2CPMA

Solution structure of the r3h domain of human sperm-associated antigen 7
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
94
structure length
94
Chain Sequence
GSSGSSGQKVEFRKRMEKEVSDFIQDSGQIKKKFQPMNKIERSILHDVVEVAGLTSFSFGEDDDCRYVMIFKKEFAPSDEELDSYRRGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sperm-associated antigen 7
publication title Solution structure of the R3H domain of human sperm-associated antigen 7
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
total genus 16
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01424 R3H R3H domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.50 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 R3H-like domain 2cpmA00
2CPMA 3GKUA 1MSZA 2A1SA 2LRRA 1UG8A 1WHRA
chains in the Genus database with same CATH superfamily
2VKCA 1IBMH 5BR8H 2M8WA 2D9IA 2JVZA 4DR3H 2F4VH 3GABA 4X62H 1KHMA 2DGRA 3EZJA 2OPUA 1X0AA 3FAUA 2UUAH 4LF8H 1FKAH 5DT9A 2UXCH 4WALA 1DT4A 5IWAH 1XNRH 4X66H 4GKKH 4FJUA 1XMOH 5LL6b 1N34H 4B3MH 1WHRA 4LIJA 2G8YA 1I6UA 1WE8A 1S03G 1EC6A 4LF5H 2PQUA 1VIGA 3J7AK 5LMUH 2QNDA 4WANA 1NXUA 1WVNA 1IBKH 2CTMA 2HH2A 5IT9W 3KDKA 2CTFA 2MJHA 4BA2I 2FFMA 3GR5A 4JI4H 4DV1H 1SEIA 4KHPH 4NZRM 2LF0A 2CWHA 4AIMA 4FJSA 2ZQEA 4DR1H 2CPQA 1V9NA 2PY9A 3GKUA 2HHHH 2A1SA 2BA0A 2YQRA 3JAMW 2UUCH 4LFBH 2JE6I 1ZZKA 1X4NA 3UOEA 1HNZH 4EC5A 1HR0H 2UUBH 1F0XA 2VQFH 4DV4H 3OSSD 2FMRA 4B8CD 4JI3H 2CWFA 5LMNH 2VQEH 2JEBI 4AM3A 2BL5A 1I94H 3T1YH 4PDBA 4JI0H 1AN7A 5K36G 4LF9H 4JYAH 4B8TA 1XNQH 1TUAA 2CTLA 1Z2IA 5A2QW 1PQXA 2CTEA 1X4MA 2CPMA 4X64H 4DV7H 2UU9H 4JI8H 4DV2H 4JVYA 4JI6H 4JI5H 4DV6H 1ODHA 1UG8A 4QMFB 3J80W 2ANNA 4B3RH 4JV5H 1N32H 1HNWH 4DR2H 2NN6G 4DR5H 4OX9H 5JEAG 1K1GA 1S20A 5FLXW 2UXBH 1HNXH 2CTKA 1VIHA 4B3SH 1XRHA 4YHHH 2UXDH 4BA1I 4LFAH 1IBLH 3SB1A 2ANRA 2M6QA 3KDGA 2CTJA 1ZZJA 2O4CA 4NXMH 1FJGH 2P2RA 2HH3A 4LF4H 1MSZA 3OTOH 1V8CA 1J4WA 4X65H 1J5EH 4LF6H 4K0KH 2LTLA 3V69A 1J5KA 4LF7H 1WTJA 4G08A 3NCVA 4LFCH 4B3TH 2JEAI 4DR7H 4DR6H 4JVHA 4YY3H 1ZTGA 4DUZH 2E3UA 2X06A 4NZTM 3AEVB 1N36H 2K1HA 2Y3MA 3U1KA 1ZZIA 2AXYA 4DV0H 1XMQH 4DR4H 2E5LH 2LTMA 2JZXA 4AQYH 4JI1H 1X9ZA 4NXNH 2LRRA 3J81W 2PT7G 2ZM6H 4NBQA 4JI2H 4IFDG 4JI7H 4OCHA 4E9JA 2JA9A 2FPHX 5C0XG 3I0PA 3OETA 4OD6A 1DTJA 4DUYH 4DV5H 4OO1G 4DV3H 3L7ZC 3T1HH 3RF2A 1N33H 4GKJH 2Z0SA 2OPVA 4H8AA 1VBIA 3VKEA 3QD7X
chains in the Genus database with same CATH topology
2CPMA 3GKUA 1MSZA 2A1SA 2LRRA 1UG8A 1WHRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CPM A;  3GKU A;  1MSZ A;  2A1S A;  2LRR A;  1UG8 A;  1WHR A; 
#chains in the Genus database with same CATH topology
 2VKC A;  1IBM H;  5BR8 H;  2M8W A;  2D9I A;  2JVZ A;  4DR3 H;  2F4V H;  3GAB A;  4X62 H;  1KHM A;  2DGR A;  3EZJ A;  2OPU A;  1X0A A;  3FAU A;  2UUA H;  4LF8 H;  1FKA H;  5DT9 A;  2UXC H;  4WAL A;  1DT4 A;  5IWA H;  1XNR H;  4X66 H;  4GKK H;  4FJU A;  1XMO H;  5LL6 b;  1N34 H;  4B3M H;  1WHR A;  4LIJ A;  2G8Y A;  1I6U A;  1WE8 A;  1S03 G;  1EC6 A;  4LF5 H;  2PQU A;  1VIG A;  3J7A K;  5LMU H;  2QND A;  4WAN A;  1NXU A;  1WVN A;  1IBK H;  2CTM A;  2HH2 A;  5IT9 W;  3KDK A;  2CTF A;  2MJH A;  4BA2 I;  2FFM A;  3GR5 A;  4JI4 H;  4DV1 H;  1SEI A;  4KHP H;  4NZR M;  2LF0 A;  2CWH A;  4AIM A;  4FJS A;  2ZQE A;  4DR1 H;  2CPQ A;  1V9N A;  2PY9 A;  3GKU A;  2HHH H;  2A1S A;  2BA0 A;  2YQR A;  3JAM W;  2UUC H;  4LFB H;  2JE6 I;  1ZZK A;  1X4N A;  3UOE A;  1HNZ H;  4EC5 A;  1HR0 H;  2UUB H;  1F0X A;  2VQF H;  4DV4 H;  3OSS D;  2FMR A;  4B8C D;  4JI3 H;  2CWF A;  5LMN H;  2VQE H;  2JEB I;  4AM3 A;  2BL5 A;  1I94 H;  3T1Y H;  4PDB A;  4JI0 H;  1AN7 A;  5K36 G;  4LF9 H;  4JYA H;  4B8T A;  1XNQ H;  1TUA A;  2CTL A;  1Z2I A;  5A2Q W;  1PQX A;  2CTE A;  1X4M A;  2CPM A;  4X64 H;  4DV7 H;  2UU9 H;  4JI8 H;  4DV2 H;  4JVY A;  4JI6 H;  4JI5 H;  4DV6 H;  1ODH A;  1UG8 A;  4QMF B;  3J80 W;  2ANN A;  4B3R H;  4JV5 H;  1N32 H;  1HNW H;  4DR2 H;  2NN6 G;  4DR5 H;  4OX9 H;  5JEA G;  1K1G A;  1S20 A;  5FLX W;  2UXB H;  1HNX H;  2CTK A;  1VIH A;  4B3S H;  1XRH A;  4YHH H;  2UXD H;  4BA1 I;  4LFA H;  1IBL H;  3SB1 A;  2ANR A;  2M6Q A;  3KDG A;  2CTJ A;  1ZZJ A;  2O4C A;  4NXM H;  1FJG H;  2P2R A;  2HH3 A;  4LF4 H;  1MSZ A;  3OTO H;  1V8C A;  1J4W A;  4X65 H;  1J5E H;  4LF6 H;  4K0K H;  2LTL A;  3V69 A;  1J5K A;  4LF7 H;  1WTJ A;  4G08 A;  3NCV A;  4LFC H;  4B3T H;  2JEA I;  4DR7 H;  4DR6 H;  4JVH A;  4YY3 H;  1ZTG A;  4DUZ H;  2E3U A;  2X06 A;  4NZT M;  3AEV B;  1N36 H;  2K1H A;  2Y3M A;  3U1K A;  1ZZI A;  2AXY A;  4DV0 H;  1XMQ H;  4DR4 H;  2E5L H;  2LTM A;  2JZX A;  4AQY H;  4JI1 H;  1X9Z A;  4NXN H;  2LRR A;  3J81 W;  2PT7 G;  2ZM6 H;  4NBQ A;  4JI2 H;  4IFD G;  4JI7 H;  4OCH A;  4E9J A;  2JA9 A;  2FPH X;  5C0X G;  3I0P A;  3OET A;  4OD6 A;  1DTJ A;  4DUY H;  4DV5 H;  4OO1 G;  4DV3 H;  3L7Z C;  3T1H H;  3RF2 A;  1N33 H;  4GKJ H;  2Z0S A;  2OPV A;  4H8A A;  1VBI A;  3VKE A;  3QD7 X; 
#chains in the Genus database with same CATH homology
 2CPM A;  3GKU A;  1MSZ A;  2A1S A;  2LRR A;  1UG8 A;  1WHR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...