2LRRA

Solution structure of the r3h domain from human smubp-2 in complex with 2'-deoxyguanosine-5'-monophosphate
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
70
structure length
70
Chain Sequence
PEGVESQDGVDHFRAMIVEFMASKKMQLEFPPSLNSHDRLRVHQIAEEHGLRHDSSGEGKRRFITVSKRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords DNA-binding protein SMUBP-2
publication title Structural Basis for 5'-End-Specific Recognition of Single-Stranded DNA by the R3H Domain from Human Smubp-2
pubmed doi rcsb
source organism Homo sapiens
total genus 20
structure length 70
sequence length 70
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2012-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01424 R3H R3H domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.50 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 R3H-like domain 2lrrA00
2CPMA 3GKUA 1MSZA 2LRRA 1WHRA 1UG8A 2A1SA
chains in the Genus database with same CATH superfamily
2PY9A 2ZM6H 2UUCH 1KHMA 1X0AA 4PDBA 1XNQH 1N33H 1WVNA 3EZJA 2ZQEA 1HNZH 1N32H 3KDKA 2CTMA 2YQRA 2UXBH 4OO1G 4GKJH 3AEVB 1WTJA 4JYAH 4QMFB 3L7ZC 2Y3MA 2M6QA 2CTLA 4LF6H 2ANNA 2O4CA 1IBMH 3T1HH 3I0PA 4JI8H 4X62H 4KHPH 1VIHA 4EC5A 2DGRA 5C0XG 1SEIA 1IBLH 2G8YA 1Z2IA 1WE8A 4JI5H 3VKEA 2VQFH 4LF5H 4DUYH 4AM3A 4DR6H 1FJGH 5K36G 4DV2H 1J5KA 3GABA 1XNRH 2Z0SA 5IT9W 2F4VH 2JE6I 1N34H 2M8WA 1FKAH 2UUBH 3J81W 3RF2A 1AN7A 5IWAH 4DV0H 3T1YH 5DT9A 2JEAI 5A2QW 5LMUH 2P2RA 2UXCH 4B8TA 4WALA 4E9JA 2JZXA 4OD6A 5LL6b 2LTMA 2PT7G 4JI4H 4BA2I 2JA9A 1XMOH 1J4WA 4B8CD 4DR5H 1X4MA 2CPMA 2HHHH 4JI7H 2LF0A 3UOEA 4DV7H 3OSSD 2OPVA 4B3SH 1VIGA 1X4NA 4LF9H 4YHHH 4BA1I 3OETA 2HH2A 2JEBI 4NZTM 2CTKA 5BR8H 2FFMA 1HNXH 2X06A 1TUAA 4OCHA 4JV5H 3GKUA 4X64H 1ZZJA 1XMQH 4B3TH 1WHRA 2BL5A 3NCVA 2CWFA 2FPHX 1V8CA 2VQEH 4LF7H 4DR7H 2A1SA 1S20A 4NZRM 4DV3H 4LF4H 1EC6A 4OX9H 1X9ZA 2LRRA 5LMNH 4JI1H 4DV5H 1V9NA 1IBKH 4DV4H 2E5LH 3FAUA 2PQUA 4JVHA 4NBQA 4B3RH 4JVYA 4FJSA 4LFCH 4JI2H 2HH3A 4LF8H 1VBIA 4DV6H 4DR3H 4DR1H 3KDGA 3J80W 2CPQA 2QNDA 4X66H 5JEAG 4JI6H 4NXMH 4LFBH 3JAMW 2MJHA 2CWHA 1K1GA 4DR4H 1XRHA 2FMRA 1PQXA 3GR5A 4G08A 2UU9H 1HNWH 1DTJA 4H8AA 1F0XA 2ANRA 4AQYH 2VKCA 2D9IA 4YY3H 2UXDH 2CTFA 1N36H 4FJUA 3SB1A 3QD7X 3U1KA 1NXUA 2CTEA 4LIJA 2BA0A 1ZZIA 2E3UA 4DUZH 4JI3H 1J5EH 4IFDG 4K0KH 4JI0H 2K1HA 1ZZKA 3V69A 2OPUA 4DV1H 4B3MH 1UG8A 4WANA 1ODHA 1S03G 2CTJA 1HR0H 4AIMA 2JVZA 2UUAH 1MSZA 4LFAH 1I94H 5FLXW 3OTOH 4DR2H 3J7AK 4GKKH 4X65H 2AXYA 1DT4A 2LTLA 1ZTGA 1I6UA 4NXNH 2NN6G
chains in the Genus database with same CATH topology
2CPMA 3GKUA 1MSZA 2LRRA 1WHRA 1UG8A 2A1SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CPM A;  3GKU A;  1MSZ A;  2LRR A;  1WHR A;  1UG8 A;  2A1S A; 
#chains in the Genus database with same CATH topology
 2PY9 A;  2ZM6 H;  2UUC H;  1KHM A;  1X0A A;  4PDB A;  1XNQ H;  1N33 H;  1WVN A;  3EZJ A;  2ZQE A;  1HNZ H;  1N32 H;  3KDK A;  2CTM A;  2YQR A;  2UXB H;  4OO1 G;  4GKJ H;  3AEV B;  1WTJ A;  4JYA H;  4QMF B;  3L7Z C;  2Y3M A;  2M6Q A;  2CTL A;  4LF6 H;  2ANN A;  2O4C A;  1IBM H;  3T1H H;  3I0P A;  4JI8 H;  4X62 H;  4KHP H;  1VIH A;  4EC5 A;  2DGR A;  5C0X G;  1SEI A;  1IBL H;  2G8Y A;  1Z2I A;  1WE8 A;  4JI5 H;  3VKE A;  2VQF H;  4LF5 H;  4DUY H;  4AM3 A;  4DR6 H;  1FJG H;  5K36 G;  4DV2 H;  1J5K A;  3GAB A;  1XNR H;  2Z0S A;  5IT9 W;  2F4V H;  2JE6 I;  1N34 H;  2M8W A;  1FKA H;  2UUB H;  3J81 W;  3RF2 A;  1AN7 A;  5IWA H;  4DV0 H;  3T1Y H;  5DT9 A;  2JEA I;  5A2Q W;  5LMU H;  2P2R A;  2UXC H;  4B8T A;  4WAL A;  4E9J A;  2JZX A;  4OD6 A;  5LL6 b;  2LTM A;  2PT7 G;  4JI4 H;  4BA2 I;  2JA9 A;  1XMO H;  1J4W A;  4B8C D;  4DR5 H;  1X4M A;  2CPM A;  2HHH H;  4JI7 H;  2LF0 A;  3UOE A;  4DV7 H;  3OSS D;  2OPV A;  4B3S H;  1VIG A;  1X4N A;  4LF9 H;  4YHH H;  4BA1 I;  3OET A;  2HH2 A;  2JEB I;  4NZT M;  2CTK A;  5BR8 H;  2FFM A;  1HNX H;  2X06 A;  1TUA A;  4OCH A;  4JV5 H;  3GKU A;  4X64 H;  1ZZJ A;  1XMQ H;  4B3T H;  1WHR A;  2BL5 A;  3NCV A;  2CWF A;  2FPH X;  1V8C A;  2VQE H;  4LF7 H;  4DR7 H;  2A1S A;  1S20 A;  4NZR M;  4DV3 H;  4LF4 H;  1EC6 A;  4OX9 H;  1X9Z A;  2LRR A;  5LMN H;  4JI1 H;  4DV5 H;  1V9N A;  1IBK H;  4DV4 H;  2E5L H;  3FAU A;  2PQU A;  4JVH A;  4NBQ A;  4B3R H;  4JVY A;  4FJS A;  4LFC H;  4JI2 H;  2HH3 A;  4LF8 H;  1VBI A;  4DV6 H;  4DR3 H;  4DR1 H;  3KDG A;  3J80 W;  2CPQ A;  2QND A;  4X66 H;  5JEA G;  4JI6 H;  4NXM H;  4LFB H;  3JAM W;  2MJH A;  2CWH A;  1K1G A;  4DR4 H;  1XRH A;  2FMR A;  1PQX A;  3GR5 A;  4G08 A;  2UU9 H;  1HNW H;  1DTJ A;  4H8A A;  1F0X A;  2ANR A;  4AQY H;  2VKC A;  2D9I A;  4YY3 H;  2UXD H;  2CTF A;  1N36 H;  4FJU A;  3SB1 A;  3QD7 X;  3U1K A;  1NXU A;  2CTE A;  4LIJ A;  2BA0 A;  1ZZI A;  2E3U A;  4DUZ H;  4JI3 H;  1J5E H;  4IFD G;  4K0K H;  4JI0 H;  2K1H A;  1ZZK A;  3V69 A;  2OPU A;  4DV1 H;  4B3M H;  1UG8 A;  4WAN A;  1ODH A;  1S03 G;  2CTJ A;  1HR0 H;  4AIM A;  2JVZ A;  2UUA H;  1MSZ A;  4LFA H;  1I94 H;  5FLX W;  3OTO H;  4DR2 H;  3J7A K;  4GKK H;  4X65 H;  2AXY A;  1DT4 A;  2LTL A;  1ZTG A;  1I6U A;  4NXN H;  2NN6 G; 
#chains in the Genus database with same CATH homology
 2CPM A;  3GKU A;  1MSZ A;  2LRR A;  1WHR A;  1UG8 A;  2A1S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...