2CPMA

Solution structure of the r3h domain of human sperm-associated antigen 7
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
94
structure length
94
Chain Sequence
GSSGSSGQKVEFRKRMEKEVSDFIQDSGQIKKKFQPMNKIERSILHDVVEVAGLTSFSFGEDDDCRYVMIFKKEFAPSDEELDSYRRGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Sperm-associated antigen 7
publication title Solution structure of the R3H domain of human sperm-associated antigen 7
rcsb
source organism Homo sapiens
total genus 16
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01424 R3H R3H domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.50 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 R3H-like domain 2cpmA00
2A1SA 1WHRA 2CPMA 3GKUA 2LRRA 1MSZA 1UG8A
chains in the Genus database with same CATH superfamily
3KDKA 3U1KA 4LF8H 4X65H 4GKKH 4JVHA 1HNZH 2M6QA 1MSZA 2O4CA 5LL6b 1X4MA 1F0XA 4B8TA 4E9JA 1N33H 1XMOH 2CWHA 4QMFB 2CTMA 1XRHA 2FPHX 3GKUA 2UUCH 4JI0H 1S03G 2CPQA 1N34H 4B3TH 2OPUA 1WHRA 4DUZH 3EZJA 1NXUA 2D9IA 4YY3H 2E3UA 3OSSD 4LF7H 3T1YH 4WANA 5IT9W 2ANRA 4BA2I 2PY9A 2YQRA 2JEAI 1X4NA 2ZQEA 4X62H 2PQUA 2UU9H 4DR2H 4DR7H 4DV0H 1IBMH 3L7ZC 1HNWH 1XNRH 1K1GA 3I0PA 4DR6H 2CTKA 2LF0A 3QD7X 3SB1A 4K0KH 4FJUA 1ZTGA 4AM3A 2JE6I 2QNDA 2VQFH 2CTJA 2AXYA 2CWFA 4FJSA 4GKJH 2FMRA 5FLXW 1I94H 1J4WA 1WVNA 1ZZKA 3GR5A 4LF6H 4X64H 2M8WA 5BR8H 2JZXA 2MJHA 4B8CD 1XMQH 1X9ZA 2VKCA 4DR1H 2CPMA 4NXNH 2HH3A 4OD6A 3FAUA 4LFAH 2ANNA 2G8YA 3T1HH 1UG8A 2Y3MA 3RF2A 1FKAH 4JI2H 2UUAH 1V8CA 1VIGA 1KHMA 3NCVA 2UUBH 1IBKH 1N32H 2DGRA 3OETA 5JEAG 4JI7H 4NZRM 1J5EH 4LFBH 4WALA 4KHPH 1HR0H 2JVZA 2ZM6H 2P2RA 5A2QW 1FJGH 1AN7A 1X0AA 1J5KA 4DUYH 1I6UA 2Z0SA 4JVYA 4PDBA 1N36H 4NXMH 4G08A 4NZTM 3J80W 2E5LH 2A1SA 1DT4A 5DT9A 5IWAH 2HHHH 1ZZJA 3JAMW 4LF5H 4JV5H 1DTJA 1S20A 1XNQH 4NBQA 3GABA 4AQYH 3VKEA 2UXDH 1HNXH 1TUAA 2UXCH 4JI1H 1SEIA 1IBLH 1Z2IA 1ODHA 4DR4H 4B3RH 2UXBH 4OO1G 3OTOH 2BL5A 1ZZIA 4B3SH 4IFDG 4DR5H 4JI6H 4JI8H 3UOEA 4JI3H 1EC6A 4DV6H 2OPVA 3J7AK 1VBIA 4DV3H 2K1HA 4OCHA 2F4VH 1WE8A 4H8AA 3V69A 5C0XG 4JI5H 2CTLA 4B3MH 4LF9H 4JYAH 2LTMA 4AIMA 2LRRA 4DV7H 4OX9H 4BA1I 1PQXA 2LTLA 4X66H 5LMUH 4DV2H 4LFCH 2BA0A 2CTEA 2PT7G 4LIJA 5K36G 4DV5H 1V9NA 2FFMA 4JI4H 3AEVB 3J81W 1VIHA 2JA9A 4EC5A 2NN6G 5LMNH 2JEBI 3KDGA 2HH2A 4LF4H 4DV4H 4DR3H 4YHHH 2VQEH 2X06A 4DV1H 1WTJA 2CTFA
chains in the Genus database with same CATH topology
2A1SA 1WHRA 2CPMA 3GKUA 2LRRA 1MSZA 1UG8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A1S A;  1WHR A;  2CPM A;  3GKU A;  2LRR A;  1MSZ A;  1UG8 A; 
#chains in the Genus database with same CATH topology
 3KDK A;  3U1K A;  4LF8 H;  4X65 H;  4GKK H;  4JVH A;  1HNZ H;  2M6Q A;  1MSZ A;  2O4C A;  5LL6 b;  1X4M A;  1F0X A;  4B8T A;  4E9J A;  1N33 H;  1XMO H;  2CWH A;  4QMF B;  2CTM A;  1XRH A;  2FPH X;  3GKU A;  2UUC H;  4JI0 H;  1S03 G;  2CPQ A;  1N34 H;  4B3T H;  2OPU A;  1WHR A;  4DUZ H;  3EZJ A;  1NXU A;  2D9I A;  4YY3 H;  2E3U A;  3OSS D;  4LF7 H;  3T1Y H;  4WAN A;  5IT9 W;  2ANR A;  4BA2 I;  2PY9 A;  2YQR A;  2JEA I;  1X4N A;  2ZQE A;  4X62 H;  2PQU A;  2UU9 H;  4DR2 H;  4DR7 H;  4DV0 H;  1IBM H;  3L7Z C;  1HNW H;  1XNR H;  1K1G A;  3I0P A;  4DR6 H;  2CTK A;  2LF0 A;  3QD7 X;  3SB1 A;  4K0K H;  4FJU A;  1ZTG A;  4AM3 A;  2JE6 I;  2QND A;  2VQF H;  2CTJ A;  2AXY A;  2CWF A;  4FJS A;  4GKJ H;  2FMR A;  5FLX W;  1I94 H;  1J4W A;  1WVN A;  1ZZK A;  3GR5 A;  4LF6 H;  4X64 H;  2M8W A;  5BR8 H;  2JZX A;  2MJH A;  4B8C D;  1XMQ H;  1X9Z A;  2VKC A;  4DR1 H;  2CPM A;  4NXN H;  2HH3 A;  4OD6 A;  3FAU A;  4LFA H;  2ANN A;  2G8Y A;  3T1H H;  1UG8 A;  2Y3M A;  3RF2 A;  1FKA H;  4JI2 H;  2UUA H;  1V8C A;  1VIG A;  1KHM A;  3NCV A;  2UUB H;  1IBK H;  1N32 H;  2DGR A;  3OET A;  5JEA G;  4JI7 H;  4NZR M;  1J5E H;  4LFB H;  4WAL A;  4KHP H;  1HR0 H;  2JVZ A;  2ZM6 H;  2P2R A;  5A2Q W;  1FJG H;  1AN7 A;  1X0A A;  1J5K A;  4DUY H;  1I6U A;  2Z0S A;  4JVY A;  4PDB A;  1N36 H;  4NXM H;  4G08 A;  4NZT M;  3J80 W;  2E5L H;  2A1S A;  1DT4 A;  5DT9 A;  5IWA H;  2HHH H;  1ZZJ A;  3JAM W;  4LF5 H;  4JV5 H;  1DTJ A;  1S20 A;  1XNQ H;  4NBQ A;  3GAB A;  4AQY H;  3VKE A;  2UXD H;  1HNX H;  1TUA A;  2UXC H;  4JI1 H;  1SEI A;  1IBL H;  1Z2I A;  1ODH A;  4DR4 H;  4B3R H;  2UXB H;  4OO1 G;  3OTO H;  2BL5 A;  1ZZI A;  4B3S H;  4IFD G;  4DR5 H;  4JI6 H;  4JI8 H;  3UOE A;  4JI3 H;  1EC6 A;  4DV6 H;  2OPV A;  3J7A K;  1VBI A;  4DV3 H;  2K1H A;  4OCH A;  2F4V H;  1WE8 A;  4H8A A;  3V69 A;  5C0X G;  4JI5 H;  2CTL A;  4B3M H;  4LF9 H;  4JYA H;  2LTM A;  4AIM A;  2LRR A;  4DV7 H;  4OX9 H;  4BA1 I;  1PQX A;  2LTL A;  4X66 H;  5LMU H;  4DV2 H;  4LFC H;  2BA0 A;  2CTE A;  2PT7 G;  4LIJ A;  5K36 G;  4DV5 H;  1V9N A;  2FFM A;  4JI4 H;  3AEV B;  3J81 W;  1VIH A;  2JA9 A;  4EC5 A;  2NN6 G;  5LMN H;  2JEB I;  3KDG A;  2HH2 A;  4LF4 H;  4DV4 H;  4DR3 H;  4YHH H;  2VQE H;  2X06 A;  4DV1 H;  1WTJ A;  2CTF A; 
#chains in the Genus database with same CATH homology
 2A1S A;  1WHR A;  2CPM A;  3GKU A;  2LRR A;  1MSZ A;  1UG8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...