3AEVB

Crystal structure of a/eif2alpha-adim2p-rrna complex from pyrococcus horikoshii ot3
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
183
structure length
177
Chain Sequence
DEWEEFFKQEEYVKIPKDRIAVLIGKKGQTKKEIEKRTKTKITIDSETGEVWITSTKETEDPLAVWKARDIVLAIGRGFSPERAFRLLNEGEYLEIINLTDIIALPRVRGRIIGRKGRTRQIIEEMSGASVSVYGKTVAIIGNPIQIEIAKTAIEKLARGSPHGSVYRYLERRKKDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation/rna binding protein/rna
molecule keywords Translation initiation factor 2 subunit alpha
publication title An archaeal Dim2-like protein, aDim2p, forms a ternary complex with a/eIF2 alpha and the 3' end fragment of 16S rRNA
pubmed doi rcsb
source organism Pyrococcus horikoshii
total genus 61
structure length 177
sequence length 183
ec nomenclature
pdb deposition date 2010-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 3aevB01
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 3aevB02
2YQRA 2NN6G 1J4WA 4BA1I 1EC6A 4QMFB 5K36G 1ZZKA 1ZZIA 2PY9A 3L7ZC 2CPQA 1WVNA 2MJHA 4AM3A 4OO1G 2CTJA 2JVZA 1X4NA 2BL5A 2OPUA 2QNDA 2HH2A 3V69A 2CTKA 4WALA 1VIGA 3AEVB 4WANA 2HH3A 4JVHA 1ZTGA 1J5KA 4B8TA 2CTFA 2DGRA 4LIJA 2JEBI 2P2RA 1K1GA 2FMRA 1DTJA 4BA2I 1DT4A 1TUAA 2Z0SA 2E3UA 3U1KA 2JEAI 4JVYA 4NBQA 2CTEA 1WE8A 1ZZJA 1VIHA 2AXYA 2JE6I 2PQUA 4IFDG 2ANRA 1X4MA 5JEAG 5C0XG 3VKEA 2JA9A 1KHMA 4AIMA 2CTLA 2JZXA 2CTMA 2ANNA 2BA0A 2OPVA
chains in the Genus database with same CATH superfamily
1Z2IA 2Y3MA 4X62H 5BR8H 1I6UA 4X64H 1XNQH 1EC6A 5K36G 1ZZIA 4JI3H 4OO1G 4LF9H 2MJHA 1AN7A 4LF4H 1PQXA 3JAMW 4JI0H 4WANA 4JV5H 1VIGA 1VBIA 1ZTGA 1J5KA 1XMOH 4JI5H 4YY3H 2LTMA 2K1HA 4X66H 1J5EH 3U1KA 1TUAA 1N34H 4JI7H 4LFCH 4DUYH 4NBQA 1WE8A 4E9JA 1ZZJA 1V8CA 2CWHA 2JE6I 3OTOH 2LTLA 1UG8A 1X4MA 2ZQEA 4NZRM 2G8YA 5A2QW 1F0XA 2VQFH 4AQYH 3VKEA 1FKAH 4NXNH 1S20A 2JZXA 1HNWH 2CTMA 3J81W 1N33H 2YQRA 4FJUA 1N36H 4LF7H 4OCHA 4DR3H 2FPHX 5IT9W 4FJSA 1I94H 4NZTM 3L7ZC 2CPQA 3J80W 2VKCA 2CWFA 4B8CD 2CTJA 2OPUA 1X4NA 3V69A 4B3TH 4AM3A 2HH2A 2UXCH 5LL6b 3FAUA 2HH3A 4JI8H 1S03G 2CTFA 4JI2H 4EC5A 1K1GA 2FMRA 2UXBH 4JI6H 2LRRA 4DV0H 4DR1H 1WTJA 2E3UA 3EZJA 2CTEA 2AXYA 4DV2H 5IWAH 2UUBH 4OD6A 5C0XG 2JA9A 2X06A 4DR2H 2CTLA 1HNZH 2LF0A 4DV1H 4LF5H 4X65H 3J7AK 4K0KH 4LF6H 1HR0H 3OETA 2A1SA 2D9IA 2NN6G 1J4WA 2UUCH 4BA1I 3I0PA 4QMFB 1N32H 4LF8H 4GKKH 1WVNA 4DV7H 2UU9H 1V9NA 4LFBH 4GKJH 2E5LH 1FJGH 4PDBA 2UXDH 2JVZA 4DV4H 3AEVB 4WALA 2CTKA 5LMUH 4DV3H 4DV5H 2PT7G 3SB1A 3T1HH 2O4CA 4NXMH 1X0AA 4B3RH 4DR6H 4B8TA 4JI1H 2DGRA 1SEIA 4LIJA 4JYAH 1KHMA 2VQEH 3GR5A 2HHHH 1XNRH 3NCVA 1IBMH 4LFAH 3KDKA 4DUZH 1XMQH 3UOEA 2ANRA 5JEAG 2F4VH 2M6QA 4H8AA 4YHHH 5DT9A 2ZM6H 4B3SH 2JEAI 1ODHA 4DV6H 1WHRA 1NXUA 3GKUA 2CPMA 4G08A 1ZZKA 2PY9A 3GABA 2BL5A 2QNDA 3T1YH 1MSZA 3KDGA 4DR5H 4JVHA 2JEBI 2P2RA 1HNXH 2FFMA 4OX9H 1DTJA 4BA2I 1DT4A 1IBLH 2Z0SA 2UUAH 3QD7X 5FLXW 4JVYA 4DR7H 4IFDG 1VIHA 2PQUA 3RF2A 3OSSD 4DR4H 4KHPH 4AIMA 5LMNH 2M8WA 4B3MH 4JI4H 2ANNA 2BA0A 1X9ZA 2OPVA 1XRHA 1IBKH
chains in the Genus database with same CATH topology
2YQRA 2NN6G 1J4WA 4BA1I 1EC6A 4QMFB 5K36G 1ZZKA 1ZZIA 2PY9A 3L7ZC 2CPQA 1WVNA 2MJHA 4AM3A 4OO1G 2CTJA 2JVZA 1X4NA 2BL5A 2OPUA 2QNDA 2HH2A 3V69A 2CTKA 4WALA 1VIGA 3AEVB 4WANA 2HH3A 4JVHA 1ZTGA 1J5KA 4B8TA 2CTFA 2DGRA 4LIJA 2JEBI 2P2RA 1K1GA 2FMRA 1DTJA 4BA2I 1DT4A 1TUAA 2Z0SA 2E3UA 3U1KA 2JEAI 4JVYA 4NBQA 2CTEA 1WE8A 1ZZJA 1VIHA 2AXYA 2JE6I 2PQUA 4IFDG 2ANRA 1X4MA 5JEAG 5C0XG 3VKEA 2JA9A 1KHMA 4AIMA 2CTLA 2JZXA 2CTMA 2ANNA 2BA0A 2OPVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YQR A;  2NN6 G;  1J4W A;  4BA1 I;  1EC6 A;  4QMF B;  5K36 G;  1ZZK A;  1ZZI A;  2PY9 A;  3L7Z C;  2CPQ A;  1WVN A;  2MJH A;  4AM3 A;  4OO1 G;  2CTJ A;  2JVZ A;  1X4N A;  2BL5 A;  2OPU A;  2QND A;  2HH2 A;  3V69 A;  2CTK A;  4WAL A;  1VIG A;  3AEV B;  4WAN A;  2HH3 A;  4JVH A;  1ZTG A;  1J5K A;  4B8T A;  2CTF A;  2DGR A;  4LIJ A;  2JEB I;  2P2R A;  1K1G A;  2FMR A;  1DTJ A;  4BA2 I;  1DT4 A;  1TUA A;  2Z0S A;  2E3U A;  3U1K A;  2JEA I;  4JVY A;  4NBQ A;  2CTE A;  1WE8 A;  1ZZJ A;  1VIH A;  2AXY A;  2JE6 I;  2PQU A;  4IFD G;  2ANR A;  1X4M A;  5JEA G;  5C0X G;  3VKE A;  2JA9 A;  1KHM A;  4AIM A;  2CTL A;  2JZX A;  2CTM A;  2ANN A;  2BA0 A;  2OPV A; 
#chains in the Genus database with same CATH topology
 1Z2I A;  2Y3M A;  4X62 H;  5BR8 H;  1I6U A;  4X64 H;  1XNQ H;  1EC6 A;  5K36 G;  1ZZI A;  4JI3 H;  4OO1 G;  4LF9 H;  2MJH A;  1AN7 A;  4LF4 H;  1PQX A;  3JAM W;  4JI0 H;  4WAN A;  4JV5 H;  1VIG A;  1VBI A;  1ZTG A;  1J5K A;  1XMO H;  4JI5 H;  4YY3 H;  2LTM A;  2K1H A;  4X66 H;  1J5E H;  3U1K A;  1TUA A;  1N34 H;  4JI7 H;  4LFC H;  4DUY H;  4NBQ A;  1WE8 A;  4E9J A;  1ZZJ A;  1V8C A;  2CWH A;  2JE6 I;  3OTO H;  2LTL A;  1UG8 A;  1X4M A;  2ZQE A;  4NZR M;  2G8Y A;  5A2Q W;  1F0X A;  2VQF H;  4AQY H;  3VKE A;  1FKA H;  4NXN H;  1S20 A;  2JZX A;  1HNW H;  2CTM A;  3J81 W;  1N33 H;  2YQR A;  4FJU A;  1N36 H;  4LF7 H;  4OCH A;  4DR3 H;  2FPH X;  5IT9 W;  4FJS A;  1I94 H;  4NZT M;  3L7Z C;  2CPQ A;  3J80 W;  2VKC A;  2CWF A;  4B8C D;  2CTJ A;  2OPU A;  1X4N A;  3V69 A;  4B3T H;  4AM3 A;  2HH2 A;  2UXC H;  5LL6 b;  3FAU A;  2HH3 A;  4JI8 H;  1S03 G;  2CTF A;  4JI2 H;  4EC5 A;  1K1G A;  2FMR A;  2UXB H;  4JI6 H;  2LRR A;  4DV0 H;  4DR1 H;  1WTJ A;  2E3U A;  3EZJ A;  2CTE A;  2AXY A;  4DV2 H;  5IWA H;  2UUB H;  4OD6 A;  5C0X G;  2JA9 A;  2X06 A;  4DR2 H;  2CTL A;  1HNZ H;  2LF0 A;  4DV1 H;  4LF5 H;  4X65 H;  3J7A K;  4K0K H;  4LF6 H;  1HR0 H;  3OET A;  2A1S A;  2D9I A;  2NN6 G;  1J4W A;  2UUC H;  4BA1 I;  3I0P A;  4QMF B;  1N32 H;  4LF8 H;  4GKK H;  1WVN A;  4DV7 H;  2UU9 H;  1V9N A;  4LFB H;  4GKJ H;  2E5L H;  1FJG H;  4PDB A;  2UXD H;  2JVZ A;  4DV4 H;  3AEV B;  4WAL A;  2CTK A;  5LMU H;  4DV3 H;  4DV5 H;  2PT7 G;  3SB1 A;  3T1H H;  2O4C A;  4NXM H;  1X0A A;  4B3R H;  4DR6 H;  4B8T A;  4JI1 H;  2DGR A;  1SEI A;  4LIJ A;  4JYA H;  1KHM A;  2VQE H;  3GR5 A;  2HHH H;  1XNR H;  3NCV A;  1IBM H;  4LFA H;  3KDK A;  4DUZ H;  1XMQ H;  3UOE A;  2ANR A;  5JEA G;  2F4V H;  2M6Q A;  4H8A A;  4YHH H;  5DT9 A;  2ZM6 H;  4B3S H;  2JEA I;  1ODH A;  4DV6 H;  1WHR A;  1NXU A;  3GKU A;  2CPM A;  4G08 A;  1ZZK A;  2PY9 A;  3GAB A;  2BL5 A;  2QND A;  3T1Y H;  1MSZ A;  3KDG A;  4DR5 H;  4JVH A;  2JEB I;  2P2R A;  1HNX H;  2FFM A;  4OX9 H;  1DTJ A;  4BA2 I;  1DT4 A;  1IBL H;  2Z0S A;  2UUA H;  3QD7 X;  5FLX W;  4JVY A;  4DR7 H;  4IFD G;  1VIH A;  2PQU A;  3RF2 A;  3OSS D;  4DR4 H;  4KHP H;  4AIM A;  5LMN H;  2M8W A;  4B3M H;  4JI4 H;  2ANN A;  2BA0 A;  1X9Z A;  2OPV A;  1XRH A;  1IBK H; 
#chains in the Genus database with same CATH homology
 2YQR A;  2NN6 G;  1J4W A;  4BA1 I;  1EC6 A;  4QMF B;  5K36 G;  1ZZK A;  1ZZI A;  2PY9 A;  3L7Z C;  2CPQ A;  1WVN A;  2MJH A;  4AM3 A;  4OO1 G;  2CTJ A;  2JVZ A;  1X4N A;  2BL5 A;  2OPU A;  2QND A;  2HH2 A;  3V69 A;  2CTK A;  4WAL A;  1VIG A;  3AEV B;  4WAN A;  2HH3 A;  4JVH A;  1ZTG A;  1J5K A;  4B8T A;  2CTF A;  2DGR A;  4LIJ A;  2JEB I;  2P2R A;  1K1G A;  2FMR A;  1DTJ A;  4BA2 I;  1DT4 A;  1TUA A;  2Z0S A;  2E3U A;  3U1K A;  2JEA I;  4JVY A;  4NBQ A;  2CTE A;  1WE8 A;  1ZZJ A;  1VIH A;  2AXY A;  2JE6 I;  2PQU A;  4IFD G;  2ANR A;  1X4M A;  5JEA G;  5C0X G;  3VKE A;  2JA9 A;  1KHM A;  4AIM A;  2CTL A;  2JZX A;  2CTM A;  2ANN A;  2BA0 A;  2OPV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...