XA 1T9HA 1I4QA 2B2YA 4H02A 4BBRB 5KYLA 2KECA 2ALYB 2F0JA 3E9IA 1KDBA 2KCNA 4RGNA 5IP9H 2KQ3A 1VQNA 1SLJA 3WDNA 2X69A 1YIJA 1HR0L 3A8KE 1RTOA 1UAPA 1S40A 1I5FA 4C3IH 1K83B 5I2YA 1XMOL 5I6WA 1JR0D 2E5LQ 1XPOA 3JAMc 1DCZA 1AH9A 4QUCA 2QKIC 2NZ1D 2EQSA 2L9HA 2L11A 5IGCA 3BZCA 3NWSA 1ET9A 1N33Q 3PIP3 4Y7NB 4LF7L 4K8JA 3TRZA 2E74C 4HEDA 5LL6S 4ZLTF 3CCEA 1B2TA 5C6AA 2R61A 3J81c 1SNDA 5KGUA 1QWYA 1LTTD 3I8ZA 1WTQA 4LF9L 1HR0Q 1UE6A 1C0AA 2BOSA 1NMFA 3L3OC 3HOUH 1ZYRD 1YI2A 5DNFA 4C3IG 4B08A 4QIWB 4QJFA 2C9OA 1ZTGA 2ICEC 5TSSA 2F0LA 3AB9A 2UXCQ 3BZDB 3FPUB 4C3HB 2JEBI 4XXEA 4GZYC 1EQTA 3S2HB 2PW7A 1MSGA 4IFDH 2DGYA 2CFMA 1OXUA 5IYCH 2PNHA 4BA1I 4BY7G 2ANNA 4IURA 2VY3A 4LF9Q 2CTMA 1XJVA 1GUSA 5ELBA 4OHJA 1AW7A 3S15B 3F8TA 4HJAA 3MTSA 4JVHA 1GVPA 2PQUA 2PZWA 1CK1A 3IL8A 4JI8Q 1IYJB 1TS2A 1HZCA 3F2CA 2MQHA 2HQEA 2YTXA 1BBWA 4M8AA 3LX0A 3I4NG 5JPMC 3NBHB 1QVCA 1VQKA 1RHPA 4OO1H 5GQOA 3WWVA 1PA6A 3DEOA 1A3VA 2HH2A 2L4NA 1YNJD 3KJPA 5C4XB 3OIQA 5FJ8G 4OO1I 1UNSA 5E1FA 4JI2Q 2V1CC 2YV5A 3NBHA 1KLGD 5CGKA 4JI7Q 2K50A 1YNNC 2QF7A 3HOUB 1AEXA 3IRBA 1HA6A 3GQBA 2PYKA 3U50C 2QA4A 4DR6L 1E2VA 1EEFD 3H94A 3VA5A 3WOEA 1I4HA 3MFYA 3S2DH 4POGA 2QEXA 4FP5D 2LY7A 1U0LA 3F2UA 1B70B 4A3MH 1YHBA 1WOCA 5C3EB 1V1PA 2ENBA 1UEAB 4A3KB 4RA8A 2RHSB 3V05A 1M1KC 1PYWD 2HT1A 4IOAA 2IHFA 3ITPA 2F3WA 1VQ4A 1SSOA 1JOKA 4KJOA 4LIJA 3Q6SA 1X6OA 3DM1A 1LTRD 2C35B 3S17B 1EQRA 1EIYB 4LMQD 3A54A 5IWAQ 1TWCB 3I90A 2E2JH 4A93B 1VQLA 2JZXA 3CMEA 2L12A 3OWFA 1D5XC 5IGBA 1U5KA 1A0IA 4C2MB 5AJ3Q 3U1KA 4DNIA 3A5UA 4QQBX 1HUMA 1BNZA 2QGQA 1GO3E 4DV2L 4B9WA 3K5NA 1A63A 2KA7A 5COYA 4L8JA 2B39A 3K57A 1HFNA 2GVAA 3M3YH 4DN4M 4QUFA 3K0XA 1Y1WH 3V69A 4DF7A 1OXVA 1J4WA 1OXXK 1S72A 2JVZA 1W6KA 2B3GA 3GTPH 1I3QB 2GN5A 3NELA 3RR5A 2UUCL 3A74A 1MIUA 4R1JA 2K5DA 4JBKA 4X66Q 4GOPB 3H0GH 2BH8A 5IY0A 3H3VI 2LMCB 5KNCA 1U9RA 2F0OA 5EPLA 3H15A 1T5EA 1FNUA 3PUVA 1YEZA 2PMZB 3PSIA 3SK5A 2K33A 4YHHQ 4A3BB 4RG1A 3S1NH 4UP9A 2I5HA 1E1TA 2UXBL 1GUNA 2ZTEA 4JI5L 3NQIA 3HKZB 2OTJA 3HS0C 1PHJA 1RL2A 3KLWA 3R8BA 4FF1A 1QZGA 1SYDA 1XNRL 1TS5A 2WP8J 4NB3A 1SXTA 4WJ4A 3LNNA 1N34L 4O1NA 1E0BA 4ILWA 1E3PA 5NUCA 4RH6A 4L5QA 2MHVA 3FRPB 4PMCA 3TQYA 3K81C 1SN8A 1TXYA 1SBBB 2XVSA 3MHBA 4PZ8A 2F0TA 3KLSA 3G4SA 1I94L 4X3KA 2CTKA 1STGA 1L0WA 2NVTB 1VQCA 1HNZL 3U4ZA 4YIJA 5FO9B 3SE0A 2EYHA 1HH2P 2K1BA 1C9OA 2UUAQ 1G291 1WJJA 3RMHA 2A69C 5IYBH 2R92H 3OYYA 1ASZA 4LUZA 3CCQA 5FOBB 5K5PA 1RCVD 5GROA 1GOZA 2EY2A 1QCBD 1Y69U 3HOXG 2PZUA 3U58A 5FLMH 1PRTC 1VQPA 2ATWA 3DWPA 1CKNB 3JC66 1EOTA 4UP7A 1AP0A 4KHPQ 1VQ8A 2Z1CA 2RVLA 2J7ZA 4HCEA 1G91A 3VYSA 2HHHQ 4B3SQ 3ND8A 5KNBA 4DV5Q 2WV6D 2D0OA 3SGIA 1IBMQ 1VMPA 2BE5C 1EYDA 3S9WA 3HKZE 1T5XD 1W6JA 2O4XA 1PMRA 5M3FG 1ONLA 3KLRA 4A3EB 2K5NA 1E2ZA 1Y8OB 1GHKA 2H4OA 1PRTB 1BQQT 1PLFA 3T4AC 2Z0SA 1QB5D 4JV5Q 3HOVB 4HR7B 3D8GA 1X4NA 3G7LA 3F1ZA 2OWOA 2DNEA 1B50A 4A3DB 2L0CA 4X6AH 1YNND 1VQMA 1N32L 4ODGA 2AXYA 2HCIA 1H9SA 1CM9A 3NSWA 4H13C 2R7ZH 1QUQA 3KOJA 1Q8IA 1OTCA 5J3BA 1SYEA 4LF4Q 1A8VA 5JEAH 3DUZA 2SEBD 4ZK9B 1NY4A 3BDCA 1HNZQ 1UEBA 3D6CA 3J80E 4PMWA 1V8QA 1B53A 1G6PA 5GAHC 2JA6H 1ET6A 4B3TQ 4DXFA 1TKWB 3D3RA 3H3VH 1E2WA 1NMGA 3HOYH 3W2DA 1G2TA 4C56C 2A68D 1AZPA 3BYYB 3LWEA 3VYTA 4RGTA 1VQ7A 4XYOA 5KIXA 3CCJA 1OXTA 2BA0A 1PFNA 2B2WA 4KHPL 3D6WA 5JJZA 3MA2B 1XYIA 4POFA 5LL6X 1CQVA 2RDHA 4A3DH 4B3SL 1QNUA 3A7LA 2E5LL 4B3ML 1PRTD 1C7YA 4JOIC 2K28A 4LW1A 3ZJYC 2N49A 2KBNA 3OMGA 3MXNB 2TMPA 4DNRB 3PUZA 2A73B 2B2TA 1KD1C 1NBWA 3TREA 1QVFA 1MSHA 2F0KA 1EY6A 4JI4L 4IN3A 2D5DA 3HOXB 3VR2A 3CC7A 4B8TA 1SNOA 4LFAL 2HDLA 4A3FH 1KDCA 1TWFH 4DR5Q 4LF5L 4A3IH 1IYVA 1N32Q 4H0LC 3O13A 3PO3G 1GJXA 4P73A 3RD4A 2WB1B 1C8CA 5IYBG 5C5LA 4DV2Q 2ES2A 3GTQB 1JT8A 2UUBQ 4LF4L 3S1NB 4IPCA 3I4OA 3PMFA 3CKIB 3L0OA 2KCTA 1NAPA 5EBDA 4BXXG 4XYQA 2R92B 2EYOA 3KBGA 1R9TB 2DNCA 3UE0A 4LF5Q 4HJ5A 5DEHA 3DM3A 4GKKL 1K8MA 4K5VA 1GUTA 4OIJA 3U4VA 4DR3Q 2MUYA 4DV4L 4NW2A 1V1OA 1JICA 3NK9A 3J81j 1PVOA 3HKZG 3GTKH 2D0PA 4MHEA 2L15A 3CF5A 1E22A 4QL5A 3HP3A 3K6OA 1SYFA 5CV9A 1Y1VG 4CBVA 1EIFA 2RKSA 1W3SA 3C46A 2NZHA 1I6VC 1FGUA 2PQAB 3UDFA 1FYCA 4ZYSA 3AU7A 2E2IB 1VQOA 5KRUA 3ULLA 3A7AB 3NENA 3S14B 2NN6I 1BVSA 4OWXB 1V9PA 4RAUC 1KIXA 4FDBA 5C4ZA 4A3JG 2MJ8A 2RSNA 1FVIA 2EXDA 3OPOA 2G9DA 4DR6Q 4A3IB 2VL6A 3M7GA 5LMUQ 3SR1A 3FKIH 4RKBA 3PO2H 5JEAG 4GKJQ 1TY0A 1EOVA 1ILPA 5C44H 2VUMB 3S17H 1Z9FA 2K04A 4IFDJ 1AZQA 2EOTA 3K59A 1O7LA 1SE3A 1G51A 4DXGA 1TVXA 4IUUA 4EX5A 2A6EC 4X3UA 3QB3A 1I4RA 2MGSA 5FO7B 2FMMA 3DWQA 2Z4HA 5ELCA 5C0XG 5IIFA 5BN5A 2OQKA 2JJQA 3H0GG 1KRTA 2UU9Q 1G8ZD 1LV9A 3EIVA 3TSSA 2IX3A 4A3KH 1S5FD 2NBFA 5C0XJ 1IL2A 1U4RA 4QB4A 5J39A 1VQ5A 3GTGH 4JBWA 4R4IA 4A93G 4YCWA 4XTCS 1U4PA 4X65L 2CWAA 2WFWA 2R92G 3I56A 3IFTA 4BY1B 1LLRD 2R7FA 1R4PB 3IAYA 5IT9E 1WCMH 4RGMA 1MD2D 2K03A 3HOVH 4OX9L 2HHHL 2NVQB 4JOIA 3SK8A 1JOQA 4KI0A 1BBUA 2ZXRA 1HZBA 3V2TA 1R9TH 1IBML 1BO0A 4YCVA 3T13A 2NB0A 4A3GB 4HMIA 1YBYA 3OTOQ 4PNYA 4LF8Q 1SE8A 1SFOH 4HN7A 4RKLA 1E7ZA 2QILA 1DTJA 4WALA 3JAMi 4JC0A 3RUZA 3GP7A 3RLOA 5C0XH 3FKIB 3TP7A 2JA8B 2MPMA 2IX1A 1EWIA 3HGBA 1HQRD 4A76A 1H95A 4X66L 2LXKA 3T51B 3STBC 1VQJA 3CCUA 3OTOL 4AYBB 2L5TA 4GKJL 4APVA 4DAMA 4Y52H 1A3UA 5I6YA 4PMBA 1WD1A 1Q90A 4TQUS 1TWAB 4H7BA 2K5WA 5EKLA 3GTGB 5E4WC 1K9MC 3H6MA 4DR4Q 1A2TA 4QCLA 3FPPA 1NUCA 2A1AA 2Y0SE 1SR3A 3VR3A 4DR7Q 4KMUC 2LKVA 3F2BA 1L2FA 1N34Q 1D5ZC 4UP8A 3DXJC 4L63B 1SDFA 3CCMA 3EVQA 1D1IA 3UDIA 2PCFB 3N52A 5KNDA 5IP9G 1KHMA 2XWBB 1BBXC 1F2LA 1WI5A 1X54A 5LHY1 1OO9B 3J80i 1CUKA 4C3HG 2F0EA 2OCEA 4GLAC 4NBQA 1TT2A 1GD7A 1KC8C 3KF6B 1EEID 3K5OA 1JJ2A 2I07B 5C4JH 2UUAL 4A3CH 4C3IB 2BH2A 3GTQH 2EJGC 1J6QA 1EZ6A 1K73C 3PIPA 5CV4A 5ISRA 1G2SA 3QOJA 4DUZL 3TS2A 2BL5A 3HOVG 1FGBD 4KY7A 5ELOA 3BDLA 5IYDH 3A55A 4KY5A 4K2LA 3KF8B 3MXGA 4LK1C 2GVBA 4H44C 1BR9A 2FFKB 1LABA 2NVYH 3K8AA 3CQZB 3BG3A 2HIVA 3CPWA 5LMNQ 5C3WA 1CHQD 3NHHA 4DV5L 3E5SA 5CV6A 1IKMA 4O42A 4KKTA 1YJ9A 1PH5A 5EPKA 1SRUA 5K36H 4K5XA 4CKEA 3SXHA 2JA5G 3LWUA 3KLSX 4N9TA 3NXWA 4DK1A 2JA5B 1E24A 3A8IE 2JP1A 4CKCA 3VR5A 4FF4A 1J9OA 3SVMA 4CKBA 1XTCD 2CCZA 3GTLH 1PFBA 2CTJA 4MZ9A 3R2TA 4UPAA 3PUXA 1STHA 2K4KA 1TWHH 2B63G 3GD7A 2KEEA 3CHBD 5IYDG 3BYTB 3RLNA 1KAWA 2VQFQ 1IL8A 1LO5D 3KUPA 3VYUA 5C0XI 1L1OA 2ZTCA 2EJFC 3HZXA 2Z6KA 1WD0A 4K14A 5A35A 2FINB 2N55A 2I5MX 3LGJA 2IY5B 1I50B 3SDZA 5CV5A 3MFGA 1PTOF 1JWUD 4IPDA 4JI6L 1TQOA 4HIKA 1CI3M 1RJTA 2JYOA 3CW2C 2O5IC 4M1UB 1IKLA 2YU9H 1VF7A 3NP8A 4OIKA 2NN6H 3U9OA 1HNWL 1PV4A 4GLXA 3J7AF 2N8NA 4WORA 1JE4A 5ELFA 3ICEA 1UE7A 4R4TA 3MZ5A 5IP7G 1LT3D 1L0XB 1JORA 3K0YA 5M9OA 4IO9A 1Q1EA 3J81L 1ESRA 3HOYB 3PV0A 2F03A 3A0JA 4RMFA 1N33L 4GNXC 3EBEA 2LSSA 1VCIA 2VUMH 4Q0FA 1VQ9A 4DGZA 3AEVA 1Q86C 2HDMA 3BU2A 1PXUA 1HJPA 5FLXL 1RF2D 4AYBG 4LFAQ 4ABNA 3GTMB 4B9XA 1SFOB 1CKMA 2PNRC 5D3IB 4YWMA 2ICIA 4CJ1B 4GN5A 3SHLA 4ULLA 1PH2A 5EPJA 1LTSD 4CGYB 2E2HB 3D4RA 3NTIA 4BWGB 1PH4A 4A3CG 4WFN3 5IGFA 4GOPC 1VQGA 2NN6G 3FKIG 3Q8DA 2UUBL 4QMGA 1A2UA 1KABA 4WJ3M 2K5QA 3VYRA 1QOHA 1CSQA 5AFWA 3HFZB 1BOSA 3D0FA 2VZAA 1PZKD 3UDXA 1PTOD 4RFBA 4RHRA 4A3GG 4DK6C 4DNTB 3BS1A 2L1BA 1IZ6A 1X3EA 4XQJA 2F0PA 1FD7D 1TR5A 4IUVA 3DEPA 2EVBA 5D3DA 1DOLA 1PFSA 1N9WA 1HA5A 3EA6A 1H9MA 5G3LD 3ONAB 2DUDA 5C3EG 4Z9CB 4C3JH 1G6ZA 1O7IA 4TVAB 3RZOB 2FJ2A 1EWCA 4DV7L 1SNQA 2VB2X 1F2ZA 3CP0A 2RDGA 3VR4A 1SYCA 5T1IA 3S16H 2Q2UA 4K5WA 4FYDA 3STBD 2H5XA 4YCUA 3H0GB 4I65A 3G6JB 2B2VC 4ZRZA 4BA2I 1X3GA 2ZXOA 4C1NK 5DM73 1X3FA 1GUOA 1U4LA 2F0MA 1AE2A 1WVLA 3M7NA 3URYA 3CRLC 2X6LA 2ZTDA 2CQAA 3Q23A 1RDPD 2WKCA 4KHVA 3J7YW 2JE6I 3S14H 2F0UA 1QNKA 2F4IA 4DV3Q 2VXWA 3KYHC 3I4NB 1X4MA 3GV3A 4C1NI 4FXDA 2NVQH 1QZHA 3K5LA 1WVNA 2ZJQA 2WAQE 1TWAH 1TIID 2BCOA 2HIXA 2I0QA 2F0HA 1SNPA 1QUQB 1FNVA 3HOYG 1A3TA 4DKAC 1KNEA 2RBMA 3G48A 1SE4A 5FLMG 1I50H 2ZJPA 3NE5B 4EQOA 1S5DD 1Q1BA 4QF4A 2E8GA 1Q81C 2SDFA 4RCOA 3SK4A 1AE3A 3S1RB 2FMRA 5AJ3L 4F87A 1O78A 4A93H 1ASYA 1I4PA 4DV4Q 4JI2L 1MGSA 1Y1VB 3E6ZX 1JWSD 4KTAA 4LFCQ 5LMNL 3QG1A 1WTVA 3TZDA 1KHIA 4IPHA 2JA8H 2CTEA 5I9PA 4F88A 1QJOA 4G7HC 1RKNA 1GM5A 3NWTA 1WTOA 1B9NA 2Q8IB 1PH3A 2JQOA 1B4OA 1K8OA 1X55A 2D9UA 3P75A 5M5YH 3GO5A 1KNAA 2EIFA 4LJZC 1YHQA 1B7YB 1EQVA 2R93H 2B63B 2YTYA 1PFMA 2ZXPA 4GNXA 2RHQB 3KF8A 2WB1G 3FHWA 3PO3H 1DOMA 4R4CA 4WJWA 3PO3B 2A8VA 2OPVA 2WB1E 2B2UC 1X3PA 2KUMA 3PIO3 4YWLA 2F3IA 4V190 3ERQA 4E6IA 3J80L 1GUGA 1M90C 1VIHA 2RSOA 1X32A 2A74C 2Q8TA 5E7NA 1RTNA 4Y7NH 1VMCA 1N36Q 4RHSA 2CW0D 3CQZH 2KOLA 3QO2A 2XTIA 3BZKA 3QWNA 4BBRG 1XTDA 3A56A 5H1SE 4P72A 3UE1A 1HPCA 4XQQA 2PPBC 4HIMA 5A2QL 1YZ6A 4DR1Q 4NXMQ 3M4OB 1Z7TA 4KD3A 3EROA 3GTOB 3CPFA 4DA2A 3ULPA 4IJLA 3OW7A 4LF6Q 2K05A 3IFDA 4KY6A 1CZGA 4UY8C 3S1MB 2R7ZG 2WAQG 1IBKL 3FP9A 4NXML 1I4GA 1SROA 4C3HH 4EQPA 2FMCA 1WTWA 4OGQC 4DU9A 4X64Q 5C4XH 4OL7A 1WFQA 2IWHA 4J6HA 2YU9B 1PTOH 1SEBD 4LF6L 4A4IA 2UXBQ 2IT1A 2ID0A 1EYGA 4TRDA 5EKIA 2JXMB 1Y8NB 1FJGQ 4F7XA 5J22A 3RNUA 1D2BA 1DOKA 5IGGA 3ER0A 4JK1C 1Z47A 3NEMA 1VQDA 1A15A 2KEDA 1TWGB 3SK6A 3S1MH 4KKUA 2F0DA 2SOBA 3NTHA 5M5XB 2WINB 4C2MH 4X64L 2NTSA 2JA6B 2PY9A 1TWHB 4LUOA 4IZ8A 1S3OA 5FJ8H 1LTGD 3KK7A 3L2PA 5C5MA 1VQ6A 4G7ZC 1HQMC 2KJXA 1VQFA 1Q12A 2PW5A 4GLVB 4J1MA 5FLXE 4A3EG 5EQ0A 3WOFA 5I9OA 3GTJB 2E3UA 2IX0A 4DAVA 5M3FB 1VQIA 4P2CB 1LTID 3I72A 1CTMA 4DUYL 3M4YA 4G4KA 1B8AA 1M4VA 4TSSA 3HOXH 2OT2A 2NUCA 1ZZIA 2JA8G 1Y1VH 1ILQA 3D31A 1EFID 2AMCB 1QILA 3M4PA 4IJHA 2A69D 2KHIA 5M3MH 1CSPA 2Q2IA 4GNXB 1HTLD 4R4QA 3S2DB 3L9AX 5C4HA 2EY6A 1QG7A 3D4WA 2N78A 4OWWB 2Z8LA 5JJKA 2Y0SB 4KKSA 2B2VA 2KCCA 4XT1B 1STNA 3MAQA 4QMFB 1HTPA 5CR3A 1XXGA 2F0VA 4KN4C 1Y14B 4R8NA 2G9HD 2EYFA 3BVZA 5IGEA 1BXTA 1XMOQ 1YITA 4BXXH 2RCNA 2YQRA 2K32A 4HIDA 4O2DA 1DM0B 1MBYA 5DAUA 2E75C 2PQEA 2XNAC 1BCPD 2R6GA 5HY6A 1EIHA 1EZ8A 1KLUD 5M5WH 4BY1G 4GN3B 2D2CC 1PH7A 3PCOB 4MTNA 1F2YA 1NCVA 1IBLQ 4XQNA 2EYPA 4DV3L 3D4DA 2Z4IA 3E0JA 4BBSB 4OONA 3PO2B 3RN2A 5IT9c 1KAAA 2L55A 2PI2E 3ZYYX 4BS9A 3T16A 5M5WB 1ENAA 2FXQA 2WKDA 4A3MB 1B3AA 3G6EA 4KV6A 4MIUA 1DJRD 4ZAIA 4U673 4PG3A 1XMQL 4JI7L 3PUWA 4O0AA 4DV6Q 1Q8KA 5HGQA 2K7VA 4A3BG 2VUMG 3B6YA 4K6LA 1S5BD 5E4XA 3JAML 4BY1H 1PTOB 4P71A 2A6ED 2CW0C 4FF2A 4A3IG 1PRTF 1Q82C 1EYAA 3NQTA 4GS3A 1HZ9A 4ME5A 4A3JB 3TZUA 1EYCA 1HUNA 2B8FA 4L5SA 3I4MH 3DWAA 2VQFL 4GN4B 1YHAA 5HURA 4KK7A 3J80c 2XGTA 2ZJRA 2XWJB 4IPGA 1NE3A 4P75A 4FXGC 1EU4A 3Q24A 5IT9L 2R93B 1JB7A 4CJ2C 2C5CA 1J5KA 1BUVT 1JJGA 4FXKC 4L5RC 2F3VA 3C3LA 1GUWA 4ZQ3A 4KJNA 5A2QE 1F77A 3EFXD 2CVRA 1NSNS 1XWEA 1VQEA 4Q5VA 5K36G 5C4JB 5CYUA 2JA5H 5C3XA 4J15A 1H9SB 5M5XH 3J7AV 1WE8A 3MXPA 1SNMA 2EY1A 4DR5L 1K8AC 1YVCA 3HOWG 1NTGA 1PZJD 3M3YB 1AN8A 2TSSA 1WYDA 4AH6A 3VDYA 1KTKA 1EU3A 4EGVA 2EDGA 3FEWX 1ZYRC 4EQNA 3T1YL 1WCMB 1CA5A 3S1QH 1SYBA 3DMUA 5LMUL 3AEVB 4XDXA 1ZKOA 4A3KG 4K2KA 4KD4A 2B2WC 2NVXH 2AQ2B 2F0WA 2Q8RE 3TP6A 2K01A 1EWHA 2EXZA 2M2LA 2QNDA 2K6AA 2B2TC 3T56B 3JAME 2NZOA 2EYLA 4HJ8A 3I55A 4DAYA 1B44D 1O7ZA 2MNAA 3HOUG 2RDFA 3Q22A 1I6HB 3J81i 5EBCA 4A3LG 1F9PA 3EN2A 1ESFA 1CFMA 3SEBA 4JG2A 2CPQA 3MXUA 1CKNA 1TWFB 1SMYD 3GTOH 1ML0D 4IOCA 1IXRA 1VF5C 1NJIC 2HH3A 1K1GA 1Y1WG 4IUQA 4DFAA 1E1OA 2R7DA 1CQFA 4PV1C 2RF4A 4I7ZC 1ZZJA 2XRQD 3I4MG 2LFNA 2UUCQ 3BJUA 2AWNA 1JOOA 2EJMA 1JQYD 4LAAA 1HHVA 2MFIA 1QVGA 4MN3A 1I4XA 2E76C 4JI3L 4OX9Q 2PO4A 4A3LH 1U4MA 3UDGA 1X9NA 2E2DC 4AM3A 1WTRA 2D62A 4OXPA 3AQQA 4LF8L 1ENCA 1AFPA 3HOWB 3I2ZA 2VS1A 4JI1Q 1SJED 1P16A 2ANRA 1EIGA 1XNRQ 2EE1A 3HRZC 1MI2A 3QIAA 3T1YQ 3M85A 4DK0A 2NYZD 4XT3B 4JI5Q 1SAPA 4DUYQ 1M8AA 2AKWB 3TBIB 1KL9A 4X65Q 2K5HA 4A3DG 1J5EQ 3QOLA 4NP5A 4R8IA 1X56A 2MO1A 2B8GA 1K83H 1YNJC 3GV6A 5EJWA 5CV8A 4ZUJA 2NWGA 3ND9A 4K0KQ 1TU2B 5BR8L 2I46A 3GTMH 5JPNC 1F9QA 3C2PA 4LNQA 3MVVA 2DN8A 4DR4L 3M9BA 3KDFB 3NUCA 1D8LA 3OW2A 2O5JC 3E0EA 4DR1L 1BDOA 4BBSH 1FL0A 4DR7L 1K3RA 4A75A 3L7ZC 1B9MA 3NPPA 4UDUC 1XX8A 3KBXA 4HSVA 1ZXTA 2DY7A 1JC7A 2SNSA 5IYCG 4IFDG 3MWYW 3I73A 1XPRA 1HNXL 3OSOA 3CU7A 3TP8A 2Q2HA 3I91A 4JBMA 3G71A 1JJCB 3HOWH 1VQAA 1MJCA 1EY9A 1DGSA 4ZKCB 4IUPA 1IBLL 3CD6A 3J81E 3CMAA 3FVQA 1ENFA 3MEHA 2AQ1B 3PO2G 4BBSG 4DV0L 1IYUA 2RA4A 1MKHA 2F1MA 3HOZB 4B3RL 3DHQA 2P2RA 3QJYA 2F0QA 1PH9A 2J4XA 4JYAQ 2XIWA 4IUNA 3U9SA 1H9JA 2PZTA 3C1EA 5M5YB 4AIMA 1Q3LA 1CKOA 3EQLC 3OMCA 3A8JE 1J8IA 4N9PA 4DAYB 1PDQA 1RD9D 4DV6L 4JI0L 1IW7C 2O2LD 1ZEQX 2JA9A 1F9SA 3CAMA 1C48A 2B29A 2A19A 1PH1A 1JMCA 3I4LA 3RZDH 4JV5L 4KLKA 5DM63 1CHPD 1Z6HA 3CC2A 3HOZG 2J0TD 1IW7D 1Q46A 4L6TB 1WTPA 1HRJA 1BCPF 4B3RQ 3M4QA 4P74A 2M00A 2NTTA 2M9VA 3M4OH 4J8QA 3PF4A 3S15H 1SMXA 2A6HC 4NPSA 3I70A 4TKOB 4ZUIA 5CBEE 2EZVA 1LM0A 3KJOA 1EFWA 2MP1A 1EY4A 1A6XA 3F2DA 2WACA 3S2HH 1JCKB 3TEHB 4ME3A 1N8RC 2E2IH 1S4ZA 2EPBA 5JJIA 2WIIB 4G7OC 3I4NH 1EY7A 4DR2L 2UXDL 2K52A 1SNCA 2KCMA 2BDNA 4B3TL 2NVTH 4OO1G 1L0YB 3S1QB 4ZKBB 3BDOA 1B1ZA 1PH8A 4WRDA 2E2HH 4DV1L 1XNQQ 1STYA 4YY3Q 1W2BA 1BCPC 3CC4A 2JA6G 1R4QB 5CC4A 1A62A 3K5MA 2PI2A 2ZT9C 1KRSA 2A6HD 4DAPA 5FLXc 4JI6Q 4NKLA 3TMEA 3PUYA 1Q7YC 4RCNA 3R93A 1KDAA 4QGUA 2KENA 4DV0Q 1UE1A 3IKJA 1I6HH 3OOCA 4A3FB 5BN3A 2PMZE 4JCVE 3NBIA 4JI4Q 1O7YA 4S3SA 4YWKA 2LXJA 2HQLA 1GKHA 3BVMA 1TUAA 3GDEA 2QCPX 4F8MA 2R3ZA 5C44B 1VIGA 3DLLA 3C1FA 3H09A 2QEJC 1SYGA 1V1PB 3H3VC 5IP7H 4YY3L 2XRSD 5E3FA 2YTVA 4X62L 4LUVA 2OTLA 5G3LF 1JWMD 4L5TA 4R4OA 3K58A 4AQYQ 2MJHA 2BDOA 1D6EC 2KHJA 3CXCA 2X6GA 3AFQA 3I4MB 3P7JA 4BY7H 2R7ZB 4A3JH 1S5ED 2VB3X 3X3NA 4MNOA 1XMQQ 1BKBA 2SNMA 1V1QA 1Y1WB 4JBJA 5JEAJ 2IW3A 1ICWA 3I7FA 4FF3A 1HCZA 4GKKQ 2HCCA 5I4DA 5JJLA 1STBA 3W5OA 2CTFA 2JA7B 3TS0A 2ZM6Q 2YYZA 5FKAC 5D14A 4JI8L 1VDZA 3MEFA 3TDQA 3X3MA 3Q0AA 4K6DA 1H9KA 1CZWA 5GAEC 2UU9L 1EY5A 5C4XG 4KN7C 2K5VA 1IHZA 1D1KA 3S1RH 5IE8A 3AFPA 1UE5A 3W1BA 1FNWA 4IUTA 1VQBA 4HJ7A 1I3QH 5F2DA 1LYLA 1OXSC 1EY0A 4CJ0B 1DT4A 2JEAI 3J7ZC 1WCMG 4WANA 1LTBD 3A5ZB 4UAIA 2IJ0A 5C3EH 2QDBA 5CMDA 4IQZA 1CA6A 3P20A 3PF5A 4X3SA 4OWTB 5M3MB 4G57A 3K7UC 4BY7B 2A68C 1EQQA 4IALA 1S5CD 2V4DA 2IPKD 4X62Q 4HSPA 4DV7Q 4HJ9A 5HGTA 3ULJA 3VKEA 1PZID 5GAGC 1SJHD 4NMZA 1EC6A 5ELEA 1WTXA 2JK8A 1XPUA