2CPMA

Solution structure of the r3h domain of human sperm-associated antigen 7
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
94
structure length
94
Chain Sequence
GSSGSSGQKVEFRKRMEKEVSDFIQDSGQIKKKFQPMNKIERSILHDVVEVAGLTSFSFGEDDDCRYVMIFKKEFAPSDEELDSYRRGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sperm-associated antigen 7
publication title Solution structure of the R3H domain of human sperm-associated antigen 7
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
total genus 16
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01424 R3H R3H domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.50 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 R3H-like domain 2cpmA00
2A1SA 2LRRA 1MSZA 1WHRA 2CPMA 3GKUA 1UG8A
chains in the Genus database with same CATH superfamily
1WVNA 2CTLA 2FFMA 2ZM6H 1IBLH 1K1GA 3UOEA 2DGRA 1FKAH 1KHMA 1J4WA 4X66H 4NXNH 1HNXH 4JV5H 2JEAI 1X4MA 3T1YH 3KDKA 4JI8H 4JI6H 2UUAH 5IT9W 1F0XA 4OCHA 2UXBH 2AXYA 4EC5A 2VQEH 2HHHH 3QD7X 4B3RH 4KHPH 4DV2H 4X62H 3AEVB 4BA1I 4LF9H 4H8AA 4IFDG 1J5EH 2UU9H 3J81W 4OD6A 2K1HA 3V69A 4AQYH 1J5KA 4DR4H 1UG8A 4YHHH 1V9NA 5FLXW 2BA0A 2JEBI 5LMNH 5DT9A 2ANRA 4G08A 2VKCA 1ZZJA 4LIJA 2CPQA 1VIHA 4DR5H 2UXCH 2M8WA 2VQFH 4JI5H 3FAUA 2OPVA 2LRRA 1NXUA 3RF2A 1TUAA 2JVZA 4X64H 2ZQEA 4DR1H 2JA9A 4JVYA 1XRHA 2HH3A 2M6QA 5JEAG 2CPMA 4DV0H 2CTEA 1HR0H 4LF6H 2D9IA 4LFBH 1EC6A 1AN7A 2HH2A 2OPUA 2BL5A 1XNQH 4OX9H 1ODHA 4DV7H 4AIMA 4DV1H 1WTJA 3I0PA 2A1SA 4DR7H 1Z2IA 5K36G 4DV3H 2Z0SA 1S20A 4JYAH 4FJSA 4GKKH 2PY9A 5IWAH 1HNZH 3GR5A 2G8YA 3U1KA 4DUYH 3SB1A 1VBIA 4B8TA 4DR6H 2CTKA 4NZRM 4DR2H 2LTMA 5A2QW 4LF5H 4JVHA 1XNRH 2UXDH 1VIGA 4JI2H 4JI0H 1N34H 3OTOH 1X9ZA 4NBQA 4K0KH 4B3SH 2UUCH 1S03G 2CTFA 3EZJA 1DTJA 4B8CD 4OO1G 1N33H 2QNDA 3OSSD 4JI1H 5BR8H 1PQXA 4DV4H 5LL6b 3L7ZC 3NCVA 2CTJA 2JE6I 2Y3MA 1ZZIA 4B3TH 1MSZA 1ZZKA 4E9JA 1WE8A 5C0XG 4DUZH 4JI3H 2CTMA 2CWHA 1HNWH 4DV5H 4LF8H 4LF7H 4FJUA 1I94H 4WANA 2NN6G 2FMRA 2PT7G 1X4NA 2E5LH 3GKUA 2ANNA 4BA2I 1X0AA 4QMFB 4GKJH 2F4VH 4B3MH 4DV6H 2UUBH 2MJHA 3J7AK 4NZTM 2PQUA 2E3UA 2LTLA 2O4CA 4YY3H 4WALA 4X65H 3VKEA 1IBKH 3GABA 1I6UA 1SEIA 2CWFA 3KDGA 3T1HH 1FJGH 3OETA 1ZTGA 4AM3A 4JI7H 2P2RA 1DT4A 1V8CA 5LMUH 4LFAH 2LF0A 4LF4H 3J80W 4JI4H 1IBMH 2JZXA 2YQRA 1XMQH 4DR3H 1N36H 2FPHX 3JAMW 2X06A 4PDBA 4NXMH 4LFCH 1WHRA 1XMOH 1N32H
chains in the Genus database with same CATH topology
2A1SA 2LRRA 1MSZA 1WHRA 2CPMA 3GKUA 1UG8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A1S A;  2LRR A;  1MSZ A;  1WHR A;  2CPM A;  3GKU A;  1UG8 A; 
#chains in the Genus database with same CATH topology
 1WVN A;  2CTL A;  2FFM A;  2ZM6 H;  1IBL H;  1K1G A;  3UOE A;  2DGR A;  1FKA H;  1KHM A;  1J4W A;  4X66 H;  4NXN H;  1HNX H;  4JV5 H;  2JEA I;  1X4M A;  3T1Y H;  3KDK A;  4JI8 H;  4JI6 H;  2UUA H;  5IT9 W;  1F0X A;  4OCH A;  2UXB H;  2AXY A;  4EC5 A;  2VQE H;  2HHH H;  3QD7 X;  4B3R H;  4KHP H;  4DV2 H;  4X62 H;  3AEV B;  4BA1 I;  4LF9 H;  4H8A A;  4IFD G;  1J5E H;  2UU9 H;  3J81 W;  4OD6 A;  2K1H A;  3V69 A;  4AQY H;  1J5K A;  4DR4 H;  1UG8 A;  4YHH H;  1V9N A;  5FLX W;  2BA0 A;  2JEB I;  5LMN H;  5DT9 A;  2ANR A;  4G08 A;  2VKC A;  1ZZJ A;  4LIJ A;  2CPQ A;  1VIH A;  4DR5 H;  2UXC H;  2M8W A;  2VQF H;  4JI5 H;  3FAU A;  2OPV A;  2LRR A;  1NXU A;  3RF2 A;  1TUA A;  2JVZ A;  4X64 H;  2ZQE A;  4DR1 H;  2JA9 A;  4JVY A;  1XRH A;  2HH3 A;  2M6Q A;  5JEA G;  2CPM A;  4DV0 H;  2CTE A;  1HR0 H;  4LF6 H;  2D9I A;  4LFB H;  1EC6 A;  1AN7 A;  2HH2 A;  2OPU A;  2BL5 A;  1XNQ H;  4OX9 H;  1ODH A;  4DV7 H;  4AIM A;  4DV1 H;  1WTJ A;  3I0P A;  2A1S A;  4DR7 H;  1Z2I A;  5K36 G;  4DV3 H;  2Z0S A;  1S20 A;  4JYA H;  4FJS A;  4GKK H;  2PY9 A;  5IWA H;  1HNZ H;  3GR5 A;  2G8Y A;  3U1K A;  4DUY H;  3SB1 A;  1VBI A;  4B8T A;  4DR6 H;  2CTK A;  4NZR M;  4DR2 H;  2LTM A;  5A2Q W;  4LF5 H;  4JVH A;  1XNR H;  2UXD H;  1VIG A;  4JI2 H;  4JI0 H;  1N34 H;  3OTO H;  1X9Z A;  4NBQ A;  4K0K H;  4B3S H;  2UUC H;  1S03 G;  2CTF A;  3EZJ A;  1DTJ A;  4B8C D;  4OO1 G;  1N33 H;  2QND A;  3OSS D;  4JI1 H;  5BR8 H;  1PQX A;  4DV4 H;  5LL6 b;  3L7Z C;  3NCV A;  2CTJ A;  2JE6 I;  2Y3M A;  1ZZI A;  4B3T H;  1MSZ A;  1ZZK A;  4E9J A;  1WE8 A;  5C0X G;  4DUZ H;  4JI3 H;  2CTM A;  2CWH A;  1HNW H;  4DV5 H;  4LF8 H;  4LF7 H;  4FJU A;  1I94 H;  4WAN A;  2NN6 G;  2FMR A;  2PT7 G;  1X4N A;  2E5L H;  3GKU A;  2ANN A;  4BA2 I;  1X0A A;  4QMF B;  4GKJ H;  2F4V H;  4B3M H;  4DV6 H;  2UUB H;  2MJH A;  3J7A K;  4NZT M;  2PQU A;  2E3U A;  2LTL A;  2O4C A;  4YY3 H;  4WAL A;  4X65 H;  3VKE A;  1IBK H;  3GAB A;  1I6U A;  1SEI A;  2CWF A;  3KDG A;  3T1H H;  1FJG H;  3OET A;  1ZTG A;  4AM3 A;  4JI7 H;  2P2R A;  1DT4 A;  1V8C A;  5LMU H;  4LFA H;  2LF0 A;  4LF4 H;  3J80 W;  4JI4 H;  1IBM H;  2JZX A;  2YQR A;  1XMQ H;  4DR3 H;  1N36 H;  2FPH X;  3JAM W;  2X06 A;  4PDB A;  4NXM H;  4LFC H;  1WHR A;  1XMO H;  1N32 H; 
#chains in the Genus database with same CATH homology
 2A1S A;  2LRR A;  1MSZ A;  1WHR A;  2CPM A;  3GKU A;  1UG8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...