5C0XG

Structure of a 12-subunit nuclear exosome complex bound to structured rna
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
237
structure length
237
Chain Sequence
b'MSTFIFPGDSFPVDPTTPVKLGPGIYCDPNTQEIRPVNTGVLHVSAKGKSGVQTAYIDYSSKRYIPSVNDFVIGVIIGTFSDSYKVSLQNFSSSVSLSYMAFPNASKKNRPTLQVGDLVYARVCTAEKELEAEIECFDSTTGRDAGFGILEDGMIIDVNLNFARQLLFNNDFPLLKVLAAHTKFEVAIGLNGKIWVKCEELSNTLACYRTIMECCQKNDTAAFKDIAKRQFKEILTV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exosome complex component RRP45
publication title RNA degradation paths in a 12-subunit nuclear exosome complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae s288c
molecule tags Hydrolase/rna
total genus 43
structure length 237
sequence length 237
ec nomenclature
pdb deposition date 2015-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF15985 KH_6 KH domain
G PF18311 Rrp40_N Exosome complex exonuclease Rrp40 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5c0xG01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5c0xG02
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 5c0xG03
2EXDA 4IFDJ 2PI2A 4RMFA 3FKIG 1LYLA 5H1SE 2E3UA 3HOVG 1WVNA 3TS0A 1FJGQ 5FLXc 2JA5H 1PVOA 4QMFB 2VW9A 1X3GA 3UE0A 2UUAQ 3VA7A 5C4XH 1PYBA 4QGUA 4BY7H 4PZ6A 5KNCA 3WDNA 3CP0A 1M90C 1KRTA 3KF6A 4OWXB 1N33Q 3KF8B 3CF5A 3OW7A 5C0XI 1LTLA 1PH3A 2FXQA 4L5RC 3J81j 5IYCG 2ZM6Q 2UU9Q 5GAEC 2EVBA 1A8VA 2P2RA 4JBMA 1GHJA 3BJUA 1K83H 2ZTCA 1N32Q 2B8GA 5M5XH 3VKEA 3IFTA 1XNRQ 1UWVA 3RZDH 4OWTB 1FYCA 4LFAQ 2PI2E 4LF6Q 2FMRA 4L5SA 3U50C 4LFCL 1X55A 1X54A 1HZCA 2MQHA 3TREA 2XGTA 4A93G 4DAMA 4DR5L 1WCMG 3VR4A 1IBLL 1GUSA 3S1RH 1VQ6A 2PQUA 4MNOA 4A3MH 1XNQQ 2A6HC 1HZAA 4KMUC 4KI0A 3HOUH 4DV0L 5ELNA 4K0KQ 2NN6H 2YTYA 1EYGA 3AEVB 2D0OA 3M85A 4DV4L 3J80i 2KA7A 1L0WA 4ME3A 1ASZA 2ALYB 4JV5L 4AIMA 2YQRA 1QVGA 2K75A 2EJFC 5M5YH 2F4VL 4B3TL 4HIDA 1J4WA 4R4CA 1FL0A 4AYBG 1K0RA 3J81i 3UDIA 2RCNA 1WE8A 1YJ9A 1V1QA 1LUZA 1RIPA 4GKJL 3ULLA 3G48A 1IYJB 4JYAL 1X3FA 1CKOA 3PO2H 4GOPB 1CKNA 3QIAA 2PMZE 5GROA 4A3IH 3F8TA 2IHFA 4C3JH 1X65A 3ND9A 3NEMA 1OXSC 1SROA 1PHJA 4DR6Q 4PG3A 1YHQA 1KL9A 3GTKH 3S15H 1EIYB 4DV7L 3HOVH 4NXMQ 1R9TH 4NPSA 4X64Q 2R7DA 4JI0Q 4UP8A 1KRSA 3CC2A 3M7NA 2CFMA 3KFUA 1VF5C 2ES2A 2YYZA 1IW7D 1TXYA 3CRLC 3K81C 5C3EG 4LK1C 1PA6A 4DV1L 1WYDA 1XPUA 1J6QA 1Z7TA 1WFQA 1YNNC 2WB1G 3CCMA 1XMOL 3K7UC 5IYCH 1GUOA 1PH7A 3U58A 1HH2P 2A1AA 2HT1A 4DKAC 1K8MA 4A3FG 3KYHC 2PNHA 1YHBA 2DNEA 1OTCA 1G291 2K52A 5GADC 3IKJA 1XJVA 3G4SA 4BBRG 5E7NA 4RCNA 1A62A 4WJ3M 4UPAA 5J3BA 3JAMi 5K36G 1CKMA 4A93H 5JJIA 2ZJQA 4TQUS 1IYVA 2PQAB 4LIJA 2JA6H 3MEFA 1CSPA 1YVCA 3ULPA 2ZTEA 2MJHA 5IWAL 3A8IE 3PUYA 1BVSA 1EQRA 4LFCQ 1PH5A 3S1NH 2D0PA 1TWCH 5LMNL 2QNDA 1LACA 1FR3A 4DR5Q 1Y1WG 1L1OB 3CCJA 1IBLQ 4GKKL 4R1JA 3RN5A 3J7ZC 1W3SA 3T53B 1HR0W 2Q8IB 3VR5A 3W1BA 3AFQA 4DV0Q 4JI2L 4GLAC 2IHEA 3PUZA 5GAHC 4DV4Q 4A3EG 2OQKA 2OWOA 2A6ED 3I72A 4QY7A 3DM3A 4JI5L 3A74A 4JV5Q 2MNAA 2UXDL 3GTOH 4GOPC 2VUMG 2AWOA 4R4TA 2F4VQ 4B3TQ 4X62L 1O7LA 3OW2A 1VQ4A 1GKHA 2OPUA 1I6HH 1X56A 4GKJQ 3L7ZC 2Q2HA 3STBD 3A0JA 4JYAQ 3A7AB 4PZ8A 2B3GA 2AMCB 1KHMA 1C0AA 2WFWA 5GAGC 3GTJH 1KXLA 3I4LA 4IPGA 3B6YA 2L15A 2BE5D 3TEHB 4KHPL 2HQLA 1B8AA 2JA7G 4DK6C 3EBEA 4DV7Q 1B70B 2KBNA 2KHJA 1VQ9A 1B9NA 1PMRA 4OO1I 1M1KC 1TWHH 2VZAA 3CRKC 1B7YB 1IW7C 4IPDA 4H13C 4DV1Q 4A3FH 3Q8DA 4LF6L 4G7OC 1XMOQ 4JOIC 4C2MH 5JEAH 4BBRH 4MTNA 1X4NA 1KIXA 1Q82C 4YCVA 3UDXA 5KNBA 2NVTH 4DR4L 4K0KL 1V8QA 2F1MA 4GN3B 3H15A 4A3KG 5M5WH 3PUWA 2R92H 5ELOA 2CWPA 4A3MG 2JK8A 1YZ6A 1L1OC 4HIMA 2A69D 3KJPA 1VQHA 2HHHL 4L8JA 5IWAQ 3U4VA 3W1GA 4DV5L 2O5JC 3GTPH 4B3SL 2Z0SA 5LMNQ 1BBWA 4GKKQ 4UY8C 3PIOA 1GO3E 3FP9A 2IY5B 5IYBG 1OXVA 4DR6L 2B63G 4JI2Q 1X9NA 1VIGA 3MXNB 3I7FA 1HCZA 1Z47A 2PQAA 1TUAA 4JI3L 4J15A 3RLFA 4JI5Q 4P72A 2KCTA 3A5ZB 2A6EC 1Q12A 2UXDQ 3V69A 2B8FA 1P16A 4YWKA 4X62Q 1H9SA 1O7IA 2NZOA 3CCSA 4KN7C 3KLWA 4GNXA 4LFBL 1PH4A 1NTGA 2JVZA 5C0XG 2IX0A 1VQMA 2V4DA 4DR7L 2JA7H 4Y52H 2OPVA 1CTMA 5C4JH 3STBC 2DGYA 1EUJA 2WAQE 2YU9H 1D8LA 1GHKA 4PV1C 3U4ZA 3L0OA 4KHPQ 3GTQH 3PCOB 2BE5C 3A5UA 3G6EA 1ZZIA 4DR3L 1S72A 1K1GA 2MFIA 1SR3A 3ERSX 2R7FA 4DV3Q 3QG1A 3UE1A 5FLMG 1WI5A 1QVFA 1I5FA 3S24A 4DV2L 3D0FA 3UDGA 2RHQB 2CTEA 2QEXA 2EJMA 2GVAA 1VQFA 4IO9A 4RG1A 2V1CC 2N3SA 3I56A 2H5XA 3S2DH 3ICEA 3F1ZA 1VQ7A 2JJQA 3TZUA 1MKHA 3RNUA 3S2HH 3OOCA 3LGJA 1KC8C 4JI7L 3FHWA 2DUDA 3F2BA 4OXPA 1NJIC 3H94A 4A3KH 1JB7A 2K14A 2JA6G 1UE1A 4L5TA 3BG3A 2K32A 1VQLA 4A76A 3CCRA 4QIWE 4HR7B 2JXMB 4DR4Q 1U5KA 4DNRB 1MIUA 1W2BA 1DD2A 2R6GA 1EFWA 4LF4L 4GLVB 2R93H 1H9RA 4BBSG 1H9KA 3CC4A 3EIVA 3RLOA 4C3IH 2D62A 2VQFL 3N6RA 2VQEL 4A3LG 3EQLC 2KENA 4DUZL 1HZ9A 2E8GA 2NVYH 2CKZB 1VS0A 2A69C 3S16H 1SFOH 3S1MH 2HHHQ 3P20A 5IYBH 3I2ZA 5FJ8G 3T1HL 2B63H 1IZ6A 4DV5Q 1HZBA 4YWMA 1BBUA 2K33A 4B3SQ 1I50H 1I94L 3I4MG 4P73A 5A35A 3SE0A 3BZCA 3LWUA 1EQQA 3I73A 1K8OA 1KQSA 3PUXA 4LWCA 3K7AH 4AQYL 1VQ8A 1CSQA 3CPFA 2E5LL 2E76C 1A0IA 3VR6A 4IFDI 4DPGA 5C44H 2NVQH 2HH3A 4JI3Q 1U0LA 5C0XH 4A3BG 1ZZKA 2Y0SG 4XIGS 3QJYA 3CPWA 2KHIA 4LF5L 1NBWA 5IE8A 1QJOA 1P8LA 4JI8L 3CMAA 1VQEA 3WWVA 3RN2A 1UEBA 2D2CC 4LFBQ 3GDEA 1H95A 4DR7Q 1KAWA 3CQZH 3GTMH 2AUKA 3T51B 4H0LC 3ER0A 5FLMH 1KD1C 1VQBA 4IJHA 4BA2I 5M3MH 4KKTA 2JE6I 1BKBA 3CC7A 4DR3Q 5JEAG 4LF8L 1S40A 2CTJA 4YY3L 5BR8L 2CW0C 4DV2Q 2QGQA 4KKUA 3FMCA 1OXTA 4R4QA 4YHHL 4HJ5A 2K5HA 2ZJRA 2R92G 1YIJA 4JI7Q 1JMCA 2F52A 2ANNA 1YHAA 4A4IA 2Z6KC 4BBSH 1PH8A 2JEBI 1DT4A 3GQBA 3T1YL 1GD7A 1Q8KA 1E7ZA 1HQMC 1QZGA 4A3LH 1NMFA 4Y7NH 4FDBA 3SGIA 3CCUA 3HGBA 3GTLH 4LF7L 4LF4Q 3F2DA 5FJ8H 5IT9c 1FGUA 5GQOA 2EIFA 1HR0L 2VQFQ 3HOXG 2VQEQ 3I4MH 3CCVA 4DUZQ 3OPOA 4GN5A 5LMUL 1SN8A 2DNCA 1Z6HA 3ND8A 3KF6B 2RF4A 4TVAB 2BDOA 4OONA 5IYDG 3T1HQ 2BA0A 4DNIA 2HH2A 2AWNA 1I94Q 4IPHA 3AEVA 3H3VI 4JC0A 5JJLA 4A3BH 4DV6L 3LNNA 4AQYQ 2Z6KA 1GM5A 3VR2A 2E5LQ 4OO1G 3M4YA 1Q86C 5DLQE 5IP9G 1Q46A 2AUJD 4DV3L 3CAMA 4A75A 1YJNA 4LF5Q 2ASBA 3S14H 4JI8Q 1SE8A 4GOPA 2DGRA 4G7HC 5C0XJ 1XPOA 4EX5A 4O2DA 2CCZA 3D31A 2N8NA 2ZTDA 3HOZH 1Q81C 4JI6L 2A68D 2CTKA 1TWGH 2HIXA 1N9WA 3HKZE 4HIOA 2N78A 3I4OA 4LUZA 4L5QA 3KDFB 4H44C 1GUGA 2UUCL 4NXNQ 1TU2B 3PV0A 2IT1A 4JG2A 2B29A 4LF8Q 1DXMA 3PSIA 3FPPA 4YY3Q 2GVBA 2K5VA 2MO0A 4G7ZC 1WJJA 1E22A 1YITA 5BR8Q 1PV4A 2YV5A 3U1KA 1DCZA 1VQDA 3ZJYC 4LJZC 1N34L 5IY0A 1VQ5A 3JC66 1I3QH 4AYBE 1OXXK 3S1QH 4YHHQ 2R93G 4UP7A 3J80c 4A3GH 3A8JE 2KCMA 1QZHA 2EDGA 1YJWA 1D7QA 1TWFH 4H02A 4JOIA 1ZTGA 1J5EL 3T1YQ 3J81c 3HOXH 4YCWA 1CFMA 3PO3G 2OTLA 2CPQA 2NN6I 3E0EA 4HJAA 1IBML 4LF7Q 4LUVA 3DXJC 3IRBA 1Q1BA 2I5HA 2PY9A 4KHZA 5IYDH 3TRZA 1IL2A 2QF7A 1TKWB 5AJ3L 1YBYA 1HR0Q 1GJXA 1Z9FA 3VR3A 4DR2L 2QA4A 5LMUQ 4DAYB 3CCLA 2UXCL 3S17H 3I55A 2R7ZH 5C44G 1X3EA 1L1OA 3CCQA 4OO1H 2WB1E 1EOVA 2K4KA 4ALPA 1E2VA 3M4OH 2JEAI 5IP9H 4KKSA 1HNXL 4DV6Q 1K8GA 2LSSA 3OTOL 4IOCA 3I4NG 2OTJA 4EQ5A 1X6OA 1EWHA 1PFSA 5JJKA 1H9JA 4GLXA 1K8AC 2K7VA 3VDYA 2JA8G 3E9HA 1ONLA 4POFA 2EJGC 1CUKA 4JK1C 2UXBL 1JE5A 1HNWL 4OGQC 3GTGH 2VS1A 4DK0A 4A3CH 2ZJPA 1PYSB 2I5LX 1NE3A 5M3MG 1ZYRC 1Y14B 2D5DA 2EQSA 1K73C 4DR1L 3K8AA 4AM3A 1Q90A 1SRUA 3PF5A 2JA9A 1HNZL 4JI6Q 3M3YH 1VQOA 1A63A 3AQQA 2A68C 4HJ7A 2YTXA 5HY6A 3JAMc 4BA1I 1EIFA 2NVXH 1YNJC 3L2PA 3RZOH 4X66L 2CTMA 1UE5A 2CQOA 4NBQA 1Y1VH 2UUCQ 5JEAJ 4A3JG 2E75C 1VQJA 3K80C 3HKZG 1HPCA 1YNXA 2K50A 3G71A 2Q2TA 1ASYA 1VQPA 4LF9L 3RR5A 4HJ8A 1N34Q 2GN5A 2UUBL 4B8TA 1K3RA 4DUYL 3HOYH 4GN4B 3UDFA 4IQZA 1C9OA 2AKWB 4BXXH 2BH2A 3OYYA 4X65L 1VQAA 4UP9A 4DK1A 3PO3H 1JJ2A 3W5OA 4B3RL 4IFDG 3KDFA 1VDZA 2L5TA 2BH8A 3PUVA 2ID0A 4APVA 3CCEA 1SMYC 3TQYA 1J5EQ 1VF7A 3AB9A 4C3HH 1VCIA 4LW1A 3F2CA 2BL5A 5BN3A 3KLRA 3A7LA 5EAYA 4R4OA 2WP8J 1IBMQ 1I6VC 1MJEA 2C35B 1GUTA 4JI4L 1JT8A 2K5NA 5AJ3Q 4R4IA 3FKIH 1E24A 4DR2Q 2CTLA 2AXYA 1QUQB 3BU2A 2UXCQ 2O5IC 3I4NH 1E2ZA 1G51A 4X6AH 4I7ZC 1QVCA 1H9MA 2N49A 1WOCA 1XTDA 4B3ML 2Q2UA 2JA8H 3DLLA 1HNXQ 4JCVE 3OTOQ 4HIKA 5KNDA 2E2JH 3HOZG 1PH2A 1S3OA 4NXNL 2HIVA 3H0GG 5HGQA 3K0XA 2MO1A 2UXBQ 2WAQG 1JJGA 1IXRA 4IOAA 1HNWQ 3KOJA 2PPBC 4NB3A 2PCFB 5M3FG 1VQCA 2YTVA 4AH6A 1E1TA 4OX9L 4DR1Q 4P75A 3U9SA 1KHIA 4BY1G 4MZ9A 4POGA 1Y8OB 1Y8PB 3NENA 4JVYA 1HNZQ 1GUNA 1RL2A 4A3JH 4JVHA 1JJCB 5LMNW 1T9HA 2I5MX 1WCMH 3HOWG 4JI1L 1EWIA 1L2FA 4A3DG 1GVPA 4X66Q 2XTIA 1H9SB 2KCCA 1Q7YC 4A3GG 1XPRA 3NBHB 3CD6A 1N36L 2BA1A 5IP7G 1VQKA 2RHSB 4GNXB 1IBKL 1YEZA 2JZXA 1NY4A 1PH1A 4IFDH 4LF9Q 1YI2A 1TWAH 2UUBQ 3CMEA 1E1OA 4DUYQ 3EN2A 3CXCA 1XMQL 4WALA 4PMWA 4X65Q 3ULJA 4YCUA 2E74C 4QJFA 4LNQA 2ZT9C 2LMCB 4GZYC 1AE2A 4WJ4A 2PNRC 3M4PA 1HTPA 1E3PA 1VIHA 3J7A5 4B3RQ 2JQOA 1SLJA 1V43A 3PIPA 1FVIA 2A19A 3CW2C 5BN4A 3M4QA 3MFYA 4QQBX 2R7ZG 3HFZB 1CI3M 1FJGL 2VNUD 1J5KA 1MJCA 2ANRA 2UUAL 1PH9A 1UE6A 3D4RA 4IPCA 3BDOA 1AH9A 1Y8NB 4P71A 1DTJA 1C7YA 1DGSA 4JI4Q 1N33L 2E2IH 1B9MA 4QL5A 4DK3C 2JA5G 2NZHA 3RLNA 1NMGA 5C3EH 1K9MC 4O0AA 1AE3A 4TKOB 1VQIA 5C4XG 2ZM6L 4BY7G 2UU9L 1Q1EA 4IJLA 4OWWB 1N32L 3T56B 1N8RC 4B3MQ 4A3CG 4YWLA 2OCEA 3H0GH 1HJPA 4P74A 1XNRL 4PZ7A 1T5EA 1ZKOA 3KJOA 1SMXA 5M3FH 4LFAL 3E9IA 1G6PA 3AFPA 3HKSA 4KN4C 4BY1H 2CTFA 1QUQA 3PF4A 3GD7A 2A6HD 3M9BA 3W3AA 4KLKA 1XNQL 1VQGA 5K36H 3PGZA 2VL6A 2ATWA 1PH6A 4DNTB 1CKNB 4XTCS 3HOWH 1ZZJA 1LABA 2Q2IA 4OX9Q 1Y1VG 4HJ9A 1E2WA 2E2HH 4A3DH 4GS3A 3NELA 1VQNA 5BN5A 1UE7A 2CWAA 1O78A 1X4MA 4JBWA 2LXKA 3TS2A 3HOUG 4GNXC 2NN6G 5IP7H 1Y1WH 3HOYG 4JI1Q 4JBJA 3A8KE 2DN8A 4BXXG 3GO5A 4JBKA 1OXUA 2VY3A 3MXUA 3AYHB 3H3VH 4LUOA 1LM0A 2LXJA 4A3EH 1N36Q 1V9PA 3BZKA 2AHOB 1IBKQ 2A8VA 3NE5B 2Y0SE 2I0QA 1EC6A 2IX1A 2VUMH 4WANA 1BDOA 1XMQQ 3SDZA 2F3IA 1A6XA 3PO2G 4NXML 4X64L 1IYUA 1Y69U 2OQ0A 4JI0L 4A3IG
chains in the Genus database with same CATH superfamily
2EXDA 4C3JG 4IFDJ 3J81L 4KY5A 2PI2A 4KHVA 4DAVA 4RMFA 3FKIG 1LYLA 4Q5VA 4CKCA 5H1SE 3NBHA 2E3UA 4ZAIA 4F7XA 1DJRD 3HOVG 3KBXA 3MA2B 4ZCKA 2WACA 3SK8A 1WVNA 3TS0A 1YNND 1FJGQ 5FLXc 5I4DA 2JA5H 1PVOA 1WTJA 4QMFB 4FJUA 2VW9A 1X3GA 4CKBA 3UOEA 3UE0A 2SNMA 2UUAQ 2J4XA 3QOJA 3AMUA 1TIID 4ZK9B 1CM9A 2SOBA 3CQZB 2O4CA 1EWCA 3VA7A 2KEEA 1PYBA 5C4XH 4QGUA 4BY7H 4PZ6A 5KNCA 3WDNA 3CP0A 1M90C 5C5MA 3OIQA 1KRTA 2RKSA 3KF6A 3D4WA 4OWXB 1N33Q 4JI0L 5FLXW 1K28A 3KF8B 3NCVA 3CF5A 3OW7A 2FMCA 5C0XI 1LTLA 2NB0A 3HEJA 1PH3A 2FXQA 4L5RC 1DYQA 3FEWX 1FD7D 4NW2A 4OIKA 1QILA 3J81j 2BOSA 1F9SA 1EQTA 4YIJA 5IYCG 2ZM6Q 1QE6A 1PQXA 2UU9Q 5GAEC 1A8VA 2EVBA 2P2RA 4JBMA 1V1PA 1GHJA 3BJUA 4X64H 2ZTCA 1D6EC 1K83H 1UNSA 1N32Q 5LL6b 2B8GA 5M5XH 4JI0H 1FKAH 3VKEA 1TQOA 1B1ZA 2WIIB 2K5DA 2EY6A 3IFTA 2MPMA 1XNRQ 1UWVA 3RZDH 2JA6B 4PMBA 2TMPA 4JPBW 1V1OA 3F2UA 3GKUA 3VYTA 1SNOA 3U9OA 1JB3A 4OWTB 1FYCA 4LFAQ 2PI2E 4LF6Q 2FMRA 1SNCA 4L5SA 1S5CD 3BDCA 3U50C 4LFCL 1FNWA 2EYPA 1X55A 1X54A 3S1NB 1HZCA 2MQHA 3TREA 5D65A 2NTSA 2XGTA 4A93G 3R93A 4DAMA 3D4DA 4DR5L 1WCMG 2H1EA 3VR4A 1IBLL 4BBSB 1PYWD 1GUSA 3S1RH 1VQ6A 2PQUA 4MNOA 3BYYB 4A3MH 1XNQQ 2A6HC 1HZAA 4KMUC 4X3TA 2F0MA 4KI0A 4Y7NB 1HNWH 1BF4A 3HOUH 4DV0L 5ELNA 4K0KQ 2NN6H 2YTYA 1EYGA 3AEVB 2Z9HA 2D0OA 3GV6A 4HSPA 3M85A 4DV4L 5IGBA 2WINB 3J80i 3JAML 2LKVA 2HDMA 4BS9A 2KA7A 1L0WA 1LTSD 4ME3A 2KJXA 1ASZA 2ALYB 4KTAA 4JV5L 4RHRA 3KDKA 3GTOB 4AIMA 2PZUA 2YQRA 1B3AA 1QVGA 3I4MB 2K75A 2EJFC 5M5YH 1EZ8A 5HGTA 2F4VL 4B3TL 4HIDA 1J4WA 1EU3A 4R4CA 1FL0A 1MSGA 1STNA 1MI2A 2J7ZA 1SEIA 3RD4A 4AYBG 1K0RA 1A3VA 3J81i 3UDIA 2L4NA 2RCNA 1WE8A 4UAIA 1YJ9A 1V1QA 2CQAA 1LUZA 1RIPA 4GKJL 3ULLA 3G48A 1IYJB 4JYAL 3K5MA 3HG9A 1X3FA 1CKOA 1G8ZD 1J8IA 3PO2H 4GOPB 3X3NA 4LFCH 1CKNA 2IW3A 3QIAA 2PMZE 4QMGA 5GROA 1V9NA 4A3BB 1RD9D 4A3IH 1EIGA 3F8TA 4FVMA 2IHFA 4C3JH 4DR5H 4DU9A 1X65A 3ND9A 2Y0SB 3NEMA 1IBLH 1OXSC 4RGTA 3D6WA 1SROA 2I07B 1PHJA 4FF4A 4DR6Q 4IUPA 4PG3A 1YHQA 1BNZA 1KL9A 3GTKH 5JPNC 3S15H 1WTPA 1C48A 1EIYB 4DV7L 4DV0H 3HOVH 4NXMQ 1R9TH 4DUYH 2K5QA 4NPSA 4X64Q 2B2UC 2R7DA 4DV4H 2HD3A 3BDLA 4JI0Q 4UP8A 2NWGA 1KRSA 1B50A 3CC2A 3M7NA 2CFMA 1ILQA 3KFUA 1A2TA 5DEHA 1VF5C 2ES2A 3I90A 2YYZA 3S14B 4DF7A 1IW7D 1TXYA 3CRLC 4B3TH 3K81C 5C3EG 4XQQA 4LK1C 1LTRD 1PA6A 1I4QA 1G2SA 4DV1L 1WYDA 4RCOA 4ZKBB 3C1EA 4JW0A 1XPUA 1J6QA 1Z7TA 2EY1A 3L9AX 4GKJH 1TWGB 1WFQA 1YNNC 2WB1G 3CCMA 1XMOL 1ZEQX 4JYAH 3K7UC 3MFGA 4C2MB 4QCLA 4WFN3 5IYCH 1GUOA 3ITPA 2IWHA 2A5HA 4PQXA 1PH7A 3U58A 2NUCA 1HH2P 2A1AA 2HT1A 1GOZA 3TBIB 4DKAC 2JYOA 5CBEE 1K8MA 4A3FG 3KYHC 2L0CA 2PNHA 3OIPA 1YHBA 2DNEA 1OTCA 4FF1A 1G291 1EL0A 2K52A 1LO5D 3MEHA 4K5WA 4XQNA 5GADC 3IKJA 1XJVA 5M5WB 3G4SA 4BBRG 5L37A 1ICWA 5E7NA 5ELBA 5JPMC 3NHHA 4DV7H 3MXPA 4XT1B 1WTRA 2R92B 2X06A 4RCNA 2F0KA 1A62A 2B2UA 4WJ3M 1SNQA 2N88A 4UPAA 5J3BA 3JAMi 1QOHA 3I8ZA 2RDGA 5FLXE 5K36G 1CKMA 1I3QB 4A93H 1TT2A 3SK4A 5JJIA 2ZJQA 4TQUS 2PQAB 1IYVA 1I4PA 2CWFA 4LIJA 2JA6H 3MEFA 1CSPA 1YVCA 1II3A 1F2MA 2KQ3A 3ULPA 3MTSA 2ZTEA 2MJHA 5IWAL 3A8IE 2QEJC 1BVSA 3PUYA 1EQRA 5E4WC 2XN9C 2Z1CA 4DV1H 3KF8A 4LFCQ 1PH5A 5C4HA 3S1NH 3T4AC 2D0PA 2Z4IA 1ET6A 1TWCH 5LMNL 1X32A 2QNDA 1LACA 1FR3A 5A2QW 4DR5Q 1Y1WG 1L1OB 3CCJA 1IBLQ 4GKKL 2JSOA 1TWFB 3PMFA 2A73B 4R1JA 3RN5A 5CORA 4XT3B 3J7ZC 1W3SA 3T53B 1HR0W 2DY8A 3HOXB 2Q8IB 1SJHD 3VR5A 3W1BA 3AFQA 4DV0Q 4JI2L 3DUZA 4GLAC 2IHEA 4KJOA 3IFDA 1ICFB 3PUZA 5GAHC 5HURA 3R2IA 1R4QB 1HA5A 4DV4Q 5DNFA 5KGUA 4A3EG 1BXTA 2OQKA 5G3LD 2OWOA 2A6ED 2PYKA 3I72A 4QY7A 3DM3A 4JI5L 3A74A 5C6AA 2M9VA 2DJGC 1VMPA 3I91A 4JV5Q 2MNAA 2UXDL 4FF2A 2EY2A 1EEFD 3GTOH 4GOPC 1DOKA 4G4KA 4RA8A 2VUMG 3BVZA 2AWOA 4R4TA 2F4VQ 4B3TQ 4X62L 2LFNA 4HMJA 1U4LA 1EQVA 1O7LA 3OW2A 1VQ4A 1SYFA 1GKHA 2ZXOA 1KNEA 1BOSA 2OPUA 1I6HH 1X56A 3BVGA 4GKJQ 1X3PA 3L7ZC 2Q2HA 3GV3A 1AEXA 3STBD 3A0JA 4JYAQ 3A7AB 2JA7B 5IWAH 5G3LF 1SYCA 4PZ8A 1DOLA 2B3GA 2AMCB 1KHMA 2B2VC 1C0AA 2WFWA 2EYOA 5GAGC 3GTJH 3M4OB 3I4LA 4IPGA 1KXLA 2PMZB 5CGKA 1QG7A 3B6YA 2YU9B 2RSOA 5JVH3 4EQNA 5LMNH 2L15A 3V05A 2IJ0A 2BE5D 3RMHA 4KV6A 3SR1A 1WTOA 4GKKH 3TEHB 1STBA 1IBKH 4KHPL 3GTQB 2F0WA 2HQLA 5ELDA 1B8AA 4P2CB 2JA7G 4DK6C 3EBEA 2PQEA 1EZ6A 5C3XA 4DV7Q 1B70B 3OMCA 1BQQT 2KBNA 3QWNA 4ILWA 4UHVA 5LL6X 2KHJA 4K8JA 2G9HD 3GTGB 1VQ9A 2CPMA 4JI5H 3VYRA 1B9NA 2CH4W 1PMRA 2A74C 4OO1I 2RBMA 1M1KC 2UXDH 1TWHH 2KCNA 2L1BA 1A2UA 2VZAA 4K2KA 2F0LA 3CRKC 1B7YB 1IW7C 3LWEA 2B2YA 4IPDA 4H13C 4DV1Q 4A3FH 3Q8DA 3S2DB 4LF6L 2H4OA 4X3UA 3S2HB 4R9WA 4G7OC 1XMOQ 5J22A 4JOIC 4C2MH 4U68A 5JEAH 3MC0B 4ZLTF 4BBRH 4MTNA 2MHVA 1X4NA 2B2VA 1KIXA 3N52A 3FDTA 1XYIA 2BDNA 4K14A 1Q82C 4YCVA 3UDXA 5KNBA 2NVTH 2NTTA 4KHPH 4DR4L 2MJ8A 4K0KL 1V8QA 2F3VA 3MWYW 2F1MA 3HS0C 4GN3B 3H15A 3TN2A 5M5WH 3URYA 4A3KG 1F2YA 3PUWA 4XYOA 2R93B 1OO9B 2R92H 3RUZA 2XVSA 2CWPA 5ELOA 4C3IB 4A3MG 2EXZA 1JC7A 5LL6S 2JK8A 2K28A 1YZ6A 4CJ2C 1L1OC 2LY7A 4HIMA 2A69D 1SYBA 3I3CA 3VYUA 3KJPA 1LTTD 3J7YW 4B8CD 5CV4A 1VQHA 2LF0A 1SFOB 2HHHL 4L8JA 2LRRA 5IWAQ 1PRTD 2X6GA 3U4VA 3PO3B 3W1GA 2K05A 3TP5A 4DV5L 2O5JC 1D5ZC 3K5NA 3GTPH 5DAUA 4DN4M 3E5SA 1D2BA 4LF6H 4B3SL 1SYDA 4ODGA 2Z0SA 3EVQA 3H91A 5LMNQ 3P7JA 1SAPA 2RVLA 1BBWA 1JICA 4CJ1B 4GKKQ 4UY8C 3G6JB 3PIOA 5ISRA 1NR2A 1O7ZA 2K01A 1UUPA 5EPLA 3K7AB 1GO3E 3FP9A 2IY5B 5IYBG 1OXVA 4DR6L 2B63G 1Q8IA 4MHEA 4LAAA 4JI2Q 1X9NA 1W6KA 3OMGA 1VIGA 3MXNB 3I7FA 1PRTF 1PTOH 2VKCA 1PRTB 5C44B 4DR4H 4K0KH 1ZXTA 1HCZA 1Z47A 2PQAA 1TUAA 4JI3L 2P5ZX 1PLFA 4J15A 4S3SA 3E0JA 1A3TA 3RLFA 4JI5Q 4P72A 3NWSA 2KCTA 3A5ZB 2A6EC 1Q12A 2UXDQ 3V69A 5IGDA 2B8FA 1RCVD 2A1SA 1ODHA 1P16A 4YWKA 3ERQA 3SEBA 4X62Q 4O42A 1W6JA 4CJ0B 1H9SA 1O7IA 1XRHA 1I4XA 2NZOA 3CCSA 4KN7C 4RGMA 5CV5A 4RFBA 2BCOA 3GABA 3I4NB 2MP1A 4ME5A 3KLWA 4GNXA 2ZQEA 4LFBL 1G91A 1PH4A 4I65A 1NTGA 2JVZA 1S5FD 2IX0A 5C0XG 3Q24A 1VQMA 2V4DA 4DR7L 2HHHH 2JA7H 4Y52H 2OPVA 1CTMA 3OSOA 5C4JH 4TSSA 1EEID 3STBC 2JA8B 4DV5H 2IX3A 3J7AV 2DGYA 1EUJA 4ZUJA 2WAQE 4B3SH 5M9OA 3TP7A 2YU9H 1D8LA 3KLSA 3GTMB 2XWBB 4IUNA 1GHKA 4PV1C 4HTHA 3U4ZA 3L0OA 4KHPQ 5I9OA 3GTQH 3PCOB 2BE5C 2E2JB 5M3MB 3K6OA 3A5UA 3G6EA 1ZZIA 1AZPA 4DR6H 1RTNA 5CMDA 2E2DC 4KD4A 4DR3L 1S72A 2Q8RE 5EBCA 1K1GA 2MFIA 2HUGA 1SR3A 3ERSX 3Q22A 2QDBA 2R7FA 4DV3Q 4NXMH 4KY7A 1RODA 1CZGA 3QG1A 1D1KA 2B2WC 2CW0D 2ICEC 3NXWA 4FO2A 3UE1A 5IGGA 5FLMG 3T13A 5FLXL 1WI5A 1QVFA 1I5FA 1WTHA 4NZRM 3S24A 1TS3A 1AW7A 4DV2L 1GXDC 3D0FA 3UDGA 2DY7A 2RHQB 2CTEA 2QEXA 2EJMA 1KDAA 2GVAA 1JORA 1VQFA 4IO9A 1TY2A 4RG1A 2V1CC 3EROA 2N3SA 3I56A 2H5XA 2F0HA 3S2DH 1SDFA 1PFMA 3ICEA 3F1ZA 1SNDA 4IUUA 2JJQA 1VQ7A 4KY6A 3TZUA 1D1IA 1MKHA 3RNUA 3S2HH 3LGJA 3OOCA 1KC8C 2G8YA 2EYFA 4JI7L 4A3JB 1HUMA 1ESRA 3NK9A 4J8QA 3FHWA 2DUDA 3F2BA 4OXPA 3H94A 4A3KH 1NJIC 5J39A 1PFBA 1JB7A 2K14A 1BUVT 3HKZB 1LT3D 1JOKA 1PDQA 2JA6G 1ILPA 1UE1A 4L5TA 3BG3A 3NSWA 3QR8A 2K32A 1VQLA 4A76A 2Q8TA 3CCRA 4QIWE 4HR7B 1RTOA 2JXMB 4DR4Q 4OCHA 1ENAA 3I70A 1M4VA 4CDDC 1U5KA 4DNRB 4TRDA 1MIUA 3GTLB 2XIWA 1W2BA 1R4PB 1WVLA 1DD2A 3JAMW 2R6GA 1EFWA 3P1HA 5IGFA 1WTXA 1EYDA 4LF4L 4GLVB 4K6DA 2R93H 1H9RA 4BBSG 1H9KA 3CC4A 3EIVA 3RLOA 4C3IH 1SNMA 2D62A 5E3FA 4F8MA 1TWAB 1HFGA 1WTVA 2VQFL 3N6RA 2VQEL 1IKLA 3EA6A 4A3LG 3EQLC 2KENA 2KHSA 4DUZL 3BS1A 1HZ9A 2E8GA 2NVYH 2CKZB 1VS0A 2F0VA 4DV2H 2ICIA 2A69C 3SXHA 3S16H 1SFOH 3S1MH 2HHHQ 3P20A 4RKBA 3UI2A 5IYBH 4IN3A 3I2ZA 2R3ZA 5FJ8G 3T1HL 2QDLA 2HCIA 2HQEA 2B63H 1STEA 1IZ6A 4DV5Q 1HZBA 4YWMA 1BBUA 1DM0B 2F0TA 1JWUD 3PQIA 1JCKB 1PRTC 2K33A 4B3SQ 1I50H 5T1IA 2AQ1B 4JVZA 5IGCA 1I94L 3I4MG 4P73A 1CA6A 4JI7H 5A35A 3SE0A 3BZCA 2O2LD 3LWUA 1EQQA 3I73A 1TR5A 1K8OA 1KQSA 1EY5A 1B53A 3PUXA 3NTIA 5JVG3 4LWCA 3NUCA 3K7AH 3TSSA 4AQYL 1VQ8A 1HUNA 1CSQA 2F0NA 3CPFA 1WD1A 1K0SA 4H8AA 2E5LL 2K6AA 1LTID 2E76C 3SK5A 1A0IA 2CHBD 3NTKA 3VR6A 4IFDI 4DPGA 2J0TD 3SVMA 3WOEA 1BBXC 5DM63 5C44H 2RQXA 2NVQH 2KOLA 2HH3A 4FXDA 1U4MA 4JI3Q 1HA6A 4Q0FA 1MGSA 3NQIA 5CV9A 1U0LA 5C0XH 4A3BG 2E2IB 1F77A 3DEOA 5CV6A 1ZZKA 4LF4H 5J1ZA 3WOFA 1MBYA 2Y0SG 5I6WA 1XXGA 4XIGS 3QJYA 2M00A 3ONAB 5CR3A 3CPWA 2EOTA 2KHIA 4LF5L 1NBWA 5IE8A 4JV5H 1EFID 3GR5A 5K5PA 1IHZA 1QJOA 2VQFH 1P8LA 3MHBA 4JI8L 2F4VH 2O4XA 4DUZH 3CMAA 2RA4A 1VQEA 3WWVA 3RN2A 3CU7A 1UEBA 2D2CC 3ZYYX 3K5LA 4LFBQ 3GDEA 4PMCA 3HOZB 1H95A 3TDQA 1L0YB 1MSHA 2F0QA 4DR7Q 3QOLA 1QNKA 4CGYB 1EOTA 3H0GB 1F9QA 1KAWA 3CQZH 2WAQB 4OEMB 3MXNA 1I94H 3GTMH 2AUKA 3T51B 4H0LC 1KTKA 1LTGD 3ER0A 4OL7A 5FLMH 1KD1C 5KEEA 1VQBA 4KJNA 5M3FB 2AQ2B 1SBBB 4IJHA 4BA2I 5M3MH 1AN8A 4AQYH 4KKTA 2JE6I 2E5LH 3EZJA 1BKBA 4BY1B 4PDBA 3DWPA 3CC7A 1UEAB 4DR3Q 5JEAG 4LF8L 1S40A 2CTJA 3FAUA 1EY6A 4E9JA 3FPUB 1EY0A 2MGSA 4YY3L 5BR8L 2KVMA 5EKLA 4DXFA 3OSSD 1A3UA 1L0XB 1LT4D 2FFMA 2C9OA 2CW0C 1RF2D 2F0FA 3HOWB 4DV2Q 3CHBD 2QGQA 4KKUA 4LF5H 1RJTA 1I4HA 5EJWA 3T16A 3FMCA 1OXTA 1SYGA 4HCEA 5LHY1 1STGA 3S1QB 1ESFA 4JI8H 4R4QA 3MVVA 4V0BA 2E2HB 5FK9C 4YHHL 4HJ5A 4A3DB 2K5HA 5ELCA 2ZJRA 2R92G 1YIJA 4IUQA 4ZRZA 4A3GB 4IUTA 4JI7Q 3PIP3 1JMCA 2F52A 2ANNA 1YHAA 2D9UA 1XMOH 1KAAA 4A4IA 2Z6KC 3RF2A 4KD3A 4BBSH 1PH8A 1WTQA 2JEBI 4FF3A 1DT4A 2XRSD 5KYIA 3KK7A 3GQBA 3T1YL 1GD7A 1Q8KA 4U673 1E7ZA 1HQMC 2QW7A 1QZGA 4QIWB 1NMFA 4Y7NH 4FDBA 4A3LH 3SGIA 4ZKCB 4G57A 3CCUA 1TY0A 3HGBA 2L12A 3GTLH 4UDUC 1B44D 4LF7L 1STAA 4LF4Q 5T1GA 3C2PA 3F2DA 5FJ8H 5IT9c 4LF8H 3KUPA 1FGUA 5GQOA 4J1MA 4YY3H 2SNSA 1CA5A 1S4ZA 5BR8H 4H7BA 2EIFA 1HR0L 2PO4A 2VQFQ 3HOXG 3MZ5A 2VQEQ 3I4MH 3CCVA 3C1FA 5FO7B 4DUZQ 3OPOA 5DM73 1T5XD 4GN5A 5LMUL 1SN8A 2XRQD 4G08A 1EY7A 2DNCA 3QO2A 1Z6HA 3KF6B 3ND8A 2RF4A 4M1UB 3S17B 2R7ZB 2D9IA 4TVAB 3P75A 2BDOA 5IT9W 1SE2A 4OONA 2XSCA 3CKIB 5IYDG 3T1HQ 1I4RA 2BA0A 2G9DA 4DNIA 2HH2A 2AWNA 5I2YA 5D3IB 1I94Q 2R61A 4IPHA 2EYLA 3AEVA 3H3VI 1X3QA 4JC0A 5JJLA 4A3BH 2RCFA 5EQ0A 4DV6L 4IALA 3LNNA 4EVOA 4C56C 4AQYQ 2Z6KA 1GM5A 3VR2A 2E5LQ 4OO1G 1V8CA 2OEOA 3M4YA 3T1YH 1Q86C 2K1HA 5DLQE 1NXUA 1PZID 3K5OA 4RAUC 5C4XB 4BY7B 4JI2H 1FNVA 5IP9G 1IKMA 1Q46A 2Z6BA 2AUJD 4HEDA 4DV3L 4LF7H 3CAMA 4A75A 1ZYRD 3DWQA 4IUVA 1STYA 2RSNA 1YJNA 3QD7X 4LF5Q 1MHWC 2EZVA 2ASBA 3K57A 3S14H 4DGZA 1WD0A 4JI8Q 1SE8A 4GOPA 1RDPD 1EY8A 1SYEA 2ENBA 2L11A 1G6ZA 4X62H 1QWYA 3E3XA 2DGRA 5LMUH 4G7HC 5C0XJ 1XPOA 4EX5A 4O2DA 4IZ8A 4E6IA 3D31A 2CCZA 2OXPA 2N8NA 3HOZH 1K83B 1Q81C 5EPJA 5M5XB 3A54A 4JI6L 2A68D 3M3YB 2CTKA 1TWGH 2HIXA 1NUCA 4K8IA 1KDBA 1N9WA 1QNUA 5NUCA 3I0PA 3RZDB 3NBIA 3HKZE 4HIOA 2QILA 1YNJD 2N78A 2RDHA 3I4OA 4LUZA 2PW5A 2NVXB 1F9RA 3BVMA 4CDEC 4L5QA 4DV6H 3RZOB 3KDFB 4H44C 4N8FA 1CT1D 1GUGA 2FINB 3Q23A 2LTLA 1X0AA 1Y1VB 2UUCL 5IIFA 1TU2B 4NXNQ 3PV0A 3Q6SA 2IT1A 5ELEA 4JG2A 4FYDA 1LTBD 2B29A 4LF8Q 1DXMA 3PSIA 3FPPA 1NR4A 4HAEA 3PIO3 3S1RB 4YY3Q 1TS4A 2GVBA 2K5VA 2MO0A 4G7ZC 4WRDA 1WJJA 1E22A 2ZXPA 1YITA 5BR8Q 1PV4A 5TSSA 2YV5A 3U1KA 1PFNA 3BZDB 1DCZA 4DV3H 1VQDA 3ZJYC 4LJZC 1N34L 3HOUB 5IY0A 1VQ5A 1HFNA 3JC66 4ZYSA 1I3QH 4AYBE 3HOYB 3VYSA 3KLSX 2FFKB 1EYCA 1PXUA 1OXXK 4FP5D 3S1QH 1G2TA 1EU4A 1CK1A 4YHHQ 2R93G 3H3VC 4UP7A 3J80c 4A3GH 4C3IG 3A8JE 1AP0A 2KCMA 5M5YB 3NQTA 2GA4B 4JI6H 2M2LA 1QZHA 1NNXA 2EDGA 1YJWA 1SMYD 1JOOA 1D7QA 1TWFH 4H02A 4JOIA 1ZTGA 1J5EL 2PW7A 4CKEA 1FGBD 5C5LA 4C3HB 3T1YQ 4RH6A 3J81c 3HOXH 3J80W 4YCWA 1CFMA 3PO3G 3PO2B 4FNFA 1HQRD 1O80A 2OTLA 5IOCA 2CPQA 2NN6I 1CQFA 3E0EA 4HJAA 1IBML 4B9WA 4LF7Q 4LUVA 4XQJA 2UUCH 3DXJC 3IRBA 1Q1BA 2EYMA 2I5HA 4A3IB 2PY9A 4KHZA 2KEDA 2L9HA 4C3JB 5IYDH 3EFXD 5A2QE 2JP1A 4O1NA 3TRZA 1IL2A 2QF7A 1TKWB 3J81W 1JE4A 5AJ3L 1YBYA 3NWTA 1HR0Q 3FKIB 1GJXA 1Z9FA 3VR3A 4DR2L 3S15B 2QA4A 4V190 1N34H 5LMUQ 3HOVB 4DAYB 5CV8A 3CCLA 4OHJA 2UXCL 3S17H 1NSNS 3I55A 2R7ZH 2CH4A 5C44G 4CDFC 1X3EA 5E4XA 1L1OA 4FXKC 1S03G 3CCQA 4OO1H 5DT9A 2WB1E 4EQOA 4EGVA 1EOVA 2K4KA 4ALPA 4J6HA 4HCSA 1E2VA 4RGOS 1NCVA 1RKNA 5I9PA 4EQPA 2JN4A 4R8IA 4X3KA 2NYZD 1CQVA 2Z8LA 2JEAI 3M4OH 5IP9H 2CWHA 4KKSA 1XWEA 1HNXL 4DV6Q 2FPHX 1K8GA 1B4OA 2LSSA 2F0OA 3OTOL 4IOCA 3I4NG 2XNAC 2OTJA 4EQ5A 1EY9A 1X6OA 5KIXA 1J5EH 1EWHA 3K0YA 1PFSA 5IT9E 5JJKA 3DMUA 1H9JA 4GLXA 1I4GA 2Y3MA 1K8AC 2K7VA 1EYAA 3VDYA 3E9HA 1ONLA 2JA8G 4POFA 2EJGC 1CUKA 4JK1C 2UXBL 1B3QA 1JE5A 5EBDA 4MN3A 2F0SA 1IBMH 1HNWL 4JI3H 4OGQC 3GTGH 2VS1A 1XTCD 4DK0A 3K59A 4A3CH 2SEBD 2ZJPA 1PYSB 2I5LX 1NE3A 4RWSC 5M3MG 1ZYRC 4HN7A 1Y14B 2D5DA 2EQSA 1K73C 4DR1L 3K8AA 4DR2H 4AM3A 4R8NA 1Q90A 1SRUA 1LTAD 4ZQ3A 3PF5A 2UXCH 1GUWA 1U4RA 2JA9A 2ZXRA 3KBGA 1HNZL 3J7AF 4JI6Q 3M3YH 4LFBH 1TVXA 1VQOA 1A63A 3TP8A 4A93B 4DR7H 1JQYD 3AQQA 1Z2IA 2A68C 4HJ7A 1MSZA 1WCMB 2YTXA 5HY6A 1BO0A 3NTHA 3FRPB 3JAMc 1F2LA 4BA1I 2G5DA 1EIFA 2NVXH 1FNUA 1YNJC 3L2PA 1HNXH 1BR9A 2VB3X 3RZOH 3OTOH 3DHQA 5JOBA 2F4IA 2OF1A 4X66L 2CTMA 1UE5A 2CQOA 4NBQA 1Y1VH 2UUCQ 5JEAJ 1TWCB 2EY5A 4A3JG 5EKKA 2E75C 1VQJA 1HHVA 2EPBA 3V96A 3K80C 3D3RA 2DJFC 2VB2X 3HKZG 3MAQA 2M6QA 4DR3H 3R8BA 1HPCA 2EYHA 2UXBH 1YNXA 2K50A 3EJIA 4NP5A 3G71A 2Q2TA 1JOQA 1ASYA 3R2TA 4X3SA 1VQPA 4LF9L 3RR5A 4HJ8A 3KDGA 1N34Q 5KYLA 1LV9A 2GN5A 2UUBL 4B8TA 1K3RA 5FO9B 4DUYL 4AYBB 2B2WA 4GN4B 3HOYH 1QCBD 3UDFA 2AKWB 1C9OA 4IQZA 1LLRD 4BXXH 4KK7A 2BH2A 3OYYA 4DR1H 4X65L 3IAYA 3OWFA 1VQAA 4M8AA 4UP9A 5FOBB 5JJZA 4DK1A 2WKCA 3PO3H 1JJ2A 3W5OA 2IL8A 2Z4HA 4DFAA 4B3RL 4IFDG 3DWAA 3KDFA 1VDZA 2L5TA 1HNZH 2BH8A 3PUVA 2ID0A 4APVA 1KLGD 3NP8A 1TS5A 3CCEA 1WHRA 1SMYC 3TQYA 1J5EQ 5EKIA 3O13A 1I6HB 1VF7A 3AB9A 4XYQA 4C3HH 1VCIA 4K5XA 4LW1A 1S5DD 3F2CA 1CZWA 1SNPA 2BL5A 1D5MC 5BN3A 4MIUA 3KLRA 5C3WA 5CC4A 2FJ2A 3GTJB 3A7LA 4X66H 5EAYA 3BYTB 4R4OA 1KABA 2WP8J 1IBMQ 1I6VC 1MJEA 2C35B 3VA5A 1GUTA 4JI4L 2L55A 1JT8A 4ABNA 4NMZA 2K5NA 5AJ3Q 1D5XC 4R4IA 3FKIH 3A56A 4B9XA 1E24A 4DR2Q 1B2TA 2CTLA 2AXYA 2F0UA 4LF9H 4OD6A 2F0PA 1QUQB 2KECA 5C3EB 3J80E 1JR0D 2VQEH 3BU2A 5EPKA 2UUBH 1AZQA 2UXCQ 1E0BA 2O5IC 3OETA 1JWSD 2F0IA 3NPPA 3I4NH 4FJSA 4N8X1 1E2ZA 1G51A 4X6AH 4I7ZC 3FVQA 5D3DA 1QVCA 4X65H 2WB1B 3D6CA 1H9MA 2N49A 5CV7A 1WOCA 1XTDA 2I46A 4B3ML 3T1HH 2Q2UA 1TWHB 3J81E 1EIHA 2JA8H 5JAVA 4B3RH 3DLLA 4I7AA 2N55A 5EGTA 1HNXQ 4DA2A 2F0GA 1K3BC 4JCVE 3OTOQ 4A3FB 4HIKA 1Q3LA 4OELB 2RDFA 3E6ZX 5KNDA 2K04A 2E2JH 3LX0A 4Z9CB 3H6MA 4QB4A 3HOZG 3DEPA 1PH2A 1S3OA 2PZTA 4NXNL 2HIVA 3H0GG 1UG8A 4BBRB 5HGQA 3K0XA 2MO1A 2UXBQ 2QKIC 2WAQG 4DAYA 2M8WA 2HDLA 1JJGA 1IXRA 4IOAA 4F88A 5COYA 3SK6A 1HNWQ 3KOJA 2PPBC 2NVTB 1U9RA 4NB3A 2PCFB 5M3FG 4JI4H 2SDFA 1VQCA 4F87A 2YTVA 4AH6A 3W2DA 1X9ZA 1BCPD 3SHLA 5AFWA 1E1TA 4OX9L 4DR1Q 2LTMA 4P75A 3U9SA 1KHIA 4BY1G 2K1BA 4MZ9A 4POGA 1Y8OB 2MUYA 1TS2A 1C8CA 3C3LA 1Y8PB 3NENA 4C1NI 4JVYA 1HNZQ 1GUNA 4ID6A 1RL2A 3Q0AA 4A3JH 4JVHA 1JJCB 5LMNW 1T9HA 2I5MX 1WCMH 1Y1WB 4B3MH 3HOWG 1PZKD 2LS01 3MXGA 3HP3A 4JI1L 1CHQD 1VBIA 1JWMD 3M7GA 5C4ZA 1EWIA 1HXYD 1BCPF 4K2LA 1BCPB 3GP7A 1PTOD 1HTLD 3X3MA 1L2FA 2PT7G 4CHTB 1GVPA 4WJWA 5CYUA 3GTPB 4A3DG 4X66Q 3L3OC 2XTIA 1H9SB 2KCCA 1Q7YC 1DZ1A 1SJED 4A3GG 4HMIA 1XPRA 3NBHB 4ULLA 4BWGB 3CD6A 4A3EB 1N36L 2BA1A 1U4PA 5IP7G 1VQKA 4QF4A 2RHSB 4GNXB 5A2QL 1IBKL 4NXNH 2B2TC 2F0EA 4NDXA 1YEZA 2JZXA 1NY4A 2VUMB 3HRZC 1PH1A 4LF9Q 4IFDH 1YI2A 3J7AK 1TWAH 4FXGC 4N9PA 1KLUD 3D8GA 2UUBQ 3CMEA 1E1OA 4DUYQ 3EN2A 3CXCA 1XMQL 1M8AA 1PTOF 1PTOB 1S20A 2HCCA 4WALA 4PMWA 4CDCC 4OX9H 3S9WA 5FKAC 4X65Q 2K03A 1WTWA 1J9OA 3ULJA 4YCUA 1KNAA 2F0JA 2E74C 4QJFA 4RKLA 3JAME 4LNQA 2ZT9C 2LMCB 1AE2A 3C46A 4GZYC 4WJ4A 2PNRC 3M4PA 1E3PA 1HTPA 4YHHH 1VIHA 1KDCA 5IGEA 3J7A5 4B3RQ 5I2XA 4LMQD 2F3WA 2B2YC 2JQOA 1SLJA 1V43A 5KRUA 2C5CA 3PIPA 3SB1A 5D14A 1FVIA 2A19A 1EY4A 3CW2C 5CBAE 5BN4A 1A15A 1PZJD 1V1PB 3M4QA 3MFYA 4QQBX 2R7ZG 4K6LA 4JI1H 3HFZB 1CI3M 1S5BD 5IT9L 1FJGL 2VNUD 1J5KA 2JA5B 1MJCA 3HZXA 2ANRA 4L6TB 5C4JB 2UUAL 1VMCA 5I6YA 1ENCA 1SXTA 1PH9A 1UE6A 3D4RA 4IPCA 2KUMA 3BDOA 1AH9A 1Y8NB 3OHXC 4P71A 1SSOA 1N36H 1DTJA 1C7YA 1DGSA 4JI4Q 2E2IH 1B9MA 2X6LA 1N33L 4QL5A 5ELFA 4DK3C 1O7YA 3H09A 2F03A 2B2TA 2JA5G 2NZHA 3RLNA 4XDXA 4XXEA 4DXGA 1NMGA 1SE4A 5C3EH 1HR0H 1K9MC 1UAPA 4O0AA 1AE3A 4TKOB 1VQIA 1XMQH 3IL8A 5C4XG 2ZM6L 4BY7G 2UU9L 4N9TA 4MTKA 1Q1EA 4IJLA 2IPKD 4OWWB 2EE1A 3TMEA 1N32L 3T56B 3TP6A 1AFPA 1N8RC 4B3MQ 4A3CG 4YWLA 2OCEA 3H0GH 1HJPA 4P74A 1STHA 1XNRL 5IODA 3G7LA 4PZ7A 1T5EA 1SE3A 1F9PA 1MD2D 2TSSA 1LT5D 4QUFA 1ZKOA 4RHSA 3KJOA 1SMXA 5F2DA 2CVRA 5M3FH 4LFAL 4CBVA 4IURA 3E9IA 1FJGH 1G6PA 2K5WA 3AFPA 3HKSA 1F2ZA 2QCPX 2UUAH 4KN4C 4A3KB 4BY1H 2CTFA 1QUQA 3PF4A 3R3OA 3GD7A 2WKDA 2A6HD 3M9BA 1CHPD 3W3AA 4PNYA 4KLKA 1ET9A 4OIJA 4A3MB 1XNQL 1I6UA 1VQGA 1DOMA 4L63B 1ENFA 5K36H 1N33H 3K58A 3PGZA 2VL6A 5FO8B 2ATWA 1PH6A 3AU7A 4DNTB 1CKNB 3OWEB 4XTCS 3HOWH 4NZTM 4EC5A 1ZZJA 1S5ED 1LABA 4K5VA 2Q2IA 4OX9Q 4ZUIA 1C4QA 1Y1VG 2VXWA 1ML0D 1BCPC 4HJ9A 1E2WA 4C1NK 2E2HH 2ZM6H 4A3DH 4GS3A 2UU9H 3NELA 2FMMA 1NAPA 2NBFA 2X69A 1VQNA 1UE7A 2CWAA 5BN5A 1O78A 3V2TA 4HSVA 1X4MA 1N32H 4JBWA 2LXKA 3TS2A 3HOUG 4GNXC 2NN6G 5IP7H 1Y1WH 2NVYB 3A55A 2EYJA 5E1FA 3HOYG 4QUCA 4JI1Q 4JBJA 1SEBD 4WORA 3A8KE 2DN8A 1XNRH 3S16B 2XWJB 4BXXG 1XX8A 2AQ3B 3GO5A 3TZDA 3S1MB 1LT6D 2OT2A 4JBKA 1F0XA 4B08A 2NZ1D 2B63B 2PZWA 2WV6D 1DONA 1OXUA 2VY3A 1PTOC 3MXUA 1RHPA 4LFAH 1I50B 3AYHB 3H3VH 4LUOA 3QB3A 1LM0A 2LXJA 4A3EH 1N36Q 1V9PA 3BZKA 2AHOB 4DAPA 1IBKQ 2A8VA 3NE5B 2Y0SE 3DM1A 2I0QA 1EC6A 2IX1A 2VUMH 4C3HG 2B39A 4RGNA 1XNQH 4WANA 1BDOA 3J80L 4NKLA 3GTKB 1IL8A 1QB5D 1XMQQ 2F3IA 3SDZA 3PO2G 1A6XA 1AN7A 2NVQB 4NXML 1R9TB 2F0DA 4X64L 1HRJA 1IYUA 2FHTA 1Y69U 2OQ0A 2ZTDA 4A3IG
chains in the Genus database with same CATH topology
2EXDA 4C3JG 4IFDJ 3J81L 4KY5A 2PI2A 4KHVA 4DAVA 4RMFA 3FKIG 4Q5VA 1LYLA 4CKCA 5H1SE 3NBHA 2E3UA 4ZAIA 4F7XA 1DJRD 3HOVG 3KBXA 3MA2B 2WACA 3SK8A 1WVNA 3TS0A 1YNND 1FJGQ 5FLXc 5I4DA 2JA5H 1PVOA 4QMFB 2VW9A 1X3GA 4CKBA 3UE0A 2SNMA 2UUAQ 2J4XA 3QOJA 3AMUA 1TIID 4ZK9B 1CM9A 2SOBA 3CQZB 1EWCA 3VA7A 2KEEA 1PYBA 5C4XH 4QGUA 4BY7H 4PZ6A 5KNCA 3WDNA 3CP0A 1M90C 5C5MA 3OIQA 1KRTA 2RKSA 3KF6A 3D4WA 4OWXB 1N33Q 4JI0L 3KF8B 3CF5A 3OW7A 2FMCA 5C0XI 1LTLA 2NB0A 3HEJA 1PH3A 2FXQA 4L5RC 1DYQA 3FEWX 1FD7D 4NW2A 4OIKA 1QILA 3J81j 2BOSA 1F9SA 1EQTA 4YIJA 5IYCG 2ZM6Q 1QE6A 2UU9Q 5GAEC 2EVBA 1A8VA 2P2RA 4JBMA 1V1PA 1GHJA 3BJUA 1D6EC 1K83H 2ZTCA 1UNSA 1N32Q 2B8GA 5M5XH 3VKEA 1TQOA 1B1ZA 2WIIB 2K5DA 2EY6A 3IFTA 2MPMA 1XNRQ 1UWVA 3RZDH 2JA6B 4PMBA 2TMPA 1V1OA 3F2UA 3VYTA 1SNOA 3U9OA 1JB3A 4OWTB 1FYCA 4LFAQ 2PI2E 4LF6Q 2FMRA 1SNCA 4L5SA 1S5CD 3BDCA 3U50C 4LFCL 1FNWA 2EYPA 1X55A 3S1NB 1X54A 1HZCA 2MQHA 3TREA 5D65A 2NTSA 2XGTA 4A93G 3R93A 4DAMA 3D4DA 4DR5L 1WCMG 2H1EA 3VR4A 4BBSB 1IBLL 1PYWD 1GUSA 3S1RH 1VQ6A 2PQUA 4MNOA 3BYYB 4A3MH 1XNQQ 2A6HC 1HZAA 4KMUC 4X3TA 2F0MA 4KI0A 4Y7NB 1BF4A 3HOUH 4DV0L 5ELNA 4K0KQ 2NN6H 2YTYA 1EYGA 3AEVB 3GV6A 2D0OA 4HSPA 3M85A 4DV4L 5IGBA 2WINB 3J80i 3JAML 2LKVA 2HDMA 4BS9A 2KA7A 1L0WA 1LTSD 4ME3A 2KJXA 1ASZA 2ALYB 4KTAA 4JV5L 4RHRA 3GTOB 4AIMA 2PZUA 2YQRA 1B3AA 1QVGA 3I4MB 2K75A 2EJFC 5M5YH 1EZ8A 5HGTA 2F4VL 4B3TL 4HIDA 1J4WA 1EU3A 4R4CA 1MSGA 1FL0A 1STNA 1MI2A 2J7ZA 3RD4A 4AYBG 1K0RA 1A3VA 3J81i 3UDIA 2L4NA 2RCNA 1WE8A 4UAIA 1YJ9A 1V1QA 2CQAA 1LUZA 1RIPA 4GKJL 3ULLA 3G48A 1IYJB 4JYAL 3K5MA 3HG9A 1X3FA 1CKOA 1G8ZD 1J8IA 3PO2H 4GOPB 3X3NA 2IW3A 3QIAA 1CKNA 2PMZE 4QMGA 5GROA 4A3BB 1RD9D 4A3IH 1EIGA 3F8TA 4FVMA 2IHFA 4C3JH 4DU9A 1X65A 3ND9A 2Y0SB 3NEMA 1OXSC 4RGTA 3D6WA 2I07B 1SROA 1PHJA 4FF4A 4DR6Q 4IUPA 4PG3A 1YHQA 1BNZA 1KL9A 3GTKH 5JPNC 3S15H 1WTPA 1C48A 1EIYB 4DV7L 3HOVH 4NXMQ 1R9TH 2K5QA 4NPSA 4X64Q 2B2UC 2R7DA 3BDLA 4JI0Q 4UP8A 2NWGA 1KRSA 1B50A 3CC2A 3M7NA 2CFMA 1ILQA 3KFUA 1A2TA 5DEHA 1VF5C 2ES2A 3I90A 2YYZA 3S14B 4DF7A 1IW7D 1TXYA 3CRLC 3K81C 5C3EG 4XQQA 4LK1C 1LTRD 1PA6A 1I4QA 1G2SA 4DV1L 1WYDA 4RCOA 4ZKBB 3C1EA 1XPUA 1J6QA 1Z7TA 2EY1A 3L9AX 1TWGB 1WFQA 1YNNC 2WB1G 3CCMA 1XMOL 1ZEQX 3MFGA 3K7UC 4C2MB 4QCLA 4WFN3 5IYCH 1GUOA 3ITPA 2IWHA 2A5HA 4PQXA 1PH7A 3U58A 2NUCA 1HH2P 2A1AA 2HT1A 1GOZA 3TBIB 4DKAC 2JYOA 5CBEE 1K8MA 4A3FG 3KYHC 2L0CA 3OIPA 2PNHA 1YHBA 2DNEA 1OTCA 4FF1A 1G291 1EL0A 2K52A 1LO5D 3MEHA 4K5WA 4XQNA 5GADC 3IKJA 1XJVA 5M5WB 3G4SA 4BBRG 1ICWA 5ELBA 5JPMC 5E7NA 3NHHA 3MXPA 4XT1B 1WTRA 2R92B 4RCNA 2F0KA 1A62A 2B2UA 4WJ3M 1SNQA 2N88A 4UPAA 5J3BA 3JAMi 1QOHA 3I8ZA 2RDGA 5FLXE 5K36G 1CKMA 1I3QB 4A93H 1TT2A 3SK4A 5JJIA 2ZJQA 4TQUS 1IYVA 2PQAB 1I4PA 4LIJA 2JA6H 3MEFA 1CSPA 1YVCA 1II3A 1F2MA 2KQ3A 3ULPA 3MTSA 2ZTEA 2MJHA 5IWAL 3A8IE 2QEJC 3PUYA 5E4WC 1BVSA 1EQRA 2XN9C 2Z1CA 3KF8A 4LFCQ 1PH5A 5C4HA 3S1NH 3T4AC 2D0PA 2Z4IA 1ET6A 1TWCH 5LMNL 1X32A 2QNDA 1LACA 1FR3A 4DR5Q 1Y1WG 1L1OB 3CCJA 1IBLQ 4GKKL 2JSOA 1TWFB 3PMFA 2A73B 4R1JA 3RN5A 5CORA 4XT3B 3J7ZC 1W3SA 3T53B 1HR0W 2DY8A 3HOXB 2Q8IB 1SJHD 3VR5A 3W1BA 3AFQA 4DV0Q 4JI2L 3DUZA 4GLAC 2IHEA 4KJOA 3IFDA 3PUZA 5GAHC 5HURA 3R2IA 1R4QB 1HA5A 4DV4Q 5DNFA 5KGUA 4A3EG 1BXTA 2OQKA 5G3LD 2OWOA 2A6ED 2PYKA 3I72A 4QY7A 3DM3A 4JI5L 3A74A 5C6AA 2M9VA 3I91A 1VMPA 4JV5Q 2MNAA 2UXDL 4FF2A 2EY2A 1EEFD 3GTOH 4GOPC 1DOKA 4G4KA 4RA8A 2VUMG 3BVZA 2AWOA 4R4TA 2F4VQ 4B3TQ 4X62L 2LFNA 4HMJA 1U4LA 1EQVA 1O7LA 3OW2A 1VQ4A 1SYFA 1GKHA 2ZXOA 1KNEA 1BOSA 2OPUA 1I6HH 3BVGA 1X56A 4GKJQ 1X3PA 3L7ZC 2Q2HA 3GV3A 1AEXA 3STBD 3A0JA 4JYAQ 3A7AB 2JA7B 5G3LF 1SYCA 4PZ8A 1DOLA 2B3GA 2AMCB 1KHMA 2B2VC 1C0AA 2WFWA 2EYOA 5GAGC 3GTJH 3M4OB 3I4LA 4IPGA 1KXLA 2PMZB 5CGKA 1QG7A 3B6YA 2YU9B 2RSOA 5JVH3 4EQNA 2L15A 3V05A 2IJ0A 2BE5D 3RMHA 4KV6A 3SR1A 1WTOA 3TEHB 1STBA 4KHPL 3GTQB 2F0WA 2HQLA 5ELDA 4P2CB 1B8AA 2JA7G 4DK6C 3EBEA 2PQEA 1EZ6A 5C3XA 4DV7Q 1B70B 3OMCA 1BQQT 2KBNA 3QWNA 4ILWA 5LL6X 2KHJA 4K8JA 2G9HD 3GTGB 1VQ9A 3VYRA 1B9NA 1PMRA 2A74C 4OO1I 2RBMA 1M1KC 1TWHH 2KCNA 2L1BA 1A2UA 2VZAA 4K2KA 2F0LA 3CRKC 1B7YB 1IW7C 3LWEA 2B2YA 4IPDA 4H13C 4DV1Q 4A3FH 3Q8DA 3S2DB 4LF6L 2H4OA 4X3UA 3S2HB 4R9WA 4G7OC 1XMOQ 5J22A 4JOIC 4C2MH 4U68A 5JEAH 3MC0B 4ZLTF 4BBRH 4MTNA 2MHVA 1X4NA 2B2VA 1KIXA 3N52A 3FDTA 1XYIA 2BDNA 4K14A 1Q82C 4YCVA 3UDXA 5KNBA 2NVTH 2NTTA 4DR4L 2MJ8A 4K0KL 1V8QA 2F3VA 3MWYW 2F1MA 3HS0C 4GN3B 3H15A 3TN2A 5M5WH 3URYA 4A3KG 1F2YA 3PUWA 4XYOA 2R93B 1OO9B 2R92H 3RUZA 2XVSA 2CWPA 5ELOA 4C3IB 4A3MG 2EXZA 1JC7A 5LL6S 2JK8A 2K28A 4CJ2C 1YZ6A 2LY7A 1L1OC 4HIMA 2A69D 1SYBA 3I3CA 3VYUA 3KJPA 1LTTD 3J7YW 5CV4A 1VQHA 1SFOB 2HHHL 4L8JA 5IWAQ 1PRTD 2X6GA 3U4VA 3PO3B 3W1GA 2K05A 3TP5A 4DV5L 2O5JC 1D5ZC 3K5NA 3GTPH 5DAUA 4DN4M 3E5SA 1D2BA 4B3SL 1SYDA 4ODGA 2Z0SA 3EVQA 3H91A 5LMNQ 3P7JA 1SAPA 2RVLA 4CJ1B 1JICA 1BBWA 4GKKQ 4UY8C 3G6JB 3PIOA 5ISRA 1NR2A 1O7ZA 2K01A 1UUPA 5EPLA 3K7AB 1GO3E 3FP9A 2IY5B 5IYBG 1OXVA 4DR6L 2B63G 1Q8IA 4MHEA 4LAAA 4JI2Q 1X9NA 1W6KA 3OMGA 1VIGA 3MXNB 3I7FA 1PRTF 1PTOH 1PRTB 5C44B 1ZXTA 1HCZA 1Z47A 2PQAA 1TUAA 4JI3L 1PLFA 4J15A 4S3SA 3E0JA 1A3TA 3RLFA 4JI5Q 4P72A 3NWSA 2KCTA 3A5ZB 2A6EC 1Q12A 2UXDQ 3V69A 5IGDA 2B8FA 1RCVD 1P16A 4YWKA 3ERQA 3SEBA 4X62Q 4O42A 1W6JA 4CJ0B 1H9SA 1O7IA 1I4XA 2NZOA 3CCSA 4KN7C 4RGMA 5CV5A 4RFBA 2BCOA 3I4NB 2MP1A 4ME5A 3KLWA 4GNXA 1G91A 4LFBL 1PH4A 4I65A 1NTGA 2JVZA 1S5FD 2IX0A 5C0XG 3Q24A 1VQMA 2V4DA 4DR7L 2JA7H 4Y52H 2OPVA 1CTMA 3OSOA 5C4JH 4TSSA 1EEID 3STBC 2JA8B 2IX3A 3J7AV 2DGYA 1EUJA 4ZUJA 2WAQE 5M9OA 3TP7A 2YU9H 1D8LA 3KLSA 3GTMB 2XWBB 4IUNA 1GHKA 4PV1C 4HTHA 3U4ZA 3L0OA 4KHPQ 5I9OA 3GTQH 3PCOB 2BE5C 2E2JB 5M3MB 3K6OA 3A5UA 3G6EA 1ZZIA 1AZPA 1RTNA 5CMDA 2E2DC 4KD4A 4DR3L 1S72A 2Q8RE 5EBCA 1K1GA 2MFIA 2HUGA 1SR3A 3Q22A 3ERSX 2QDBA 2R7FA 4DV3Q 4KY7A 1RODA 1CZGA 3QG1A 1D1KA 2B2WC 2CW0D 2ICEC 3NXWA 4FO2A 5IGGA 5FLXL 4R8IA 3T13A 3UE1A 5FLMG 1WI5A 1QVFA 1I5FA 3S24A 1TS3A 1AW7A 4DV2L 1GXDC 3D0FA 3UDGA 2DY7A 2RHQB 2CTEA 2QEXA 2EJMA 1KDAA 1JORA 2GVAA 1VQFA 4IO9A 1TY2A 4RG1A 3EROA 2V1CC 2N3SA 3I56A 2H5XA 2F0HA 3S2DH 1SDFA 1PFMA 3ICEA 4IUUA 1SNDA 3F1ZA 2JJQA 1VQ7A 4KY6A 3TZUA 1D1IA 1MKHA 3RNUA 3S2HH 3OOCA 3LGJA 1KC8C 2EYFA 4JI7L 4A3JB 1HUMA 1ESRA 3NK9A 4J8QA 3FHWA 2DUDA 3F2BA 4OXPA 3H94A 4A3KH 1NJIC 5J39A 1PFBA 1JB7A 2K14A 1BUVT 3HKZB 1LT3D 1JOKA 1PDQA 1ILPA 2JA6G 1UE1A 4L5TA 3BG3A 3NSWA 2K32A 1VQLA 4A76A 2Q8TA 3CCRA 4QIWE 4HR7B 1RTOA 2JXMB 4DR4Q 1ENAA 3I70A 1M4VA 1U5KA 4DNRB 4TRDA 1MIUA 3GTLB 2XIWA 1W2BA 1R4PB 1WVLA 1DD2A 2R6GA 1EFWA 3P1HA 5IGFA 1WTXA 1EYDA 4LF4L 4GLVB 4K6DA 2R93H 1H9RA 4BBSG 1H9KA 3CC4A 3EIVA 3RLOA 4C3IH 1SNMA 2D62A 5E3FA 4F8MA 1TWAB 1HFGA 1WTVA 2VQFL 3N6RA 2VQEL 1IKLA 3EA6A 4A3LG 3EQLC 2KENA 2KHSA 4DUZL 3BS1A 1HZ9A 2E8GA 2NVYH 2F0VA 1VS0A 2CKZB 2ICIA 2A69C 3SXHA 3S16H 1SFOH 3S1MH 2HHHQ 3P20A 4RKBA 3UI2A 5IYBH 4IN3A 3I2ZA 2R3ZA 5FJ8G 3T1HL 2HCIA 2HQEA 2B63H 1STEA 1IZ6A 4DV5Q 1HZBA 4YWMA 1DM0B 1BBUA 2F0TA 1JWUD 1JCKB 1PRTC 2K33A 4B3SQ 1I50H 5T1IA 2AQ1B 1I94L 5IGCA 3I4MG 4P73A 1CA6A 5A35A 3SE0A 3BZCA 2O2LD 3LWUA 1EQQA 3I73A 1TR5A 1K8OA 1KQSA 1EY5A 1B53A 3PUXA 3NTIA 5JVG3 4LWCA 3NUCA 3TSSA 3K7AH 4AQYL 1VQ8A 1HUNA 2F0NA 1CSQA 3CPFA 1WD1A 2E5LL 2K6AA 1LTID 2E76C 3SK5A 1A0IA 2CHBD 3NTKA 3VR6A 4IFDI 4DPGA 2J0TD 3SVMA 3WOEA 1BBXC 5DM63 5C44H 2RQXA 2NVQH 2KOLA 2HH3A 4FXDA 1U4MA 4JI3Q 1HA6A 4Q0FA 1MGSA 3NQIA 5CV9A 1U0LA 5C0XH 4A3BG 2E2IB 1F77A 3DEOA 5CV6A 1ZZKA 5J1ZA 3WOFA 1MBYA 2Y0SG 5I6WA 1XXGA 4XIGS 3QJYA 2M00A 3ONAB 5CR3A 3CPWA 2EOTA 2KHIA 4LF5L 1NBWA 5IE8A 1EFID 5K5PA 1IHZA 1QJOA 1P8LA 3MHBA 4JI8L 2O4XA 3CMAA 2RA4A 1VQEA 3WWVA 3RN2A 3CU7A 2D2CC 3ZYYX 3K5LA 4LFBQ 4PMCA 3GDEA 3HOZB 1H95A 3TDQA 1L0YB 1MSHA 2F0QA 4DR7Q 3QOLA 1QNKA 4CGYB 1EOTA 1F9QA 3H0GB 1KAWA 3CQZH 2WAQB 3MXNA 3GTMH 3T51B 2AUKA 4H0LC 1KTKA 1LTGD 3ER0A 4OL7A 5FLMH 1KD1C 5KEEA 1VQBA 4KJNA 5M3FB 2AQ2B 1SBBB 4IJHA 4BA2I 5M3MH 1AN8A 4KKTA 2JE6I 4BY1B 1BKBA 3DWPA 3CC7A 1UEAB 4DR3Q 5JEAG 4LF8L 1S40A 2CTJA 1EY6A 3FPUB 1EY0A 2MGSA 4YY3L 5BR8L 2KVMA 5EKLA 4DXFA 1A3UA 1L0XB 1LT4D 2C9OA 2CW0C 1RF2D 2F0FA 3HOWB 4DV2Q 3CHBD 2QGQA 4KKUA 1RJTA 1I4HA 5EJWA 3T16A 3FMCA 1OXTA 1SYGA 4HCEA 5LHY1 1STGA 3S1QB 1ESFA 4R4QA 3MVVA 4V0BA 2E2HB 5FK9C 4YHHL 4HJ5A 4A3DB 2K5HA 5ELCA 2ZJRA 2R92G 1YIJA 4IUQA 4ZRZA 4A3GB 4IUTA 4JI7Q 3PIP3 1JMCA 2F52A 2ANNA 1YHAA 2D9UA 1KAAA 4A4IA 2Z6KC 4KD3A 4BBSH 1PH8A 1WTQA 2JEBI 4FF3A 1DT4A 2XRSD 5KYIA 3KK7A 3GQBA 3T1YL 1GD7A 1Q8KA 4U673 1E7ZA 1HQMC 1QZGA 4A3LH 4QIWB 1NMFA 4Y7NH 4FDBA 4ZKCB 3SGIA 4G57A 3CCUA 1TY0A 3HGBA 2L12A 3GTLH 4UDUC 1B44D 4LF7L 1STAA 4LF4Q 5T1GA 3C2PA 3F2DA 5FJ8H 5IT9c 3KUPA 1FGUA 5GQOA 4J1MA 2SNSA 1CA5A 1S4ZA 4H7BA 2EIFA 1HR0L 2PO4A 2VQFQ 3HOXG 3MZ5A 2VQEQ 3I4MH 3CCVA 3C1FA 5FO7B 4DUZQ 3OPOA 5DM73 1T5XD 4GN5A 5LMUL 1SN8A 2XRQD 1EY7A 2DNCA 3QO2A 1Z6HA 3ND8A 3S17B 4M1UB 2R7ZB 2RF4A 3KF6B 4TVAB 3P75A 2BDOA 1SE2A 4OONA 2XSCA 3CKIB 5IYDG 3T1HQ 1I4RA 2BA0A 2G9DA 4DNIA 2HH2A 2AWNA 5I2YA 5D3IB 1I94Q 2R61A 4IPHA 2EYLA 3AEVA 3H3VI 1X3QA 4JC0A 5JJLA 4A3BH 5EQ0A 4DV6L 4IALA 3LNNA 4EVOA 4C56C 4AQYQ 2Z6KA 1GM5A 3VR2A 2E5LQ 4OO1G 2OEOA 3M4YA 1Q86C 5DLQE 1PZID 3K5OA 4RAUC 5C4XB 4BY7B 1FNVA 5IP9G 1IKMA 1Q46A 2AUJD 4HEDA 4DV3L 3CAMA 4A75A 1ZYRD 3DWQA 4IUVA 1STYA 2RSNA 1YJNA 4LF5Q 2EZVA 2ASBA 3K57A 3S14H 4DGZA 1WD0A 4JI8Q 1SE8A 4GOPA 1RDPD 1EY8A 1SYEA 2ENBA 2L11A 1G6ZA 1QWYA 2DGRA 4G7HC 5C0XJ 1XPOA 4EX5A 4E6IA 4IZ8A 4O2DA 3D31A 2CCZA 2OXPA 2N8NA 2ZTDA 3HOZH 1K83B 1Q81C 5EPJA 5M5XB 3A54A 4JI6L 2A68D 3M3YB 2CTKA 1TWGH 2HIXA 1NUCA 4K8IA 1KDBA 1QNUA 5NUCA 1N9WA 3RZDB 3NBIA 3HKZE 4HIOA 2QILA 1YNJD 2N78A 2RDHA 3I4OA 4LUZA 2PW5A 2NVXB 1F9RA 3BVMA 4L5QA 3RZOB 3KDFB 4H44C 1CT1D 1GUGA 2FINB 3Q23A 1Y1VB 2UUCL 5IIFA 1TU2B 4NXNQ 3PV0A 3Q6SA 2IT1A 5ELEA 4JG2A 4FYDA 1LTBD 2B29A 4LF8Q 1DXMA 3PSIA 3FPPA 1NR4A 4HAEA 3PIO3 3S1RB 4YY3Q 1TS4A 2GVBA 2K5VA 2MO0A 4G7ZC 4WRDA 2ZXPA 1E22A 1WJJA 1YITA 5BR8Q 1PV4A 5TSSA 2YV5A 3U1KA 1PFNA 3BZDB 1DCZA 1VQDA 3ZJYC 4LJZC 1N34L 3HOUB 5IY0A 1VQ5A 1HFNA 3JC66 4ZYSA 1I3QH 4AYBE 3HOYB 3VYSA 3KLSX 2FFKB 1EYCA 1PXUA 1OXXK 4FP5D 1G2TA 3S1QH 1EU4A 1CK1A 4YHHQ 2R93G 3H3VC 4UP7A 3J80c 4A3GH 4C3IG 3A8JE 1AP0A 2KCMA 5M5YB 3NQTA 2GA4B 2M2LA 1QZHA 2EDGA 1YJWA 1SMYD 1JOOA 1D7QA 1TWFH 4H02A 4JOIA 1ZTGA 1J5EL 2PW7A 4CKEA 1FGBD 5C5LA 4C3HB 3T1YQ 4RH6A 3J81c 3HOXH 4YCWA 1CFMA 3PO3G 3PO2B 4FNFA 1HQRD 1O80A 2OTLA 5IOCA 2CPQA 2NN6I 1CQFA 3E0EA 4HJAA 1IBML 4B9WA 4LF7Q 4LUVA 4XQJA 3DXJC 3IRBA 1Q1BA 2EYMA 4A3IB 2I5HA 2PY9A 4KHZA 2KEDA 2L9HA 4C3JB 5IYDH 3EFXD 5A2QE 2JP1A 4O1NA 3TRZA 1IL2A 2QF7A 1TKWB 1JE4A 5AJ3L 3NWTA 1YBYA 1HR0Q 3FKIB 1GJXA 1Z9FA 3VR3A 3S15B 4DR2L 2QA4A 4V190 5LMUQ 3HOVB 4DAYB 5CV8A 3CCLA 4OHJA 2UXCL 3S17H 1NSNS 3I55A 2R7ZH 5C44G 1X3EA 5E4XA 1L1OA 4FXKC 3CCQA 4OO1H 4EQOA 2WB1E 4EGVA 1EOVA 2K4KA 4ALPA 4J6HA 4HCSA 1E2VA 4RGOS 1NCVA 1RKNA 5I9PA 4EQPA 4X3KA 2NYZD 1CQVA 2Z8LA 2JEAI 3M4OH 5IP9H 4KKSA 1XWEA 1HNXL 4DV6Q 1K8GA 1B4OA 2LSSA 2F0OA 3OTOL 4IOCA 3I4NG 2XNAC 2OTJA 4EQ5A 1EY9A 5KIXA 1X6OA 1EWHA 3K0YA 5IT9E 1PFSA 5JJKA 3DMUA 1H9JA 4GLXA 1I4GA 1K8AC 2K7VA 1EYAA 3VDYA 3E9HA 1ONLA 2JA8G 4POFA 2EJGC 1CUKA 4JK1C 2UXBL 1JE5A 5EBDA 4MN3A 2F0SA 1HNWL 4OGQC 3GTGH 2VS1A 1XTCD 4DK0A 3K59A 4A3CH 2SEBD 2ZJPA 1PYSB 2I5LX 1NE3A 4RWSC 5M3MG 1ZYRC 4HN7A 1Y14B 2D5DA 2EQSA 1K73C 4DR1L 3K8AA 4AM3A 4R8NA 1Q90A 1SRUA 1LTAD 4ZQ3A 3PF5A 1GUWA 1U4RA 2JA9A 2ZXRA 3KBGA 1HNZL 3J7AF 4JI6Q 3M3YH 1TVXA 1VQOA 1A63A 3TP8A 4A93B 1JQYD 3AQQA 2A68C 4HJ7A 1WCMB 2YTXA 5HY6A 1BO0A 3NTHA 3FRPB 3JAMc 1F2LA 4BA1I 1EIFA 2NVXH 1FNUA 1YNJC 3L2PA 1BR9A 2VB3X 3RZOH 3DHQA 5JOBA 2F4IA 2OF1A 4X66L 2CTMA 1UE5A 2CQOA 4NBQA 1Y1VH 2UUCQ 5JEAJ 1TWCB 2EY5A 4A3JG 5EKKA 2E75C 1VQJA 1HHVA 2EPBA 3V96A 3K80C 3D3RA 2VB2X 3HKZG 3MAQA 3R8BA 1HPCA 2EYHA 1YNXA 2K50A 3EJIA 4NP5A 1JOQA 3G71A 2Q2TA 1ASYA 3R2TA 4X3SA 1VQPA 4LF9L 3RR5A 4HJ8A 1N34Q 5KYLA 1LV9A 2GN5A 2UUBL 4B8TA 1K3RA 5FO9B 4DUYL 4AYBB 2B2WA 4GN4B 3HOYH 1QCBD 3UDFA 4IQZA 1C9OA 2AKWB 1LLRD 4BXXH 4KK7A 2BH2A 3OYYA 4X65L 3IAYA 3OWFA 4M8AA 5FOBB 5JJZA 1VQAA 4UP9A 4DK1A 2WKCA 3PO3H 1JJ2A 3W5OA 2IL8A 2Z4HA 4DFAA 4B3RL 4IFDG 3DWAA 3KDFA 1VDZA 2L5TA 2BH8A 3PUVA 2ID0A 4APVA 1KLGD 3NP8A 1TS5A 3CCEA 1SMYC 3TQYA 1J5EQ 5EKIA 3O13A 1I6HB 1VF7A 3AB9A 4XYQA 4C3HH 1VCIA 4K5XA 4LW1A 1S5DD 3F2CA 1CZWA 1SNPA 2BL5A 1D5MC 5BN3A 4MIUA 3KLRA 5C3WA 5CC4A 2FJ2A 3GTJB 3A7LA 5EAYA 3BYTB 4R4OA 1KABA 2WP8J 1IBMQ 1I6VC 1MJEA 2C35B 3VA5A 1GUTA 4JI4L 2L55A 1JT8A 4ABNA 4NMZA 2K5NA 5AJ3Q 1D5XC 4R4IA 3FKIH 3A56A 4B9XA 1E24A 4DR2Q 1B2TA 2CTLA 2AXYA 2F0UA 2F0PA 1QUQB 2KECA 5C3EB 3J80E 1JR0D 5EPKA 3BU2A 1AZQA 2UXCQ 1E0BA 2O5IC 1JWSD 2F0IA 3NPPA 3I4NH 1E2ZA 1G51A 4X6AH 4I7ZC 3FVQA 5D3DA 1QVCA 2WB1B 3D6CA 1H9MA 2N49A 5CV7A 1WOCA 1XTDA 2I46A 4B3ML 2Q2UA 1TWHB 3J81E 1EIHA 2JA8H 5JAVA 3DLLA 5EGTA 2N55A 1HNXQ 4DA2A 2F0GA 4JCVE 4A3FB 3OTOQ 4HIKA 1Q3LA 2RDFA 3E6ZX 5KNDA 2K04A 2E2JH 3LX0A 4Z9CB 3H6MA 4QB4A 3HOZG 3DEPA 1PH2A 1S3OA 2PZTA 4NXNL 2HIVA 3H0GG 4BBRB 5HGQA 3K0XA 2MO1A 2UXBQ 2QKIC 4DAYA 2WAQG 2HDLA 1JJGA 1IXRA 4IOAA 4F88A 5COYA 3SK6A 1HNWQ 3KOJA 2PPBC 2NVTB 1U9RA 4NB3A 2PCFB 5M3FG 2SDFA 1VQCA 4F87A 2YTVA 4AH6A 3W2DA 1BCPD 3SHLA 5AFWA 1E1TA 4OX9L 4DR1Q 4P75A 3U9SA 1KHIA 4BY1G 2K1BA 4MZ9A 4POGA 1Y8OB 2MUYA 1TS2A 1C8CA 3C3LA 1Y8PB 3NENA 4C1NI 4JVYA 1HNZQ 1GUNA 4ID6A 3Q0AA 1RL2A 4A3JH 4JVHA 1JJCB 5LMNW 1T9HA 2I5MX 1WCMH 1Y1WB 3HOWG 1PZKD 2LS01 3MXGA 3HP3A 4JI1L 1CHQD 1JWMD 3M7GA 5C4ZA 1EWIA 1HXYD 1BCPF 4K2LA 1BCPB 3GP7A 1PTOD 1HTLD 3X3MA 1L2FA 4CHTB 1GVPA 4WJWA 5CYUA 3GTPB 4A3DG 4X66Q 3L3OC 2XTIA 1H9SB 2KCCA 1DZ1A 1Q7YC 1SJED 4A3GG 4HMIA 1XPRA 3NBHB 4ULLA 4BWGB 3CD6A 4A3EB 1N36L 2BA1A 1U4PA 5IP7G 1VQKA 4QF4A 2RHSB 4GNXB 5A2QL 1IBKL 2B2TC 2F0EA 4NDXA 1YEZA 2JZXA 1NY4A 2VUMB 3HRZC 1PH1A 4IFDH 4LF9Q 1YI2A 1TWAH 4FXGC 4N9PA 1KLUD 3D8GA 2UUBQ 3CMEA 1E1OA 4DUYQ 3EN2A 3CXCA 1XMQL 1M8AA 1PTOF 1PTOB 2HCCA 4WALA 4PMWA 3S9WA 5FKAC 4X65Q 2K03A 1WTWA 1J9OA 3ULJA 4YCUA 1KNAA 2F0JA 2E74C 4RKLA 3JAME 4QJFA 4LNQA 2ZT9C 2LMCB 3C46A 4GZYC 1AE2A 4WJ4A 2PNRC 3M4PA 1HTPA 1E3PA 1VIHA 1KDCA 5IGEA 3J7A5 4B3RQ 5I2XA 4LMQD 2F3WA 2B2YC 2JQOA 5KRUA 1V43A 1SLJA 2C5CA 3PIPA 5D14A 1FVIA 5CBAE 1EY4A 2A19A 3CW2C 5BN4A 1A15A 1PZJD