3AEVB

Crystal structure of a/eif2alpha-adim2p-rrna complex from pyrococcus horikoshii ot3
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
183
structure length
177
Chain Sequence
DEWEEFFKQEEYVKIPKDRIAVLIGKKGQTKKEIEKRTKTKITIDSETGEVWITSTKETEDPLAVWKARDIVLAIGRGFSPERAFRLLNEGEYLEIINLTDIIALPRVRGRIIGRKGRTRQIIEEMSGASVSVYGKTVAIIGNPIQIEIAKTAIEKLARGSPHGSVYRYLERRKKDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translation initiation factor 2 subunit alpha
publication title An archaeal Dim2-like protein, aDim2p, forms a ternary complex with a/eIF2 alpha and the 3' end fragment of 16S rRNA
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Translation/rna binding protein/rna
total genus 61
structure length 177
sequence length 183
ec nomenclature
pdb deposition date 2010-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 3aevB01
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 3aevB02
1WVNA 2ANRA 2PY9A 2JZXA 4NBQA 2DGRA 3VKEA 3AEVB 1DT4A 2BA0A 2FMRA 2MJHA 2Z0SA 1EC6A 4BA2I 2CTLA 2CPQA 4IFDG 2OPVA 2YQRA 4LIJA 1X4MA 2CTFA 4AIMA 2BL5A 1KHMA 2JEAI 4JVHA 2CTJA 1TUAA 5JEAG 4B8TA 2E3UA 1K1GA 2P2RA 3L7ZC 5K36G 1ZZKA 2CTMA 3V69A 4WANA 1DTJA 1WE8A 4BA1I 2JE6I 1VIGA 2QNDA 2CTKA 2ANNA 4AM3A 4QMFB 1VIHA 2JVZA 5C0XG 2JEBI 1ZZJA 4OO1G 1J5KA 2NN6G 2PQUA 2HH3A 1J4WA 4WALA 2AXYA 3U1KA 2HH2A 4JVYA 1ZTGA 2OPUA 1ZZIA 2JA9A 2CTEA 1X4NA
chains in the Genus database with same CATH superfamily
2PY9A 4JI8H 4NZRM 3AEVB 1PQXA 1XRHA 1DT4A 2G8YA 2LTLA 5DT9A 2K1HA 1FKAH 1MSZA 1UG8A 3GKUA 1AN7A 3T1HH 2CPQA 4FJUA 2OPVA 2YQRA 4NZTM 2LTMA 2UU9H 4B3MH 4JV5H 4AIMA 2ZQEA 2M6QA 3NCVA 1TUAA 1X9ZA 4X62H 4DR4H 4JI4H 2A1SA 3EZJA 1N34H 4DR7H 2UXCH 4BA1I 2JE6I 1VIGA 4DR6H 1S20A 3J7AK 4QMFB 3UOEA 5C0XG 1I6UA 4JI5H 2F4VH 4DV2H 2PQUA 4AQYH 3J80W 3OTOH 3OSSD 4PDBA 3U1KA 2OPUA 1HNXH 3J81W 4X65H 3QD7X 4LF9H 4NBQA 2DGRA 2UXDH 2MJHA 4LF5H 2Z0SA 3KDKA 2E5LH 2CWHA 2Y3MA 1HNZH 1EC6A 1SEIA 4DV7H 1WTJA 2CTFA 2UUAH 1N33H 4OCHA 4LF7H 1KHMA 4GKKH 5JEAG 4B8TA 1I94H 5FLXW 5IWAH 3T1YH 1N36H 2CTMA 3GABA 3V69A 4WANA 1XMQH 1DTJA 2ANNA 2LRRA 1XNQH 1IBLH 4DUYH 4OO1G 2JEBI 2VKCA 4LF8H 4LFBH 4JI6H 1NXUA 4YHHH 4JI7H 1FJGH 4DR2H 2HHHH 4JI0H 4JVYA 4DV0H 2CTEA 4DV4H 4K0KH 1WVNA 2ANRA 5LMUH 4LF6H 2JZXA 3OETA 4X64H 3VKEA 2BA0A 2FFMA 1V9NA 5BR8H 5LL6b 2CPMA 2CTLA 3RF2A 2UUCH 1V8CA 1F0XA 2BL5A 2VQFH 4OD6A 4B3SH 1ODHA 2E3UA 1K1GA 4G08A 1N32H 1J5EH 1WE8A 4DR5H 2CTKA 4DV6H 1VIHA 1Z2IA 2FPHX 4JI3H 2HH3A 2M8WA 4WALA 2AXYA 1HR0H 4KHPH 1ZTGA 4B8CD 3FAUA 1VBIA 2JA9A 2UUBH 2VQEH 4GKJH 4OX9H 2O4CA 1S03G 4DV3H 2CWFA 4E9JA 4FJSA 2D9IA 3JAMW 4DV5H 3I0PA 4DV1H 2FMRA 1WHRA 2X06A 4EC5A 4B3RH 4B3TH 4BA2I 2PT7G 2LF0A 4DR1H 4NXNH 4IFDG 4H8AA 4LIJA 5IT9W 1X4MA 4LFCH 1XMOH 2ZM6H 2JEAI 2CTJA 1X0AA 4JI2H 4LF4H 4DUZH 3GR5A 3L7ZC 2P2RA 2UXBH 1ZZKA 5K36G 1IBMH 1XNRH 4JVHA 2QNDA 4DR3H 4NXMH 4AM3A 4YY3H 2JVZA 1ZZJA 1HNWH 3KDGA 1J5KA 1IBKH 4LFAH 2NN6G 1J4WA 5A2QW 4JYAH 4JI1H 4X66H 2HH2A 5LMNH 3SB1A 1ZZIA 1X4NA
chains in the Genus database with same CATH topology
1WVNA 2ANRA 2PY9A 2JZXA 4NBQA 2DGRA 3VKEA 3AEVB 1DT4A 2BA0A 2FMRA 2MJHA 2Z0SA 1EC6A 4BA2I 2CTLA 2CPQA 4IFDG 2OPVA 2YQRA 4LIJA 1X4MA 2CTFA 4AIMA 2BL5A 1KHMA 2JEAI 4JVHA 2CTJA 1TUAA 5JEAG 4B8TA 2E3UA 1K1GA 2P2RA 3L7ZC 5K36G 1ZZKA 2CTMA 3V69A 4WANA 1DTJA 1WE8A 4BA1I 2JE6I 1VIGA 2QNDA 2CTKA 2ANNA 4AM3A 4QMFB 1VIHA 2JVZA 5C0XG 2JEBI 1ZZJA 4OO1G 1J5KA 2NN6G 2PQUA 2HH3A 1J4WA 4WALA 2AXYA 3U1KA 2HH2A 4JVYA 1ZTGA 2OPUA 1ZZIA 2JA9A 2CTEA 1X4NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WVN A;  2ANR A;  2PY9 A;  2JZX A;  4NBQ A;  2DGR A;  3VKE A;  3AEV B;  1DT4 A;  2BA0 A;  2FMR A;  2MJH A;  2Z0S A;  1EC6 A;  4BA2 I;  2CTL A;  2CPQ A;  4IFD G;  2OPV A;  2YQR A;  4LIJ A;  1X4M A;  2CTF A;  4AIM A;  2BL5 A;  1KHM A;  2JEA I;  4JVH A;  2CTJ A;  1TUA A;  5JEA G;  4B8T A;  2E3U A;  1K1G A;  2P2R A;  3L7Z C;  5K36 G;  1ZZK A;  2CTM A;  3V69 A;  4WAN A;  1DTJ A;  1WE8 A;  4BA1 I;  2JE6 I;  1VIG A;  2QND A;  2CTK A;  2ANN A;  4AM3 A;  4QMF B;  1VIH A;  2JVZ A;  5C0X G;  2JEB I;  1ZZJ A;  4OO1 G;  1J5K A;  2NN6 G;  2PQU A;  2HH3 A;  1J4W A;  4WAL A;  2AXY A;  3U1K A;  2HH2 A;  4JVY A;  1ZTG A;  2OPU A;  1ZZI A;  2JA9 A;  2CTE A;  1X4N A; 
#chains in the Genus database with same CATH topology
 2PY9 A;  4JI8 H;  4NZR M;  3AEV B;  1PQX A;  1XRH A;  1DT4 A;  2G8Y A;  2LTL A;  5DT9 A;  2K1H A;  1FKA H;  1MSZ A;  1UG8 A;  3GKU A;  1AN7 A;  3T1H H;  2CPQ A;  4FJU A;  2OPV A;  2YQR A;  4NZT M;  2LTM A;  2UU9 H;  4B3M H;  4JV5 H;  4AIM A;  2ZQE A;  2M6Q A;  3NCV A;  1TUA A;  1X9Z A;  4X62 H;  4DR4 H;  4JI4 H;  2A1S A;  3EZJ A;  1N34 H;  4DR7 H;  2UXC H;  4BA1 I;  2JE6 I;  1VIG A;  4DR6 H;  1S20 A;  3J7A K;  4QMF B;  3UOE A;  5C0X G;  1I6U A;  4JI5 H;  2F4V H;  4DV2 H;  2PQU A;  4AQY H;  3J80 W;  3OTO H;  3OSS D;  4PDB A;  3U1K A;  2OPU A;  1HNX H;  3J81 W;  4X65 H;  3QD7 X;  4LF9 H;  4NBQ A;  2DGR A;  2UXD H;  2MJH A;  4LF5 H;  2Z0S A;  3KDK A;  2E5L H;  2CWH A;  2Y3M A;  1HNZ H;  1EC6 A;  1SEI A;  4DV7 H;  1WTJ A;  2CTF A;  2UUA H;  1N33 H;  4OCH A;  4LF7 H;  1KHM A;  4GKK H;  5JEA G;  4B8T A;  1I94 H;  5FLX W;  5IWA H;  3T1Y H;  1N36 H;  2CTM A;  3GAB A;  3V69 A;  4WAN A;  1XMQ H;  1DTJ A;  2ANN A;  2LRR A;  1XNQ H;  1IBL H;  4DUY H;  4OO1 G;  2JEB I;  2VKC A;  4LF8 H;  4LFB H;  4JI6 H;  1NXU A;  4YHH H;  4JI7 H;  1FJG H;  4DR2 H;  2HHH H;  4JI0 H;  4JVY A;  4DV0 H;  2CTE A;  4DV4 H;  4K0K H;  1WVN A;  2ANR A;  5LMU H;  4LF6 H;  2JZX A;  3OET A;  4X64 H;  3VKE A;  2BA0 A;  2FFM A;  1V9N A;  5BR8 H;  5LL6 b;  2CPM A;  2CTL A;  3RF2 A;  2UUC H;  1V8C A;  1F0X A;  2BL5 A;  2VQF H;  4OD6 A;  4B3S H;  1ODH A;  2E3U A;  1K1G A;  4G08 A;  1N32 H;  1J5E H;  1WE8 A;  4DR5 H;  2CTK A;  4DV6 H;  1VIH A;  1Z2I A;  2FPH X;  4JI3 H;  2HH3 A;  2M8W A;  4WAL A;  2AXY A;  1HR0 H;  4KHP H;  1ZTG A;  4B8C D;  3FAU A;  1VBI A;  2JA9 A;  2UUB H;  2VQE H;  4GKJ H;  4OX9 H;  2O4C A;  1S03 G;  4DV3 H;  2CWF A;  4E9J A;  4FJS A;  2D9I A;  3JAM W;  4DV5 H;  3I0P A;  4DV1 H;  2FMR A;  1WHR A;  2X06 A;  4EC5 A;  4B3R H;  4B3T H;  4BA2 I;  2PT7 G;  2LF0 A;  4DR1 H;  4NXN H;  4IFD G;  4H8A A;  4LIJ A;  5IT9 W;  1X4M A;  4LFC H;  1XMO H;  2ZM6 H;  2JEA I;  2CTJ A;  1X0A A;  4JI2 H;  4LF4 H;  4DUZ H;  3GR5 A;  3L7Z C;  2P2R A;  2UXB H;  1ZZK A;  5K36 G;  1IBM H;  1XNR H;  4JVH A;  2QND A;  4DR3 H;  4NXM H;  4AM3 A;  4YY3 H;  2JVZ A;  1ZZJ A;  1HNW H;  3KDG A;  1J5K A;  1IBK H;  4LFA H;  2NN6 G;  1J4W A;  5A2Q W;  4JYA H;  4JI1 H;  4X66 H;  2HH2 A;  5LMN H;  3SB1 A;  1ZZI A;  1X4N A; 
#chains in the Genus database with same CATH homology
 1WVN A;  2ANR A;  2PY9 A;  2JZX A;  4NBQ A;  2DGR A;  3VKE A;  3AEV B;  1DT4 A;  2BA0 A;  2FMR A;  2MJH A;  2Z0S A;  1EC6 A;  4BA2 I;  2CTL A;  2CPQ A;  4IFD G;  2OPV A;  2YQR A;  4LIJ A;  1X4M A;  2CTF A;  4AIM A;  2BL5 A;  1KHM A;  2JEA I;  4JVH A;  2CTJ A;  1TUA A;  5JEA G;  4B8T A;  2E3U A;  1K1G A;  2P2R A;  3L7Z C;  5K36 G;  1ZZK A;  2CTM A;  3V69 A;  4WAN A;  1DTJ A;  1WE8 A;  4BA1 I;  2JE6 I;  1VIG A;  2QND A;  2CTK A;  2ANN A;  4AM3 A;  4QMF B;  1VIH A;  2JVZ A;  5C0X G;  2JEB I;  1ZZJ A;  4OO1 G;  1J5K A;  2NN6 G;  2PQU A;  2HH3 A;  1J4W A;  4WAL A;  2AXY A;  3U1K A;  2HH2 A;  4JVY A;  1ZTG A;  2OPU A;  1ZZI A;  2JA9 A;  2CTE A;  1X4N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...