3AEVB

Crystal structure of a/eif2alpha-adim2p-rrna complex from pyrococcus horikoshii ot3
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
183
structure length
177
Chain Sequence
DEWEEFFKQEEYVKIPKDRIAVLIGKKGQTKKEIEKRTKTKITIDSETGEVWITSTKETEDPLAVWKARDIVLAIGRGFSPERAFRLLNEGEYLEIINLTDIIALPRVRGRIIGRKGRTRQIIEEMSGASVSVYGKTVAIIGNPIQIEIAKTAIEKLARGSPHGSVYRYLERRKKDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An archaeal Dim2-like protein, aDim2p, forms a ternary complex with a/eIF2 alpha and the 3' end fragment of 16S rRNA
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Translation/rna binding protein/rna
molecule keywords Translation initiation factor 2 subunit alpha
total genus 61
structure length 177
sequence length 183
ec nomenclature
pdb deposition date 2010-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 3aevB01
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 3aevB02
2CTKA 2CTMA 2CTEA 2OPUA 5JEAG 1ZZJA 1ZTGA 4BA2I 4NBQA 4AIMA 2JVZA 2BL5A 2YQRA 1X4NA 2JA9A 5C0XG 4IFDG 2PY9A 1VIGA 4WANA 2ANRA 2JEAI 1KHMA 2OPVA 4LIJA 2JZXA 2QNDA 1WE8A 4B8TA 1TUAA 2CTFA 2JEBI 3U1KA 2Z0SA 2FMRA 3AEVB 4BA1I 3VKEA 4AM3A 1DT4A 2HH3A 1WVNA 4WALA 1ZZKA 2CTJA 2P2RA 1DTJA 2HH2A 2NN6G 3L7ZC 2MJHA 3V69A 1X4MA 2E3UA 2AXYA 4QMFB 1J5KA 4JVYA 2PQUA 2CPQA 2BA0A 1K1GA 2ANNA 1VIHA 4OO1G 1ZZIA 4JVHA 2JE6I 2CTLA 5K36G 1J4WA 1EC6A 2DGRA
chains in the Genus database with same CATH superfamily
2OPUA 4BA2I 1HNWH 4JI0H 3NCVA 2BL5A 1X4NA 1XRHA 2JA9A 4NZTM 5IWAH 2Y3MA 2ANRA 2OPVA 5A2QW 2UUBH 4LFAH 4H8AA 2JZXA 1FKAH 4B8TA 5BR8H 2CTFA 3OSSD 2LRRA 1NXUA 2LTLA 2A1SA 3SB1A 4AM3A 1WHRA 1XMOH 5IT9W 1XNQH 1WVNA 2P2RA 2NN6G 2MJHA 4DV4H 1MSZA 4JI4H 1X4MA 2AXYA 4DUZH 4X65H 5FLXW 1X9ZA 4DR5H 2CPQA 2FPHX 2X06A 1J5KA 2M8WA 1K1GA 3KDKA 4JV5H 4JI2H 1ZZIA 2JE6I 4OO1G 4DR2H 3KDGA 2DGRA 2CTKA 1ZZJA 1J5EH 1ZTGA 4JI3H 1UG8A 4NBQA 1N33H 4AIMA 4B3RH 4YY3H 5C0XG 2ZQEA 4OD6A 2UUCH 2PY9A 4IFDG 2JEAI 2LF0A 4JI7H 4LIJA 4OX9H 2QNDA 1ODHA 4NXMH 1FJGH 4X64H 2JEBI 1WTJA 3FAUA 3U1KA 2K1HA 4B3SH 3JAMW 4LF8H 4LFBH 1PQXA 4BA1I 1HNXH 1IBKH 2E5LH 1I6UA 2O4CA 2UUAH 1IBMH 1SEIA 1ZZKA 4DUYH 1N36H 4G08A 4YHHH 1V8CA 2E3UA 2UU9H 2PQUA 3UOEA 2M6QA 1N32H 1VIHA 1AN7A 2CWHA 3T1HH 5LL6b 1HR0H 4GKKH 3J81W 4JI1H 2CTLA 1EC6A 2CTMA 1VBIA 1HNZH 3GR5A 4DR3H 2UXCH 2VQFH 3QD7X 2VQEH 2UXBH 2FFMA 1VIGA 4E9JA 1KHMA 4B8CD 1IBLH 5LMNH 1TUAA 2Z0SA 1S03G 4LF5H 1F0XA 4PDBA 3OETA 4LFCH 3AEVB 1I94H 1XNRH 1S20A 2HH3A 3OTOH 1V9NA 2G8YA 2HHHH 2CTJA 5LMUH 1DTJA 3L7ZC 4EC5A 3V69A 4DR4H 4DV0H 3GABA 4QMFB 4LF7H 3J7AK 4KHPH 3GKUA 4DV1H 2BA0A 4JI6H 4K0KH 3I0PA 2PT7G 4NZRM 1J4WA 2UXDH 5K36G 3J80W 2CTEA 5JEAG 4DV3H 4X62H 4DR6H 4DR7H 4LF6H 2JVZA 4OCHA 1N34H 2D9IA 4FJSA 2YQRA 2ZM6H 4WANA 4JYAH 4AQYH 2CWFA 4DV5H 4JI5H 2F4VH 1WE8A 4B3MH 4DV6H 4B3TH 1X0AA 2FMRA 2LTMA 2CPMA 3VKEA 1DT4A 1Z2IA 4WALA 2HH2A 4DR1H 2VKCA 4JVYA 4JI8H 4LF9H 4X66H 5DT9A 4FJUA 2ANNA 3EZJA 4LF4H 4JVHA 4DV7H 1XMQH 4GKJH 4NXNH 3RF2A 3T1YH 4DV2H
chains in the Genus database with same CATH topology
2CTKA 2CTMA 2CTEA 2OPUA 5JEAG 1ZZJA 1ZTGA 4BA2I 4NBQA 4AIMA 2JVZA 2BL5A 2YQRA 1X4NA 2JA9A 5C0XG 4IFDG 2PY9A 1VIGA 4WANA 2ANRA 2JEAI 1KHMA 2OPVA 4LIJA 2JZXA 2QNDA 1WE8A 4B8TA 1TUAA 2CTFA 2JEBI 3U1KA 2Z0SA 2FMRA 3AEVB 4BA1I 3VKEA 4AM3A 1DT4A 2HH3A 1WVNA 4WALA 1ZZKA 2CTJA 2P2RA 1DTJA 2HH2A 2NN6G 3L7ZC 2MJHA 3V69A 1X4MA 2E3UA 2AXYA 4QMFB 1J5KA 4JVYA 2PQUA 2CPQA 2BA0A 1K1GA 2ANNA 1VIHA 4OO1G 1ZZIA 4JVHA 2JE6I 2CTLA 5K36G 1J4WA 1EC6A 2DGRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CTK A;  2CTM A;  2CTE A;  2OPU A;  5JEA G;  1ZZJ A;  1ZTG A;  4BA2 I;  4NBQ A;  4AIM A;  2JVZ A;  2BL5 A;  2YQR A;  1X4N A;  2JA9 A;  5C0X G;  4IFD G;  2PY9 A;  1VIG A;  4WAN A;  2ANR A;  2JEA I;  1KHM A;  2OPV A;  4LIJ A;  2JZX A;  2QND A;  1WE8 A;  4B8T A;  1TUA A;  2CTF A;  2JEB I;  3U1K A;  2Z0S A;  2FMR A;  3AEV B;  4BA1 I;  3VKE A;  4AM3 A;  1DT4 A;  2HH3 A;  1WVN A;  4WAL A;  1ZZK A;  2CTJ A;  2P2R A;  1DTJ A;  2HH2 A;  2NN6 G;  3L7Z C;  2MJH A;  3V69 A;  1X4M A;  2E3U A;  2AXY A;  4QMF B;  1J5K A;  4JVY A;  2PQU A;  2CPQ A;  2BA0 A;  1K1G A;  2ANN A;  1VIH A;  4OO1 G;  1ZZI A;  4JVH A;  2JE6 I;  2CTL A;  5K36 G;  1J4W A;  1EC6 A;  2DGR A; 
#chains in the Genus database with same CATH topology
 2OPU A;  4BA2 I;  1HNW H;  4JI0 H;  3NCV A;  2BL5 A;  1X4N A;  1XRH A;  2JA9 A;  4NZT M;  5IWA H;  2Y3M A;  2ANR A;  2OPV A;  5A2Q W;  2UUB H;  4LFA H;  4H8A A;  2JZX A;  1FKA H;  4B8T A;  5BR8 H;  2CTF A;  3OSS D;  2LRR A;  1NXU A;  2LTL A;  2A1S A;  3SB1 A;  4AM3 A;  1WHR A;  1XMO H;  5IT9 W;  1XNQ H;  1WVN A;  2P2R A;  2NN6 G;  2MJH A;  4DV4 H;  1MSZ A;  4JI4 H;  1X4M A;  2AXY A;  4DUZ H;  4X65 H;  5FLX W;  1X9Z A;  4DR5 H;  2CPQ A;  2FPH X;  2X06 A;  1J5K A;  2M8W A;  1K1G A;  3KDK A;  4JV5 H;  4JI2 H;  1ZZI A;  2JE6 I;  4OO1 G;  4DR2 H;  3KDG A;  2DGR A;  2CTK A;  1ZZJ A;  1J5E H;  1ZTG A;  4JI3 H;  1UG8 A;  4NBQ A;  1N33 H;  4AIM A;  4B3R H;  4YY3 H;  5C0X G;  2ZQE A;  4OD6 A;  2UUC H;  2PY9 A;  4IFD G;  2JEA I;  2LF0 A;  4JI7 H;  4LIJ A;  4OX9 H;  2QND A;  1ODH A;  4NXM H;  1FJG H;  4X64 H;  2JEB I;  1WTJ A;  3FAU A;  3U1K A;  2K1H A;  4B3S H;  3JAM W;  4LF8 H;  4LFB H;  1PQX A;  4BA1 I;  1HNX H;  1IBK H;  2E5L H;  1I6U A;  2O4C A;  2UUA H;  1IBM H;  1SEI A;  1ZZK A;  4DUY H;  1N36 H;  4G08 A;  4YHH H;  1V8C A;  2E3U A;  2UU9 H;  2PQU A;  3UOE A;  2M6Q A;  1N32 H;  1VIH A;  1AN7 A;  2CWH A;  3T1H H;  5LL6 b;  1HR0 H;  4GKK H;  3J81 W;  4JI1 H;  2CTL A;  1EC6 A;  2CTM A;  1VBI A;  1HNZ H;  3GR5 A;  4DR3 H;  2UXC H;  2VQF H;  3QD7 X;  2VQE H;  2UXB H;  2FFM A;  1VIG A;  4E9J A;  1KHM A;  4B8C D;  1IBL H;  5LMN H;  1TUA A;  2Z0S A;  1S03 G;  4LF5 H;  1F0X A;  4PDB A;  3OET A;  4LFC H;  3AEV B;  1I94 H;  1XNR H;  1S20 A;  2HH3 A;  3OTO H;  1V9N A;  2G8Y A;  2HHH H;  2CTJ A;  5LMU H;  1DTJ A;  3L7Z C;  4EC5 A;  3V69 A;  4DR4 H;  4DV0 H;  3GAB A;  4QMF B;  4LF7 H;  3J7A K;  4KHP H;  3GKU A;  4DV1 H;  2BA0 A;  4JI6 H;  4K0K H;  3I0P A;  2PT7 G;  4NZR M;  1J4W A;  2UXD H;  5K36 G;  3J80 W;  2CTE A;  5JEA G;  4DV3 H;  4X62 H;  4DR6 H;  4DR7 H;  4LF6 H;  2JVZ A;  4OCH A;  1N34 H;  2D9I A;  4FJS A;  2YQR A;  2ZM6 H;  4WAN A;  4JYA H;  4AQY H;  2CWF A;  4DV5 H;  4JI5 H;  2F4V H;  1WE8 A;  4B3M H;  4DV6 H;  4B3T H;  1X0A A;  2FMR A;  2LTM A;  2CPM A;  3VKE A;  1DT4 A;  1Z2I A;  4WAL A;  2HH2 A;  4DR1 H;  2VKC A;  4JVY A;  4JI8 H;  4LF9 H;  4X66 H;  5DT9 A;  4FJU A;  2ANN A;  3EZJ A;  4LF4 H;  4JVH A;  4DV7 H;  1XMQ H;  4GKJ H;  4NXN H;  3RF2 A;  3T1Y H;  4DV2 H; 
#chains in the Genus database with same CATH homology
 2CTK A;  2CTM A;  2CTE A;  2OPU A;  5JEA G;  1ZZJ A;  1ZTG A;  4BA2 I;  4NBQ A;  4AIM A;  2JVZ A;  2BL5 A;  2YQR A;  1X4N A;  2JA9 A;  5C0X G;  4IFD G;  2PY9 A;  1VIG A;  4WAN A;  2ANR A;  2JEA I;  1KHM A;  2OPV A;  4LIJ A;  2JZX A;  2QND A;  1WE8 A;  4B8T A;  1TUA A;  2CTF A;  2JEB I;  3U1K A;  2Z0S A;  2FMR A;  3AEV B;  4BA1 I;  3VKE A;  4AM3 A;  1DT4 A;  2HH3 A;  1WVN A;  4WAL A;  1ZZK A;  2CTJ A;  2P2R A;  1DTJ A;  2HH2 A;  2NN6 G;  3L7Z C;  2MJH A;  3V69 A;  1X4M A;  2E3U A;  2AXY A;  4QMF B;  1J5K A;  4JVY A;  2PQU A;  2CPQ A;  2BA0 A;  1K1G A;  2ANN A;  1VIH A;  4OO1 G;  1ZZI A;  4JVH A;  2JE6 I;  2CTL A;  5K36 G;  1J4W A;  1EC6 A;  2DGR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...