5C0XG

Structure of a 12-subunit nuclear exosome complex bound to structured rna
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
237
structure length
237
Chain Sequence
MSTFIFPGDSFPVDPTTPVKLGPGIYCDPNTQEIRPVNTGVLHVSAKGKSGVQTAYIDYSSKRYIPSVNDFVIGVIIGTFSDSYKVSLQNFSSSVSLSYMAFPNASKKNRPTLQVGDLVYARVCTAEKELEAEIECFDSTTGRDAGFGILEDGMIIDVNLNFARQLLFNNDFPLLKVLAAHTKFEVAIGLNGKIWVKCEELSNTLACYRTIMECCQKNDTAAFKDIAKRQFKEILTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/rna
molecule keywords Exosome complex component RRP45
publication title RNA degradation paths in a 12-subunit nuclear exosome complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae s288c
total genus 43
structure length 237
sequence length 237
ec nomenclature
pdb deposition date 2015-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF15985 KH_6 KH domain
G PF18311 Rrp40_N Exosome complex exonuclease Rrp40 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5c0xG01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5c0xG02
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 5c0xG03
4JI7L 4K0KQ 4X62Q 3L7ZC 4UP7A 2UUAL 3H94A 3M85A 1BKBA 3HOXG 4A3LG 3JC66 3KF8B 2EIFA 1Y14B 2RCNA 3HOUG 1ZZJA 1FYCA 2VZAA 1W2BA 2WB1E 1GKHA 1VIHA 1OTCA 3S15H 2BDOA 4IJLA 1C7YA 1PH5A 2JA6G 2WP8J 3ND9A 2A8VA 3E0EA 1VQHA 4YCVA 5C4XH 5HGQA 4GNXC 2I5HA 2K33A 4NXMQ 4IO9A 2JK8A 1Y1VG 1X56A 1GHKA 3LWUA 5LMUQ 2ZTCA 3T1YQ 1H9KA 2MNAA 4A3EG 2E2HH 3H3VI 2CWPA 2JA9A 3S16H 1FGUA 4B3TL 4QJFA 3PV0A 1GM5A 1G51A 1E24A 1PH4A 3H0GH 1WJJA 1OXVA 4IJHA 3A8IE 4L5RC 5FLMG 1H9SA 3CCMA 4PMWA 1BDOA 4DV5Q 3BJUA 2R7ZG 4APVA 2ATWA 2KENA 2HHHQ 4IOCA 3GD7A 3T53B 4X65L 4LF4Q 5IYDH 4HR7B 3EIVA 4DNTB 3S1NH 1Z47A 2ANRA 1R9TH 3KLWA 4A3CG 4AQYL 1Z6HA 4IPCA 1VQDA 2Q2UA 1SMXA 3IFTA 4X66L 4A3MH 1YVCA 3NENA 4A3KH 5ELOA 1L0WA 1VQEA 1LM0A 1N32Q 4YY3Q 1CKNA 2JQOA 2B63G 1EUJA 3PIPA 1Q1EA 1L1OA 3CF5A 2YTYA 2UUCL 1X55A 1X65A 4G7OC 2PNRC 4RMFA 3JAMi 2JA7H 4LF5L 3T1HQ 3L2PA 4BY1H 4BBSH 3S2HH 3NBHB 2CTFA 2B8FA 4BBRH 2OTLA 3GTMH 2WB1G 1YITA 3PF4A 2A6ED 1UE6A 3KOJA 3S24A 3CCVA 2NVXH 4JOIC 2Q2HA 2GN5A 4DNRB 4LUVA 4IFDH 4UPAA 4A3DG 1VIGA 1YBYA 3BZCA 1B7YB 4LWCA 4P75A 5JEAH 4LFCL 1YHAA 3PSIA 1YI2A 1TU2B 2K7VA 3ND8A 4QIWE 4NXNL 4QQBX 2IHEA 1VQOA 1K9MC 5M5WH 3IKJA 1G6PA 4I7ZC 1J6QA 4GLAC 3E9IA 5IYBG 2LSSA 4YHHQ 4LF7L 1CTMA 4KKUA 2NN6H 4JI2Q 5C4XG 4XTCS 4B3SQ 3G4SA 2B8GA 3S1QH 3D4RA 1QVFA 4X64Q 4IOAA 3KDFB 4DV1Q 2QEXA 2B3GA 2HQLA 4DR5L 1H9JA 4HIKA 3H0GG 1IBML 2VUMH 4DR1L 2R93H 1KRSA 1HR0Q 1BVSA 1LTLA 4IQZA 1FJGQ 2DGRA 3I4NH 1XMQL 3GTLH 3W3AA 2ZM6L 2A19A 4JI8Q 3M9BA 2AUJD 2PI2E 2R92H 1JB7A 1E2VA 2P2RA 4DV3L 4A4IA 3J7A5 2KBNA 4UP8A 1GHJA 3MEFA 1EWIA 3FKIG 4H44C 3BDOA 3W1BA 4A3KG 1Q86C 1ASYA 3CCRA 3AB9A 3NELA 4LJZC 3TQYA 4A3FG 2N8NA 4DR3Q 1G291 2PY9A 4JI3L 5M3MG 1IBLL 2N3SA 2UXDL 1A0IA 1LUZA 1M90C 1EWHA 4DR2Q 3TEHB 3TRZA 4OWWB 1OXXK 4JI1Q 1UEBA 2CFMA 3BZKA 3LNNA 2A6EC 1K8OA 1MJEA 3I56A 4GKKQ 3CXCA 4UY8C 2OWOA 4JI0L 4PZ7A 5GAHC 4AYBG 3RN5A 1HZCA 1V9PA 2F4VQ 1X3FA 3HOXH 2IX1A 3UDGA 4GKJL 4A3LH 4IFDG 2UXBQ 1VQ6A 3HOUH 3S2DH 1EQQA 2I0QA 4LNQA 1SFOH 3GTJH 3HFZB 1GUSA 3U50C 1K8AC 4L5QA 1W3SA 1TWGH 1X4MA 5IT9c 4A3JG 2JA6H 4PZ8A 2NZOA 2O5IC 4ALPA 3OW7A 4GNXA 4P73A 1SN8A 2NN6G 2KCMA 3WWVA 2A69D 2IT1A 4LK1C 1KRTA 1D7QA 4IFDI 1QVGA 1XMOQ 4XIGS 2K75A 1VQ7A 4LUZA 4G7HC 5GAEC 4A3EH 4ME3A 1T5EA 4WANA 2YYZA 1HZAA 1PH6A 3PGZA 4DV2L 2QF7A 4LF8Q 1SROA 3BU2A 4YCUA 3RZOH 4IPHA 2IY5B 3KJPA 1VQPA 3U1KA 2E3UA 4L5TA 2NN6I 3CCEA 2A68D 3KLRA 4BXXG 4A3GG 1OXSC 4DR4L 1VQ9A 1B9MA 4NB3A 1CKOA 4O0AA 3T51B 3HOYH 1VQIA 2MO0A 1I6HH 4DV7Q 3HGBA 2BA1A 1N9WA 4POFA 4JI4L 1L2FA 2ZJQA 2JZXA 3A5UA 4TVAB 1QVCA 4A3IG 1IZ6A 1TUAA 1T9HA 2B63H 1X3GA 3H15A 1IBKQ 4LW1A 4P74A 3CC2A 3CQZH 1PH1A 4BY7G 1CKNB 4JBWA 4YWLA 1X54A 1YHBA 1O78A 4DV5L 4DV0L 1CI3M 2DUDA 3B6YA 4DR6Q 2HIVA 1QZGA 1A63A 2CW0C 3I7FA 1V8QA 3Q8DA 3NE5B 2CTEA 2ZJRA 1JE5A 2BH2A 1XTDA 3PUXA 1MKHA 4HJ5A 4B3RQ 2PNHA 1K3RA 1V1QA 2PI2A 4BA2I 4WALA 1FR3A 2AMCB 4JOIA 3I2ZA 1WE8A 1NBWA 1HZBA 1K83H 3CCUA 1BBUA 4DK3C 2DGYA 4A3DH 3VA7A 3AEVA 4JI6Q 2D5DA 5IWAQ 5KNDA 2VQEQ 1HJPA 1XPOA 2VNUD 5C44H 3KF6A 1K73C 2A69C 3T1HL 4DV4Q 3OTOQ 3D0FA 5ELNA 5IYBH 2ZT9C 1HCZA 4QGUA 2VW9A 1N34L 1YIJA 2E5LQ 3HOZG 3RLNA 5AJ3Q 1XNRQ 1U5KA 1N36Q 2YQRA 1Q7YC 1EIFA 2E2JH 4JG2A 2AUKA 1VQGA 3GTPH 3KYHC 3PIOA 3U4ZA 4DR7L 1HNZL 5K36G 3STBD 5IY0A 1E3PA 2A68C 4GS3A 4B3ML 2Y0SG 4BA1I 3CCQA 1HPCA 1VQKA 4LF9Q 4Y7NH 3G48A 1WCMG 3A5ZB 1VQ4A 1QJOA 3N6RA 1N33L 1ZZIA 4OGQC 4OX9Q 3GDEA 4AM3A 3MXUA 4GN4B 4B8TA 1Z9FA 3GTGH 4JYAQ 1NTGA 3M4OH 3HOYG 4HJ7A 3ER0A 4YHHL 4R4QA 4R1JA 1PV4A 2VS1A 4DPGA 4C3JH 3CC7A 3RLFA 1HNWQ 5JEAJ 2C35B 2JVZA 4TKOB 2RHSB 2ZJPA 3FKIH 4X64L 3W1GA 3I72A 1Z7TA 2KA7A 2JEAI 2UUBQ 4R4IA 1EC6A 1JJCB 4P71A 2ZTDA 5FJ8G 1J5EL 4JI7Q 4A3FH 3RR5A 1VQ5A 2UUAQ 2IHFA 2XGTA 1KC8C 4LIJA 5M3MH 1GUGA 1C0AA 1VQCA 3UE0A 2L15A 3EQLC 2OQKA 4HJAA 5C0XJ 2LMCB 2ALYB 1VQ8A 5E7NA 1PH3A 2HIXA 1WI5A 1YJNA 1A8VA 4JI5L 2CTKA 3TZUA 1HH2P 1GD7A 3HKZE 3PF5A 2MQHA 1Y1WG 4GOPB 3TREA 1I6VC 3A7AB 4B3TQ 4DR3L 1YZ6A 4KHPQ 1XNQL 2VY3A 5C44G 2JE6I 1P16A 1LYLA 1JMCA 1Y8OB 3P20A 3A74A 4A3JH 1Y69U 4JI1L 2PQAB 1I94L 4DUZQ 1B9NA 1D8LA 1E2ZA 4HJ9A 4X65Q 5IYCG 2OPVA 3S17H 4C3HH 3STBC 1CKMA 4KI0A 4AQYQ 1SE8A 2V4DA 2MJHA 1XPUA 4X66Q 2AKWB 2QNDA 3AFPA 4JV5L 1MJCA 2EJGC 1IL2A 1UE5A 2L5TA 4BXXH 2HT1A 4A3GH 3U58A 1QZHA 1SMYC 1YNJC 1B70B 5EAYA 4DV6L 1HQMC 2I5MX 2D0PA 3EBEA 2UUCQ 4YWKA 2YTVA 2Q2IA 1NMFA 2E76C 4LF5Q 4DKAC 5BR8Q 2WFWA 3CPFA 2K5VA 2KHJA 4H13C 1MIUA 3J80c 5C3EH 2RHQB 1JJ2A 4LFAL 2AWNA 3A7LA 1GUOA 4A3IH 1HNXL 1A6XA 2D0OA 4LF8L 1ASZA 1GUNA 3I55A 4BY7H 2PQUA 3OW2A 1JT8A 4HIDA 4WJ3M 1TKWB 3QJYA 3F8TA 1NMGA 4DUYL 3PUYA 3NEMA 1EOVA 1O7IA 3AFQA 4LFCQ 3VR2A 1PVOA 1L1OC 3HKZG 2LXJA 2BE5D 4NXNQ 2E74C 2RF4A 3HOWH 4LF6L 2R6GA 3G6EA 4DV7L 4LF7Q 4RCNA 4OO1H 2UXCL 3CCSA 4DAMA 3PUZA 3F2CA 5IP9H 2DNCA 3VR3A 3F2DA 3K7AH 4IPGA 4KKTA 3CW2C 1AH9A 3GTKH 4DR5Q 1WFQA 4NPSA 2EQSA 1K8MA 1J5KA 1IBMQ 3A8KE 4KLKA 1NE3A 1TWFH 2IX0A 4DR1Q 1VF5C 3ULJA 3K0XA 3QG1A 1CSPA 2OQ0A 1PA6A 2K4KA 3HOZH 1XMQQ 1AE3A 2Q8IB 2ZM6Q 1HTPA 4DV3Q 4K0KL 4X62L 3I4MG 5K36H 3M7NA 2VQFQ 3GTOH 1YHQA 3CPWA 4PZ6A 3CD6A 3I73A 1PYSB 2F3IA 5FLXc 4MTNA 1H9SB 1WCMH 2K50A 1LACA 5M3FG 1WYDA 3FPPA 1VQFA 4L8JA 4KN7C 3CAMA 3W5OA 3SDZA 4EX5A 1IYVA 3TS0A 3RN2A 4JBKA 5GROA 1TWCH 5LMNQ 1IBLQ 2UXDQ 2EVBA 2H5XA 1OXUA 3V69A 2ES2A 5AJ3L 4TQUS 2JA5G 4NXML 1H9RA 5C3EG 1N36L 2YTXA 4AIMA 5LMUL 3T1YL 3HOVG 4DNIA 4P72A 3J81c 1X4NA 2UU9Q 5FJ8H 2OTJA 4PV1C 2JJQA 1CSQA 4GN3B 4JI0Q 2K5NA 2CPQA 1VF7A 1KHMA 4A3BG 4GKJQ 1L1OB 1FL0A 2CTMA 4GN5A 3F2BA 2QGQA 1E7ZA 2OPUA 2HHHL 1XPRA 3ZJYC 5IP7G 2YV5A 2FMRA 1VQBA 4LF4L 3E9HA 4JVHA 3UDIA 1VS0A 3HOWG 5J3BA 5BN4A 1Q1BA 1IXRA 4JCVE 1E1TA 2Q2TA 4A93G 4OO1G 1NJIC 2F52A 4OONA 1VDZA 1KXLA 4C2MH 2EJMA 3L0OA 3ULLA 5IP9G 4OWXB 1N32L 4YY3L 1Q12A 2R7FA 3IRBA 1Y1WH 2CTJA 3PO2H 1VQJA 1X9NA 3OPOA 1ONLA 4DAYB 4DV2Q 1HR0W 3LGJA 3I4OA 4GOPC 4LFBQ 1I5FA 2N49A 5HY6A 4OO1I 2LXKA 1PYBA 4Y52H 4IPDA 4A75A 5IYCH 4DR4Q 2JA8H 5KNCA 1GO3E 4POGA 3S1RH 1IYUA 1GVPA 1N8RC 3QIAA 5JJLA 1IYJB 2K32A 4JI4Q 2WAQE 1FVIA 3K7UC 3TS2A 3OOCA 1Y8NB 4KHPL 3A8JE 2ZTEA 1LABA 3PO3G 1HZ9A 3D31A 2VL6A 2K14A 1B8AA 4HIOA 2E75C 1SR3A 4YWMA 4IFDJ 3K81C 3PCOB 4DV0Q 4JI2L 1YJWA 4B3SL 3FMCA 4DUZL 3PUVA 4X6AH 1EFWA 4QMFB 3VR4A 2XTIA 3MFYA 2OCEA 4DV1L 2GVBA 3CRLC 1S72A 5A35A 1K8GA 3A0JA 4JBJA 2B29A 3ICEA 4DK1A 1IW7D 2NVTH 1WOCA 1HR0L 1SRUA 1PH2A 1FJGL 2CTLA 1DD2A 1QUQA 2Z6KC 3VKEA 1H95A 4JI8L 2V1CC 1UE7A 1VCIA 4A76A 3DM3A 4J15A 2K5HA 3ULPA 1V43A 5IE8A 5BR8L 1SLJA 2KHIA 1N34Q 4DK6C 3CC4A 2HH3A 1I50H 1YJ9A 5DLQE 3G71A 2F1MA 1ZZKA 2MO1A 3UDFA 1UWVA 4C3IH 1GUTA 2EXDA 3PO2G 4GLVB 2R7DA 4DR7Q 1HNZQ 3AYHB 1DCZA 1PH7A 4B3MQ 1DGSA 1S40A 4DR2L 3PUWA 1M1KC 3RLOA 1KD1C 1N33Q 3J80i 2CKZB 2K52A 5LMNW 1Q8KA 2PMZE 4AYBE 1ZKOA 4GNXB 2WAQG 5BN3A 2JA8G 4RG1A 1I3QH 3VR6A 4GKKL 3UDXA 1CFMA 5C4JH 3JAMc 1JJGA 3I4MH 1C9OA 2F4VL 4KHZA 4FDBA 4LUOA 4EQ5A 2QA4A 2UXBL 1NY4A 3J81j 1YNNC 4R4TA 2ASBA 2GVAA 3U9SA 3M4PA 4GLXA 2CQOA 5M3FH 1Y8PB 1J5EQ 5C0XH 1TWAH 1EQRA 1VQMA 3CCJA 1BBWA 1A62A 1RL2A 1Q46A 2NVYH 2FXQA 5H1SE 1DXMA 2JA5H 1E22A 1XMOL 3CMEA 3AQQA 5IYDG 3F1ZA 3HOVH 2E2IH 4NBQA 1IW7C 3M4YA 1VQNA 2VQFL 4L5SA 1E1OA 1YEZA 2O5JC 5M5XH 3T56B 4JI5Q 2JEBI 1PFSA 4A3BH 4A3MG 3ERSX 3SGIA 1PMRA 3J7ZC 4R4CA 1PHJA 5IP7H 1H9MA 2NVQH 1VQAA 1X6OA 5GQOA 2CWAA 3SE0A 3BG3A 2AXYA 1XNQQ 2KCCA 1K1GA 1PH9A 1AE2A 2PPBC 5LMNL 1GJXA 3WDNA 3CRKC 2JA7G 1KHIA 2PCFB 4BY1G 4A93H 5M5YH 2E8GA 2D62A 1I94Q 4BBSG 4QY7A 4H0LC 2A6HD 3OYYA 2UU9L 1KL9A 4BBRG 1IBKL 1EIYB 5BN5A 3DLLA 2BH8A 3UE1A 1K0RA 2EDGA 3AEVB 4KKSA 2KCTA 4H02A 2DNEA 4GOPA 3CP0A 4DR6L 1PH8A 1UE1A 1XJVA 2N78A 2AHOB 3RZDH 2ANNA 3KF6B 5JEAG 3H3VH 4JV5Q 4JVYA 4JBMA 4QL5A 1ZTGA 4OXPA 4B3RL 5JJKA 3M4QA 3J81i 4DV6Q 2PQAA 4G7ZC 2ID0A 1TWHH 3I4LA 2EJFC 3KDFA 1Y1VH 1OXTA 1U0LA 3GQBA 4YCWA 4LFAQ 4AH6A 4MNOA 3K8AA 2DN8A 1TXYA 3KJOA 1DT4A 3U4VA 2BL5A 1VQLA 3CMAA 4JI6L 1ZYRC 1E2WA 1HNXQ 2Z0SA 5JJIA 1KQSA 5IWAL 2VQEL 4PG3A 5C0XG 4WJ4A 2VUMG 2A1AA 3HKSA 3PO3H 5FLMH 2R93G 4LFBL 4JI3Q 4DV4L 3OTOL 4R4OA 2R7ZH 2AWOA 1Q90A 4DK0A 4GZYC 4DUYQ 2E5LL 1KAWA 3I4NG 1XNRL 2MFIA 3RNUA 1WVNA 1X3EA 3S1MH 1EYGA 2R92G 2Y0SE 4JC0A 4LF6Q 1CUKA 2CCZA 1Q82C 5C0XI 3VR5A 4A3CH 5KNBA 2UXCQ 1DTJA 3GTQH 4JK1C 2D2CC 4KN4C 2BA0A 3KFUA 4HJ8A 3CCLA 4LF9L 4O2DA 4MZ9A 3FP9A 2BE5C 4OX9L 3MXNB 2Z6KA 2HH2A 4KMUC 4UP9A 1KIXA 3GO5A 4JYAL 3DXJC 1QUQB 1P8LA 1RIPA 3M3YH 1HNWL 1Q81C 2A6HC 4OWTB 3K80C 2I5LX 3VDYA 4HIMA 2NZHA 1O7LA 5GADC 1S3OA 1J4WA 3EN2A 2JXMB 3FHWA 1YNXA 2UUBL 5GAGC 3S14H 2YU9H
chains in the Genus database with same CATH superfamily
2HDLA 1PLFA 4JI7L 1VMCA 3IL8A 3R2IA 4K0KQ 4X62Q 3L7ZC 1AFPA 4UP7A 2RDFA 3NUCA 1F77A 5EKIA 2UUAL 3H94A 3M85A 1BKBA 2RDGA 3HOXG 4A3LG 1V1PB 3JC66 1I4HA 3KF8B 3X3MA 1ENFA 2EIFA 1Y14B 2AQ2B 2RCNA 4JI0H 1TWCB 3HOUG 4K6LA 1ZZJA 1FYCA 2B2TA 2VZAA 1LTAD 1SXTA 4GKJH 1W2BA 2WB1E 1GKHA 5JVH3 1BUVT 1VIHA 3CKIB 1OTCA 3S15H 2BDOA 4CDEC 1BCPD 4IJLA 4CHTB 3K58A 3GKUA 1C7YA 1SYEA 1NSNS 1SNCA 1SNMA 2WIIB 1PH5A 1LTGD 5D14A 2JA6G 2WP8J 1EY8A 2M9VA 2X69A 3ND9A 2A8VA 3E0EA 2F0VA 1VQHA 4YCVA 5C4XH 2IWHA 5HGQA 4GNXC 3Q6SA 2I5HA 2K33A 4NXMQ 4IO9A 2JK8A 1Y1VG 1OO9B 1X56A 1GHKA 3VYSA 2J4XA 3FDTA 3LWUA 5LMUQ 5IT9E 2EE1A 1UNSA 2ZTCA 1D5MC 3T1YQ 1H9KA 1F9PA 2MNAA 2Z4HA 4A3EG 5CC4A 4CKCA 2E2HH 3H3VI 2CWPA 4FYDA 4R9WA 2JA9A 3S16H 1FGUA 4B3TL 2WINB 1Q8IA 3PV0A 4QJFA 1GM5A 5D3IB 1G51A 2Z9HA 1E24A 1PH4A 3H0GH 1WJJA 1OXVA 4IJHA 3A8IE 3MAQA 3QWNA 4L5RC 5FLMG 1H9SA 3CCMA 4PMWA 4DV2H 1BDOA 4DV5Q 3BJUA 3M3YB 3JAMW 2R7ZG 1SDFA 3BVZA 4APVA 3QB3A 2ATWA 2KENA 4LFBH 2HHHQ 1ZXTA 4IOCA 3GD7A 1WTOA 3D4WA 2K04A 3T53B 4X65L 4C2MB 2F0MA 4LF4Q 5IYDH 1DONA 4KY7A 4HR7B 1IKLA 5FLXE 3EIVA 4JW0A 5E4WC 2E2DC 4DA2A 4DNTB 3S1NH 2LS01 1TS2A 1Z47A 4G08A 3V05A 1Y1WB 2ANRA 4DR4H 1R9TH 1JWUD 1WHRA 3PO2B 1X3PA 3KLWA 4IUTA 4A3CG 2M8WA 4AQYL 1Z6HA 4IPCA 1VQDA 2F0TA 2Q2UA 1SMXA 1D5ZC 1G2SA 3IFTA 4HN7A 4X66L 1MHWC 4A3MH 1YVCA 2ENBA 3NENA 4A3KH 5ELOA 1L0WA 1VQEA 1LM0A 1N32Q 4KY5A 4YY3Q 1CKNA 2JQOA 2B63G 1EUJA 4RGTA 5E4XA 5FO8B 1SYFA 3PIPA 4JI4H 1HUMA 4ZYSA 1Q1EA 2F3VA 2Z8LA 1L1OA 1I4GA 3I70A 2MHVA 2ZQEA 3CF5A 2YTYA 1EWCA 2JA8B 2UUCL 1X55A 1X65A 4G7OC 1U4PA 2PNRC 1QNUA 4RMFA 3JAMi 2JA7H 4LF5L 3T1HQ 3S1RB 4FF3A 1EYCA 3FRPB 3L2PA 1S5BD 4BY1H 4DV0H 5FKAC 4EQNA 5KYLA 3D6WA 4BBSH 3S2HH 1RODA 1SNOA 2ZXOA 3NBHB 1ICWA 2CTFA 1F2LA 2OEOA 2B8FA 3FEWX 4BBRH 4ZKBB 2OTLA 3GTMH 4ZQ3A 2WB1G 5IGGA 1YITA 3PF4A 2P5ZX 2A6ED 1UE6A 3KOJA 2FMMA 3ZYYX 3S24A 3CCVA 5NUCA 2NVXH 1S20A 4JOIC 2Q2HA 2GN5A 4DNRB 1FKAH 5AFWA 2JN4A 3D8GA 4LUVA 4IFDH 4UPAA 1I4PA 4KHVA 4A3DG 1BCPC 1VIGA 1YBYA 4DAYA 3Q22A 1PTOF 3BZCA 1B7YB 4LWCA 4P75A 1S5FD 4LFCL 4CGYB 5JEAH 1YHAA 3JAML 1G2TA 3KUPA 1IHZA 3PSIA 4IUQA 1YI2A 1TU2B 2K7VA 3ND8A 4QIWE 3U9OA 4NXNL 4QQBX 2IHEA 1VQOA 5D3DA 1K9MC 5M5WH 3IKJA 1G6PA 4I7ZC 1J6QA 1EYAA 2F0LA 4GLAC 3E9IA 5IYBG 2LSSA 1A3TA 1PDQA 1LLRD 3SK6A 4YHHQ 4LF7L 1CTMA 4KKUA 5CGKA 2NN6H 4JI2Q 5C4XG 1U4LA 3T1HH 4XTCS 4B3SQ 3G4SA 1FNUA 1AZPA 3MVVA 2NVTB 5T1GA 2B8GA 4BWGB 3S1QH 2ICIA 1STEA 4ID6A 4X3SA 3D4RA 1QVFA 1N34H 5IGCA 5HGTA 3DEPA 4X64Q 4IOAA 3KDFB 4DV1Q 5CMDA 2QEXA 2B3GA 4JPBW 3QD7X 2HQLA 4DR5L 1H9JA 2EYPA 3NSWA 4FF4A 4HIKA 4I65A 3H0GG 2G5DA 1IBML 2VUMH 3HKZB 4DR1L 1MSZA 3MA2B 1AEXA 2R93H 3NCVA 4RKLA 1FNVA 3VA5A 4DR7H 1HNZH 1QILA 1PZID 1R4QB 1KRSA 3C46A 1HR0Q 2JA7B 1PTOH 1BVSA 1LTLA 5K5PA 2N88A 4IQZA 4B3MH 1A15A 1FJGQ 2DGRA 3K5NA 3I4NH 2WACA 1XMQL 1I50B 3GTLH 3W3AA 1U4RA 3R2TA 2A19A 2ZM6L 4JI8Q 1N33H 2XRSD 3M9BA 2AUJD 2PI2E 2R92H 4BBRB 1K0SA 4CBVA 1JB7A 4QCLA 1E2VA 2P2RA 1EY5A 2KJXA 1WD1A 3GR5A 4DV3L 4C3IB 3HRZC 4A4IA 2LFNA 1QE6A 1GOZA 4C3JG 3J7A5 4DU9A 2NVXB 2KBNA 4WJWA 2HCCA 4UP8A 2DJFC 1GHJA 3MEFA 1QCBD 4OEMB 4YHHH 2VXWA 3SEBA 1EWIA 1JICA 2DY7A 3FKIG 3DWPA 4H44C 1F2YA 3P1HA 1RF2D 3BDOA 5IGDA 3KLSX 3W1BA 2PW7A 1JWMD 2KVMA 4A3KG 3KDGA 2EZVA 4ABNA 2OF1A 1Q86C 1ASYA 1B50A 3CCRA 3AB9A 3NELA 4X64H 3BDCA 4LJZC 3TQYA 4A3FG 1UG8A 2SDFA 2N8NA 4DR3Q 1G291 2PY9A 4JI3L 3WOFA 4PDBA 1J5EH 5M3MG 1IBLL 2N3SA 2EYOA 1A0IA 3Q23A 2UXDL 3H3VC 1LUZA 1M90C 2EYJA 5C4JB 1EWHA 4DR2Q 3TEHB 1CHQD 5G3LD 3TRZA 3I4MB 4OWWB 1OXXK 4JI1Q 1UEBA 1EYDA 2O4XA 2CFMA 3BZKA 3MC0B 2HUGA 3LNNA 1NNXA 2A6EC 4IUNA 4N8FA 1RTOA 1K8OA 2CW0D 4K6DA 1MJEA 1B3QA 3I56A 4GKKQ 3CXCA 4XT3B 4UY8C 4TSSA 3NHHA 1NCVA 5M3FB 2OWOA 4NZTM 4JI0L 4F8MA 1TWAB 4PZ7A 5GAHC 4AYBG 3RN5A 1AW7A 1HZCA 1V9PA 1NR2A 2F4VQ 3CU7A 1X3FA 2B2VC 3HOXH 2IX1A 3UDGA 4GKJL 1GXDC 4A3LH 2F0PA 3ERQA 1V9NA 2A74C 4IFDG 2UXBQ 5I9OA 1VQ6A 1LT4D 3HOUH 3S2DH 1EQQA 4JI5H 2I0QA 1XTCD 2NVYB 4O42A 4LNQA 1SFOH 3GTJH 5T1IA 1HTLD 3HFZB 3I4NB 1GUSA 3U50C 1K8AC 4L5QA 2NZ1D 1ET6A 2DJGC 4J8QA 1W3SA 4DAVA 1TWGH 4XDXA 2B2WA 1AN7A 1XWEA 1X4MA 1UUPA 1C48A 3HOVB 2E2IB 1E0BA 5IT9c 4A3JG 4FF1A 4EGVA 2JA6H 4PZ8A 1XNQH 1L0YB 2NZOA 2O5IC 3SB1A 4ALPA 2R61A 3OW7A 4GNXA 4P73A 1SN8A 2NN6G 4K8IA 2KCMA 3WWVA 2A69D 2IT1A 3FVQA 1SNDA 5ELFA 4LK1C 5M5XB 1KRTA 1D7QA 4IFDI 2FFKB 1QVGA 1XMOQ 4XIGS 4A3BB 4JI1H 2K75A 1VQ7A 3SVMA 1EU3A 4LUZA 4G7HC 5GAEC 1I94H 4A3EH 4ME3A 4X3KA 4B9WA 1T5EA 4KJOA 4WANA 2YYZA 1HZAA 1PH6A 4CDDC 2WKDA 3PGZA 4DV2L 2QF7A 2NVQB 4LF8Q 4ODGA 2X6LA 1TY2A 1SROA 3BU2A 2N55A 4NDXA 4YCUA 3RZOH 1M8AA 1V1OA 4IPHA 2IY5B 3KJPA 2F0OA 1F0XA 4RH6A 5I6WA 1VQPA 4RHRA 1TS4A 3U1KA 4CKBA 2E3UA 4L5TA 3RF2A 2NN6I 2PQEA 3CCEA 2C5CA 3K6OA 2A68D 4A93B 2TSSA 3QR8A 1CT1D 3A54A 3KLRA 5M5YB 4BXXG 4A3GG 4RKBA 1KLGD 1OXSC 5A2QW 4PQXA 4DR4L 5C3WA 1VQ9A 1B9MA 2K1HA 4JV5H 4NB3A 1CKOA 4O0AA 3MXPA 5I9PA 3T51B 5DEHA 3HOYH 1VQIA 5JPMC 5FO7B 2MO0A 3K5LA 1I6HH 1T5XD 1CQVA 3TP5A 1VBIA 4DV6H 1UAPA 4RFBA 1D1IA 4OD6A 3MFGA 4DV7Q 3HGBA 2BA1A 1N9WA 4POFA 1LV9A 1ML0D 3T16A 3KBXA 4JI4L 1L2FA 2ZJQA 2JZXA 1WTHA 4UDUC 3A5UA 4TVAB 1QVCA 4A3IG 1IZ6A 5CR3A 1TUAA 1T9HA 4FF2A 2KECA 3RZDB 2B63H 2EY1A 1X3GA 1JWSD 3H15A 2K05A 1IBKQ 1RCVD 4LFAH 5DNFA 4LW1A 2IX3A 4P74A 1R4PB 3CC2A 3CQZH 1PH1A 3J80E 4BY7G 1CKNB 4JBWA 1KLUD 4YWLA 1HNXH 2F3WA 2B39A 1HFGA 4LMQD 3DMUA 5ELEA 1X54A 1YHBA 1O78A 4DV5L 4LF8H 4DV0L 1CI3M 2DUDA 1X9ZA 3B6YA 1U4MA 2IJ0A 4DR6Q 3PIP3 3FPUB 2IPKD 1TWHB 2PO4A 5HURA 3X3NA 4JI3H 2HIVA 1QZGA 1A63A 2CW0C 2EYHA 3I7FA 3NBIA 1V8QA 5CV5A 4DGZA 3Q8DA 1Y1VB 5KGUA 3NE5B 1LTID 2CTEA 2ZJRA 4DUYH 1JE5A 4CDFC 4C1NI 2L0CA 2BH2A 1XTDA 3PUXA 4K5XA 1MKHA 4HJ5A 4B3RQ 2PNHA 2LTMA 4EQOA 1K3RA 1TVXA 1V1QA 4QUFA 2RDHA 2PI2A 4KTAA 4BA2I 4WALA 1FR3A 2AMCB 4JOIA 3I2ZA 4LF6H 2TMPA 2O4CA 1WE8A 1NBWA 1HZBA 1K83H 3CCUA 1WTJA 3OHXC 1BBUA 4DK3C 3PO3B 2DGYA 3RZOB 1DYQA 1ODHA 2B2YC 3D3RA 4DV7H 2UXCH 4A3DH 3VA7A 2FHTA 5EGTA 3MEHA 1EY7A 2RA4A 3AEVA 2R7ZB 4OL7A 1PRTB 4JI6Q 5ISRA 2D5DA 2F03A 5IWAQ 4PMCA 5KNDA 2VQEQ 1HJPA 5I6YA 1XPOA 5C4ZA 5EKLA 4M1UB 2VNUD 2QKIC 1ILQA 1JR0D 5C44H 3S1MB 3TSSA 3KF6A 1RD9D 5A2QL 2A69C 1K73C 3T1HL 4DV4Q 3OTOQ 3D0FA 5ELNA 2KUMA 5IYBH 2ZT9C 2RVLA 4RWSC 1ENCA 3OIQA 1HCZA 1ESRA 4QGUA 2VW9A 1N34L 2F0GA 1S5CD 2G9DA 1YIJA 2L4NA 3RD4A 2E5LQ 3HOZG 3NPPA 3GTQB 3RLNA 5AJ3Q 1XNRQ 2CWHA 1U5KA 3URYA 5M9OA 1N36Q 2YQRA 1Q7YC 1EIFA 3BVMA 2EOTA 2E2JH 4JG2A 2B63B 2AUKA 1VQGA 5FOBB 4HSVA 3P7JA 3GTPH 3KYHC 3PIOA 2WV6D 3CQZB 3U4ZA 4DR7L 1HNZL 5K36G 2QDLA 3FAUA 3STBD 5IY0A 1E3PA 1ICFB 3C3LA 2A68C 4GS3A 4B3ML 2Y0SG 2F0DA 4K0KH 4BA1I 4R8NA 1HPCA 4X3TA 3CCQA 4X62H 4KD3A 1VQKA 4LF9Q 1NUCA 2XNAC 4Y7NH 3G48A 2AQ1B 1STYA 1WCMG 1D1KA 3A5ZB 1VQ4A 1QJOA 3N6RA 1N33L 1ZZIA 4OGQC 4OX9Q 2Y3MA 2KCNA 3GDEA 2F0SA 4AM3A 2F0UA 3MXUA 4GN4B 4B8TA 1Z9FA 5E1FA 3MZ5A 1SJED 3GTGH 4JYAQ 3A56A 1NTGA 3M4OH 3HOYG 3DHQA 1PYWD 3NQTA 3S14B 4HJ7A 5CV9A 3ER0A 1CQFA 2YU9B 1EFID 4YHHL 4R4QA 4WRDA 1SMYD 4R1JA 1YNJD 1PV4A 2VS1A 4DPGA 4C3JH 3CC7A 3RLFA 1HNWQ 5JEAJ 1I4RA 3TP8A 2C35B 2JSOA 4TKOB 2RHSB 2JVZA 4V0BA 2ZJPA 3FKIH 3MTSA 4X64L 1CZGA 3W1GA 3I72A 4NXMH 1Z7TA 5DM73 2KA7A 2JEAI 5C4HA 3RMHA 2UUBQ 1RDPD 4R4IA 1EC6A 1JJCB 1N36H 5LMUH 3CHBD 4P71A 1JOQA 3OETA 3T1YH 2ZTDA 5FJ8G 1J5EL 3S15B 4JI7Q 4ZK9B 2SNMA 4A3FH 3LWEA 3RR5A 1VQ5A 4UAIA 2WAQB 2UUAQ 2JP1A 2IHFA 4ILWA 2XGTA 1KC8C 4LIJA 3BDLA 3J81E 5M3MH 2VB2X 1GUGA 2B2UA 1QWYA 5JOBA 1C0AA 3L3OC 4M8AA 1VQCA 2SEBD 2BDNA 5KIXA 5C4XB 2XWJB 1NXUA 3UE0A 4DV5H 1TY0A 2MGSA 2L15A 3EQLC 4V190 2OQKA 3NTIA 3EA6A 4KV6A 4HJAA 5C0XJ 2LMCB 4CJ2C 5IIFA 2HHHH 2ALYB 2NYZD 3GABA 4LF4H 2E2HB 5DM63 1VQ8A 3S16B 5E7NA 1SJHD 4KY6A 3VYRA 1PH3A 2HIXA 3T13A 1WI5A 3H0GB 1YJNA 1A8VA 1KNEA 3C2PA 2R3ZA 4JI5L 2B2VA 2CTKA 1HH2P 3TZUA 4E9JA 1GD7A 3HKZE 3J7YW 3PF5A 5IGBA 1IL8A 4Y7NB 5EJWA 1C4QA 3SXHA 2MQHA 1Y1WG 4GOPB 3TREA 1I6VC 1PFNA 1BCPF 3A7AB 4B3TQ 5JAVA 4DR3L 1N32H 3KF8A 1YZ6A 4YY3H 4KHPQ 1DOKA 1TIID 4OIJA 1XNQL 3MXGA 1B2TA 3KDKA 2VY3A 3VYTA 5C44G 1P16A 2JE6I 3E6ZX 1MBYA 1LYLA 1KDCA 1JMCA 1Y8OB 2OXPA 3V96A 3P20A 3A74A 4A3JH 1HRJA 3S1NB 3V2TA 1SYBA 3EFXD 1R9TB 1Y69U 1WTRA 4HTHA 4L6TB 4JI1L 2PQAB 5IODA 3GV6A 2PZWA 1I94L 3OWEB 1PRTD 4DUZQ 1B9NA 1D8LA 1E2ZA 4HJ9A 4X65Q 5IYCG 3IAYA 2OPVA 3S17H 1PXUA 4C3HH 4A3MB 4HMJA 4IN3A 4A3KB 3STBC 1HFNA 1CKMA 2QCPX 4F88A 4KI0A 3UI2A 2VKCA 2ICEC 2NUCA 1BOSA 2K01A 4AQYQ 1SE8A 1KDBA 1G8ZD 3O13A 2V4DA 5I2YA 5IT9W 2MJHA 1XPUA 4X66Q 4FXDA 3K59A 2AKWB 2K6AA 2CPMA 2QNDA 3AFPA 1DOMA 4JV5L 1MJCA 2EJGC 1IL2A 4BY1B 1UE5A 3K5OA 2L5TA 2CWFA 4BXXH 2HT1A 4A3GH 3U58A 4BBSB 1QZHA 3S2HB 4RHSA 4FO2A 1SMYC 1YNJC 1B70B 1ZYRD 5EAYA 5EBDA 4DV6L 1HQMC 2I5MX 2D0PA 5I4DA 3NP8A 1EL0A 4KHPH 1BO0A 5IGEA 3EBEA 2UUCQ 4YWKA 4HCSA 2YTVA 3GTMB 1F9QA 2Q2IA 3EZJA 5TSSA 1NMFA 3P75A 2E76C 4LF5Q 1X32A 4DKAC 5BR8Q 2WFWA 3OSSD 1EOTA 3CPFA 2K5VA 1DOLA 2PMZB 5ELBA 2KHJA 4AYBB 4H13C 1MIUA 1SNPA 2RSOA 3J80c 5C3EH 1ENAA 1LTSD 2RHQB 4CJ0B 1JJ2A 4LFAL 2L9HA 2A73B 4JI2H 2WKCA 2AWNA 4B3SH 1F9SA 3A7LA 5FLXW 1GUOA 4A3IH 1WTXA 1XYIA 4ZRZA 1JCKB 4K2LA 2KEDA 1HNXL 1A6XA 1JOKA 2D0OA 4LF8L 1ASZA 4CKEA 1GUNA 4NP5A 3I55A 4DV1H 4BY7H 2PQUA 3I90A 3OW2A 1SE3A 1JT8A 4HIDA 5M5WB 1BXTA 4A3JB 4WJ3M 1TKWB 1PFMA 4KJNA 5L37A 3F8TA 3QJYA 1EIGA 1NMGA 1HHVA 4DUYL 4F7XA 3PUYA 3NEMA 1EOVA 2MPMA 1HR0H 1LT3D 1O7IA 2EY6A 3AFQA 4LFCQ 4B9XA 3VR2A 1PVOA 4DXFA 3NXWA 1L1OC 3S1QB 3HKZG 2LXJA 1FJGH 2BE5D 4NXNQ 4WFN3 4OIKA 2E74C 2RF4A 3HOWH 3K5MA 4LF6L 2R6GA 1SYGA 1QB5D 3BYTB 4JI8H 3DM1A 3G6EA 3NBHA 3BZDB 5C6AA 4DV7L 4LF7Q 4RCNA 4OO1H 2UXCL 2VUMB 3CCSA 3I91A 3DEOA 4DAMA 5BR8H 4NW2A 4JVZA 3PUZA 3F2CA 2R93B 1I4XA 3OWFA 2X06A 5IP9H 1CZWA 2K5WA 2DNCA 4QMGA 2FINB 1PTOB 1LT5D 2NTTA 4DXGA 3VR3A 2F0FA 5IT9L 2SOBA 3F2DA 3K7AH 4E6IA 4DAPA 4QB4A 5C3XA 4IPGA 4C3IG 1EEFD 4KKTA 1EY4A 4N9TA 4MIUA 3CW2C 5D65A 1AH9A 3GTKH 4A3GB 4DR5Q 3GTLB 1WFQA 2H1EA 1A3VA 5CYUA 4NPSA 2EQSA 1K8MA 4P2CB 1J5KA 4XT1B 1IBMQ 3A8KE 2DY8A 3KBGA 2F0EA 4KLKA 1NE3A 1TWFH 2IX0A 1HUNA 2G8YA 4DR1Q 2R92B 4FNFA 1PRTC 4DR3H 5CV6A 1UEAB 2RQXA 1VF5C 3D6CA 5EQ0A 3ULJA 3I0PA 2KOLA 3K0XA 1PQXA 3QG1A 3DWQA 4IUUA 3OIPA 1CSPA 1PRTF 2OQ0A 1PA6A 3IFDA 1STNA 2K4KA 3HOZH 4DR2H 1XMQQ 1AE3A 2LTLA 2Q8IB 1SE2A 4XXEA 2KQ3A 4C3HG 2ZM6Q 3L9AX 4HAEA 2NTSA 4K5WA 4BS9A 4RA8A 1HTPA 1JB3A 1F9RA 2O2LD 1ZEQX 4DV3Q 4K0KL 4X62L 3I4MG 2CVRA 2VQFQ 3M7NA 5K36H 3GTOH 1YHQA 3CPWA 4XQJA 1AN8A 2GA4B 4GKKH 4PZ6A 3CD6A 3I73A 2XIWA 1PYSB 4L63B 2F3IA 5FLXc 2F4VH 3JAME 4MTNA 3PIO3 1H9SB 1WCMH 2M6QA 2FMCA 2UXBH 1S03G 2K50A 1LACA 2HD3A 5M3FG 1WYDA 1VQFA 3FPPA 4L8JA 1S5ED 4KN7C 5LL6X 3CAMA 3W5OA 4OHJA 2K03A 3SDZA 4EX5A 1IYVA 3TS0A 4LAAA 2M00A 3RN2A 4JBKA 3T4AC 5GROA 1TWCH 5LMNQ 1IBLQ 2UXDQ 2EVBA 1DM0B 1OXUA 2H5XA 3V69A 2ES2A 1J9OA 5AJ3L 4TQUS 5DAUA 2JA5G 4NXML 3HG9A 1H9RA 2EY5A 2BOSA 5C3EG 2Q8RE 3TP7A 2YTXA 4AIMA 2XRQD 4CDCC 5LMUL 1N36L 3HOXB 3T1YL 5EPKA 3HOVG 3HOUB 4DNIA 3S2DB 4P72A 3R8BA 3J81c 1RKNA 1X4NA 3NK9A 1XMOH 2UU9Q 1X3QA 1SFOB 3GTJB 1STBA 1W6JA 4X3UA 4HCEA 3Q0AA 3EJIA 5FJ8H 2KEEA 2OTJA 3DWAA 4IURA 2JJQA 4PV1C 5LL6S 1CSQA 1TWGB 4K2KA 2LKVA 3TZDA 4GN3B 4JI0Q 5J22A 2K5NA 2CPQA 1VF7A 3G6JB 1K28A 2VQFH 3C1EA 1KHMA 4A3BG 4GKJQ 1L1OB 1S5DD 2JA6B 1A3UA 3BS1A 1FL0A 2CTMA 3ONAB 1SEIA 5G3LF 4GN5A 3F2BA 2QGQA 5IOCA 1I6UA 1E7ZA 2OPUA 3AMUA 5CORA 1XPRA 2HHHL 2K1BA 1JORA 3ZJYC 5IP7G 2YV5A 1WD0A 2FMRA 1VQBA 3KK7A 4N9PA 4LF4L 1O7YA 3E9HA 2VB3X 1KAAA 4JVHA 3UDIA 3TDQA 1VS0A 3HOWG 1PZJD 2L12A 4KD4A 5J3BA 4EQPA 5BN4A 4A3EB 1Q1BA 1HXYD 2NBFA 1IXRA 4JCVE 1E1TA 3F2UA 5J39A 2Q2TA 3DUZA 4A93G 1NJIC 4OO1G 2F52A 4OONA 1VDZA 3SK8A 1KXLA 4C2MH 5LHY1 2Y0SB 4MHEA 1SYCA 2EJMA 3L0OA 3ULLA 5IP9G 4OWXB 1N32L 4HSPA 2FJ2A 4YY3L 1Q12A 1JC7A 2R7FA 5IGFA 3IRBA 2L55A 1Y1WH 2OT2A 2CTJA 3WOEA 3BVGA 3PO2H 1VQJA 1X9NA 3QO2A 3OPOA 1ONLA 4DAYB 4DV2Q 2UU9H 3I8ZA 1HR0W 4HMIA 1IBKH 2EPBA 3LGJA 3I4OA 3HOYB 3SK5A 1QOHA 1JQYD 2Z1CA 1NAPA 1B44D 1WVLA 2QW7A 1EIHA 4GOPC 4LFBQ 1I6HB 1I5FA 2N49A 5HY6A 4OO1I 1WTPA 2CH4A 1PTOD 2LXKA 4DR6H 1PYBA 4Y52H 4IPDA 2PYKA 5CBAE 4A75A 1EU4A 4ULLA 2B2WC 5IYCH 2HDMA 4DR4Q 3PQIA 3HEJA 2JA8H 4H7BA 5KNCA 1GO3E 4POGA 1S4ZA 2F0HA 3S1RH 4MN3A 1IYUA 3EVQA 4B3RH 1GVPA 1STHA 4XQNA 1B1ZA 2EXZA 1XRHA 4NKLA 3GP7A 4C1NK 2XVSA 1N8RC 3QIAA 5JJLA 1SNQA 1IYJB 4G4KA 4RCOA 5EKKA 5JVG3 2K32A 4JI4Q 1LO5D 2WAQE 1CA6A 2D9IA 4U673 1FVIA 4FXGC 1RJTA 2FFMA 3K7UC 3TS2A 3OOCA 1Y8NB 1TS5A 4KHPL 4DF7A 2RSNA 3A8JE 2ZTEA 1LABA 1YNND 4JI6H 3PO3G 1HZ9A 3D31A 2VL6A 5IWAH 1U9RA 2K14A 3KLSA 1B8AA 2Q8TA 4HIOA 3J7AF 2KHSA 2VQEH 2E75C 1SR3A 4YWMA 1CK1A 4IFDJ 3K81C 3PCOB 4DV0Q 2WB1B 4JI2L 1YJWA 3LX0A 3FMCA 4B3SL 3OTOH 4DUZL 4DV4H 1K83B 3PUVA 4X6AH 3MHBA 1AZQA 1EFWA 4QMFB 4HEDA 3UOEA 3VR4A 2XTIA 3MFYA 3E0JA 2XWBB 2OCEA 4A3DB 1D6EC 4DV1L 3PMFA 2E5LH 1MD2D 1XNRH 2C9OA 2GVBA 3CRLC 5EBCA 1Q3LA 1S72A 5A35A 1QNKA 1K8GA 3A0JA 1DJRD 4JBJA 3H09A 2B29A 3ICEA 2PZTA 4DK1A 1IW7D 2F0WA 2K5QA 2NVTH 5C44B 3AU7A 1B53A 1FD7D 1WOCA 3MXNA 1HR0L 1SRUA 4OCHA 5EPLA 3HZXA 1BNZA 2F4IA 2QILA 5COYA 1PH2A 1FJGL 2CTLA 4RAUC 1DD2A 5ELCA 2MJ8A 4LF9H 1QUQA 2Z6KC 5LL6b 1H95A 3VKEA 2MUYA 1ESFA 3J80W 4N8X1 4JI8L 2V1CC 1UE7A 1SAPA 1VCIA 4A76A 4OX9H 1HA6A 3DM3A 1TS3A 1SEBD 4J15A 1M4VA 3TN2A 2K5HA 2E2JB 3ULPA 1V43A 5JJZA 1FGBD 1L0XB 5IE8A 5BR8L 4IUVA 3G7LA 5FK9C 3GTPB 4JYAH 5C5MA 1SLJA 2KHIA 3HS0C 1N34Q 4DK6C 3CC4A 2HH3A 3C1FA 4RGOS 1I50H 1YJ9A 1D2BA 2IW3A 2X6GA 4B08A 1SBBB 1HNWH 2J7ZA 4ZLTF 5DLQE 2JYOA 3G71A 4NMZA 2F1MA 1ZZKA 2MO1A 1F2MA 4FJUA 3UDFA 4PNYA 4H8AA 2I46A 1UWVA 4ME5A 3RUZA 1SSOA 4C3IH 1GUTA 5KRUA 2EXDA 3PO2G 1A2TA 4GLVB 1V1PA 2R7DA 2UUBH 2F0QA 2M2LA 4DR7Q 1HNZQ 3NWSA 4K8JA 3AYHB 3GTGB 1PTOC 4JI7H 3M4OB 1DCZA 1PH7A 4B3MQ 1DGSA 1S40A 4G57A 3NWTA 4ZUIA 4DR2L 3NTKA 3PUWA 1M1KC 2UUAH 1BBXC 4Z9CB 3RLOA 4C3JB 2B2TC 1KD1C 1N33Q 3J80i 2CKZB 2K52A 2LY7A 5LMNW 3FKIB 1Q8KA 1II3A 2XN9C 2PMZE 4AYBE 1HA5A 1RTNA 1ZKOA 2WAQG 4GNXB 5J1ZA 5BN3A 5CV8A 2JA8G 4RG1A 1I3QH 3VR6A 4GKKL 4XYOA 4ZCKA 3UDXA 1CFMA 2F0JA 5I2XA 5C4JH 3JAMc 1JJGA 1TR5A 2L11A 2CQAA 3I4MH 1EZ6A 4K14A 4A3FB 1MSGA 1STGA 1C9OA 4R8IA 2F4VL 4KHZA 3I3CA 4ZKCB 4FDBA 4FP5D 1EY6A 4LUOA 2XSCA 4EQ5A 2QA4A 2UXBL 5M3MB 1WTQA 2EYFA 4QUCA 1NY4A 2MP1A 4XQQA 2RKSA 3J81j 1YNNC 1LTTD 4R4TA 2ASBA 4J1MA 2GVAA 3M4PA 3U9SA 3Q24A 4GLXA 3QOJA 1KTKA 2CQOA 5M3FH 1FNWA 1Y8PB 5KEEA 1J5EQ 5C0XH 1PFBA 1TWAH 5A2QE 1BQQT 3J7AV 1EQRA 2RBMA 4Q5VA 1STAA 4WORA 1B4OA 1TQOA 3J80L 1VQMA 3CCJA 4B3TH 5CBEE 1BBWA 1A62A 1RL2A 1Q46A 4O1NA 4KK7A 2NVYH 2FXQA 2QEJC 2LRRA 5H1SE 4QIWB 1DXMA 3H6MA 2BCOA 2JA5H 4DFAA 1E22A 3OSOA 1XMOL 3CMEA 1ET9A 1EQTA 2SNSA 3AQQA 5IYDG 1X0AA 1XXGA 2IL8A 3F1ZA 3HOVH 2E2IH 4DUZH 4NBQA 1IW7C 3M4YA 4X65H 1VQNA 3H91A 1TT2A 2VQFL 1EY9A 3NQIA 2PT7G 4L5SA 1NR4A 1E1OA 1YEZA 2O5JC 1KABA 5M5XH 3T56B 2D9UA 4JI5Q 4F87A 1PFSA 2JEBI 3SR1A 2PZUA 4A3BH 4A3MG 3ERSX 4AQYH 4RGNA 3SGIA 3TBIB 1PMRA 3J7ZC 4R4CA 1PHJA 5IP7H 4X66H 4CJ1B 1H9MA 2NVQH 1VQAA 3E3XA 1MGSA 1X6OA 2K5DA 5GQOA 2CWAA 2QDBA 3BG3A 3SE0A 1GUWA 1XNQQ 2AXYA 3S17B 2KCCA 4C3HB 2K28A 1K1GA 1I3QB 1PH9A 2FPHX 1AE2A 2PPBC 3J81W 5LMNL 4I7AA 1GJXA 1EEID 3WDNA 3CRKC 2B2UC 2JA7G 1KHIA 4S3SA 5CV4A 5EPJA 2PCFB 4BY1G 2F0KA 4A93H 2UUCH 4FXKC 1F2ZA 4FVMA 5M5YH 2E8GA 2D62A 4LF5H 1I94Q 4BBSG 2B2YA 4QY7A 4OELB 4H0LC 3QOLA 2A6HD 3OYYA 2F0NA 2UU9L 1KL9A 4BBRG 1IBKL 1EIYB 4NZRM 5BN5A 1BCPB 3W2DA 2BH8A 3DLLA 3UE1A 1K0RA 1CM9A 1LTRD 1VMPA 2EDGA 1CA5A 4PMBA 3OMCA 4KKSA 3AEVB 1O7ZA 2KCTA 2NWGA 1WTWA 3R3OA 4H02A 1BR9A 1V8CA 2DNEA 4GOPA 2ZXPA 3CP0A 4DR6L 3S9WA 1PH8A 3SK4A 1LT6D 1UE1A 1XJVA 2N78A 4IUPA 2AHOB 3RZDH 2LF0A 2ANNA 3TMEA 3KF6B 4QF4A 5JEAG 3H3VH 4JV5Q 2JA5B 2HQEA 4JVYA 1O80A 5C3EB 4JBMA 1MSHA 4QL5A 1ZTGA 2I07B 4OXPA 1KDAA 4B3RL 5JJKA 1JE4A 3M4QA 3J81i 4A3IB 4DV6Q 5JPNC 2PQAA 1BF4A 4LFCH 3EROA 5E3FA 4G7ZC 1KNAA 2ID0A 4NXNH 1TWHH 5FLXL 4IZ8A 2Z4IA 3I4LA 4BY7B 2EJFC 4K5VA 2RCFA 5C5LA 3KDFA 2H4OA 1ILPA 1A2UA 1Y1VH 1OXTA 1U0LA 3GQBA 5DT9A 4LF7H 4YCWA 4LFAQ 4AH6A 4MNOA 3K8AA 1TXYA 2DN8A 3KJOA 1DT4A 3U4VA 2BL5A 1VQLA 1AP0A 3CMAA 1DZ1A 4JI6L 1ZYRC 1E2WA 1HNXQ 2Z0SA 5JJIA 1KQSA 5IWAL 5ELDA 2VQEL 4MTKA 2ZXRA 4RGMA 4PG3A 1MI2A 3J7AK 5C0XG 4WJ4A 1XX8A 2VUMG 2A1AA 1G91A 1EQVA 3HKSA 3K0YA 4Q0FA 3PO3H 5FLMH 3HOWB 2R93G 3ITPA 4LFBL 4JI3Q 4UHVA 3OTOL 4DV4L 4FJSA 4DR5H 4R4OA 4U68A 1IBMH 1C8CA 4IALA 2R7ZH 2AWOA 3J81L 1RHPA 3R93A 1Q90A 1HQRD 4DK0A 4DR1H 4GZYC 4DUYQ 2E5LL 1KAWA 3I4NG 3OMGA 1XNRL 1Z2IA 2A5HA 5CV7A 3MWYW 3M7GA 2MFIA 3RNUA 1WVNA 1X3EA 3K57A 3S1MH 1EYGA 1IKMA 2F0IA 2R92G 2Z6BA 2Y0SE 3A55A 5FO9B 4JC0A 1XMQH 4LF6Q 3K7AB 1CUKA 2CCZA 1Q82C 2G9HD 2ZM6H 1J8IA 2AQ3B 5C0XI 3SHLA 3VR5A 4A3CH 3GTKB 1B3AA 1K3BC 5KNBA 1LTBD 2EYMA 2UXCQ 2NB0A 1DTJA 4ZAIA 4EVOA 3GTQH 1PZKD 4J6HA 4JK1C 3D4DA 4EC5A 1TWFB 2D2CC 4DV3H 4KN4C 2BA0A 3KFUA 3E5SA 4TRDA 1JOOA 4HJ8A 3CCLA 3NTHA 4LF9L 4O2DA 1D5XC 1SE4A 3GV3A 4B8CD 4MZ9A 1SYDA 3FP9A 3VYUA 2BE5C 4DN4M 4OX9L 3MXNB 2Z6KA 4C56C 4XYQA 5KYIA 1CHPD 3HOZB 2L1BA 2HH2A 4KMUC 4UP9A 1WTVA 1KIXA 1EY0A 3GO5A 4JYAL 3BYYB 3DXJC 1QUQB 5F2DA 1W6KA 1I4QA 3N52A 1G6ZA 1P8LA 1RIPA 2CH4W 1EZ8A 3M3YH 1HNWL 1Q81C 2A6HC 2CHBD 4OWTB 3K80C 2I5LX 3VDYA 3GTOB 1QG7A 4HIMA 2J0TD 4YIJA 5LMNH 2NZHA 1IBLH 2UXDH 1O7LA 2EY2A 2PW5A 3HP3A 5GADC 2A1SA 4ZUJA 2HCIA 1S3OA 1J4WA 3EN2A 2JXMB 3FHWA 2EYLA 1YNXA 2UUBL 5GAGC 3S14H 3TP6A 1WCMB 2YU9H
chains in the Genus database with same CATH topology
2HDLA 1PLFA 4JI7L 1VMCA 3IL8A 3R2IA 4K0KQ 4X62Q 3L7ZC 1AFPA 4UP7A 2RDFA 3NUCA 1F77A 5EKIA 2UUAL 3H94A 3M85A 1BKBA 2RDGA 3HOXG 4A3LG 1V1PB 3JC66 1I4HA 3KF8B 3X3MA 1ENFA 2EIFA 2AQ2B 1Y14B 2RCNA 1TWCB 3HOUG 4K6LA 1ZZJA 1FYCA 2B2TA 2VZAA 1LTAD 1SXTA 1W2BA 2WB1E 1GKHA 5JVH3 1BUVT 1VIHA 3CKIB 1OTCA 3S15H 2BDOA 1BCPD 4CHTB 3K58A 4IJLA 1C7YA 1SYEA 1NSNS 1SNCA 1SNMA 2WIIB 1PH5A 1LTGD 5D14A 2JA6G 2WP8J 1EY8A 2M9VA 2X69A 3ND9A 2A8VA 3E0EA 2F0VA 1VQHA 4YCVA 5C4XH 2IWHA 5HGQA 4GNXC 3Q6SA 2I5HA 2K33A 4NXMQ 4IO9A 2JK8A 1Y1VG 1OO9B 1X56A 1GHKA 3VYSA 2J4XA 3FDTA 3LWUA 5IT9E 5LMUQ 2EE1A 1UNSA 2ZTCA 1D5MC 3T1YQ 1H9KA 1F9PA 2MNAA 2Z4HA 4A3EG 5CC4A 4CKCA 2E2HH 3H3VI 2CWPA 4FYDA 4R9WA 2JA9A 3S16H 1FGUA 4B3TL 2WINB 1Q8IA 3PV0A 4QJFA 1GM5A 5D3IB 1G51A 1E24A 1PH4A 3H0GH 1WJJA 1OXVA 4IJHA 3A8IE 3MAQA 3QWNA 4L5RC 5FLMG 1H9SA 3CCMA 4PMWA 1BDOA 4DV5Q 3BJUA 3M3YB 2R7ZG 1SDFA 3BVZA 4APVA 3QB3A 2ATWA 2KENA 2HHHQ 1ZXTA 4IOCA 3GD7A 1WTOA 3D4WA 2K04A 3T53B 4X65L 4C2MB 2F0MA 4LF4Q 5IYDH 1DONA 4KY7A 4HR7B 1IKLA 5FLXE 5E4WC 3EIVA 2E2DC 4DA2A 4DNTB 3S1NH 2LS01 1TS2A 1Z47A 3V05A 1Y1WB 2ANRA 1R9TH 1JWUD 3PO2B 1X3PA 3KLWA 4IUTA 4A3CG 4AQYL 1Z6HA 4IPCA 1VQDA 2F0TA 2Q2UA 1SMXA 1D5ZC 1G2SA 3IFTA 4HN7A 4X66L 4A3MH 1YVCA 2ENBA 3NENA 4A3KH 5ELOA 1L0WA 1VQEA 1LM0A 1N32Q 4KY5A 4YY3Q 1CKNA 2JQOA 2B63G 4RGTA 5FO8B 5E4XA 1EUJA 1SYFA 3PIPA 1HUMA 4ZYSA 1Q1EA 2F3VA 2Z8LA 1L1OA 1I4GA 3I70A 2MHVA 3CF5A 2YTYA 1EWCA 2JA8B 2UUCL 1X55A 1X65A 4G7OC 1U4PA 2PNRC 1QNUA 4RMFA 3JAMi 2JA7H 4LF5L 3T1HQ 3S1RB 4FF3A 1EYCA 3FRPB 3L2PA 1S5BD 4BY1H 5FKAC 4EQNA 5KYLA 3D6WA 4BBSH 3S2HH 1RODA 1SNOA 2ZXOA 3NBHB 1ICWA 2CTFA 1F2LA 2OEOA 2B8FA 3FEWX 4BBRH 4ZKBB 2OTLA 3GTMH 4ZQ3A 5IGGA 2WB1G 1YITA 3PF4A 2A6ED 1UE6A 3KOJA 2FMMA 3ZYYX 3S24A 3CCVA 5NUCA 2NVXH 4JOIC 2Q2HA 2GN5A 4DNRB 5AFWA 3D8GA 4LUVA 4IFDH 4UPAA 1I4PA 4KHVA 4A3DG 1BCPC 1VIGA 1YBYA 4DAYA 3Q22A 1PTOF 3BZCA 1B7YB 4LWCA 4P75A 1S5FD 5JEAH 4CGYB 4LFCL 1YHAA 3JAML 1G2TA 3KUPA 1IHZA 3PSIA 4IUQA 1YI2A 1TU2B 2K7VA 3ND8A 3U9OA 4QIWE 4NXNL 4QQBX 2IHEA 1VQOA 5D3DA 1K9MC 5M5WH 3IKJA 1G6PA 4I7ZC 1EYAA 1J6QA 2F0LA 4GLAC 3E9IA 5IYBG 2LSSA 1A3TA 1PDQA 1LLRD 3SK6A 4YHHQ 4LF7L 1CTMA 4KKUA 5CGKA 2NN6H 4JI2Q 5C4XG 1U4LA 4XTCS 4B3SQ 3G4SA 1FNUA 1AZPA 3MVVA 2NVTB 5T1GA 2B8GA 4BWGB 3S1QH 2ICIA 1STEA 4ID6A 4X3SA 3D4RA 1QVFA 5IGCA 5HGTA 3DEPA 4X64Q 4IOAA 3KDFB 4DV1Q 5CMDA 2QEXA 2B3GA 2HQLA 4DR5L 1H9JA 2EYPA 3NSWA 4FF4A 4HIKA 4I65A 3H0GG 1IBML 2VUMH 3HKZB 4DR1L 3MA2B 1AEXA 2R93H 4RKLA 1FNVA 3VA5A 1QILA 1PZID 1R4QB 3C46A 1KRSA 1HR0Q 2JA7B 1PTOH 1BVSA 1LTLA 5K5PA 2N88A 4IQZA 1A15A 1FJGQ 2DGRA 3K5NA 3I4NH 2WACA 1XMQL 1I50B 3GTLH 3W3AA 1U4RA 3R2TA 2A19A 2ZM6L 4JI8Q 2XRSD 3M9BA 2AUJD 2PI2E 2R92H 4BBRB 4CBVA 1JB7A 4QCLA 1E2VA 2P2RA 1EY5A 2KJXA 1WD1A 4DV3L 4C3IB 3HRZC 4A4IA 2LFNA 1QE6A 1GOZA 4C3JG 3J7A5 4DU9A 2NVXB 4WJWA 2KBNA 2HCCA 4UP8A 1GHJA 3MEFA 1QCBD 2VXWA 3SEBA 2DY7A 1JICA 1EWIA 3FKIG 3DWPA 4H44C 1F2YA 3P1HA 1RF2D 3BDOA 5IGDA 3KLSX 3W1BA 2PW7A 1JWMD 2KVMA 4A3KG 2EZVA 4ABNA 2OF1A 1Q86C 1ASYA 1B50A 3CCRA 3AB9A 3NELA 3BDCA 4LJZC 3TQYA 4A3FG 2SDFA 2N8NA 4DR3Q 1G291 2PY9A 4JI3L 3WOFA 5M3MG 1IBLL 3Q23A 2EYOA 1A0IA 2N3SA 2UXDL 3H3VC 1LUZA 1M90C 2EYJA 5C4JB 1EWHA 4DR2Q 3TEHB 1CHQD 5G3LD 3TRZA 3I4MB 4OWWB 1OXXK 4JI1Q 1UEBA 1EYDA 2O4XA 2CFMA 3BZKA 2HUGA 3MC0B 3LNNA 2A6EC 4IUNA 1RTOA 1K8OA 2CW0D 4K6DA 1MJEA 3I56A 4GKKQ 3CXCA 4XT3B 4UY8C 4TSSA 3NHHA 1NCVA 5M3FB 2OWOA 4JI0L 4F8MA 1TWAB 4PZ7A 5GAHC 4AYBG 3RN5A 1AW7A 1HZCA 1V9PA 1NR2A 2F4VQ 3CU7A 1X3FA 2B2VC 2IX1A 3HOXH 3UDGA 4GKJL 1GXDC 4A3LH 2F0PA 3ERQA 2A74C 4IFDG 2UXBQ 5I9OA 1VQ6A 1LT4D 3HOUH 3S2DH 1EQQA 2I0QA 1XTCD 2NVYB 4O42A 4LNQA 1SFOH 3GTJH 5T1IA 1HTLD 3I4NB 3HFZB 1GUSA 3U50C 1K8AC 4L5QA 2NZ1D 1ET6A 4J8QA 1W3SA 4DAVA 1TWGH 4XDXA 2B2WA 1XWEA 1X4MA 1UUPA 1C48A 3HOVB 2E2IB 1E0BA 5IT9c 4A3JG 4FF1A 4EGVA 2JA6H 4PZ8A 1L0YB 2NZOA 2O5IC 4ALPA 2R61A 3OW7A 4GNXA 4P73A 1SN8A 2NN6G 4K8IA 2KCMA 3WWVA 2A69D 2IT1A 3FVQA 1SNDA 5ELFA 4LK1C 5M5XB 1KRTA 1D7QA 4IFDI 2FFKB 1QVGA 1XMOQ 4XIGS 4A3BB 2K75A 1VQ7A 3SVMA 1EU3A 4LUZA 4G7HC 5GAEC 4A3EH 4X3KA 4B9WA 4ME3A 1T5EA 4KJOA 4WANA 2YYZA 1HZAA 1PH6A 2WKDA 3PGZA 4DV2L 2QF7A 2NVQB 4LF8Q 4ODGA 2X6LA 1TY2A 1SROA 3BU2A 2N55A 4NDXA 4YCUA 3RZOH 1M8AA 1V1OA 4IPHA 2IY5B 3KJPA 2F0OA 4RH6A 5I6WA 1VQPA 4RHRA 1TS4A 3U1KA 4CKBA 2E3UA 4L5TA 2NN6I 2PQEA 3CCEA 2C5CA 3K6OA 2A68D 4A93B 2TSSA 1CT1D 3A54A 3KLRA 5M5YB 4BXXG 4A3GG 4RKBA 1KLGD 1OXSC 4PQXA 4DR4L 5C3WA 1VQ9A 1B9MA 4NB3A 1CKOA 4O0AA 3MXPA 5I9PA 3T51B 5DEHA 3HOYH 1VQIA 5JPMC 5FO7B 3K5LA 2MO0A 1I6HH 1T5XD 1CQVA 3TP5A 1UAPA 4RFBA 1D1IA 3MFGA 4DV7Q 3HGBA 2BA1A 1N9WA 4POFA 1LV9A 1ML0D 3T16A 3KBXA 4JI4L 1L2FA 2ZJQA 2JZXA 4UDUC 3A5UA 4TVAB 1QVCA 4A3IG 1IZ6A 5CR3A 1TUAA 1T9HA 4FF2A 2KECA 3RZDB 2B63H 2EY1A 1X3GA 1JWSD 3H15A 2K05A 1IBKQ 1RCVD 5DNFA 4LW1A 2IX3A 4P74A 1R4PB 3CC2A 3CQZH 1PH1A 3J80E 4BY7G 1CKNB 4JBWA 1KLUD 4YWLA 2F3WA 2B39A 1HFGA 4LMQD 3DMUA 5ELEA 1X54A 1YHBA 1O78A 4DV5L 4DV0L 1CI3M 2DUDA 3B6YA 1U4MA 2IJ0A 4DR6Q 3PIP3 3FPUB 2IPKD 1TWHB 2PO4A 5HURA 3X3NA 2HIVA 1QZGA 1A63A 2CW0C 2EYHA 3I7FA 3NBIA 1V8QA 5CV5A 4DGZA 5KGUA 1Y1VB 3Q8DA 3NE5B 1LTID 2CTEA 2ZJRA 1JE5A 4C1NI 2L0CA 2BH2A 1XTDA 3PUXA 4K5XA 1MKHA 4HJ5A 4B3RQ 2PNHA 4EQOA 1K3RA 1TVXA 4QUFA 1V1QA 2RDHA 2PI2A 4KTAA 4BA2I 4WALA 1FR3A 2AMCB 4JOIA 3I2ZA 2TMPA 1WE8A 1NBWA 1HZBA 1K83H 3CCUA 3OHXC 1BBUA 4DK3C 3PO3B 2DGYA 3RZOB 1DYQA 2B2YC 3D3RA 4A3DH 3VA7A 2FHTA 5EGTA 3MEHA 1EY7A 2RA4A 3AEVA 2R7ZB 4OL7A 1PRTB 4JI6Q 5ISRA 2D5DA 2F03A 5IWAQ 4PMCA 5KNDA 2VQEQ 1HJPA 5I6YA 1XPOA 5C4ZA 5EKLA 4M1UB 2VNUD 2QKIC 1ILQA 1JR0D 5C44H 3S1MB 3TSSA 3KF6A 1RD9D 5A2QL 2A69C 1K73C 3T1HL 4DV4Q 3OTOQ 3D0FA 5ELNA 2KUMA 5IYBH 2ZT9C 2RVLA 4RWSC 1ENCA 3OIQA 1HCZA 1ESRA 4QGUA 2VW9A 1N34L 2F0GA 1S5CD 2G9DA 1YIJA 2L4NA 3RD4A 2E5LQ 3HOZG 3NPPA 3GTQB 3RLNA 5AJ3Q 1XNRQ 1U5KA 3URYA 5M9OA 1N36Q 2YQRA 1Q7YC 1EIFA 3BVMA 2EOTA 2E2JH 4JG2A 2B63B 2AUKA 1VQGA 5FOBB 4HSVA 3P7JA 3GTPH 3KYHC 3PIOA 2WV6D 3CQZB 3U4ZA 4DR7L 1HNZL 5K36G 3STBD 5IY0A 1E3PA 3C3LA 2A68C 4GS3A 4B3ML 2Y0SG 2F0DA 4BA1I 4R8NA 1HPCA 4X3TA 3CCQA 4KD3A 1VQKA 4LF9Q 1NUCA 2XNAC 4Y7NH 3G48A 2AQ1B 1STYA 1WCMG 1D1KA 3A5ZB 1VQ4A 1QJOA 3N6RA 1N33L 1ZZIA 4OGQC 4OX9Q 2KCNA 3GDEA 2F0SA 4AM3A 2F0UA 3MXUA 4GN4B 4B8TA 1Z9FA 5E1FA 3MZ5A 1SJED 3GTGH 4JYAQ 3A56A 1NTGA 3M4OH 3HOYG 3DHQA 1PYWD 3NQTA 3S14B 4HJ7A 5CV9A 3ER0A 1CQFA 2YU9B 1EFID 4YHHL 4R4QA 4WRDA 1SMYD 4R1JA 1YNJD 1PV4A 2VS1A 4DPGA 4C3JH 3CC7A 3RLFA 1HNWQ 5JEAJ 1I4RA 3TP8A 2C35B 2JSOA 4TKOB 2RHSB 2JVZA 4V0BA 2ZJPA 3FKIH 3MTSA 4X64L 1CZGA 3W1GA 3I72A 1Z7TA 5DM73 2KA7A 2JEAI 5C4HA 3RMHA 2UUBQ 1RDPD 4R4IA 1EC6A 1JJCB 3CHBD 4P71A 1JOQA 2ZTDA 5FJ8G 1J5EL 3S15B 4JI7Q 4ZK9B 2SNMA 4A3FH 3LWEA 3RR5A 1VQ5A 4UAIA 2WAQB 2UUAQ 2JP1A 2IHFA 4ILWA 2XGTA 1KC8C 4LIJA 3BDLA 3J81E 5M3MH 2VB2X 1GUGA 2B2UA 1QWYA 5JOBA 1C0AA 3L3OC 4M8AA 1VQCA 2SEBD 2BDNA 5KIXA 5C4XB 2XWJB 3UE0A 1TY0A 2MGSA 2L15A 3EQLC 4V190 2OQKA 3NTIA 3EA6A 4KV6A 4HJAA 5C0XJ 2LMCB 4CJ2C 5IIFA 2ALYB 2NYZD 2E2HB 5DM63 3S16B 1VQ8A 5E7NA 1SJHD 4KY6A 3VYRA 1PH3A 2HIXA 3T13A 3H0GB 3C2PA 1WI5A 1KNEA 1A8VA 1YJNA 2R3ZA 4JI5L 2B2VA 2CTKA 3TZUA 1HH2P 1GD7A 3HKZE 3J7YW 3PF5A 5IGBA 1IL8A 4Y7NB 5EJWA 1C4QA 3SXHA 2MQHA 1Y1WG 4GOPB 3TREA 1I6VC 1PFNA 1BCPF 3A7AB 4B3TQ 5JAVA 4DR3L 3KF8A 1YZ6A 4KHPQ 1DOKA 1TIID 4OIJA 1XNQL 3MXGA 1B2TA 2VY3A 3VYTA 5C44G 2JE6I 3E6ZX 1P16A 1MBYA 1LYLA 1KDCA 1JMCA 1Y8OB 2OXPA 3V96A 3P20A 1HRJA 3A74A 4A3JH 3S1NB 3V2TA 1SYBA 3EFXD 1R9TB 1Y69U 1WTRA 4HTHA 4L6TB 4JI1L 2PQAB 5IODA 3GV6A 2PZWA 1I94L 3OWEB 1PRTD 4DUZQ 1B9NA 1D8LA 1E2ZA 4HJ9A 4X65Q 3IAYA 5IYCG 2OPVA 3S17H 1PXUA 4C3HH 4A3MB 4HMJA 4IN3A 4A3KB 3STBC 1HFNA 1CKMA 2QCPX 4F88A 4KI0A 3UI2A 2ICEC 2NUCA 1BOSA 2K01A 4AQYQ 1SE8A 1KDBA 1G8ZD 3O13A 2V4DA 5I2YA 2MJHA 1XPUA 4X66Q 4FXDA 3K59A 2AKWB 2K6AA 2QNDA 3AFPA 1DOMA 4JV5L 1MJCA 2EJGC 1IL2A 4BY1B 1UE5A 3K5OA 2L5TA 4BXXH 2HT1A 4A3GH 4BBSB 3U58A 3S2HB 1QZHA 4RHSA 4FO2A 1SMYC 1YNJC 1B70B 1ZYRD 5EAYA 5EBDA 4DV6L 1HQMC 2I5MX 2D0PA 5I4DA 3NP8A 1EL0A 1BO0A 5IGEA 3EBEA 2UUCQ 4YWKA 4HCSA 3GTMB 2YTVA 1F9QA 2Q2IA 5TSSA 1NMFA 3P75A 2E76C 4LF5Q 1X32A 4DKAC 5BR8Q 2WFWA 1EOTA 3CPFA 2K5VA 1DOLA 2PMZB 5ELBA 4AYBB 2KHJA 4H13C 1MIUA 1SNPA 2RSOA 3J80c 5C3EH 1ENAA 1LTSD 4CJ0B 2RHQB 1JJ2A 4LFAL 2L9HA 2A73B 2WKCA 2AWNA 1F9SA 3A7LA 1GUOA 1WTXA 4A3IH 1XYIA 4ZRZA 1JCKB 4K2LA 2KEDA 1HNXL 1A6XA 1JOKA 2D0OA 4LF8L 1ASZA 4CKEA 1GUNA 4NP5A 3I55A 4BY7H 2PQUA 3I90A 3OW2A 1SE3A 1JT8A 4HIDA 5M5WB 1BXTA 4A3JB 4WJ3M 1TKWB 1PFMA 4KJNA 3QJYA 3F8TA 1EIGA 1NMGA 1HHVA 4DUYL 4F7XA 3PUYA 3NEMA 1EOVA 2MPMA 1LT3D 1O7IA 2EY6A 3AFQA 4LFCQ 4B9XA 3VR2A 1PVOA 4DXFA 3NXWA 3S1QB 1L1OC 3HKZG 2LXJA 2BE5D 4NXNQ 4WFN3 4OIKA 2E74C 2RF4A 3HOWH 3K5MA 4LF6L 2R6GA 1SYGA 1QB5D 3BYTB 3DM1A 3G6EA 3NBHA 3BZDB 5C6AA 4DV7L 4LF7Q 4RCNA 4OO1H 2UXCL 2VUMB 3CCSA 3I91A 3DEOA 4DAMA 4NW2A 3PUZA 3F2CA 2R93B 1I4XA 3OWFA 5IP9H 1CZWA 2K5WA 2DNCA 4QMGA 2FINB 1PTOB 1LT5D 2NTTA 4DXGA 3VR3A 2F0FA 5IT9L 2SOBA 3F2DA 3K7AH 4E6IA 4DAPA 4QB4A 5C3XA 4C3IG 4IPGA 1EEFD 4KKTA 1EY4A 4N9TA 4MIUA 3CW2C 5D65A 1AH9A 3GTKH 4A3GB 4DR5Q 3GTLB 1WFQA 2H1EA 1A3VA 5CYUA 4NPSA 2EQSA 1K8MA 4P2CB 1J5KA 4XT1B 1IBMQ 3A8KE 2DY8A 3KBGA 2F0EA 4KLKA 1NE3A 2IX0A 1TWFH 1HUNA 4DR1Q 2R92B 4FNFA 1PRTC 5CV6A 1UEAB 2RQXA 1VF5C 3D6CA 5EQ0A 3ULJA 2KOLA 3K0XA 3QG1A 3DWQA 4IUUA 3OIPA 1CSPA 1PRTF 2OQ0A 1PA6A 3IFDA 1STNA 2K4KA 3HOZH 1XMQQ 1AE3A 2Q8IB 1SE2A 4XXEA 2KQ3A 4C3HG 2ZM6Q 3L9AX 4HAEA 2NTSA 4K5WA 4BS9A 4RA8A 1HTPA 1JB3A 1F9RA 2O2LD 1ZEQX 4DV3Q 4K0KL 4X62L 3I4MG 2CVRA 5K36H 3M7NA 2VQFQ 3GTOH 1YHQA 3CPWA 4XQJA 1AN8A 2GA4B 4PZ6A 3CD6A 3I73A 2XIWA 1PYSB 4L63B 2F3IA 5FLXc 3JAME 3PIO3 4MTNA 1H9SB 1WCMH 2FMCA 2K50A 1LACA 5M3FG 1WYDA 3FPPA 1VQFA 4L8JA 1S5ED 4KN7C 5LL6X 3CAMA 3W5OA 4OHJA 2K03A 3SDZA 4EX5A 1IYVA 3TS0A 4LAAA 2M00A 3RN2A 4JBKA 3T4AC 5GROA 1TWCH 5LMNQ 1IBLQ 2UXDQ 2EVBA 1DM0B 1OXUA 2H5XA 3V69A 2ES2A 1J9OA 5AJ3L 4TQUS 5DAUA 2JA5G 4NXML 3HG9A 1H9RA 2EY5A 2BOSA 5C3EG 2Q8RE 3TP7A 3HOXB 2YTXA 2XRQD 4AIMA 5LMUL 1N36L 3T1YL 5EPKA 3HOVG 3HOUB 4DNIA 3S2DB 4P72A 3R8BA 3J81c 1RKNA 1X4NA 3NK9A 2UU9Q 1X3QA 1SFOB 3GTJB 1STBA 1W6JA 4X3UA 4HCEA 3Q0AA 3EJIA 5FJ8H 2KEEA 2OTJA 3DWAA 4IURA 4PV1C 2JJQA 5LL6S 1CSQA 1TWGB 4K2KA 2LKVA 3TZDA 4GN3B 4JI0Q 5J22A 2K5NA 2CPQA 1VF7A 3G6JB 3C1EA 1KHMA 4A3BG 4GKJQ 2JA6B 1S5DD 1L1OB 1A3UA 3BS1A 1FL0A 2CTMA 3ONAB 5G3LF 4GN5A 3F2BA 2QGQA 5IOCA 1E7ZA 2OPUA 3AMUA 5CORA 1XPRA 2HHHL 2K1BA 1JORA 3ZJYC 5IP7G 2YV5A 1WD0A 2FMRA 1VQBA 3KK7A 4N9PA 4LF4L 1O7YA 3E9HA 2VB3X 1KAAA 4JVHA 3UDIA 3TDQA 1VS0A 3HOWG 1PZJD 2L12A 4KD4A 4EQPA 5BN4A 4A3EB 5J3BA 1Q1BA 1HXYD 2NBFA 1IXRA 4JCVE 1E1TA 3F2UA 5J39A 2Q2TA 3DUZA 4A93G 4OO1G 1NJIC 2F52A 4OONA 1VDZA 3SK8A 1KXLA 4C2MH 5LHY1 2Y0SB 4MHEA 1SYCA 2EJMA 3L0OA 3ULLA 5IP9G 4OWXB 1N32L 4HSPA 2FJ2A 4YY3L 1Q12A 1JC7A 2R7FA 5IGFA 3IRBA 2L55A 1Y1WH 2OT2A 2CTJA 3WOEA 3BVGA 3PO2H 1VQJA 1X9NA 3QO2A 3OPOA 1ONLA 4DAYB 4DV2Q 3I8ZA 1HR0W 4HMIA 2EPBA 3LGJA 3I4OA 3HOYB 3SK5A 1QOHA 1JQYD 2Z1CA 1NAPA 1B44D 1WVLA 1EIHA 4GOPC 1I6HB 4LFBQ 1I5FA 2N49A 4OO1I 5HY6A 1WTPA 1PTOD 2LXKA 1PYBA 4Y52H 4IPDA 2PYKA 5CBAE 4A75A 1EU4A 4ULLA 2B2WC 5IYCH 2HDMA 4DR4Q 3HEJA 2JA8H 4H7BA 5KNCA 1GO3E 4POGA 1S4ZA 2F0HA 3S1RH 4MN3A 1IYUA 3EVQA 1STHA 1GVPA 4XQNA 1B1ZA 2EXZA 4NKLA 3GP7A 4C1NK 2XVSA 1N8RC 3QIAA 5JJLA 1SNQA 1IYJB 4G4KA 4RCOA 5EKKA 5JVG3 2K32A 4JI4Q 1LO5D 2WAQE 1CA6A 4U673 1FVIA 4FXGC 1RJTA 3K7UC 3TS2A 3OOCA 1Y8NB 1TS5A 4KHPL 4DF7A 2RSNA 3A8JE 2ZTEA 1LABA 1YNND 3PO3G 1HZ9A 3D31A 2VL6A 1U9RA 3KLSA 2K14A 2Q8TA 3J7AF 1B8AA 4HIOA 2KHSA 2E75C 1SR3A 4YWMA 1CK1A 4IFDJ 3K81C 3PCOB 4DV0Q 2WB1B 4JI2L 1YJWA 3LX0A 3FMCA 4B3SL 4DUZL 1K83B 3PUVA 4X6AH 3MHBA 1AZQA 1EFWA 4QMFB 4HEDA 3VR4A 2XTIA 3MFYA 3E0JA 2XWBB 2OCEA 4A3DB 1D6EC 4DV1L 3PMFA 1MD2D 2C9OA 5EBCA 3CRLC 2GVBA 1Q3LA 1S72A 5A35A 1QNKA 1K8GA 3A0JA 1DJRD 4JBJA 3H09A 2B29A 3ICEA 2PZTA 4DK1A 1IW7D 2F0WA 2K5QA 2NVTH 5C44B 3AU7A 1B53A 1FD7D 1WOCA 3MXNA 1HR0L 1SRUA 5EPLA 3HZXA 1BNZA 2F4IA 2QILA 5COYA 1PH2A 1FJGL 2CTLA 4RAUC 1DD2A 5ELCA 2MJ8A 1QUQA 2Z6KC 3VKEA 1H95A 2MUYA 1ESFA 4JI8L 2V1CC 1UE7A 1SAPA 1VCIA 4A76A 1HA6A 3DM3A 1TS3A 1SEBD 4J15A 1M4VA 3TN2A 2K5HA 2E2JB 3ULPA 1V43A 5JJZA 1FGBD 1L0XB 5IE8A 5BR8L 4IUVA 3G7LA 5FK9C 3GTPB 5C5MA 1SLJA 2KHIA 3HS0C 1N34Q 4DK6C 3CC4A 2HH3A 3C1FA 4RGOS 1I50H 1YJ9A 1D2BA 2IW3A 2X6GA 4B08A 1SBBB 2J7ZA 4ZLTF 5DLQE 2JYOA 3G71A 4NMZA 2F1MA 1ZZKA 2MO1A 1F2MA 3UDFA 4PNYA 2I46A 1UWVA 4ME5A 3RUZA 1SSOA 4C3IH 1GUTA 5KRUA 2EXDA 3PO2G 1A2TA 4GLVB 1V1PA 2R7DA 2F0QA 2M2LA 4DR7Q 1HNZQ 3NWSA 4K8JA 3AYHB 3GTGB 1PTOC 3M4OB 1DCZA 1PH7A 4B3MQ 1DGSA 1S40A 4G57A 3NWTA 4ZUIA 4DR2L 3NTKA 3PUWA 1M1KC 1BBXC 4Z9CB 3RLOA 4C3JB 2B2TC 1KD1C 1N33Q 3J80i 2CKZB 2K52A 2LY7A 5LMNW 3FKIB 1Q8KA 1II3A 2XN9C 2PMZE 4AYBE 1HA5A 1RTNA 1ZKOA 2WAQG 4GNXB 5J1ZA 5BN3A 5CV8A 2JA8G 4RG1A 1I3QH 3VR6A 4GKKL 4XYOA 3UDXA 1CFMA 2F0JA 5I2XA 5C4JH 3JAMc 1JJGA 1TR5A 2L11A 2CQAA 3I4MH 1EZ6A 4K14A 4A3FB 1MSGA 1STGA 4R8IA 1C9OA 2F4VL 4KHZA 3I3CA 4ZKCB 4FDBA 4FP5D 1EY6A 4LUOA 2XSCA 4EQ5A 2QA4A 2UXBL 5M3MB 1WTQA 2EYFA 4QUCA 1NY4A 2MP1A 4XQQA 2RKSA 3J81j 1YNNC 1LTTD 4R4TA 2ASBA 4J1MA 2GVAA 3U9SA 3M4PA 3Q24A 4GLXA 3QOJA 1KTKA 2CQOA 5M3FH 1FNWA 1Y8PB 5KEEA 1J5EQ 5C0XH 1PFBA 5A2QE 1TWAH 1BQQT 3J7AV 1EQRA 2RBMA 4Q5VA 1STAA 4WORA 1B4OA 1TQOA 3J80L 1VQMA 3CCJA 5CBEE 1BBWA 1A62A 1RL2A 1Q46A 4O1NA 4KK7A 2NVYH 2FXQA 2QEJC 5H1SE 4QIWB 1DXMA 3H6MA 2BCOA 2JA5H 4DFAA 1E22A 3OSOA 1XMOL 3CMEA 1ET9A 1EQTA 2SNSA 3AQQA 5IYDG 1XXGA 2IL8A 3F1ZA 3HOVH 2E2IH 4NBQA 1IW7C 3M4YA 1VQNA 3H91A 1TT2A 2VQFL 1EY9A 3NQIA 4L5SA 1NR4A 1E1OA 1YEZA 2O5JC 1KABA 5M5XH 3T56B 2D9UA 4JI5Q 4F87A 2JEBI 1PFSA 3SR1A 2PZUA 4A3BH 4A3MG 3ERSX 4RGNA 3SGIA 3TBIB 1PMRA 3J7ZC 4R4CA 1PHJA 5IP7H 4CJ1B 1H9MA 2NVQH 1VQAA 1MGSA 2K5DA 1X6OA 5GQOA 2QDBA 3SE0A 3BG3A 1GUWA 2CWAA 1XNQQ 2AXYA 3S17B 2KCCA 4C3HB 2K28A 1K1GA 1I3QB 1PH9A 1AE2A 2PPBC 5LMNL 1GJXA 1EEID 3WDNA 3CRKC 2B2UC 2JA7G 4S3SA 1KHIA 5CV4A 5EPJA 2PCFB 4BY1G 2F0KA 4A93H 4FXKC 1F2ZA 4FVMA 5M5YH 2E8GA 2D62A 1I94Q 4BBSG 2B2YA 4QY7A 4H0LC 3QOLA 2A6HD 3OYYA 2F0NA 2UU9L 1KL9A 4BBRG 1IBKL 1EIYB 5BN5A 1BCPB 3W2DA 2BH8A 3DLLA 3UE1A 1K0RA 1CM9A 1LTRD 1VMPA