5C0XG

Structure of a 12-subunit nuclear exosome complex bound to structured rna
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
237
structure length
237
Chain Sequence
MSTFIFPGDSFPVDPTTPVKLGPGIYCDPNTQEIRPVNTGVLHVSAKGKSGVQTAYIDYSSKRYIPSVNDFVIGVIIGTFSDSYKVSLQNFSSSVSLSYMAFPNASKKNRPTLQVGDLVYARVCTAEKELEAEIECFDSTTGRDAGFGILEDGMIIDVNLNFARQLLFNNDFPLLKVLAAHTKFEVAIGLNGKIWVKCEELSNTLACYRTIMECCQKNDTAAFKDIAKRQFKEILTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exosome complex component RRP45
publication title RNA degradation paths in a 12-subunit nuclear exosome complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae s288c
molecule tags Hydrolase/rna
total genus 43
structure length 237
sequence length 237
ec nomenclature
pdb deposition date 2015-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF15985 KH_6 KH domain
G PF18311 Rrp40_N Exosome complex exonuclease Rrp40 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5c0xG01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5c0xG02
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 5c0xG03
1GKHA 3RZOH 4GLAC 3S14H 2JQOA 4P71A 4NBQA 4A3MG 3ND8A 1JJ2A 4GN3B 1YHAA 4LFBL 3OOCA 5HY6A 2BE5C 1FJGQ 5HGQA 3CPWA 2OQKA 2AWOA 2DN8A 2UU9L 3AYHB 5M3MG 1QZHA 3T1YL 2NN6G 3QJYA 2KCMA 1QVGA 2I5HA 4DV6L 1VQIA 2D5DA 5JEAG 4DNTB 2V1CC 1J5KA 3EBEA 4DUZQ 2HHHQ 3G48A 1BDOA 4DNIA 4KHPQ 2ANNA 3I56A 3GTKH 3UDGA 4DV2L 1I50H 1IYVA 3GD7A 3G4SA 4PG3A 4JI8Q 1KRTA 3HGBA 2WP8J 2F52A 4UP9A 1L2FA 1TWAH 4BBRG 1YHBA 1VQJA 3OTOL 5C0XH 4A3GG 3M3YH 4A3DG 2JA8G 1KHMA 4IFDJ 5K36H 4DV4L 2EJGC 2GVAA 1VQ8A 1RL2A 1KC8C 1VQKA 4BA1I 5JJKA 1MJEA 4DUYL 2D0OA 1PA6A 1DD2A 1GM5A 2MO1A 4BXXH 1X6OA 2K52A 2Z6KC 5IWAQ 2RHSB 4A3LG 3E9HA 1VF7A 3HOZG 4UY8C 3J81i 4HIMA 4A3CG 3A5ZB 5FLMH 1Y1WH 1KRSA 1HZAA 3IFTA 1Q82C 3CCSA 2CTJA 4TVAB 1VQ5A 3QIAA 2BL5A 2DUDA 2XTIA 4LW1A 4NPSA 5DLQE 2OQ0A 4UPAA 3J7A5 3SDZA 1X54A 1EIYB 3EN2A 3CCQA 2JK8A 1EIFA 5FLXc 5GAGC 1Q81C 2RHQB 3OW7A 3A5UA 3CC2A 2A6ED 1HR0L 2VZAA 3WDNA 1I94Q 3S24A 2YYZA 5KNBA 3ND9A 1Z9FA 2VY3A 3K0XA 5C3EG 2WAQG 4NXNL 4HJ9A 1GHKA 1E3PA 4BY7H 4IQZA 1VQBA 4DR1L 1B7YB 3BZKA 1L1OB 1C7YA 3CD6A 1GUGA 2IT1A 3ZJYC 4AQYL 1VIHA 3F2BA 4EX5A 4A3IG 1N34Q 3I73A 4DR4Q 3PO3G 4POGA 1O7LA 2A69D 4A93G 1GO3E 3OW2A 1BKBA 3MXNB 4IJLA 2R93H 1T5EA 3DLLA 1Y69U 4DV5L 1N36L 3HOXH 3SE0A 4DV0L 1KD1C 2F4VQ 3W1GA 1X65A 1TUAA 3AFPA 3RNUA 1W3SA 3M9BA 5LMUL 1Q1BA 3CC7A 4LFCQ 3KLRA 4GZYC 5GADC 2BA1A 1A6XA 4QL5A 3I55A 3CCMA 4NB3A 5JJLA 2F3IA 3PUYA 4DK3C 4B3TL 3GTLH 4GNXB 1IBKL 1IYUA 3GO5A 2YTVA 3U50C 4OO1H 1VQAA 3RN5A 4DKAC 1J5EL 4GNXA 1XJVA 3TS2A 5ELOA 1HNWL 1FYCA 1HNZQ 1HZBA 2I0QA 4DR7Q 4K0KQ 4B3MQ 4X6AH 2Q2HA 3HOUH 3GQBA 2PCFB 1PH8A 2K32A 2ES2A 3WWVA 1TWHH 1WI5A 3E9IA 2CTEA 4LF6L 1WVNA 1H9KA 3EQLC 3PO2G 4POFA 2GN5A 3I7FA 1TXYA 4LF9Q 3PUVA 2JE6I 3S1QH 4DV3L 2D0PA 1YJWA 1J4WA 1W2BA 1XPRA 3F1ZA 2EVBA 4LUZA 1HCZA 1ZTGA 1U5KA 1JE5A 1N33Q 4JI5L 3PUXA 4A3BG 3PIPA 1MKHA 5M3FH 5JJIA 4OGQC 2N3SA 2A68C 2WB1E 4B3SL 4KKTA 2V4DA 1OXVA 2VL6A 1LTLA 2HT1A 4HIOA 3VR5A 1N9WA 1FR3A 4RMFA 1PV4A 3FHWA 4B3SQ 1VIGA 4OXPA 4LUVA 2JA5H 4Y7NH 1X4MA 2MO0A 2Y0SE 1GHJA 2OWOA 2ATWA 3HOVH 1PMRA 3ICEA 2C35B 4DV1Q 3STBC 4X64L 4JI6Q 4OX9Q 1X3EA 2UUBQ 3ULLA 3QG1A 3RLFA 2A8VA 2E74C 4HJ5A 3GTJH 3PF5A 2UXCQ 4DR3Q 1YNJC 4GNXC 4DK6C 2Q2TA 3GTMH 2JA6H 2K33A 1K8MA 4C2MH 3F2DA 4A75A 5JEAJ 5C4JH 4KN4C 1PH5A 1P16A 3S16H 3HKSA 2JXMB 2O5JC 1T9HA 2ZTCA 5K36G 3CMEA 2ZM6Q 1DCZA 4YCWA 3EIVA 4LUOA 1I6VC 4GKKL 1JJCB 3T1HQ 3RZDH 3PV0A 1K8GA 4J15A 1E1OA 3L0OA 3CF5A 4DR6Q 3K8AA 3GTOH 4YWLA 2RCNA 1HTPA 2A6HC 1XPUA 4BXXG 5LMNL 2UXDL 4JV5L 2MJHA 3MFYA 2ASBA 4EQ5A 5IP7H 3KYHC 1E2ZA 1QJOA 1YEZA 2CPQA 1LM0A 1SMYC 1Y1WG 5FLMG 1IBLL 1IL2A 2BDOA 1GUNA 1G51A 2N49A 2UXBL 1FL0A 2MFIA 2UXDQ 4XIGS 2I5LX 3M4QA 3TRZA 4B8TA 2RF4A 5IY0A 3HKZG 2EDGA 2JEBI 3D4RA 1PH4A 4DR2L 5C0XI 2KENA 1NMFA 4LF5Q 4HJ8A 1ZYRC 1VF5C 3PSIA 4LFAL 1FVIA 1CUKA 5IYDH 2R6GA 4A3FH 1XNQL 4X62L 3CXCA 2OCEA 4BY1H 1JT8A 4OONA 4DR2Q 4YY3Q 2JJQA 3PUWA 1SN8A 2Q8IB 2B3GA 2QA4A 2YTXA 5GAHC 1DXMA 3CCUA 2D62A 3T51B 4X62Q 3VA7A 4C3IH 4BY7G 1XMQQ 4IOCA 1WJJA 3BJUA 2ZJQA 1C0AA 2MQHA 4JI0Q 1E7ZA 3L2PA 1KL9A 2K5VA 1SE8A 4KLKA 1OXTA 1X4NA 4IOAA 1PH3A 2VNUD 1VQ7A 1MJCA 1S40A 4LFBQ 3OPOA 2ZTEA 2R93G 5M5WH 1WE8A 3M7NA 1I5FA 1B70B 4LF8L 3HOXG 2UU9Q 4DAMA 3T1YQ 3GTGH 3A8JE 3AEVB 4R4QA 4R4IA 4DV6Q 1PYSB 5H1SE 3NEMA 3GTQH 1NJIC 1N32L 4LNQA 3T56B 1X3GA 3AEVA 3E0EA 5E7NA 3CAMA 1KHIA 4IO9A 1K1GA 5EAYA 1SRUA 1GUOA 4DV2Q 4H0LC 2PNHA 5IYCH 4LF4L 4KI0A 1S3OA 1YITA 3S2HH 4R4CA 1Q1EA 2EJFC 4LWCA 3LWUA 3VR2A 3ULPA 2BH2A 2R7ZG 5FJ8G 2AUJD 3HOUG 3OTOQ 3VR3A 4JBWA 1H9JA 2CTMA 4IPCA 4DV4Q 4BBSH 1Y8NB 3FKIH 3U4VA 4TKOB 3VR6A 4QQBX 4L5TA 1K8AC 5BN4A 4DUYQ 2E2IH 5M5YH 2BH8A 3V69A 2CKZB 4H02A 4I7ZC 1IW7D 1TWCH 4JVHA 1VQ9A 4OO1I 4GLXA 1TWGH 1BBUA 1DGSA 2CWPA 2E5LL 2K50A 3AQQA 4JI7L 1ZZKA 4RG1A 5M3FG 1EQRA 5M5XH 4HIDA 2KHIA 2CTLA 1YNXA 1PVOA 4QJFA 1VQLA 3RLOA 4P73A 3UDFA 2K4KA 3J7ZC 2A6EC 2LXKA 4LIJA 1OTCA 2NZHA 2VQFL 2A19A 4QMFB 1EUJA 5KNDA 1HR0Q 3T53B 4KMUC 4R4TA 3HOVG 3OYYA 2D2CC 4AIMA 1IYJB 2Q2IA 4JBJA 3UDIA 2IX1A 4P74A 4A3MH 4NXNQ 2PMZE 3KLWA 1SFOH 2YTYA 4DR1Q 4YCUA 1X9NA 4DR5L 4JI4L 4A76A 2N8NA 3K7AH 4O2DA 2A69C 1K8OA 1V9PA 4XTCS 4AQYQ 1GUSA 4RCNA 4O0AA 3I72A 3U58A 3P20A 1V1QA 4QY7A 3D31A 4PZ8A 5KNCA 5C4XH 1BBWA 2CWAA 1N36Q 4DV5Q 3D0FA 3FP9A 4DV0Q 5LMUQ 4A3EG 5GROA 4DPGA 1IXRA 4L8JA 2IHEA 4KHZA 4B3TQ 2AHOB 1IBKQ 2UUCL 4OWTB 1AH9A 4YWMA 2AMCB 2F1MA 1J5EQ 1GJXA 3Q8DA 4A3JH 5IP7G 1HNWQ 4WJ4A 2VQEL 3BU2A 1HQMC 1AE3A 2JEAI 3KOJA 2DGRA 3VKEA 2OTJA 3RLNA 3J80c 3NBHB 4GN4B 2KBNA 5AJ3L 3HFZB 4DK1A 3ERSX 4LF6Q 4GKJL 4X65L 3S17H 3FPPA 1VDZA 2UUAL 3S1MH 2B63G 3K80C 4IFDI 1R9TH 4A3LH 4PV1C 5GQOA 5IYDG 4A3FG 1HZ9A 3HOZH 4YHHL 4GOPB 2AWNA 1HR0W 4HJAA 1IZ6A 3BG3A 4BY1G 4DV3Q 1H9RA 2KA7A 3I4MH 4GOPA 4A3KH 1AE2A 1EC6A 2WB1G 4JC0A 2CW0C 1B9MA 4P72A 2KCCA 2Z0SA 1EFWA 4JI5Q 1YHQA 3IKJA 2HIVA 2JA7H 1A8VA 1KAWA 2H5XA 3CPFA 1VQ6A 4IJHA 3CCVA 4OWWB 4JYAL 2YQRA 4JI3L 3GDEA 1XMOL 4P75A 3U9SA 1UE7A 1E2VA 4GLVB 2Y0SG 2E76C 2JA9A 4LF7L 3M4OH 1YVCA 3CW2C 4IPHA 2HIXA 1CKMA 2L5TA 1GVPA 2N78A 1CKNB 1VQMA 3A0JA 2GVBA 4JI2L 5BR8L 3G71A 1CSQA 4X64Q 2VUMH 3MXUA 2PI2A 1Y8PB 2JVZA 3J81j 4FDBA 1CKNA 2R7FA 1UE5A 1V8QA 3CCEA 4UP7A 3KF8B 2NZOA 1CI3M 3TEHB 5IYCG 4JI1L 4UP8A 5C0XG 1Q8KA 1Q86C 3CMAA 4DAYB 1EOVA 1SLJA 5C44H 4AYBE 4IFDH 2WFWA 2IHFA 3DM3A 2FXQA 4AYBG 1Y8OB 4JI1Q 1D8LA 3PIOA 3BDOA 1Y14B 1WOCA 4MNOA 1HJPA 1EWIA 4BBSG 1E2WA 1B9NA 1CTMA 3FKIG 1VQOA 1E24A 2YU9H 2R92H 4GKKQ 3W3AA 4NXML 4G7OC 1WYDA 3L7ZC 1LABA 2HH2A 1HNXL 1PH2A 4PZ7A 1SMXA 1SROA 4GOPC 1Q90A 5LMNQ 1RIPA 4JV5Q 3SGIA 4YWKA 4MTNA 3KJOA 3KFUA 5IE8A 4B3RL 1VS0A 5A35A 4DV7L 1IBLQ 3H0GH 4JOIA 3J81c 2OPUA 1TKWB 2UXBQ 2CTFA 2CQOA 5IP9H 1IBML 1B8AA 2ZJPA 2NVQH 3I2ZA 1XNRL 4JBKA 3F8TA 1UE6A 3VDYA 1X56A 2K7VA 3K7UC 1MIUA 2PQAB 3HOYH 4OWXB 3A7LA 4LFAQ 1ZKOA 1UWVA 2ZT9C 1O7IA 1XNQQ 4JBMA 3W5OA 1PFSA 3K81C 2PQAA 1KXLA 3VR4A 1PHJA 4Y52H 2ZTDA 1TU2B 4KKUA 3LNNA 1FJGL 4MZ9A 3F2CA 2JZXA 1JJGA 3W1BA 1J6QA 1OXSC 1Q46A 1YJ9A 2PNRC 4G7HC 2KHJA 2EJMA 2BE5D 4IPGA 1HPCA 3JAMi 3CCRA 2OTLA 2QF7A 1VQNA 4DUZL 2HHHL 1ZZIA 4KHPL 3HOWH 1NTGA 5C4XG 2VS1A 5ELNA 4LF8Q 4JI8L 1XPOA 2K5HA 3KF6B 3TREA 1A62A 2HQLA 3I4NH 4DNRB 2EQSA 1YBYA 1VQPA 4H13C 4OO1G 3KF6A 3PCOB 1LACA 1N32Q 2K14A 1Z7TA 4H44C 2PY9A 2LMCB 4PZ6A 1L0WA 2CTKA 4LJZC 1JB7A 3A7AB 1VQFA 3BZCA 4LF4Q 5LMNW 1HZCA 3JC66 2DNEA 1TWFH 1NE3A 2HH3A 3NELA 4JVYA 4A3JG 3B6YA 3DXJC 1VQDA 3NENA 2QGQA 2PI2E 1PH7A 4JOIC 1QZGA 1E1TA 1KQSA 4R4OA 3KDFB 3A8IE 2NN6I 3M85A 5IWAL 4L5RC 1CKOA 2E75C 1Y1VH 5IYBH 3KDFA 3UE1A 4L5SA 2NVXH 1VQCA 2Q2UA 5IT9c 1IW7C 1DT4A 1WFQA 2NVYH 2ZJRA 3H3VI 1ASZA 3M4PA 3FMCA 3AB9A 3I4MG 4HJ7A 4A3KG 1CSPA 3ULJA 2E5LQ 4JI7Q 1I94L 2JA7G 3PUZA 3CCLA 2MNAA 2K5NA 1H9MA 2DNCA 1NMGA 1S72A 2JA5G 2I5MX 4JG2A 1FGUA 1LYLA 1WCMH 1GUTA 3CCJA 2WAQE 2EIFA 2VQFQ 2ID0A 1Q7YC 2E2JH 4GN5A 2O5IC 1N34L 4DR4L 2QNDA 1BVSA 4TQUS 1CFMA 1D7QA 1UE1A 3UDXA 3CRKC 5BN3A 1PH9A 4APVA 2VUMG 1A63A 2F4VL 5M3MH 1L1OA 2E2HH 2NN6H 1I3QH 2JA6G 3KJPA 4ALPA 4KKSA 4DR5Q 4JI4Q 2ALYB 2B29A 4LFCL 3CQZH 1O78A 5JEAH 1K73C 1V43A 1H9SB 5C44G 2DGYA 4IFDG 1EWHA 1H9SA 2ANRA 1KIXA 1P8LA 1LUZA 3H3VH 1YNNC 2E3UA 2BA0A 2PPBC 1HNZL 3A8KE 4BA2I 1GD7A 3PGZA 2R7DA 1QVFA 1NBWA 4BBRH 4DR7L 4K0KL 1K83H 4B3ML 5C0XJ 2AUKA 2R92G 4A3GH 3CC4A 4QIWE 4A3DH 2JA8H 3S2DH 2AXYA 2UUCQ 4KN7C 2R7ZH 5FJ8H 1QVCA 3H94A 1N8RC 4LF9L 2KCTA 2LSSA 2VQEQ 1SR3A 2CCZA 1JMCA 3H0GG 3N6RA 3U4ZA 3CP0A 5IP9G 3I4OA 5AJ3Q 3S1RH 2CFMA 2A1AA 1G291 4A3CH 2P2RA 1N33L 4GKJQ 1YJNA 4X65Q 1X55A 2FMRA 1YZ6A 4X66L 4WJ3M 2UUAQ 3HOYG 3U1KA 3IRBA 2IX0A 3PF4A 1DTJA 1EYGA 2K75A 4YHHQ 1XTDA 1ASYA 2A68D 4R1JA 4X66Q 1L1OC 5BN5A 4L5QA 1ONLA 4PMWA 1VQ4A 3RR5A 1Z47A 3M4YA 4LK1C 1I6HH 3CRLC 4DV1L 2EXDA 4JYAQ 5C3EH 4JI6L 4OX9L 4JI3Q 2UUBL 2QEXA 1XMOQ 4HIKA 1E22A 2UXCL 3S1NH 3STBD 3NE5B 4G7ZC 4DR3L 3HOWG 4LF7Q 4A4IA 4IPDA 4A3IH 3PO3H 1PH1A 3GTPH 4A93H 3JAMc 3MEFA 3TS0A 2NVTH 3I4NG 1G6PA 1C9OA 4QGUA 4JI2Q 5BR8Q 1OXUA 4WANA 1VQHA 2ZM6L 1K0RA 1HH2P 5J3BA 3T1HL 2XGTA 3LGJA 1Z6HA 4JCVE 4ME3A 4DR6L 2L15A 4A3EH 3TQYA 1QUQB 4HR7B 4GS3A 3S15H 1U0LA 1VCIA 1H95A 4AM3A 1QUQA 1PH6A 1Y1VG 2A6HD 5IYBG 1M90C 1UEBA 5GAEC 3J80i 1EQQA 4JK1C 3G6EA 2LXJA 1YI2A 1Q12A 3I4LA 1A0IA 4NXMQ 3ER0A 1M1KC 1HNXQ 4AH6A 1VQEA 2B8GA 1OXXK 2E8GA 1K9MC 4C3JH 3UE0A 2IY5B 4LF5L 2OPVA 3AFQA 3PO2H 1X3FA 3HKZE 4DK0A 1NY4A 2PQUA 1PYBA 3TZUA 1K3RA 3RN2A 2YV5A 1VQGA 4B3RQ 4DV7Q 1YIJA 4YY3L 2B8FA 2Z6KA 2B63H 1IBMQ 2AKWB 1XMQL 1ZZJA 3A74A 3H15A 1XNRQ 1WCMG 4A3BH 4WALA 2VW9A 4C3HH 4JI0L 4YCVA
chains in the Genus database with same CATH superfamily
1RJTA 1GKHA 2QKIC 1EQVA 3RZOH 4GLAC 3S14H 1PFBA 2JQOA 4A3EB 1D1IA 4P71A 4NBQA 1S03G 4A3MG 2J0TD 2WIIB 3ND8A 1JJ2A 1LT4D 4GN3B 3KDGA 2DY7A 3S15B 1F2ZA 1WTHA 1YHAA 3OOCA 4RKBA 4LFBL 5HY6A 3NWTA 2BE5C 4ULLA 1FJGQ 5HGQA 3CPWA 2OQKA 2AWOA 2L55A 2M2LA 2DN8A 2UU9L 4TSSA 3E0JA 1DJRD 1B3AA 3AYHB 4QIWB 5M3MG 1QZHA 3ONAB 3T1YL 1XX8A 4ABNA 2NN6G 1SNQA 3P75A 1EYAA 3QJYA 1HFGA 2KCMA 4DAPA 3J81W 1WTWA 1QVGA 2I5HA 3R93A 4DV6L 3PIO3 3SVMA 5J39A 1VQIA 2D5DA 5IWAH 5JEAG 2PYKA 2EY5A 3NCVA 5IGBA 4DNTB 2QW7A 2V1CC 4J8QA 1Q3LA 1J5KA 4C3JB 4HSPA 3Q6SA 3OWFA 3PO2B 3ERQA 3EBEA 3I8ZA 4DUZQ 2TMPA 2HHHQ 4HTHA 3G48A 1BDOA 1I4QA 4DNIA 4KHPQ 2ANNA 3I56A 3GTKH 1AN8A 4NKLA 3UDGA 4DV2L 3P7JA 1I50H 4BS9A 1IYVA 3GD7A 1ENAA 1G91A 3SEBA 3G4SA 4PG3A 4JI8Q 1KRTA 3NBIA 1JWUD 2HUGA 5I9OA 4B9XA 2PT7G 4JI7H 3HGBA 2WP8J 2F52A 4UP9A 1HA6A 1KABA 2B63B 2F03A 4MTKA 3U9OA 1WTXA 4DGZA 1L2FA 1TWAH 5E3FA 4BBRG 3TN2A 1YHBA 5IGCA 3H6MA 1I4HA 4O42A 4L6TB 3NPPA 1VQJA 3OTOL 5C0XH 4A3GG 4A3BB 3M3YH 4A3DG 2JA8G 1KHMA 4C3HB 4IFDJ 5K36H 4DV4L 1I94H 2K05A 2EJGC 2GVAA 3RZOB 1NAPA 1VQ8A 4ILWA 1RL2A 3S14B 5C5LA 1KC8C 2WB1B 1VQKA 1SYGA 1PRTD 4BA1I 1FGBD 5JJKA 2XVSA 1MJEA 4DUYL 2WACA 2OXPA 4OHJA 1QB5D 1RDPD 2O2LD 2D0OA 3K57A 1PA6A 1DD2A 1NNXA 2ZQEA 1GM5A 2KHSA 4K8JA 2Q8TA 1U4RA 2LFNA 2MO1A 2KJXA 4BXXH 1X6OA 2K52A 2SOBA 2Z6KC 2CWFA 5IWAQ 1N34H 4DR4H 1JORA 5D65A 2RHSB 4A3LG 2XRQD 3E9HA 1VF7A 3EA6A 3HOZG 4K6DA 4UY8C 3MXPA 3W2DA 3J81i 4HIMA 1CA5A 2B2TC 4A3CG 3A5ZB 5FLMH 1Y1WH 1KRSA 3J7YW 1HZAA 3IFTA 2LRRA 5J22A 2B2YA 1RODA 1Q82C 1SNCA 3T4AC 3CCSA 2CTJA 4TVAB 1VQ5A 3QIAA 2BL5A 2KVMA 2F4VH 2DUDA 2LY7A 2XTIA 3J81E 4LW1A 4CDFC 2Y3MA 4NPSA 3BDLA 1C4QA 3GTKB 4KJOA 5DLQE 3K0YA 4QMGA 1CQVA 4LFCH 2OQ0A 3OIPA 4UPAA 1G2TA 4XT3B 3J7A5 1S5CD 2F0QA 3SDZA 1X54A 3V96A 1EIYB 4DN4M 3EN2A 4RHRA 3CCQA 2JK8A 1EIFA 4CGYB 5FLXc 5GAGC 1EY9A 1D5MC 3NWSA 5CR3A 1Q81C 2RHQB 3KLSX 2X6LA 1KLGD 3OW7A 3A5UA 3CC2A 4E9JA 2A6ED 1HR0L 1TWAB 2VZAA 1SNDA 2FHTA 2G9HD 3WDNA 1I94Q 1TT2A 2F0WA 4CDDC 3S24A 1CA6A 2YYZA 5KNBA 3S2HB 3GKUA 2J4XA 1Z9FA 3ND9A 2VY3A 2VXWA 3K0XA 2XNAC 4RGNA 5C3EG 2WAQG 4OELB 4NXNL 4HJ9A 1E3PA 4IUQA 5EQ0A 1GHKA 4BY7H 4IQZA 1VQBA 4DR1L 1B7YB 3BZKA 2FPHX 1L1OB 4DR7H 4K0KH 4B3MH 2ICEC 1C7YA 3CD6A 1GUGA 1PYWD 2IT1A 3ZJYC 5IT9W 4AQYL 1VIHA 1TY0A 2VQEH 3F2BA 4BBSB 4EX5A 3BZDB 4A3IG 1N34Q 3I73A 4DR4Q 2PZUA 3PO3G 4NDXA 1HHVA 4POGA 1O7LA 2A69D 4A93G 1STYA 1GOZA 1GO3E 3OW2A 1BKBA 1S20A 4LF9H 3MXNB 1S5FD 4IJLA 2R93H 1T5EA 3DLLA 1Y69U 4DV5L 1N36L 1B53A 4HSVA 3HOXH 3SE0A 5NUCA 4DV0L 1Y1WB 4QUFA 1KD1C 2F4VQ 3W1GA 1X65A 1TUAA 3AFPA 3RNUA 1W3SA 3M9BA 1LV9A 5LMUL 4UHVA 3WOFA 1RCVD 4ID6A 4IUNA 1Q1BA 2F0HA 3MXNA 3NUCA 2Z4HA 3CC7A 3HKZB 1TS5A 1IKLA 4LFCQ 3KLRA 2O4XA 4GZYC 3HRZC 5GADC 5C3WA 2BA1A 1KDAA 1A6XA 1X3QA 4QL5A 3I55A 3CCMA 4FYDA 1S5DD 4NB3A 5JJLA 2F0PA 2F3IA 4M8AA 3PUYA 1D2BA 4DK3C 4B3TL 3GTLH 4GNXB 3A54A 4HMJA 1IBKL 4X66H 1IYUA 3GO5A 2YTVA 3U50C 4OO1H 3BS1A 1VQAA 5F2DA 3RN5A 4KTAA 4DKAC 1J5EL 5LHY1 4GNXA 1XJVA 3TS2A 4R8NA 5ELOA 2NTTA 3DWAA 3I91A 1HNWL 1FYCA 1PTOH 1HNZQ 3FDTA 5JJZA 1QG7A 2B2YC 4C1NI 2KOLA 2RVLA 3TP6A 1HZBA 2I0QA 4DR7Q 4K0KQ 4N9TA 3EJIA 4B3MQ 4NMZA 4X6AH 4BY7B 1PDQA 2Q2HA 3GQBA 3HOUH 2PCFB 4ZLTF 2K32A 1PH8A 1CM9A 3WWVA 4XXEA 2ES2A 1TWHH 2EYPA 1WI5A 3E9IA 5I2XA 2CTEA 1MSHA 4LF6L 1WVNA 1H9KA 4LF7H 4FVMA 3EQLC 1V1OA 4C3JG 4DV1H 4R8IA 3AMUA 3PO2G 4POFA 2GN5A 4JI6H 4OX9H 2UUBH 3OSSD 3I7FA 1TXYA 3D3RA 1PFNA 1KTKA 4LF9Q 1UNSA 3JAML 3PUVA 3QR8A 5IT9E 2BCOA 2JE6I 2UXCH 4KK7A 3S1QH 4JI2H 2R93B 3RMHA 1AZPA 1ESFA 3FAUA 1WTOA 3HOXB 4CHTB 4DV3L 2K5DA 2D0PA 1YJWA 1B44D 1J4WA 1W2BA 2PQEA 1XPRA 1SAPA 1STBA 3WOEA 3F1ZA 2EVBA 4LUZA 1HCZA 1PXUA 1ZTGA 2MPMA 3R2IA 4HCEA 1U5KA 1JE5A 1EQTA 2AQ1B 1HA5A 3VA5A 3QD7X 1LT3D 2R61A 1N33Q 2FFMA 4JI5L 3PUXA 4A3BG 1I4GA 3PIPA 1MKHA 2EE1A 3MVVA 5M3FH 5JJIA 1A2TA 4C3HG 4OGQC 2N3SA 2A68C 2WB1E 1BCPD 4B3SL 2CW0D 1HQRD 1LTSD 4JVZA 4KKTA 2V4DA 3GTLB 2B2VA 2O4CA 1OXVA 2VL6A 2F0EA 1JOOA 1LTLA 3K5NA 2HT1A 4HIOA 3VR5A 2RSOA 1ESRA 1N9WA 1XYIA 1FR3A 2NZ1D 3SXHA 4RMFA 1PV4A 1HUMA 3FHWA 4B3SQ 1VIGA 1PTOB 4OXPA 1SEIA 3RF2A 4LUVA 2JA5H 4Y7NH 4CDCC 5TSSA 1X4MA 2MO0A 2Y0SE 5K5PA 1GHJA 2WV6D 2OWOA 2ATWA 3HOVH 1STHA 1PMRA 2Z8LA 4ZCKA 3ICEA 3HOUB 1SNPA 1TWHB 4NXMH 2P5ZX 4PMCA 2C35B 4DV1Q 1LTTD 5I9PA 3STBC 4X64L 1U9RA 5CBEE 4JI6Q 4OX9Q 1X3EA 2UUBQ 3ULLA 3QG1A 1QWYA 3RLFA 4KY6A 2A8VA 2E74C 2JSOA 1VMCA 4HJ5A 3A56A 1DYQA 4KY5A 2SNSA 3GTJH 2IW3A 1WD0A 1FNVA 3PF5A 2UXCQ 1F0XA 1EIHA 5ELBA 4DR3Q 4X3SA 4MIUA 1D1KA 1LTAD 1YNJC 4GNXC 3V05A 2XSCA 4DK6C 3IL8A 3S1QB 4B3RH 5EPKA 2Q2TA 1ENCA 3GTMH 4KD4A 4QF4A 1QCBD 2JA6H 2K33A 4LF5H 3O13A 2JN4A 1K8MA 4C2MH 3F2DA 3MC0B 4A75A 5JEAJ 5C4JH 4KN4C 2F0IA 1PH5A 2HDMA 1P16A 3S16H 2IWHA 1B1ZA 4EQPA 3HEJA 3HKSA 5M3FB 1L0XB 2JXMB 1T9HA 2ZTCA 2O5JC 3G7LA 5K36G 1JQYD 3CMEA 1MHWC 2ZM6Q 3I4MB 3D6CA 1DCZA 1WTQA 2XRSD 1G8ZD 4E6IA 4YCWA 3EIVA 4LUOA 1I6VC 4GKKL 1JJCB 3T1HQ 3RZDH 3PV0A 1K8GA 4J15A 5I4DA 1XMQH 1TR5A 1E1OA 3P1HA 2PZTA 3L0OA 3CF5A 4DR6Q 1KAAA 3K8AA 3GTOH 4YWLA 4JI0H 1FJGH 2RCNA 1WD1A 1HTPA 2A6HC 1XPUA 1STAA 2JA5B 4Y7NB 4BXXG 1EFID 4YIJA 1JCKB 5LMNL 2UXDL 3NXWA 1CZGA 4JV5L 2MJHA 3MFYA 3PIP3 2ASBA 4EQ5A 1SYDA 5IP7H 1DZ1A 4EC5A 1A2UA 3KYHC 1E2ZA 5KIXA 3HOVB 1CQFA 2L4NA 4LFBH 2CH4A 1QJOA 5D14A 1YEZA 2CPQA 1LM0A 1SMYC 1Y1WG 5FLMG 1IBLL 1IL2A 1PRTB 2BDOA 1AN7A 1GUWA 1GUNA 1G51A 3TP8A 1M8AA 1K0SA 2N49A 4I7AA 2UXBL 1FL0A 2MFIA 2UXDQ 2EPBA 2B2VC 4XIGS 2I5LX 3M4QA 3KUPA 3TRZA 1CZWA 4B8TA 3T1YH 2RF4A 5IY0A 3HKZG 2PMZB 2K1BA 2EDGA 4RFBA 2JEBI 3GTJB 3D4RA 2F4IA 1PH4A 4DV6H 4KHPH 5DEHA 4DR2L 5C0XI 2KENA 1NMFA 3Q23A 2M00A 4CBVA 4LF5Q 4HJ8A 1ZYRC 1VF5C 4JI8H 3PSIA 2EYJA 4LFAL 1FVIA 2VB3X 3GTMB 2JA6B 1CUKA 5IYDH 2R6GA 4A3FH 1XNQL 4C2MB 4X62L 3CXCA 2OCEA 5C4JB 4BY1H 1EY5A 1PTOC 4F7XA 1JT8A 4OONA 1C48A 4HN7A 4DR2Q 2RCFA 2XWJB 4YY3Q 5D3IB 2JJQA 3S16B 3Q0AA 4FJSA 4FJUA 1XRHA 2QILA 3VYSA 3PUWA 3J7AK 1SN8A 2Q8IB 4FF2A 1B3QA 2B3GA 2QA4A 2YTXA 5GAHC 1DXMA 4IZ8A 3CCUA 2D62A 3T51B 1LT5D 4X62Q 3VA7A 4C3IH 4BY7G 4IOCA 4N8X1 1XMQQ 1WJJA 3BJUA 4KY7A 3SK4A 2ZJQA 1C0AA 2MQHA 3RZDB 4RKLA 4JI0Q 1O7ZA 3OTOH 3OWEB 1BR9A 1E7ZA 3IAYA 5DM73 3HG9A 2NB0A 3L2PA 1KL9A 2K5VA 1SE8A 4KLKA 3GTOB 1OXTA 4PMBA 1G6ZA 2LTLA 4DV4H 1X4NA 3BVMA 4IOAA 1PH3A 2VNUD 1VQ7A 1MJCA 1S40A 4LFBQ 2JYOA 4U68A 5EKIA 3OPOA 3DWPA 1U4PA 1X32A 2ZTEA 2QDLA 2R93G 5M5WH 3CU7A 1WE8A 4DUYH 3M7NA 1I5FA 1B70B 4LF8L 3HOXG 3NHHA 2UU9Q 3R3OA 2F0TA 2EYMA 2G9DA 1BUVT 4DAMA 3T1YQ 3GTGH 3A8JE 2KEDA 5LL6b 4PDBA 1IL8A 2LF0A 3AEVB 2F0VA 2QDBA 4R4QA 4R4IA 4DV6Q 1PYSB 2Z6BA 5H1SE 3JAME 3NEMA 4NZRM 2K5WA 3GTQH 3J7AV 3NTIA 1NJIC 4FNFA 1EWCA 1NSNS 1N32L 5ELDA 3PQIA 4LNQA 1X3GA 3T56B 5JPNC 3AEVA 3E0EA 4MHEA 3VYRA 5E7NA 3CAMA 1KHIA 2CH4W 4IO9A 1K1GA 2KUMA 5JOBA 5EAYA 4UDUC 2FMMA 5G3LF 5FLXL 4ZK9B 1SRUA 1GUOA 1O7YA 4DV2Q 4H0LC 2NVQB 2PNHA 2XN9C 5IYCH 4A3FB 4LF4L 4KI0A 3MZ5A 1S3OA 5J1ZA 3NK9A 4P2CB 1YITA 4BY1B 5A2QL 4O1NA 3S2HH 4R4CA 1Q1EA 2EJFC 3T16A 4LWCA 3MTSA 5D3DA 3LWUA 1SNMA 3VR2A 3I0PA 1BOSA 3ULPA 4J6HA 3SK5A 4KV6A 1RF2D 4OEMB 2BH2A 2R7ZG 4NP5A 2A5HA 5FJ8G 4C3IB 2AUJD 1NUCA 3OTOQ 3HOUG 1PRTC 4L63B 2SNMA 1HR0H 2ZXRA 3VR3A 4JBWA 1H9JA 2CTMA 2LTMA 2OT2A 3J7AF 4IPCA 4DV4Q 2G8YA 4BBSH 2NBFA 1ET6A 1Y8NB 1CT1D 3FKIH 1IHZA 3U4VA 4TKOB 3VR6A 4QQBX 4L5TA 4Q5VA 4RA8A 1K8AC 1AP0A 4DR1H 5I2YA 5BN4A 4DUYQ 2Y0SB 2E2IH 5M5YH 1B2TA 3BVZA 2AQ2B 2Q8RE 2BH8A 2F3WA 3V69A 5M5WB 4AQYH 4LAAA 4G08A 2CKZB 4H02A 2OF1A 1Q8IA 4I7ZC 1IW7D 2B2WA 1TWCH 5CORA 4JVHA 1U4MA 3GTGB 1FKAH 2F0LA 1VQ9A 4OO1I 1PFMA 3AU7A 4GLXA 1TWGH 1BBUA 3GTQB 5AFWA 1DGSA 2CWPA 2E5LL 2K50A 3AQQA 2F0GA 4JI7L 2L1BA 1ZZKA 1JICA 1O80A 2C5CA 2X6GA 1EQRA 4RG1A 5M3FG 1N36H 4OD6A 3IFDA 5M5XH 2CQAA 4HIDA 2KHIA 2CTLA 1YNXA 3BYYB 1PVOA 5LMUH 4QJFA 1VQLA 3RLOA 3NQIA 4P73A 5CGKA 4IUUA 3UDFA 2CPMA 5IGDA 2K4KA 1EU4A 3J7ZC 2A6EC 2EYOA 2LXKA 3EROA 4IURA 2HD3A 1OTCA 4LIJA 1PTOF 3DUZA 4ZRZA 2NZHA 2VQFL 4C1NK 1EY8A 2A19A 1B4OA 3D4WA 5IGFA 4QMFB 1HNZH 1UEAB 3K58A 4V0BA 1EUJA 1I4XA 2CVRA 5KNDA 2F0SA 3GV6A 1HR0Q 4AYBB 2NWGA 3T53B 5KEEA 4KMUC 2RSNA 4R4TA 1BCPB 3OYYA 3URYA 3HOVG 1J5EH 2D2CC 1STNA 4AIMA 1IYJB 2Z1CA 2Q2IA 4N9PA 4JBJA 3UDIA 4B8CD 2IX1A 3LWEA 4P74A 4A3MH 2WKDA 4NXNQ 2PMZE 3KLWA 2WINB 1SFOH 3FKIB 2YTYA 4DR1Q 3E3XA 5M9OA 4YCUA 1X9NA 4DR5L 1F77A 4XDXA 2OEOA 4JI4L 1EZ6A 4A76A 2N8NA 3HP3A 3K7AH 1D6EC 2A69C 4O2DA 3J80L 1LTID 1K8OA 1V9PA 4XTCS 5HGTA 4AQYQ 1GUSA 2E2IB 4RCNA 5M5YB 4FO2A 4O0AA 3I72A 2F0UA 3U58A 2IJ0A 3P20A 4CKEA 1ENFA 3K5MA 5C4ZA 5CYUA 4X3UA 1V1QA 4QY7A 4Z9CB 1MSGA 3D31A 1TWCB 5I6YA 3EFXD 4PZ8A 4FF1A 5KNCA 5CV4A 4ZUJA 5C4XH 1BBWA 2CWAA 1N36Q 1TWGB 4DV5Q 3D0FA 3FP9A 4DV0Q 1N33H 4CJ1B 1F9RA 3BDCA 5LMUQ 3FVQA 4A3EG 4F87A 5M5XB 5GROA 4DPGA 3M7GA 4RGTA 1IXRA 1YNND 3NSWA 5IODA 1S5ED 1HRJA 1AFPA 1DOKA 1LTBD 4L8JA 3FRPB 1SYBA 2SDFA 3OHXC 1K28A 2IHEA 4KHZA 1NCVA 4B3TQ 1SBBB 2AHOB 1IBKQ 2UUCL 4OWTB 2EYLA 1LT6D 1AH9A 2B2WC 1STGA 1TS2A 4B3SH 4YWMA 1RKNA 4XYOA 2AMCB 2F1MA 1J5EQ 2B39A 2HDLA 1GJXA 3Q8DA 3Q24A 4A3JH 3SK8A 5IP7G 1HNWQ 4WJ4A 1KDBA 2VQEL 2RQXA 1EL0A 1PRTF 3C2PA 1JE4A 3BU2A 1HQMC 1AE3A 2JEAI 3KOJA 2DGRA 3VKEA 4A3MB 2OTJA 3RLNA 1SFOB 3J80c 3NBHB 1RTOA 4DF7A 2R3ZA 4GN4B 2KBNA 4K5VA 2CHBD 5AJ3L 3HFZB 3K7AB 5EKLA 3MAQA 4ZKBB 4DK1A 3ERSX 4LF6Q 5CV9A 4GKJL 4DR3H 4X65L 5E4XA 3NBHA 1STEA 3S17H 3FPPA 1VDZA 3GR5A 2UUAL 5M3MB 2E2HB 3S1MH 2B63G 2RBMA 3K80C 2K01A 4XQNA 4IFDI 1R9TH 4A3LH 4PV1C 5GQOA 5IYDG 5DNFA 4A3FG 1HZ9A 3HOZH 4YHHL 3UOEA 4GOPB 1K3BC 4HMIA 2AWNA 1HR0W 4HJAA 2F0NA 1IZ6A 3BG3A 4BY1G 5T1IA 5JVG3 2C9OA 1QE6A 3KBGA 5C4XB 5CBAE 5JVH3 4DV3Q 1H9RA 2KA7A 1EU3A 3I4MH 4GOPA 4A3KH 2IL8A 1AE2A 5FLXE 1EC6A 2WB1G 4JC0A 1BCPC 5I6WA 2CW0C 1B9MA 1W6KA 4P72A 2ZM6H 4C3IG 2KCCA 4FXDA 2Z0SA 1EFWA 1SDFA 4JI5Q 1YHQA 2HIVA 3IKJA 2JA7H 1A8VA 3T1HH 1KAWA 2H5XA 3CPFA 1VQ6A 4IJHA 4X3TA 3CCVA 4OWWB 4JYAL 3C3LA 1MD2D 2YQRA 4JI3L 3T13A 4DR6H 1I4RA 3GDEA 1XMOL 3D6WA 1BXTA 2A73B 4P75A 4FF3A 3U9SA 1V1PB 1UE7A 3RD4A 1E2VA 4GLVB 2Y0SG 2E76C 2JA9A 4LF7L 4A3JB 2FJ2A 3M4OH 1YVCA 1ICWA 3CW2C 4EGVA 4A3DB 1XWEA 4IPHA 3TBIB 4J1MA 4I65A 1KDCA 1V1PA 3BYTB 2HIXA 4KHVA 1CKMA 2L5TA 3NTHA 1L0YB 2FFKB 2RDHA 2DJGC 3R2TA 1GVPA 3QWNA 1WVLA 2FMCA 1CKNB 2N78A 1VQMA 4V190 3TDQA 5JAVA 5LMNH 2UXDH 3A0JA 3I90A 1QNKA 2AQ3B 2GVBA 4JI2L 3OETA 4JV5H 1Z2IA 3QOJA 5BR8L 1HTLD 1PZKD 3KLSA 3G71A 5T1GA 1CSQA 4X64Q 2VUMH 3MXUA 2PI2A 1Y8PB 2JVZA 5CC4A 1JC7A 3J81j 1J8IA 4FDBA 1CKNA 2R7FA 1UE5A 1IBLH 1V8QA 2DJFC 3S17B 3CCEA 3J81L 3FEWX 3QOLA 1JWSD 3S1MB 4UP7A 2UXBH 3KF8B 1R9TB 2NYZD 5E4WC 2NZOA 5DT9A 1CI3M 3TEHB 5IYCG 3HOZB 4JI1L 1UUPA 4UP8A 5C0XG 1Q8KA 1FNUA 2F0OA 1Q86C 3CMAA 1VBIA 2PO4A 3KF8A 4DR2H 2NTSA 4DAYB 4YY3H 1EOVA 1SLJA 5C44H 4AYBE 4IFDH 2WFWA 2IHFA 2D9IA 4A3KB 2Z4IA 2ZXOA 4DXFA 3DM3A 3LX0A 2K28A 2FXQA 3SK6A 4AYBG 2PZWA 1D5ZC 1Y8OB 1XNQH 4JI1Q 1D8LA 4B08A 4DAYA 4X62H 3PIOA 1Y14B 3BDOA 3ITPA 5EBDA 1WOCA 4MNOA 1PLFA 1HJPA 2JA7B 1EWIA 1MSZA 5JPMC 4K2LA 4BBSG 1E2WA 5C5MA 1B9NA 3KBXA 2GA4B 5DM63 1CTMA 1X9ZA 4KD3A 3FKIG 4RGOS 1VQOA 1E24A 2YU9H 2R92H 4GKKQ 3W3AA 4UAIA 4NXML 4G7OC 1WYDA 3JAMW 3L7ZC 1LABA 2HH2A 1JB3A 1HNXL 1F9QA 1PH2A 4PZ7A 1GXDC 3M4OB 1SMXA 2A1SA 2BDNA 4RWSC 1SROA 3D4DA 4GOPC 1Q90A 3MHBA 2UU9H 5LMNQ 1RIPA 1HFNA 2FINB 4JV5Q 3SGIA 4YWKA 4MTNA 3KJOA 1BF4A 3G6JB 2EXZA 5FOBB 4M1UB 3KFUA 5IE8A 4B3RL 1VS0A 5A35A 4DV7L 1IBLQ 3H0GH 2VUMB 4JOIA 1DM0B 3J81c 2OPUA 1R4PB 4LF8H 1TKWB 3PO3B 2UXBQ 2CTFA 2CQOA 3GTPB 5IP9H 3L3OC 1IBML 1B8AA 4MN3A 2ZJPA 2NVQH 1PZID 3I2ZA 4CKBA 3D8GA 4WJWA 1XNRL 4JBKA 1ET9A 4DV2H 5LL6X 3F8TA 3F2UA 1UE6A 2H1EA 3VDYA 1X56A 2K7VA 3K7UC 1MIUA 2IPKD 2PQAB 2EY2A 3HOYH 4OWXB 5C3XA 3A7LA 3NQTA 4LFAQ 1UWVA 1ZKOA 2ZT9C 1O7IA 5C44B 3L9AX 4K5XA 1F2YA 1XNQQ 4NW2A 2N55A 1BO0A 3W5OA 4JBMA 5E1FA 1PFSA 1JOKA 3K81C 2PQAA 1KXLA 1BCPF 3MA2B 2F3VA 3VR4A 1C8CA 2MGSA 1PHJA 4Y52H 1JWMD 2ZTDA 1TU2B 4KKUA 3LNNA 1FJGL 4MZ9A 1T5XD 1RHPA 3F2CA 3OMCA 1JJGA 2JZXA 3TP7A 3W1BA 1EY6A 1J6QA 1OXSC 2NUCA 1Q46A 1F2LA 2Z9HA 3Q22A 1YJ9A 1SJHD 2I46A 1U4LA 2PNRC 3DM1A 4G7HC 2KHJA 2EJMA 1LLRD 2BE5D 2YU9B 2R92B 4IPGA 5CV7A 5EGTA 1KNAA 1DONA 1MI2A 4ZQ3A 1F9SA 1HPCA 4CJ2C 3JAMi 3CCRA 5FO8B 4QB4A 4DAVA 2OTLA 3K59A 2QF7A 4PNYA 3OIQA 1VQNA 4DUZL 2IX3A 2HHHL 4K8IA 1ZZIA 4KHPL 3HOWH 2QEJC 5IT9L 1I6UA 3VYTA 5EBCA 1NTGA 1SE2A 5C4XG 1EIGA 4EQNA 2VS1A 2N88A 5ELNA 1R4QB 1AEXA 4LF8Q 4JI8L 1V9NA 4ZKCB 1WTVA 2K5HA 3KF6B 3TREA 1XPOA 1A62A 1TIID 3H0GB 2HQLA 3I4NH 4DNRB 2EQSA 1EYDA 1YBYA 1SE3A 4H13C 1VQPA 1S5BD 1G2SA 5DAUA 4OO1G 3KF6A 3PCOB 3OSOA 1LACA 1W6JA 4DA2A 1KNEA 1B50A 1F9PA 5EPLA 1N32Q 2K14A 5IGGA 2E5LH 1Z7TA 4H44C 2PY9A 2LMCB 4JW0A 4K2KA 3HOYB 1CHQD 4CKCA 4OCHA 4ME5A 4PZ6A 1L0WA 2CTKA 4LJZC 1JB7A 1DOLA 3A7AB 4JPBW 1KLUD 1VQFA 3BZCA 4LF4Q 5LMNW 1V8CA 4TRDA 1HZCA 3JC66 2DNEA 5KRUA 1LTRD 1TWFH 1BQQT 1NE3A 2G5DA 3SR1A 2HH3A 3NELA 4JVYA 4A3JG 3B6YA 1M4VA 1FD7D 2ICIA 2PW7A 3DXJC 1VQDA 1WHRA 2EOTA 3NENA 2QGQA 3I70A 1TS4A 2PI2E 3CHBD 4JOIC 1PH7A 1QZGA 1E1TA 1KQSA 2VQFH 4R4OA 3KDFB 2K04A 3A8IE 2NN6I 2KECA 3M85A 3EVQA 4NXNH 5IWAL 3FPUB 4S3SA 1LTGD 4L5RC 1CKOA 2LS01 2E75C 1Y1VH 5IYBH 3KDFA 3UE1A 1D5XC 4L5SA 2EY1A 2NVXH 1PQXA 1MGSA 1VQCA 2Q2UA 5IT9c 1IW7C 2EY6A 4DR5H 3N52A 4JI4H 1DT4A 3HOWB 1WFQA 1NR4A 1SXTA 2NVYH 3S9WA 1ICFB 2ZJRA 1XTCD 3H3VI 1ASZA 3M4PA 3FMCA 4DV5H 3CKIB 4DV0H 2WKCA 1WTJA 1HXYD 3AB9A 3I4MG 2JP1A 4HJ7A 4A3KG 2LKVA 3I4NB 5IGEA 1CSPA 3QO2A 3ULJA 1I50B 2E5LQ 1EEFD 4JI7Q 1I94L 2JA7G 3PUZA 3CCLA 3MFGA 2F0MA 2K5NA 2MNAA 3KK7A 1H9MA 2DNCA 5LL6S 1NMGA 5C4HA 1S72A 2JA5G 2I5MX 2K5QA 4JG2A 4B3TH 1FGUA 1ZXTA 1IBKH 3SHLA 1LYLA 1WCMH 2TSSA 1ZEQX 5KYLA 3MEHA 1EY4A 2HQEA 3DEOA 4HCSA 1WTRA 1TWFB 3C1EA 1GUTA 3CCJA 2DY8A 2WAQE 5IIFA 2EIFA 3M3YB 1SEBD 2MUYA 2VQFQ 2ID0A 1Q7YC 2E2JH 1HNWH 4GN5A 2O5IC 4FF4A 4H7BA 4RAUC 4X3KA 1AZQA 1N34L 4DR4L 2QNDA 1BVSA 5FK9C 2UUCH 4TQUS 1CFMA 1RD9D 2HCIA 1D7QA 2J7ZA 1EZ8A 4K6LA 3KDKA 1J9OA 3NTKA 1UE1A 1Y1VB 3CRKC 3UDXA 5BN3A 5L37A 4APVA 1PH9A 2VUMG 1A63A 2RDGA 3A55A 2F4VL 4HEDA 4LF6H 5M3MH 1A3UA 1L1OA 2E2HH 2NN6H 1I3QH 1EEID 3KJPA 4ALPA 2JA6G 2NVXB 1X0AA 4KKSA 3K5LA 4DR5Q 2E2DC 4JI4Q 5FLXW 2ALYB 1BNZA 1EYCA 2B29A 4LFCL 2X06A 3CQZH 1O78A 5JEAH 2K03A 4FP5D 2M6QA 5A2QW 1K73C 2MHVA 1V43A 1H9SB 2NVYB 2EYHA 5FO7B 2EYFA 4GKJH 4X65H 1A3VA 1ILQA 4WRDA 5ELEA 4DV3H 5C44G 2DGYA 4IFDG 2UUAH 5EKKA 3HZXA 3OMGA 1EWHA 2CWHA 1E0BA 5ELFA 1H9SA 2RA4A 2ANRA 1S4ZA 1SYEA 1KIXA 3UI2A 3TMEA 3C46A 4WORA 1P8LA 1LUZA 3H3VH 4YHHH 1YNNC 2E3UA 3E6ZX 3HS0C 4JI5H 2BA0A 3NP8A 1HNZL 2PPBC 1IKMA 3A8KE 4XQJA 3I3CA 1GD7A 3PGZA 5KGUA 2R7DA 4BA2I 1QVFA 1NBWA 4BBRH 4DR7L 4K0KL 4RGMA 1K83H 4B3ML 4K14A 5C0XJ 2AUKA 1TS3A 2R92G 2HCCA 2XIWA 4A3GH 1XXGA 1WCMB 5CV6A 2L9HA 1SYCA 3CC4A 2VB2X 4QIWE 2JA8H 4A3DH 2K1HA 5CV5A 3S2DH 2F0FA 1JR0D 2L0CA 3MWYW 2AXYA 2UUCQ 2E2JB 4KN7C 3GP7A 4FXGC 4LMQD 4JYAH 2R7ZH 5FJ8H 4JI3H 1QVCA 3H94A 1X3PA 2F0DA 1XMOH 1FNWA 4IUTA 1N8RC 3DWQA 4LF9L 5FKAC 4IN3A 2KCTA 2L11A 2LSSA 2VQEQ 5EJWA 1II3A 2I07B 1EY7A 1SR3A 4KJNA 2B2UA 2CCZA 4RH6A 2PW5A 1AW7A 2L12A 1JMCA 2MJ8A 3H0GG 3TSSA 4B9WA 3H09A 4X64H 5EPJA 4RCOA 3TP5A 3N6RA 1I3QB 3U4ZA 3PMFA 3CP0A 5IP9G 4RHSA 3I4OA 1NR2A 5AJ3Q 3S1RH 4G57A 4F88A 2CFMA 2A1AA 1G291 4A3CH 2P2RA 1N33L 1TVXA 3CQZB 4GKJQ 1YJNA 1VMPA 4X65Q 5BR8H 1X55A 2FMRA 2ZXPA 1YZ6A 3K6OA 4X66L 4IUPA 4WJ3M 1CHPD 4CJ0B 2UUAQ 4XT1B 1NXUA 3C1FA 3HOYG 4QUCA 3U1KA 4CDEC 3IRBA 2F0JA 2IX0A 3PF4A 1DTJA 1EYGA 2K75A 1QILA 2F0KA 5HURA 1EOTA 4YHHQ 2EZVA 1XTDA 4BWGB 1ASYA 2A68D 5A2QE 1HUNA 4R1JA 4EVOA 3SB1A 4JI1H 1BBXC 4X66Q 2H4OA 1L1OC 4U673 4L5QA 5BN5A 1ONLA 4PMWA 5FO9B 1VQ4A 3RR5A 1Z47A 3M4YA 1QOHA 2ENBA 4BBRB 2M9VA 1K83B 3DMUA 4LK1C 1I6HH 3RUZA 4GKKH 3J80W 4A3GB 1RTNA 4FXKC 3CRLC 4DV1L 2EXDA 2JA8B 3S2DB 4JYAQ 4QCLA 5COYA 5C3EH 1F2MA 4JI6L 4OX9L 4JI3Q 2UUBL 2QEXA 4C56C 1PZJD 1XMOQ 5CV8A 4F8MA 3ZYYX 4HIKA 1E22A 2R7ZB 2UXCL 3S1NH 3STBD 3NE5B 2BOSA 4DR3L 4G7ZC 4OIJA 4LF7Q 3HOWG 4A4IA 1HNXH 4G4KA 4IUVA 4IPDA 4A3IH 5KYIA 4WFN3 3PO3H 1PH1A 2M8WA 1SYFA 3GTPH 1OO9B 1SNOA 4A93H 3JAMc 1DOMA 3MEFA 3TS0A 2NVTH 4OL7A 3I4NG 1G6PA 1C9OA 1TQOA 1YNJD 4QGUA 4JI2Q 3E5SA 5BR8Q 4DU9A 5CMDA 3S1RB 1OXUA 5G3LD 3QB3A 1I4PA 1TY2A 4WANA 1SSOA 1VQHA 4DV7H 3K5OA 1A3TA 2D9UA 4K5WA 2ZM6L 1MBYA 2A74C 1K0RA 3TZDA 4LFAH 1HH2P 5J3BA 4NZTM 1IBMH 4N8FA 3R8BA 5IOCA 3T1HL 2XGTA 4ODGA 1ODHA 3LGJA 1Z6HA 2K6AA 4ZAIA 2MP1A 4ZUIA 1XNRH 4JCVE 4ME3A 4DR6L 2B2UC 2L15A 1ILPA 4IALA 4A3EH 3V2TA 3TQYA 2KEEA 5ISRA 1QUQB 4XQQA 4HR7B 4GS3A 3S15H 1U0LA 5ELCA 1A15A 1JOQA 1VCIA 1H95A 3DHQA 3DEPA 4EQOA 4AM3A 4DXGA 1I6HB 1QUQA 4R9WA 1PH6A 1Y1VG 2A6HD 5IYBG 1M90C 1SE4A 1UEBA 5GAEC 3J80i 1EQQA 2KCNA 5C3EB 4HAEA 1SJED 2WAQB 4JK1C 3G6EA 2LXJA 1WTPA 2VKCA 1YI2A 2X69A 3GV3A 1Q12A 3I4LA 2XWBB 4Q0FA 1A0IA 4NXMQ 3ER0A 1M1KC 3BVGA 1UAPA 3J80E 3VYUA 1HNXQ 4AH6A 1SMYD 2QCPX 1VQEA 3S1NB 3EZJA 2B8GA 4PQXA 1OXXK 3MXGA 2E8GA 1K9MC 4ZYSA 4C3JH 3UE0A 2IY5B 2RKSA 4LF5L 2OPVA 3AFQA 3PO2H 1X3FA 3X3MA 3HKZE 4DK0A 1QNUA 4A3IB 1NY4A 2KQ3A 4A93B 2NVTB 2PQUA 3H3VC 4DUZH 1PYBA 2HHHH 3TZUA 1K3RA 4H8AA 1LO5D 2RDFA 2YV5A 2SEBD 3RN2A 4XYQA 1VQGA 4B3RQ 1ML0D 1CK1A 4DV7Q 4OIKA 1YIJA 4YY3L 1ZYRD 2B8FA 1N32H 2Z6KA 2B63H 1IBMQ 5C6AA 3GABA 3H91A 2AKWB 1PTOD 3X3NA 1XMQL 1UG8A 1ZZJA 3A74A 3H15A 1XNRQ 4DFAA 1WCMG 4A3BH 4WALA 2VW9A 2B2TA 4LF4H 1EY0A 4C3HH 4JI0L 4YCVA
chains in the Genus database with same CATH topology
1RJTA 1GKHA 2QKIC 1EQVA 3RZOH 4GLAC 3S14H 1PFBA 4A3EB 2JQOA 1D1IA 4P71A 4NBQA 4A3MG 2J0TD 2WIIB 3ND8A 1JJ2A 1LT4D 4GN3B 2DY7A 3S15B 1F2ZA 1YHAA 4LFBL 3OOCA 4RKBA 5HY6A 3NWTA 2BE5C 4ULLA 1FJGQ 5HGQA 3CPWA 2OQKA 2AWOA 2L55A 2M2LA 2DN8A 2UU9L 4TSSA 3E0JA 1DJRD 1B3AA 4QIWB 3AYHB 5M3MG 1QZHA 3ONAB 3T1YL 1XX8A 4ABNA 2NN6G 1SNQA 3P75A 1EYAA 3QJYA 1HFGA 4DAPA 2KCMA 1WTWA 1QVGA 2I5HA 3R93A 4DV6L 3PIO3 3SVMA 5J39A 1VQIA 2D5DA 5JEAG 2PYKA 2EY5A 5IGBA 4DNTB 2V1CC 4J8QA 1Q3LA 1J5KA 4C3JB 4HSPA 3Q6SA 3OWFA 3PO2B 3ERQA 3EBEA 3I8ZA 4DUZQ 2TMPA 2HHHQ 4HTHA 3G48A 1BDOA 1I4QA 4DNIA 4KHPQ 2ANNA 3I56A 3GTKH 1AN8A 4NKLA 3UDGA 4DV2L 3P7JA 4BS9A 1I50H 1IYVA 3GD7A 1ENAA 1G91A 3SEBA 3G4SA 4PG3A 4JI8Q 1KRTA 3NBIA 1JWUD 2HUGA 5I9OA 4B9XA 3HGBA 2WP8J 2F52A 4UP9A 1HA6A 1KABA 2B63B 2F03A 3U9OA 1WTXA 4DGZA 1L2FA 1TWAH 5E3FA 5IGCA 3TN2A 1YHBA 4BBRG 3H6MA 1I4HA 4O42A 4L6TB 3NPPA 1VQJA 3OTOL 5C0XH 4A3GG 4A3BB 3M3YH 4A3DG 2JA8G 1KHMA 4C3HB 4IFDJ 5K36H 4DV4L 2K05A 2EJGC 2GVAA 3RZOB 1NAPA 1VQ8A 4ILWA 1RL2A 3S14B 5C5LA 1KC8C 2WB1B 1VQKA 1SYGA 1PRTD 4BA1I 1FGBD 5JJKA 2XVSA 1MJEA 4DUYL 2WACA 2OXPA 4OHJA 1QB5D 1RDPD 2O2LD 2D0OA 3K57A 1DD2A 1PA6A 1GM5A 2KHSA 4K8JA 2Q8TA 1U4RA 2LFNA 2MO1A 2KJXA 4BXXH 2SOBA 1X6OA 2K52A 2Z6KC 5IWAQ 1JORA 5D65A 2RHSB 4A3LG 2XRQD 3E9HA 1VF7A 3EA6A 3HOZG 4K6DA 4UY8C 3MXPA 3W2DA 3J81i 1CA5A 4HIMA 2B2TC 4A3CG 3A5ZB 5FLMH 1Y1WH 1KRSA 3J7YW 1HZAA 3IFTA 5J22A 2B2YA 1RODA 1Q82C 1SNCA 3T4AC 3CCSA 2CTJA 4TVAB 1VQ5A 3QIAA 2BL5A 2KVMA 2LY7A 3J81E 2DUDA 2XTIA 4LW1A 4NPSA 3BDLA 1C4QA 3GTKB 4KJOA 5DLQE 3K0YA 4QMGA 1CQVA 3OIPA 2OQ0A 4UPAA 1G2TA 4XT3B 3J7A5 1S5CD 2F0QA 3SDZA 3V96A 1X54A 1EIYB 4DN4M 3EN2A 4RHRA 3CCQA 2JK8A 4CGYB 1EIFA 5FLXc 5GAGC 1EY9A 1D5MC 3NWSA 5CR3A 1Q81C 2RHQB 3KLSX 2X6LA 1KLGD 3OW7A 3A5UA 3CC2A 2A6ED 1HR0L 1TWAB 2VZAA 1SNDA 2FHTA 2G9HD 3WDNA 1I94Q 1TT2A 2F0WA 1CA6A 3S24A 2YYZA 5KNBA 3S2HB 2J4XA 3ND9A 1Z9FA 2VY3A 2VXWA 3K0XA 2XNAC 4RGNA 5C3EG 2WAQG 4NXNL 4HJ9A 1GHKA 4IUQA 5EQ0A 1E3PA 4BY7H 4IQZA 1VQBA 4DR1L 1B7YB 3BZKA 1L1OB 2ICEC 1C7YA 3CD6A 1GUGA 1PYWD 2IT1A 3ZJYC 4AQYL 1VIHA 1TY0A 3F2BA 4BBSB 4EX5A 3BZDB 4A3IG 1N34Q 3I73A 4DR4Q 2PZUA 3PO3G 4NDXA 1HHVA 4POGA 1O7LA 2A69D 4A93G 1STYA 1GOZA 1GO3E 3OW2A 1BKBA 3MXNB 1S5FD 4IJLA 2R93H 1T5EA 3DLLA 1Y69U 4DV5L 1N36L 1B53A 4HSVA 3HOXH 3SE0A 5NUCA 4DV0L 1Y1WB 4QUFA 1KD1C 2F4VQ 3W1GA 1X65A 1TUAA 3AFPA 3RNUA 1W3SA 3M9BA 1LV9A 5LMUL 3WOFA 1RCVD 4ID6A 4IUNA 1Q1BA 2F0HA 3MXNA 3NUCA 2Z4HA 3CC7A 3HKZB 1TS5A 1IKLA 4LFCQ 3KLRA 2O4XA 4GZYC 3HRZC 5GADC 5C3WA 2BA1A 1KDAA 1A6XA 1X3QA 4QL5A 3I55A 4FYDA 3CCMA 1S5DD 4NB3A 5JJLA 2F0PA 2F3IA 4M8AA 3PUYA 1D2BA 4DK3C 4B3TL 3GTLH 4GNXB 3A54A 4HMJA 1IBKL 1IYUA 3GO5A 2YTVA 3U50C 4OO1H 3BS1A 1VQAA 5F2DA 3RN5A 4KTAA 4DKAC 1J5EL 5LHY1 4GNXA 1XJVA 3TS2A 4R8NA 5ELOA 2NTTA 3DWAA 3I91A 1HNWL 1FYCA 1PTOH 1HNZQ 3FDTA 5JJZA 1QG7A 2B2YC 4C1NI 2KOLA 2RVLA 3TP6A 1HZBA 2I0QA 4DR7Q 4K0KQ 4N9TA 3EJIA 4B3MQ 4NMZA 4X6AH 4BY7B 1PDQA 2Q2HA 3GQBA 3HOUH 2PCFB 4ZLTF 2K32A 1PH8A 1CM9A 3WWVA 4XXEA 2ES2A 1TWHH 2EYPA 1WI5A 3E9IA 5I2XA 2CTEA 1MSHA 4LF6L 1WVNA 1H9KA 4FVMA 3EQLC 1V1OA 4C3JG 4R8IA 3AMUA 3PO2G 4POFA 2GN5A 3I7FA 1TXYA 3D3RA 1PFNA 1KTKA 4LF9Q 1UNSA 3JAML 3PUVA 5IT9E 2BCOA 2JE6I 4KK7A 3S1QH 2R93B 3RMHA 1AZPA 1ESFA 1WTOA 3HOXB 4CHTB 4DV3L 2K5DA 2D0PA 1YJWA 1B44D 1J4WA 1W2BA 2PQEA 1XPRA 1SAPA 1STBA 3WOEA 3F1ZA 2EVBA 4LUZA 1HCZA 1PXUA 1ZTGA 2MPMA 3R2IA 4HCEA 1U5KA 1EQTA 2AQ1B 1JE5A 1HA5A 3VA5A 1LT3D 2R61A 1N33Q 4JI5L 3PUXA 4A3BG 1I4GA 3PIPA 1MKHA 2EE1A 3MVVA 5M3FH 5JJIA 1A2TA 4C3HG 4OGQC 2N3SA 2A68C 2WB1E 1BCPD 4B3SL 2CW0D 1HQRD 1LTSD 4KKTA 2V4DA 3GTLB 2B2VA 1OXVA 2VL6A 2F0EA 1JOOA 1LTLA 3K5NA 2HT1A 4HIOA 3VR5A 2RSOA 1ESRA 1N9WA 1XYIA 1FR3A 2NZ1D 3SXHA 4RMFA 1PV4A 1HUMA 3FHWA 4B3SQ 1VIGA 1PTOB 4OXPA 4LUVA 2JA5H 4Y7NH 5TSSA 1X4MA 2MO0A 2Y0SE 5K5PA 1GHJA 2WV6D 2OWOA 2ATWA 3HOVH 1STHA 1PMRA 2Z8LA 3HOUB 3ICEA 1SNPA 1TWHB 4PMCA 2C35B 4DV1Q 1LTTD 5I9PA 3STBC 4X64L 1U9RA 5CBEE 4JI6Q 4OX9Q 1X3EA 2UUBQ 3ULLA 3QG1A 1QWYA 3RLFA 4KY6A 2A8VA 2E74C 2JSOA 1VMCA 4HJ5A 3A56A 1DYQA 4KY5A 2SNSA 3GTJH 2IW3A 1WD0A 1FNVA 3PF5A 2UXCQ 1EIHA 5ELBA 4DR3Q 4X3SA 4MIUA 1D1KA 1LTAD 1YNJC 4GNXC 3V05A 2XSCA 4DK6C 3IL8A 3S1QB 5EPKA 2Q2TA 1ENCA 3GTMH 4KD4A 4QF4A 1QCBD 2JA6H 2K33A 3O13A 1K8MA 4C2MH 3F2DA 3MC0B 4A75A 5JEAJ 5C4JH 4KN4C 2F0IA 1PH5A 2HDMA 1P16A 3S16H 2IWHA 1B1ZA 4EQPA 3HEJA 3HKSA 5M3FB 1L0XB 2JXMB 2O5JC 1T9HA 2ZTCA 3G7LA 5K36G 1JQYD 3CMEA 2ZM6Q 3I4MB 3D6CA 1DCZA 1WTQA 2XRSD 1G8ZD 4E6IA 4YCWA 3EIVA 4LUOA 1I6VC 4GKKL 1JJCB 3T1HQ 3RZDH 3PV0A 1K8GA 4J15A 5I4DA 1TR5A 3P1HA 1E1OA 2PZTA 3L0OA 3CF5A 4DR6Q 1KAAA 3K8AA 3GTOH 4YWLA 2RCNA 1WD1A 1HTPA 2A6HC 1XPUA 1STAA 2JA5B 4Y7NB 4BXXG 1EFID 4YIJA 1JCKB 5LMNL 2UXDL 3NXWA 1CZGA 4JV5L 2MJHA 3MFYA 3PIP3 2ASBA 4EQ5A 1SYDA 5IP7H 1DZ1A 1A2UA 3KYHC 1E2ZA 5KIXA 3HOVB 1CQFA 2L4NA 1QJOA 5D14A 1YEZA 2CPQA 1LM0A 1SMYC 1Y1WG 5FLMG 1IBLL 1IL2A 1PRTB 2BDOA 1GUWA 1GUNA 3TP8A 1G51A 1M8AA 2N49A 2UXBL 1FL0A 2MFIA 2UXDQ 2EPBA 2B2VC 4XIGS 2I5LX 3M4QA 3KUPA 3TRZA 1CZWA 4B8TA 2RF4A 5IY0A 3HKZG 2PMZB 2K1BA 2EDGA 4RFBA 2JEBI 3GTJB 3D4RA 2F4IA 1PH4A 5DEHA 4DR2L 5C0XI 2KENA 1NMFA 3Q23A 2M00A 4CBVA 4LF5Q 4HJ8A 1ZYRC 1VF5C 3PSIA 2EYJA 4LFAL 2VB3X 3GTMB 1FVIA 2JA6B 1CUKA 5IYDH 2R6GA 4A3FH 1XNQL 4C2MB 4X62L 3CXCA 2OCEA 5C4JB 4BY1H 1EY5A 1PTOC 4F7XA 1JT8A 4OONA 1C48A 4HN7A 4DR2Q 2XWJB 4YY3Q 5D3IB 3S16B 2JJQA 3Q0AA 2QILA 3VYSA 3PUWA 1SN8A 2Q8IB 4FF2A 2B3GA 2QA4A 2YTXA 5GAHC 1DXMA 4IZ8A 3CCUA 2D62A 3T51B 1LT5D 4X62Q 3VA7A 4C3IH 4BY7G 4IOCA 1XMQQ 1WJJA 3BJUA 4KY7A 3SK4A 2ZJQA 1C0AA 2MQHA 3RZDB 4RKLA 4JI0Q 1O7ZA 3OWEB 1BR9A 3IAYA 1E7ZA 5DM73 3HG9A 2NB0A 3L2PA 1KL9A 2K5VA 1SE8A 4KLKA 3GTOB 1OXTA 4PMBA 1G6ZA 1X4NA 3BVMA 2VNUD 1PH3A 4IOAA 1VQ7A 1MJCA 1S40A 4LFBQ 2JYOA 4U68A 5EKIA 3OPOA 3DWPA 1U4PA 1X32A 2ZTEA 2R93G 5M5WH 3CU7A 1WE8A 3M7NA 1I5FA 1B70B 4LF8L 3HOXG 3NHHA 2UU9Q 3R3OA 2F0TA 2EYMA 2G9DA 1BUVT 4DAMA 3T1YQ 3GTGH 3A8JE 2KEDA 1IL8A 3AEVB 2F0VA 2QDBA 4R4QA 4R4IA 4DV6Q 1PYSB 5H1SE 3JAME 3NEMA 2K5WA 3GTQH 3J7AV 3NTIA 1NJIC 4FNFA 1EWCA 1NSNS 1N32L 5ELDA 4LNQA 3T56B 1X3GA 5JPNC 3AEVA 4MHEA 3E0EA 3VYRA 5E7NA 3CAMA 1KHIA 4IO9A 1K1GA 2KUMA 5JOBA 5EAYA 4UDUC 2FMMA 5G3LF 5FLXL 4ZK9B 1SRUA 1GUOA 1O7YA 4DV2Q 4H0LC 2NVQB 2PNHA 2XN9C 5IYCH 4A3FB 4LF4L 4KI0A 3MZ5A 1S3OA 5J1ZA 3NK9A 4P2CB 4BY1B 1YITA 5A2QL 4O1NA 3S2HH 3T16A 1Q1EA 2EJFC 4R4CA 4LWCA 3MTSA 5D3DA 3LWUA 1SNMA 3VR2A 1BOSA 3ULPA 4J6HA 3SK5A 4KV6A 1RF2D 2BH2A 2R7ZG 4NP5A 2A5HA 5FJ8G 4C3IB 2AUJD 1NUCA 3OTOQ 3HOUG 1PRTC 4L63B 2SNMA 2ZXRA 3VR3A 4JBWA 1H9JA 2CTMA 2OT2A 3J7AF 4IPCA 4DV4Q 4BBSH 2NBFA 1ET6A 1Y8NB 1CT1D 3FKIH 1IHZA 3U4VA 4TKOB 3VR6A 4QQBX 4Q5VA 4L5TA 4RA8A 1K8AC 1AP0A 5I2YA 5BN4A 4DUYQ 2Y0SB 2E2IH 5M5YH 1B2TA 3BVZA 2AQ2B 2Q8RE 2F3WA 2BH8A 3V69A 5M5WB 4LAAA 2CKZB 4H02A 2OF1A 1Q8IA 4I7ZC 1IW7D 2B2WA 1TWCH 5CORA 4JVHA 1U4MA 3GTGB 2F0LA 1VQ9A 4OO1I 1PFMA 3AU7A 4GLXA 1TWGH 3GTQB 1BBUA 5AFWA 1DGSA 2CWPA 2E5LL 2K50A 3AQQA 2F0GA 4JI7L 2L1BA 1ZZKA 1JICA 1O80A 2C5CA 2X6GA 1EQRA 4RG1A 5M3FG 3IFDA 5M5XH 2CQAA 4HIDA 2KHIA 2CTLA 1YNXA 3BYYB 1PVOA 4QJFA 1VQLA 3RLOA 3NQIA 4P73A 5CGKA 4IUUA 3UDFA 5IGDA 2K4KA 1EU4A 3J7ZC 2A6EC 2EYOA 2LXKA 3EROA 4IURA 1OTCA 4LIJA 1PTOF 3DUZA 4ZRZA 2NZHA 2VQFL 4C1NK 1EY8A 2A19A 1B4OA 3D4WA 5IGFA 4QMFB 1UEAB 3K58A 4V0BA 1EUJA 5KNDA 1I4XA 2CVRA 2F0SA 3GV6A 1HR0Q 4AYBB 2NWGA 3T53B 5KEEA 4KMUC 2RSNA 4R4TA 1BCPB 3URYA 3OYYA 3HOVG 2D2CC 1STNA 4AIMA 1IYJB 2Z1CA 2Q2IA 4N9PA 4JBJA 3UDIA 2IX1A 3LWEA 4P74A 4A3MH 2WKDA 4NXNQ 2PMZE 3KLWA 2WINB 1SFOH 3FKIB 2YTYA 4DR1Q 5M9OA 4YCUA 1X9NA 4DR5L 1F77A 4XDXA 2OEOA 4JI4L 1EZ6A 4A76A 3HP3A 2N8NA 3K7AH 1D6EC 2A69C 4O2DA 3J80L 1LTID 1K8OA 5HGTA 4XTCS 1V9PA 4AQYQ 1GUSA 2E2IB 4RCNA 5M5YB 4FO2A 4O0AA 3I72A 2F0UA 3U58A 2IJ0A 3P20A 4CKEA 1ENFA 3K5MA 5C4ZA 5CYUA 4X3UA 1V1QA 4Z9CB 4QY7A 1MSGA 3D31A 1TWCB 5I6YA 3EFXD 4PZ8A 4FF1A 5KNCA 5CV4A 4ZUJA 5C4XH 1BBWA 2CWAA 1N36Q 1TWGB 4DV5Q 3D0FA 3FP9A 4DV0Q 4CJ1B 1F9RA 3BDCA 5LMUQ 3FVQA 4A3EG 4F87A 5M5XB 5GROA 4DPGA 3M7GA 4RGTA 1YNND 1IXRA 3NSWA 5IODA 1S5ED 1HRJA 1AFPA 1DOKA 1LTBD 4L8JA 3FRPB 1SYBA 2SDFA 3OHXC 2IHEA 4KHZA 1NCVA 4B3TQ 1SBBB 2AHOB 1IBKQ 2UUCL 4OWTB 2EYLA 1LT6D 1AH9A 2B2WC 1STGA 1TS2A 4YWMA 1RKNA 4XYOA 2AMCB 2F1MA 1J5EQ 2B39A 2HDLA 1GJXA 3Q8DA 3Q24A 4A3JH 3SK8A 5IP7G 1HNWQ 4WJ4A 1KDBA 2VQEL 2RQXA 1EL0A 1PRTF 3C2PA 1JE4A 3BU2A 1HQMC 1AE3A 2JEAI 3KOJA 2DGRA 3VKEA 4A3MB 2OTJA 3RLNA 1SFOB 3J80c 3NBHB 1RTOA 4DF7A 2R3ZA 4GN4B 2KBNA 4K5VA 2CHBD 5AJ3L 3K7AB 5EKLA 3HFZB 3MAQA 4ZKBB 4DK1A 3ERSX 4LF6Q 5CV9A 4GKJL 4X65L 5E4XA 3NBHA 1STEA 3S17H 3FPPA 1VDZA 2UUAL 5M3MB 2E2HB 3S1MH 2B63G 2RBMA 3K80C 2K01A 4XQNA 4IFDI 1R9TH 4A3LH 4PV1C 5GQOA 5IYDG 5DNFA 4A3FG 1HZ9A 3HOZH 4YHHL 4GOPB 4HMIA 2AWNA 1HR0W 4HJAA 2F0NA 1IZ6A 3BG3A 5JVG3 5T1IA 4BY1G 2C9OA 1QE6A 3KBGA 5C4XB 5CBAE 5JVH3 4DV3Q 1H9RA 2KA7A 1EU3A 3I4MH 4GOPA 4A3KH 2IL8A 5FLXE 1AE2A 1EC6A 2WB1G 4JC0A 5I6WA 1BCPC 2CW0C 1B9MA 1W6KA 4P72A 4C3IG 2KCCA 4FXDA 2Z0SA 1EFWA 1SDFA 4JI5Q 1YHQA 3IKJA 2HIVA 2JA7H 1A8VA 1KAWA 2H5XA 3CPFA 1VQ6A 4IJHA 4X3TA 3CCVA 4OWWB 4JYAL 3C3LA 1MD2D 2YQRA 4JI3L 3T13A 1I4RA 3GDEA 1XMOL 3D6WA 1BXTA 2A73B 4P75A 4FF3A 3U9SA 1V1PB 3RD4A 1UE7A 1E2VA 4GLVB 2Y0SG 2E76C 2JA9A 4LF7L 4A3JB 2FJ2A 3M4OH 1YVCA 1ICWA 4EGVA 4A3DB 3CW2C 1XWEA 4IPHA 3TBIB 4J1MA 4I65A 1KDCA 1V1PA 3BYTB 2HIXA 4KHVA 1CKMA 2L5TA 3NTHA 1L0YB 2FFKB 2RDHA 3R2TA 1GVPA 3QWNA 1WVLA 2FMCA 1CKNB 2N78A 1VQMA 4V190 3TDQA 5JAVA 3I90A 3A0JA 1QNKA 2AQ3B 2GVBA 4JI2L 3QOJA 5BR8L 1HTLD 1PZKD 3KLSA 3G71A 5T1GA 1CSQA 4X64Q 2VUMH 3MXUA 2PI2A 1Y8PB 2JVZA 5CC4A 1JC7A 3J81j 1J8IA 4FDBA 1CKNA 2R7FA 1UE5A 1V8QA 3S17B 3CCEA 3J81L 3FEWX 3QOLA 1JWSD 3S1MB 4UP7A 3KF8B 1R9TB 2NYZD 5E4WC 2NZOA 1CI3M 3TEHB 5IYCG 3HOZB 4JI1L 1UUPA 4UP8A 5C0XG 1Q8KA 1FNUA 2F0OA 1Q86C 3CMAA 2PO4A 3KF8A 2NTSA 4DAYB 1EOVA 1SLJA 5C44H 4AYBE 4IFDH 2WFWA 2IHFA 4A3KB 2Z4IA 2ZXOA 4DXFA 3LX0A 3SK6A 2K28A 2FXQA 3DM3A 4AYBG 2PZWA 1D5ZC 1Y8OB 4JI1Q 1D8LA 4B08A 4DAYA 3PIOA 3BDOA 1Y14B 3ITPA 5EBDA 1WOCA 4MNOA 1PLFA 1HJPA 2JA7B 1EWIA 5JPMC 4K2LA 4BBSG 1E2WA 5C5MA 1B9NA 3KBXA 2GA4B 5DM63 1CTMA 4KD3A 4RGOS 3FKIG 1VQOA 1E24A 2YU9H 2R92H 4GKKQ 3W3AA 4UAIA 4NXML 4G7OC 1WYDA 3L7ZC 1LABA 2HH2A 1JB3A 1HNXL 1F9QA 1PH2A 4PZ7A 1GXDC 3M4OB 1SMXA 2BDNA 4RWSC 1SROA 3D4DA 4GOPC 1Q90A 3MHBA 5LMNQ 1HFNA 1RIPA 2FINB 4JV5Q 3SGIA 4YWKA 4MTNA 3KJOA 1BF4A 3G6JB 2EXZA 5FOBB 4M1UB 3KFUA 5IE8A 4B3RL 1VS0A 5A35A 4DV7L 1IBLQ 3H0GH 2VUMB 4JOIA 1DM0B 3J81c 2OPUA 1R4PB 1TKWB 3PO3B 2UXBQ 2CTFA 2CQOA 3GTPB 5IP9H 3L3OC 1IBML 4MN3A 1B8AA 2ZJPA 2NVQH 1PZID 3I2ZA 4CKBA 3D8GA 4WJWA 1XNRL 4JBKA 1ET9A 5LL6X 3F8TA 3F2UA 1UE6A 2H1EA 3VDYA 1X56A 2K7VA 3K7UC 1MIUA 2IPKD 2PQAB 2EY2A 3HOYH 5C3XA 4OWXB 3A7LA 3NQTA 4LFAQ 1ZKOA 1UWVA 2ZT9C 5C44B 1O7IA 3L9AX 4K5XA 1F2YA 1XNQQ 4NW2A 2N55A 1BO0A 3W5OA 4JBMA 5E1FA 1PFSA 1JOKA 3K81C 2PQAA 1KXLA 1BCPF 3MA2B 2F3VA 3VR4A 1C8CA 2MGSA 1PHJA 4Y52H 1JWMD 2ZTDA 1TU2B 4KKUA 3LNNA 1FJGL 4MZ9A 1T5XD 1RHPA 3F2CA 3OMCA 1JJGA 2JZXA 3TP7A 3W1BA 1EY6A 1J6QA 1OXSC 2NUCA 1Q46A 1F2LA 3Q22A 1YJ9A 1SJHD 2I46A 1U4LA 2PNRC 3DM1A 4G7HC 2KHJA 2EJMA 1LLRD 2BE5D 2YU9B 2R92B 4IPGA 5CV7A 5EGTA 1KNAA 1DONA 1MI2A 4ZQ3A 1F9SA 1HPCA 4CJ2C 3JAMi 3CCRA 5FO8B 4QB4A 4DAVA 2OTLA 3K59A 2QF7A 4PNYA 3OIQA 1VQNA 4DUZL 2IX3A 2HHHL 4K8IA 1ZZIA 4KHPL 3HOWH 2QEJC 5IT9L 3VYTA 5EBCA 1NTGA 1SE2A 5C4XG 1EIGA 4EQNA 2VS1A 2N88A 5ELNA 1R4QB 1AEXA 4LF8Q 4JI8L 4ZKCB 1WTVA 2K5HA 3KF6B 3TREA 1XPOA 1A62A 1TIID 3H0GB 2HQLA 3I4NH 4DNRB 2EQSA 1EYDA 1YBYA 1SE3A 4H13C 1VQPA 1S5BD 1G2SA 5DAUA 4OO1G 3KF6A 3PCOB 3OSOA 1LACA 1W6JA 4DA2A 1KNEA 1B50A 1F9PA 5EPLA 1N32Q 2K14A 5IGGA 1Z7TA 4H44C 2PY9A 2LMCB 4K2KA 3HOYB 1CHQD 4CKCA 4ME5A 4PZ6A 1L0WA 2CTKA 4LJZC 1JB7A 1DOLA 3A7AB 1KLUD 1VQFA 3BZCA 4LF4Q 5LMNW 4TRDA 1HZCA 3JC66 2DNEA 5KRUA 1LTRD 1TWFH 1BQQT 3SR1A 1NE3A 2HH3A 3NELA 4JVYA 4A3JG 3B6YA 1M4VA 1FD7D 2ICIA 2PW7A 3DXJC 1VQDA 2EOTA 3NENA 2QGQA 1TS4A 3CHBD 3I70A 2PI2E 4JOIC 1PH7A 1QZGA 1E1TA 1KQSA 4R4OA 3KDFB 2K04A 3A8IE 2NN6I 2KECA 3M85A 3EVQA 5IWAL 3FPUB 4S3SA 1LTGD 4L5RC 1CKOA 2LS01 2E75C 1Y1VH 5IYBH 3KDFA 3UE1A 1D5XC 4L5SA 2EY1A 2NVXH 1MGSA 1VQCA 2Q2UA 5IT9c 1IW7C 2EY6A 3N52A 1DT4A 3HOWB 1WFQA 1NR4A 1SXTA 2NVYH 3S9WA 2ZJRA 1XTCD 3H3VI 1ASZA 3M4PA 3FMCA 3CKIB 2WKCA 1HXYD 3AB9A 3I4MG 2JP1A 4HJ7A 4A3KG 2LKVA 3I4NB 5IGEA 1CSPA 3QO2A 3ULJA 1I50B 2E5LQ 1EEFD 4JI7Q 1I94L 2JA7G 3PUZA 3CCLA 3MFGA 2F0MA 2K5NA 2MNAA 3KK7A 1H9MA 2DNCA 5LL6S 1NMGA 5C4HA 1S72A 2JA5G 2I5MX 2K5QA 4JG2A 1ZXTA 1FGUA 3SHLA 1LYLA 1WCMH 2TSSA 1ZEQX 5KYLA 3MEHA 1EY4A 2HQEA 3DEOA 4HCSA 1WTRA 1TWFB 3C1EA 1GUTA 3CCJA 2DY8A 5IIFA 3M3YB 2EIFA 2WAQE 1SEBD 2MUYA 2VQFQ 2ID0A 1Q7YC 2E2JH 4GN5A 2O5IC 4FF4A 4H7BA 4RAUC 4X3KA 1AZQA 1N34L 4DR4L 2QNDA 1BVSA 5FK9C 4TQUS 1CFMA 1RD9D 2HCIA 1D7QA 2J7ZA 1EZ8A 4K6LA 1J9OA 3NTKA 1UE1A 1Y1VB 3CRKC 5BN3A 3UDXA 4APVA 1PH9A 2VUMG 1A63A 2RDGA 3A55A 2F4VL 4HEDA 5M3MH 1A3UA 1L1OA 2E2HH 2NN6H 1I3QH 1EEID 2NVXB 3KJPA 4ALPA 2JA6G 4KKSA 3K5LA 4DR5Q 2E2DC 4JI4Q 1BNZA 2ALYB 1EYCA 2B29A 4LFCL 3CQZH 1O78A 5JEAH 2K03A 4FP5D 1K73C 2MHVA 1V43A 1H9SB 2NVYB 2EYHA 5FO7B 2EYFA 1A3VA 1ILQA 4WRDA 5ELEA 5C44G 2DGYA 4IFDG 5EKKA 3HZXA 3OMGA 1EWHA 1E0BA 5ELFA 1H9SA 2RA4A 2ANRA 1S4ZA 1SYEA 1KIXA 3UI2A 3TMEA 3C46A 4WORA 1P8LA 1LUZA 3H3VH 1YNNC 2E3UA 3E6ZX 3HS0C 2BA0A 3NP8A 2PPBC 1IKMA 1HNZL 3A8KE 4XQJA 3I3CA 4BA2I 1GD7A 5KGUA 2R7DA 3PGZA 1QVFA 1NBWA 4BBRH 4DR7L 4K0KL 4RGMA 1K83H 4B3ML 4K14A 5C0XJ 2AUKA 1TS3A 2R92G 2HCCA 2XIWA 4A3GH 1XXGA 1WCMB 5CV6A 2L9HA 1SYCA 3CC4A 2VB2X 4QIWE 2JA8H 4A3DH 5CV5A 3S2DH 2F0FA 1JR0D 2L0CA 3MWYW 2AXYA 2UUCQ 2E2JB 4KN7C 3GP7A 4FXGC 4LMQD 2R7ZH 5FJ8H 1QVCA 3H94A 1X3PA 2F0DA 1FNWA 4IUTA 1N8RC 3DWQA 4LF9L 5FKAC 4IN3A 2L11A 2KCTA 2LSSA 2VQEQ 5EJWA 1II3A 2I07B 1EY7A 1SR3A 4KJNA 2B2UA 2CCZA 4RH6A 2PW5A 1AW7A 2L12A 1JMCA 2MJ8A 3H0GG 3TSSA 4B9WA 3H09A 5EPJA 4RCOA 3TP5A 3N6RA 1I3QB 3U4ZA 3PMFA 3CP0A 5IP9G 4RHSA 3I4OA 1NR2A 5AJ3Q 3S1RH 4G57A 4F88A 2CFMA 2A1AA 1G291 4A3CH 2P2RA 1N33L 1TVXA 3CQZB 4GKJQ 1YJNA 1VMPA 4X65Q 1X55A 2FMRA 2ZXPA 1YZ6A 3K6OA 4X66L 4IUPA 4WJ3M 1CHPD 4CJ0B 2UUAQ 4XT1B 3C1FA 3HOYG 4QUCA 3U1KA 3IRBA 2F0JA 2IX0A 3PF4A 1DTJA 1EYGA 2K75A