2LRRA

Solution structure of the r3h domain from human smubp-2 in complex with 2'-deoxyguanosine-5'-monophosphate
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
70
structure length
70
Chain Sequence
b'PEGVESQDGVDHFRAMIVEFMASKKMQLEFPPSLNSHDRLRVHQIAEEHGLRHDSSGEGKRRFITVSKRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA-binding protein SMUBP-2
publication title Structural Basis for 5'-End-Specific Recognition of Single-Stranded DNA by the R3H Domain from Human Smubp-2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 20
structure length 70
sequence length 70
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2012-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01424 R3H R3H domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.50 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 R3H-like domain 2lrrA00
3GKUA 1UG8A 2LRRA 2A1SA 1MSZA 2CPMA 1WHRA
chains in the Genus database with same CATH superfamily
1DT4A 1J5KA 4JI7H 3NCVA 1S03G 2CWFA 2Y3MA 2OPUA 1Z2IA 4YHHH 1PQXA 1HNXH 2LTMA 2JEBI 2PQUA 3QD7X 4DV6H 1ZTGA 4WALA 4DR1H 4LF9H 2CTKA 2UUBH 2JZXA 2O4CA 4EC5A 4JI4H 4LF5H 2JEAI 1X4MA 4DV7H 4LFAH 4JI1H 5DT9A 1XNQH 2AXYA 1N33H 4JI8H 2BA0A 5LL6b 2PT7G 4JI0H 3OTOH 4DR7H 1HNWH 4NXMH 4JI5H 1ZZIA 4AM3A 2E5LH 5JEAG 1F0XA 1I94H 1N34H 4DV1H 1TUAA 4IFDG 4OD6A 3J81W 1FKAH 4G08A 2K1HA 4OO1G 2LF0A 2CTJA 2VQEH 2ZM6H 2CTLA 4DR5H 4NXNH 5IT9W 2NN6G 1IBKH 2DGRA 3I0PA 4LFCH 2VKCA 3OSSD 4DV3H 4LF6H 1UG8A 2FMRA 5FLXW 1KHMA 4H8AA 2X06A 3V69A 4JVYA 4LF8H 1XMQH 4DR4H 5LMUH 1V9NA 4OX9H 2UXDH 2D9IA 3J7AK 4LF7H 2FFMA 1XRHA 2BL5A 4AIMA 2G8YA 2HHHH 4JVHA 2UXCH 2F4VH 4X66H 1I6UA 1IBLH 2UXBH 1X0AA 2CTEA 2LRRA 4DR3H 1IBMH 4NZTM 2UU9H 3FAUA 1K1GA 3U1KA 4LIJA 1VIHA 3KDGA 3T1HH 4BA1I 4DV2H 4YY3H 1V8CA 4FJUA 3T1YH 1N32H 4NZRM 1S20A 2M6QA 5BR8H 1N36H 1HNZH 4DV0H 1ZZJA 1EC6A 4WANA 3UOEA 4B3TH 3L7ZC 4JI6H 4LF4H 1VBIA 3EZJA 4JV5H 4KHPH 4AQYH 3OETA 5K36G 1XMOH 2UUAH 4GKKH 2JE6I 5C0XG 4X62H 4JI3H 4JYAH 2A1SA 1X4NA 3KDKA 1HR0H 2MJHA 1MSZA 2YQRA 4GKJH 1FJGH 2JA9A 2JVZA 3VKEA 1J5EH 2Z0SA 3SB1A 2M8WA 2CTFA 1ZZKA 5A2QW 3J80W 4DUYH 1AN7A 1XNRH 4K0KH 4B8CD 4B8TA 2OPVA 1WTJA 2CPQA 4DV5H 4DR6H 4BA2I 1SEIA 1ODHA 2UUCH 4FJSA 4NBQA 4X64H 4DUZH 4OCHA 1DTJA 1X9ZA 2HH2A 2LTLA 5LMNH 1WHRA 4B3MH 4DV4H 4B3SH 4QMFB 2P2RA 2QNDA 4E9JA 2E3UA 4B3RH 2HH3A 2ZQEA 4LFBH 1WVNA 3JAMW 4PDBA 3GR5A 4JI2H 2CTMA 3GABA 3AEVB 1WE8A 5IWAH 1VIGA 3GKUA 2ANNA 2PY9A 2FPHX 1J4WA 2VQFH 2ANRA 4X65H 3RF2A 2CWHA 4DR2H 1NXUA 2CPMA
chains in the Genus database with same CATH topology
3GKUA 1UG8A 2LRRA 2A1SA 1MSZA 2CPMA 1WHRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GKU A;  1UG8 A;  2LRR A;  2A1S A;  1MSZ A;  2CPM A;  1WHR A; 
#chains in the Genus database with same CATH topology
 1DT4 A;  1J5K A;  4JI7 H;  3NCV A;  1S03 G;  2CWF A;  2Y3M A;  2OPU A;  1Z2I A;  4YHH H;  1PQX A;  1HNX H;  2LTM A;  2JEB I;  2PQU A;  3QD7 X;  4DV6 H;  1ZTG A;  4WAL A;  4DR1 H;  4LF9 H;  2CTK A;  2UUB H;  2JZX A;  2O4C A;  4EC5 A;  4JI4 H;  4LF5 H;  2JEA I;  1X4M A;  4DV7 H;  4LFA H;  4JI1 H;  5DT9 A;  1XNQ H;  2AXY A;  1N33 H;  4JI8 H;  2BA0 A;  5LL6 b;  2PT7 G;  4JI0 H;  3OTO H;  4DR7 H;  1HNW H;  4NXM H;  4JI5 H;  1ZZI A;  4AM3 A;  2E5L H;  5JEA G;  1F0X A;  1I94 H;  1N34 H;  4DV1 H;  1TUA A;  4IFD G;  4OD6 A;  3J81 W;  1FKA H;  4G08 A;  2K1H A;  4OO1 G;  2LF0 A;  2CTJ A;  2VQE H;  2ZM6 H;  2CTL A;  4DR5 H;  4NXN H;  5IT9 W;  2NN6 G;  1IBK H;  2DGR A;  3I0P A;  4LFC H;  2VKC A;  3OSS D;  4DV3 H;  4LF6 H;  1UG8 A;  2FMR A;  5FLX W;  1KHM A;  4H8A A;  2X06 A;  3V69 A;  4JVY A;  4LF8 H;  1XMQ H;  4DR4 H;  5LMU H;  1V9N A;  4OX9 H;  2UXD H;  2D9I A;  3J7A K;  4LF7 H;  2FFM A;  1XRH A;  2BL5 A;  4AIM A;  2G8Y A;  2HHH H;  4JVH A;  2UXC H;  2F4V H;  4X66 H;  1I6U A;  1IBL H;  2UXB H;  1X0A A;  2CTE A;  2LRR A;  4DR3 H;  1IBM H;  4NZT M;  2UU9 H;  3FAU A;  1K1G A;  3U1K A;  4LIJ A;  1VIH A;  3KDG A;  3T1H H;  4BA1 I;  4DV2 H;  4YY3 H;  1V8C A;  4FJU A;  3T1Y H;  1N32 H;  4NZR M;  1S20 A;  2M6Q A;  5BR8 H;  1N36 H;  1HNZ H;  4DV0 H;  1ZZJ A;  1EC6 A;  4WAN A;  3UOE A;  4B3T H;  3L7Z C;  4JI6 H;  4LF4 H;  1VBI A;  3EZJ A;  4JV5 H;  4KHP H;  4AQY H;  3OET A;  5K36 G;  1XMO H;  2UUA H;  4GKK H;  2JE6 I;  5C0X G;  4X62 H;  4JI3 H;  4JYA H;  2A1S A;  1X4N A;  3KDK A;  1HR0 H;  2MJH A;  1MSZ A;  2YQR A;  4GKJ H;  1FJG H;  2JA9 A;  2JVZ A;  3VKE A;  1J5E H;  2Z0S A;  3SB1 A;  2M8W A;  2CTF A;  1ZZK A;  5A2Q W;  3J80 W;  4DUY H;  1AN7 A;  1XNR H;  4K0K H;  4B8C D;  4B8T A;  2OPV A;  1WTJ A;  2CPQ A;  4DV5 H;  4DR6 H;  4BA2 I;  1SEI A;  1ODH A;  2UUC H;  4FJS A;  4NBQ A;  4X64 H;  4DUZ H;  4OCH A;  1DTJ A;  1X9Z A;  2HH2 A;  2LTL A;  5LMN H;  1WHR A;  4B3M H;  4DV4 H;  4B3S H;  4QMF B;  2P2R A;  2QND A;  4E9J A;  2E3U A;  4B3R H;  2HH3 A;  2ZQE A;  4LFB H;  1WVN A;  3JAM W;  4PDB A;  3GR5 A;  4JI2 H;  2CTM A;  3GAB A;  3AEV B;  1WE8 A;  5IWA H;  1VIG A;  3GKU A;  2ANN A;  2PY9 A;  2FPH X;  1J4W A;  2VQF H;  2ANR A;  4X65 H;  3RF2 A;  2CWH A;  4DR2 H;  1NXU A;  2CPM A; 
#chains in the Genus database with same CATH homology
 3GKU A;  1UG8 A;  2LRR A;  2A1S A;  1MSZ A;  2CPM A;  1WHR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...