1TUAA

1.5 a crystal structure of a protein of unknown function ape0754 from aeropyrum pernix
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
189
structure length
189
Chain Sequence
AMKPRIYVKVKPERLGAVIGPRGEVKAEIMRRTGTVITVDTENSMVIVEPEAEGIPPVNLMKAAEVVKAISLGFPPEKAFRLLEEDQILVVVDLKQVVGDSQNHLKRIKGRIIGEGGRARRTIEEMTDTYINVGEYEVAIIGDYERAMAAKQAIEMLAEGRMHSTVYRHLERIMREIKRRERLKMWARE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein APE0754
publication title 1.5A crystal structure of a hypothetical protein APE0754 from Aeropyrum pernix
rcsb
source organism Aeropyrum pernix
molecule tags Structural genomics, unknown function
total genus 66
structure length 189
sequence length 189
ec nomenclature
pdb deposition date 2004-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 1tuaA01
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 1tuaA02
2DGRA 1X4NA 2AXYA 2PQUA 2Z0SA 2QNDA 4LIJA 4JVHA 3VKEA 2FMRA 2NN6G 4AIMA 4BA1I 1KHMA 4WALA 4B8TA 1K1GA 2JZXA 1X4MA 1ZZIA 2JEAI 4JVYA 1VIGA 2CPQA 2CTFA 4AM3A 2OPUA 1J5KA 1DT4A 2JEBI 1VIHA 2BL5A 4OO1G 4IFDG 2HH2A 3U1KA 3AEVB 4WANA 1WVNA 2E3UA 4NBQA 2P2RA 5K36G 2JE6I 1DTJA 1J4WA 2HH3A 2ANNA 2BA0A 2CTJA 2CTLA 1ZTGA 2JVZA 2MJHA 4BA2I 2JA9A 5C0XG 3V69A 2PY9A 1TUAA 1ZZKA 2CTMA 2CTEA 2ANRA 2YQRA 2CTKA 1WE8A 3L7ZC 1EC6A 5JEAG 1ZZJA 2OPVA 4QMFB
chains in the Genus database with same CATH superfamily
2PQUA 1NXUA 4JVHA 2Z0SA 1MSZA 3UOEA 1HR0H 1SEIA 2UU9H 2ZQEA 4WALA 4NZTM 2M8WA 4DR3H 1K1GA 4OCHA 4JYAH 1AN7A 4LF5H 2UUAH 3OETA 2OPUA 1V8CA 4DUZH 4JI0H 4B3MH 4K0KH 3T1HH 2X06A 1IBMH 3OSSD 4FJSA 4DR2H 2UUBH 4OO1G 3U1KA 4YHHH 4JI4H 4DR7H 3FAUA 2D9IA 1DTJA 2F4VH 3I0PA 2A1SA 3OTOH 4DV6H 1WHRA 2CTLA 1XNQH 4LFCH 4OX9H 1I94H 2E5LH 1XRHA 2CTEA 2YQRA 4H8AA 1EC6A 2MJHA 4LF8H 2LTMA 2DGRA 2O4CA 3GABA 1J5EH 2QNDA 2FFMA 2FMRA 4DUYH 1VBIA 1PQXA 4NZRM 4BA1I 5FLXW 2UXBH 1KHMA 2CWFA 1F0XA 4X66H 3J81W 3NCVA 3KDKA 4JI5H 5DT9A 2K1HA 2JEAI 1X0AA 2LF0A 1VIGA 3QD7X 4YY3H 4DV0H 1ODHA 1J5KA 5A2QW 3EZJA 5LL6b 3AEVB 2M6QA 4WANA 2E3UA 3J80W 3JAMW 4X65H 4JI7H 2ANNA 4GKJH 2CTJA 3GR5A 4LF7H 2PT7G 1XNRH 1ZTGA 4B3SH 4B3RH 4JI3H 2PY9A 1TUAA 2ANRA 4FJUA 2CTKA 3L7ZC 1WTJA 1V9NA 2OPVA 2AXYA 1X4NA 4X64H 4LIJA 4G08A 4AIMA 1S03G 4DV1H 1N32H 4PDBA 1X4MA 3KDGA 1UG8A 5LMUH 1ZZIA 1N36H 2UUCH 4LF9H 2CPMA 4OD6A 1Z2IA 4NXMH 2CPQA 2CTFA 4DV7H 4JI2H 4DV4H 4AM3A 4AQYH 1IBLH 4JI8H 5IT9W 5IWAH 1XMOH 2HHHH 2HH2A 1X9ZA 4IFDG 2Y3MA 4B3TH 2P2RA 2VQFH 1J4WA 4KHPH 4GKKH 4DR5H 4B8CD 2JVZA 4LFBH 2LRRA 4LF6H 4JI1H 3J7AK 2LTLA 1ZZKA 4LFAH 5LMNH 1HNZH 1WE8A 4E9JA 2VKCA 4DR4H 3GKUA 1XMQH 4QMFB 2G8YA 4DR6H 1FJGH 3VKEA 2NN6G 1HNXH 2FPHX 4B8TA 2JZXA 4JI6H 4DR1H 1FKAH 2UXDH 3SB1A 1HNWH 1S20A 3RF2A 2ZM6H 2CWHA 4NXNH 4JVYA 1DT4A 2JEBI 1VIHA 2BL5A 2UXCH 5BR8H 3T1YH 1N33H 2VQEH 1WVNA 4NBQA 1I6UA 5K36G 2JE6I 2HH3A 4EC5A 2BA0A 4DV3H 4JV5H 4BA2I 1N34H 4LF4H 2JA9A 5C0XG 1IBKH 4DV5H 4DV2H 2CTMA 4X62H 5JEAG 1ZZJA 3V69A
chains in the Genus database with same CATH topology
2DGRA 1X4NA 2AXYA 2PQUA 2Z0SA 2QNDA 4LIJA 4JVHA 3VKEA 2FMRA 2NN6G 4AIMA 4BA1I 1KHMA 4WALA 4B8TA 1K1GA 2JZXA 1X4MA 1ZZIA 2JEAI 4JVYA 1VIGA 2CPQA 2CTFA 4AM3A 2OPUA 1J5KA 1DT4A 2JEBI 1VIHA 2BL5A 4OO1G 4IFDG 2HH2A 3U1KA 3AEVB 4WANA 1WVNA 2E3UA 4NBQA 2P2RA 5K36G 2JE6I 1DTJA 1J4WA 2HH3A 2ANNA 2BA0A 2CTJA 2CTLA 1ZTGA 2JVZA 2MJHA 4BA2I 2JA9A 5C0XG 3V69A 2PY9A 1TUAA 1ZZKA 2CTMA 2CTEA 2ANRA 2YQRA 2CTKA 1WE8A 3L7ZC 1EC6A 5JEAG 1ZZJA 2OPVA 4QMFB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DGR A;  1X4N A;  2AXY A;  2PQU A;  2Z0S A;  2QND A;  4LIJ A;  4JVH A;  3VKE A;  2FMR A;  2NN6 G;  4AIM A;  4BA1 I;  1KHM A;  4WAL A;  4B8T A;  1K1G A;  2JZX A;  1X4M A;  1ZZI A;  2JEA I;  4JVY A;  1VIG A;  2CPQ A;  2CTF A;  4AM3 A;  2OPU A;  1J5K A;  1DT4 A;  2JEB I;  1VIH A;  2BL5 A;  4OO1 G;  4IFD G;  2HH2 A;  3U1K A;  3AEV B;  4WAN A;  1WVN A;  2E3U A;  4NBQ A;  2P2R A;  5K36 G;  2JE6 I;  1DTJ A;  1J4W A;  2HH3 A;  2ANN A;  2BA0 A;  2CTJ A;  2CTL A;  1ZTG A;  2JVZ A;  2MJH A;  4BA2 I;  2JA9 A;  5C0X G;  3V69 A;  2PY9 A;  1TUA A;  1ZZK A;  2CTM A;  2CTE A;  2ANR A;  2YQR A;  2CTK A;  1WE8 A;  3L7Z C;  1EC6 A;  5JEA G;  1ZZJ A;  2OPV A;  4QMF B; 
#chains in the Genus database with same CATH topology
 2PQU A;  1NXU A;  4JVH A;  2Z0S A;  1MSZ A;  3UOE A;  1HR0 H;  1SEI A;  2UU9 H;  2ZQE A;  4WAL A;  4NZT M;  2M8W A;  4DR3 H;  1K1G A;  4OCH A;  4JYA H;  1AN7 A;  4LF5 H;  2UUA H;  3OET A;  2OPU A;  1V8C A;  4DUZ H;  4JI0 H;  4B3M H;  4K0K H;  3T1H H;  2X06 A;  1IBM H;  3OSS D;  4FJS A;  4DR2 H;  2UUB H;  4OO1 G;  3U1K A;  4YHH H;  4JI4 H;  4DR7 H;  3FAU A;  2D9I A;  1DTJ A;  2F4V H;  3I0P A;  2A1S A;  3OTO H;  4DV6 H;  1WHR A;  2CTL A;  1XNQ H;  4LFC H;  4OX9 H;  1I94 H;  2E5L H;  1XRH A;  2CTE A;  2YQR A;  4H8A A;  1EC6 A;  2MJH A;  4LF8 H;  2LTM A;  2DGR A;  2O4C A;  3GAB A;  1J5E H;  2QND A;  2FFM A;  2FMR A;  4DUY H;  1VBI A;  1PQX A;  4NZR M;  4BA1 I;  5FLX W;  2UXB H;  1KHM A;  2CWF A;  1F0X A;  4X66 H;  3J81 W;  3NCV A;  3KDK A;  4JI5 H;  5DT9 A;  2K1H A;  2JEA I;  1X0A A;  2LF0 A;  1VIG A;  3QD7 X;  4YY3 H;  4DV0 H;  1ODH A;  1J5K A;  5A2Q W;  3EZJ A;  5LL6 b;  3AEV B;  2M6Q A;  4WAN A;  2E3U A;  3J80 W;  3JAM W;  4X65 H;  4JI7 H;  2ANN A;  4GKJ H;  2CTJ A;  3GR5 A;  4LF7 H;  2PT7 G;  1XNR H;  1ZTG A;  4B3S H;  4B3R H;  4JI3 H;  2PY9 A;  1TUA A;  2ANR A;  4FJU A;  2CTK A;  3L7Z C;  1WTJ A;  1V9N A;  2OPV A;  2AXY A;  1X4N A;  4X64 H;  4LIJ A;  4G08 A;  4AIM A;  1S03 G;  4DV1 H;  1N32 H;  4PDB A;  1X4M A;  3KDG A;  1UG8 A;  5LMU H;  1ZZI A;  1N36 H;  2UUC H;  4LF9 H;  2CPM A;  4OD6 A;  1Z2I A;  4NXM H;  2CPQ A;  2CTF A;  4DV7 H;  4JI2 H;  4DV4 H;  4AM3 A;  4AQY H;  1IBL H;  4JI8 H;  5IT9 W;  5IWA H;  1XMO H;  2HHH H;  2HH2 A;  1X9Z A;  4IFD G;  2Y3M A;  4B3T H;  2P2R A;  2VQF H;  1J4W A;  4KHP H;  4GKK H;  4DR5 H;  4B8C D;  2JVZ A;  4LFB H;  2LRR A;  4LF6 H;  4JI1 H;  3J7A K;  2LTL A;  1ZZK A;  4LFA H;  5LMN H;  1HNZ H;  1WE8 A;  4E9J A;  2VKC A;  4DR4 H;  3GKU A;  1XMQ H;  4QMF B;  2G8Y A;  4DR6 H;  1FJG H;  3VKE A;  2NN6 G;  1HNX H;  2FPH X;  4B8T A;  2JZX A;  4JI6 H;  4DR1 H;  1FKA H;  2UXD H;  3SB1 A;  1HNW H;  1S20 A;  3RF2 A;  2ZM6 H;  2CWH A;  4NXN H;  4JVY A;  1DT4 A;  2JEB I;  1VIH A;  2BL5 A;  2UXC H;  5BR8 H;  3T1Y H;  1N33 H;  2VQE H;  1WVN A;  4NBQ A;  1I6U A;  5K36 G;  2JE6 I;  2HH3 A;  4EC5 A;  2BA0 A;  4DV3 H;  4JV5 H;  4BA2 I;  1N34 H;  4LF4 H;  2JA9 A;  5C0X G;  1IBK H;  4DV5 H;  4DV2 H;  2CTM A;  4X62 H;  5JEA G;  1ZZJ A;  3V69 A; 
#chains in the Genus database with same CATH homology
 2DGR A;  1X4N A;  2AXY A;  2PQU A;  2Z0S A;  2QND A;  4LIJ A;  4JVH A;  3VKE A;  2FMR A;  2NN6 G;  4AIM A;  4BA1 I;  1KHM A;  4WAL A;  4B8T A;  1K1G A;  2JZX A;  1X4M A;  1ZZI A;  2JEA I;  4JVY A;  1VIG A;  2CPQ A;  2CTF A;  4AM3 A;  2OPU A;  1J5K A;  1DT4 A;  2JEB I;  1VIH A;  2BL5 A;  4OO1 G;  4IFD G;  2HH2 A;  3U1K A;  3AEV B;  4WAN A;  1WVN A;  2E3U A;  4NBQ A;  2P2R A;  5K36 G;  2JE6 I;  1DTJ A;  1J4W A;  2HH3 A;  2ANN A;  2BA0 A;  2CTJ A;  2CTL A;  1ZTG A;  2JVZ A;  2MJH A;  4BA2 I;  2JA9 A;  5C0X G;  3V69 A;  2PY9 A;  1TUA A;  1ZZK A;  2CTM A;  2CTE A;  2ANR A;  2YQR A;  2CTK A;  1WE8 A;  3L7Z C;  1EC6 A;  5JEA G;  1ZZJ A;  2OPV A;  4QMF B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...