2LRRA

Solution structure of the r3h domain from human smubp-2 in complex with 2'-deoxyguanosine-5'-monophosphate
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
70
structure length
70
Chain Sequence
PEGVESQDGVDHFRAMIVEFMASKKMQLEFPPSLNSHDRLRVHQIAEEHGLRHDSSGEGKRRFITVSKRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA-binding protein SMUBP-2
publication title Structural Basis for 5'-End-Specific Recognition of Single-Stranded DNA by the R3H Domain from Human Smubp-2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 20
structure length 70
sequence length 70
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2012-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01424 R3H R3H domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.50 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 R3H-like domain 2lrrA00
1WHRA 3GKUA 2A1SA 1MSZA 2LRRA 2CPMA 1UG8A
chains in the Genus database with same CATH superfamily
3I0PA 2CWHA 4DV4H 4GKJH 4AM3A 1VIHA 4LF6H 4LF8H 2X06A 3V69A 2O4CA 2D9IA 2CTMA 1F0XA 1V8CA 2LTMA 3T1HH 1XMQH 1MSZA 4FJSA 4DV3H 4DV6H 3RF2A 1X4NA 2P2RA 1TUAA 2LF0A 2VQFH 2NN6G 4B3MH 2JEBI 4DR3H 2UUCH 2ANNA 1HNWH 5A2QW 4YY3H 2A1SA 1FJGH 2CTFA 2PT7G 2CTEA 4NZTM 1VBIA 2UU9H 3QD7X 2CTLA 1N34H 4OX9H 2YQRA 1HNXH 2Y3MA 1ODHA 3GR5A 2CPMA 2DGRA 3J81W 4H8AA 5LMUH 4DV2H 4JI5H 2K1HA 4NZRM 4WANA 1Z2IA 4WALA 2BA0A 1K1GA 4FJUA 2ZM6H 1XNRH 2BL5A 2Z0SA 4LF4H 2PQUA 4DR6H 1X0AA 1ZZKA 4JI1H 4JI0H 4JI7H 4LFAH 4JVYA 4JVHA 1PQXA 3AEVB 4NXMH 4DV7H 1XMOH 2UXDH 1WTJA 3U1KA 2E5LH 2CTKA 4E9JA 1VIGA 3OETA 4LF9H 2OPUA 4EC5A 1HR0H 4DV1H 4DR4H 1KHMA 2JVZA 2MJHA 5LMNH 2ANRA 1NXUA 2VKCA 2E3UA 1FKAH 4LFBH 1DT4A 1ZTGA 3J7AK 4G08A 1S20A 4B8TA 5BR8H 4YHHH 3L7ZC 4OO1G 4JI2H 1J5EH 2UXBH 2JA9A 4B3TH 2UXCH 3GABA 2UUBH 5IWAH 1X9ZA 1DTJA 3NCVA 1UG8A 1AN7A 4B8CD 1IBMH 4DR7H 4JI3H 2JEAI 5C0XG 3KDGA 3J80W 1ZZIA 3JAMW 1ZZJA 4JYAH 1EC6A 4QMFB 2HH2A 2AXYA 4JI6H 4OD6A 3GKUA 1X4MA 2CWFA 4IFDG 5IT9W 2QNDA 2ZQEA 4DR1H 2CPQA 4LF5H 3EZJA 2JE6I 4BA1I 2M6QA 4DUYH 4NBQA 1N33H 4JV5H 1N36H 4LIJA 4DR5H 3T1YH 4DUZH 4LFCH 4K0KH 4AIMA 1J4WA 2LTLA 1HNZH 4X62H 4DV0H 1V9NA 4JI4H 3KDKA 5K36G 1J5KA 2OPVA 4DV5H 4KHPH 1WE8A 1XNQH 5FLXW 4BA2I 1S03G 2M8WA 4X65H 4B3RH 1I6UA 1N32H 2G8YA 4JI8H 4PDBA 5LL6b 5DT9A 2VQEH 5JEAG 4NXNH 4X64H 2FPHX 1WHRA 2F4VH 1I94H 3OSSD 4GKKH 2HH3A 2JZXA 2FFMA 4X66H 1XRHA 2LRRA 4LF7H 3VKEA 3FAUA 1SEIA 1IBLH 4B3SH 4OCHA 2UUAH 3OTOH 2CTJA 2FMRA 1WVNA 4DR2H 1IBKH 2PY9A 4AQYH 3SB1A 2HHHH 3UOEA
chains in the Genus database with same CATH topology
1WHRA 3GKUA 2A1SA 1MSZA 2LRRA 2CPMA 1UG8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WHR A;  3GKU A;  2A1S A;  1MSZ A;  2LRR A;  2CPM A;  1UG8 A; 
#chains in the Genus database with same CATH topology
 3I0P A;  2CWH A;  4DV4 H;  4GKJ H;  4AM3 A;  1VIH A;  4LF6 H;  4LF8 H;  2X06 A;  3V69 A;  2O4C A;  2D9I A;  2CTM A;  1F0X A;  1V8C A;  2LTM A;  3T1H H;  1XMQ H;  1MSZ A;  4FJS A;  4DV3 H;  4DV6 H;  3RF2 A;  1X4N A;  2P2R A;  1TUA A;  2LF0 A;  2VQF H;  2NN6 G;  4B3M H;  2JEB I;  4DR3 H;  2UUC H;  2ANN A;  1HNW H;  5A2Q W;  4YY3 H;  2A1S A;  1FJG H;  2CTF A;  2PT7 G;  2CTE A;  4NZT M;  1VBI A;  2UU9 H;  3QD7 X;  2CTL A;  1N34 H;  4OX9 H;  2YQR A;  1HNX H;  2Y3M A;  1ODH A;  3GR5 A;  2CPM A;  2DGR A;  3J81 W;  4H8A A;  5LMU H;  4DV2 H;  4JI5 H;  2K1H A;  4NZR M;  4WAN A;  1Z2I A;  4WAL A;  2BA0 A;  1K1G A;  4FJU A;  2ZM6 H;  1XNR H;  2BL5 A;  2Z0S A;  4LF4 H;  2PQU A;  4DR6 H;  1X0A A;  1ZZK A;  4JI1 H;  4JI0 H;  4JI7 H;  4LFA H;  4JVY A;  4JVH A;  1PQX A;  3AEV B;  4NXM H;  4DV7 H;  1XMO H;  2UXD H;  1WTJ A;  3U1K A;  2E5L H;  2CTK A;  4E9J A;  1VIG A;  3OET A;  4LF9 H;  2OPU A;  4EC5 A;  1HR0 H;  4DV1 H;  4DR4 H;  1KHM A;  2JVZ A;  2MJH A;  5LMN H;  2ANR A;  1NXU A;  2VKC A;  2E3U A;  1FKA H;  4LFB H;  1DT4 A;  1ZTG A;  3J7A K;  4G08 A;  1S20 A;  4B8T A;  5BR8 H;  4YHH H;  3L7Z C;  4OO1 G;  4JI2 H;  1J5E H;  2UXB H;  2JA9 A;  4B3T H;  2UXC H;  3GAB A;  2UUB H;  5IWA H;  1X9Z A;  1DTJ A;  3NCV A;  1UG8 A;  1AN7 A;  4B8C D;  1IBM H;  4DR7 H;  4JI3 H;  2JEA I;  5C0X G;  3KDG A;  3J80 W;  1ZZI A;  3JAM W;  1ZZJ A;  4JYA H;  1EC6 A;  4QMF B;  2HH2 A;  2AXY A;  4JI6 H;  4OD6 A;  3GKU A;  1X4M A;  2CWF A;  4IFD G;  5IT9 W;  2QND A;  2ZQE A;  4DR1 H;  2CPQ A;  4LF5 H;  3EZJ A;  2JE6 I;  4BA1 I;  2M6Q A;  4DUY H;  4NBQ A;  1N33 H;  4JV5 H;  1N36 H;  4LIJ A;  4DR5 H;  3T1Y H;  4DUZ H;  4LFC H;  4K0K H;  4AIM A;  1J4W A;  2LTL A;  1HNZ H;  4X62 H;  4DV0 H;  1V9N A;  4JI4 H;  3KDK A;  5K36 G;  1J5K A;  2OPV A;  4DV5 H;  4KHP H;  1WE8 A;  1XNQ H;  5FLX W;  4BA2 I;  1S03 G;  2M8W A;  4X65 H;  4B3R H;  1I6U A;  1N32 H;  2G8Y A;  4JI8 H;  4PDB A;  5LL6 b;  5DT9 A;  2VQE H;  5JEA G;  4NXN H;  4X64 H;  2FPH X;  1WHR A;  2F4V H;  1I94 H;  3OSS D;  4GKK H;  2HH3 A;  2JZX A;  2FFM A;  4X66 H;  1XRH A;  2LRR A;  4LF7 H;  3VKE A;  3FAU A;  1SEI A;  1IBL H;  4B3S H;  4OCH A;  2UUA H;  3OTO H;  2CTJ A;  2FMR A;  1WVN A;  4DR2 H;  1IBK H;  2PY9 A;  4AQY H;  3SB1 A;  2HHH H;  3UOE A; 
#chains in the Genus database with same CATH homology
 1WHR A;  3GKU A;  2A1S A;  1MSZ A;  2LRR A;  2CPM A;  1UG8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...