4PDBA

Crystal structure of bacillus anthracis ribosomal protein s8 in complex with an rna aptamer
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
129
structure length
129
Chain Sequence
b'TDPIADMLTRIRNANMVRHEKLEVPASKIKKEIAELLKREGFIRDVEYIEDNKQGILRIFLKYGANNERVITGLKRISKPGLRVYAKADEVPRVLNGLGIALVSTSKGVMTDKDARQLQTGGEVVAYVW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 30S ribosomal protein S8
molecule tags Ribosomal protein/rna
source organism Bacillus anthracis
publication title Structure analysis of free and bound states of an RNA aptamer against ribosomal protein S8 from Bacillus anthracis.
pubmed doi rcsb
total genus 33
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2014-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00410 Ribosomal_S8 Ribosomal protein S8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.30 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 4pdbA01
3.30.1490.10 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4pdbA02
4B3SH 4DR3H 2UXDH 5BR8H 4DV3H 4GKKH 4K0KH 4JI3H 1XNQH 5IT9W 1IBKH 4LF7H 2HHHH 1FKAH 5LMUH 4LF6H 4LFAH 4X65H 4LF9H 4NXMH 5FLXW 2UXBH 4DR4H 4DUYH 4JI4H 4DR5H 4JI5H 4JYAH 4DV7H 2UUCH 1AN7A 3T1YH 4GKJH 2UXCH 2VQFH 1IBMH 4DUZH 4B3MH 4DR6H 4YY3H 1N34H 1I94H 4JI0H 4X62H 4DR2H 2VQEH 4DV4H 4OX9H 4X64H 1N33H 1XMOH 4JI7H 2UUAH 4DV2H 1XMQH 1HR0H 4KHPH 1N32H 4LF5H 1HNZH 4LFBH 4B3TH 3J80W 5A2QW 1HNWH 4AQYH 2E5LH 2UUBH 4X66H 4DV0H 2F4VH 1HNXH 3RF2A 4DV5H 1S03G 4LF8H 4DV6H 5IWAH 1IBLH 5LMNH 1J5EH 4JI6H 3OTOH 4YHHH 4B3RH 3J81W 4NXNH 1XNRH 4DR1H 1FJGH 4LF4H 5LL6b 4DV1H 3JAMW 3J7AK 4JV5H 4JI2H 1SEIA 4DR7H 4JI8H 3T1HH 4JI1H 4LFCH 1I6UA 4PDBA 2ZM6H 1N36H 2UU9H
chains in the Genus database with same CATH superfamily
4Q43A 5EZYF 4IWXA 5DT9A 4B3SH 1PX2A 3R5FA 2HH3A 2LTMA 4HNVA 1PK8A 4JVYA 3GILA 2CPQA 1A0IA 2NU6B 2RDJA 1X9NA 3Q8SB 4BBSG 4E9JA 3MWEA 3RGXA 2R8JA 2JEBI 1KEEA 3KXYT 3GTKA 2JA9A 4FJUA 2WB1E 5BMVF 3OSPA 3VPDA 3VMMA 3HKZE 4ZOLF 4Q0YA 3IG0A 2FB9A 3N6XA 2CTFA 2V58A 4Q8FA 4H8AA 4G08A 4LIJA 1TWCA 2R7ZA 4X65H 5KFYA 2R93A 4EYIB 1AUXA 4ZI7F 3MR6A 3PZPA 1FVIA 2WAQA 1JKJB 4IRKA 4DUYH 4O3OA 5IP7G 4ZHQF 1WCMA 5D1OB 4RZRA 4JI4H 1RJRA 5EWGA 3GQCA 4JI5H 2VOBA 1EC6A 2A1SA 4ECQA 2XGQA 5KX5F 2VA2A 3T1YH 5K2MA 3GIIA 4GKJH 4ED8A 3V6JA 2UXCH 1KJ9A 2PT7G 4EEYA 2O4CA 4E4TA 2YU9A 2DGRA 4B3MH 5CB4F 1GO3E 4YY3H 1N34H 4O2BF 5KFJA 1V51A 3G6VA 5DG9A 1EYZA 4WANA 4JI0H 4A93G 2QNDA 2KSWA 1S0OA 1CE8A 4DR2H 1JLLB 1VBHA 5KFDA 5L1KA 4ED6A 2YZNA 4A2BA 3U9SA 2FMRA 2YCHA 5KFMA 5KFLA 3R23A 5IYDG 2W6PA 2WB1A 1N33H 2W70A 4JV0A 2WDTA 4BWSC 3HOXG 3GABA 3OETA 4DV2H 1N32H 5KFOA 4RNNA 5DG7A 1VS0A 4YJ2F 4QW8A 1HNZH 4ED2A 4HNUA 4ED1A 4IZOA 3RBEA 1X4MA 4HNTA 2E2IA 2VKCA 4A3BG 1M0WA 2R82A 2XD4A 1V9NA 4J9SA 3T5HA 1J5KA 3H40A 4Y8VB 4JVHA 4QIWE 4RU9A 2XGPA 5KT3A 5C44G 4ECVA 5GONF 4X66H 2W57A 4DV0H 4YB8B 4NZRM 1UC9A 4FU0A 5L9XA 1EHIA 3EPGA 1TWAA 4RZQA 2R84A 5KFCA 5IYBG 3H3VH 4DV6H 2JEGA 4CC5A 2E3UA 5FJ8G 3PVXA 4UCSA 4O3SA 2X06A 1B6RA 3KAJA 3IN5A 4AYBE 1VBGA 1Z2PX 1KJJA 2YL2A 3RTXA 4A3GG 3OTOH 1CQJB 2Y3MA 3BG5A 4GLXA 5FPOA 1E4GT 3J81W 1T94A 5HV6A 5LOVF 1TUAA 3I4NG 2UVVA 2Z0SA 3BQ0A 4DV1H 1A9XA 3ETHA 5KT2A 4IHJF 4RB1A 4XZ3B 1EZ1A 4NBQA 4RAZA 3GIKA 4JV5H 3L4KA 2I80A 1WE8A 2NUAB 4TQRA 4Q8EA 4O4IF 4ECRA 5K36G 3M9NB 3WNZA 1ZHSA 2C2RA 2Q2TA 2IA6A 4JV1A 4XYMB 4J9KA 3RAQA 3OSSD 3KHHA 3H4BA 2CKZB 2YS7A 3HXLA 5KFKA 2W8LA 4PDBA 1S10A 3BABA 2XCAA 1S68A 2UU9H 2I8CA 4QJFA 4ETSA 2CW7A 2GPWA 3PW0A 5JVLA 2B63G 5KG0A 3Q2OA 2W6OA 3JRWA 2UXDH 4IR1A 3LMLA 3GLKA 5KFTA 4LSXA 1TWHA 2PY9A 2FPIB 3PR4A 4ED0A 3SI8A 2HVQA 1DIKA 1XNQH 3OUUA 4O3QA 5IT9W 4YAKB 4OO1G 5DGAA 3DF7A 3KHLA 4F4ZA 5JEAG 4YR3A 1DT4A 2V4QA 2ATLA 4EC5A 2ANRA 3U9TA 3V69A 1S0MA 3WO0A 1UNNC 2CZGA 2WYOA 3N44B 4RAYA 3N42B 1WHRA 4YR0A 4A3IG 1WSCA 1N56A 5KFSA 2FLPA 2ASLA 5KG5A 1I50A 5FLXW 3N43B 1PQXA 2DIKA 4IAJA 2J6SA 4MV7A 3H4DA 1VIHA 1X9ZA 3R5XA 4YBZB 3EYYA 1KJIA 1W93A 3GTOA 1M7JA 3MFIA 4JYAH 2VUMA 2PN1A 4LSAA 1J4WA 2UUCH 2PBZA 3KDKA 3G6YA 4BY7G 4MA0A 3PW7A 3GV7B 2OPUA 2AXYA 4AIMA 4UCTA 2NU7B 1TWFA 2G8YA 2OLSA 1I94H 5LA6F 1O75A 2PMZA 4C5AA 3H0GA 2C28A 2R92G 3NCVA 4EFEA 2P2RA 4QMFB 2J6TA 3Q8PB 4JV2A 2VQEH 3I0PA 3FKIA 2CPMA 4EEQA 3MR3A 5C0XG 4DL6A 3HOVG 2R7ZG 2R93G 2R7KA 2ALZA 2XCPA 4RB3C 4YJ3F 4EBCA 2FLNA 4BXXG 4JI7H 3JSNA 3R5HA 1ZETA 1HR0H 1XMQH 2HJWA 4UCRA 4MV6A 5D8DA 4C2MA 4Q45A 5L1LA 4MTEA 3LP8A 4MV1A 4LFBH 4J9RA 2CQYA 3RBDA 3J80W 1BJTA 3JRXA 2J9GA 1K1QA 4EBEA 1KBLA 4A3JG 2JA6A 4J0MA 4O3PA 1ZZIA 1DGSA 2YS6A 3Q8QB 3BJYA 4F4XA 1GGOA 1DTJA 3PN1A 2RGRA 4GC6A 4A3DG 4QWDA 1HNWH 4FM9A 5JH7F 4AQYH 2PQUA 1S0NA 2D9IA 2SCUB 5KFPA 2F4VH 2YZMA 2B63A 1ZZJA 2VUGA 2DPJA 2RDIA 5KG7A 3PW2A 3RUPA 5C1PA 3RIZA 3HOWG 3KHGA 2WE6A 2YZGA 2NVYA 1NXUA 2R8GA 3RAXA 5KG1A 2VPQA 3KAKA 2CTMA 3LWBA 3VPBA 2J6UA 3GV8B 2R7LA 3GIJA 2FMAA 5IP9G 1T36A 1WCMG 4I4TF 1M6VA 3N8DA 4QWBA 1JXLA 4B3RH 3G8CA 4DR1H 1Y14B 5C4XG 4J9QA 2Y0SE 3GKUA 4LF4H 3RV3A 1B33N 1Z2NX 2R7NA 5KFXA 5EDWA 1AUVA 5L1IA 4YAJB 5L1JA 4J9LA 2R8IA 3AYHB 4JI2H 4IFDG 3C0FB 1SEIA 3MWMA 1KC7A 4JI1H 1I6UA 5KFVA 3V4ZA 1I3QA 3M9OB 4C5CA 5F9NA 3V6KA 5IYZF 2HVSA 4QWAA 2FPHX 2ZM6H 2WTFA 4O4HF 2ASDA 1Y1WG 2FP4B 2AGPA 3N40P 2NN6G 5CA1F 5DGBA 4DR3H 3M9MB 3FKIG 3HOYG 5BR8H 5J2UF 3RB0A 1X4NA 2FK3A 3GIQA 4JUZA 3EPIA 4DL7A 4GKKH 4DL5A 1BXRA 5KFWA 3EZJA 4EGJA 1IBKH 4UCOA 4QW9A 3QZ8A 4ECSA 3ETJA 4GC7A 3HKZA 4A3EG 5LMUH 4A2AA 3G6XA 4LF6H 2JA7A 1SCUB 2DPIA 4EGQA 2JEIA 1I7NA 2BQUA 2JVZA 3PR5B 4NXMH 2UXBH 4R8UB 1R9TA 2CW8A 2LTLA 2GLTA 5DLFA 5KG4A 1Z2OX 2M05A 5KT4A 3RGZA 1Y1VG 2W6NA 5JQWA 1VIGA 3F8NA 2IBKA 2Q2UA 5FD6A 3L7ZC 1MSZA 3QD7X 2MCTA 4DV7H 4APMA 3JSLA 4ECXA 2BL5A 2FKLA 4ED7A 5KFRA 1ULZA 3RFCA 3RB6A 1TA8A 2FPPB 2O03A 3KALA 2VQFH 2W6QA 3BA8A 5KT6A 4ECUA 2IMWP 4DUZH 4IR9A 4DR6H 2WAQE 5DQHA 2AGQA 4QIWA 4LMYA 2LRRA 1IOWA 5KFZA 4EFBA 2X0SA 3MR2A 2I87A 2V5AA 4XYLB 2FLLA 2CTJA 2PMZE 4X62H 4WD3A 4B8CD 4CC6A 2V4RA 5C3EG 2NVXA 4OD6A 3RV4A 4EBDA 3BQ2A 1DV2A 1WR2A 3BA9A 4MAMA 1UG8A 2P0AA 3OSNA 1XMOH 2UUAH 3KHRA 2VA3A 4LF5H 4IRCA 5EOYA 3T5JA 4ECYA 2VUMG 4NZTM 4B3TH 5CAEB 2MJHA 1KJQA 3FMAA 4YP3A 1T3NA 3WO1A 1C30A 5LYJF 3T5LA 2BQRA 1RJQA 4BA1I 2XIGA 3Q1KA 1X0AA 4PWQA 4UCVA 3TINA 4DL2A 5LXTF 5I47A 2HVRA 3HBLA 2FPGB 3MJFA 1RYSA 1E4FT 4ED3A 5F9LA 1HNXH 1TWGA 4QWCA 1VAJA 1ODHA 3PW4A 5HBRB 3RF2A 2HH2A 5KFGA 2JA5G 4WALA 3N41B 2R7MA 5JVDF 2R8KA 4LF8H 2W9BB 5KFUA 2R8HA 3GIPA 3GTLA 1GLVA 3SB1A 3MFHA 5KFBA 4HYKA 1IBLH 4BY1G 2JEFA 4FBTA 4TQSA 1ZHQA 1TAEA 5KT7A 4JI6H 3BQ1A 1WTJA 3Q8RB 1OWTA 5CA0F 2JA6G 5DQIA 2QK4A 2W7OA 4F4YA 1XNRH 3GTPA 2M8WA 1SYXB 2YQRA 5LL6b 3GTQA 4OCHA 5C5JA 5KG2A 3J7AK 3GR5A 3UQ8A 4MV8A 3GTGA 4DL4A 2OPVA 4BBRG 2E2HA 4A3KG 4TV8F 5KFFA 3QZ7A 4IRDA 1Y1WA 5D1PA 4JI8H 1S20A 3VPCA 5IYCG 1F0XA 4LFCH 1JDBB 1MZBA 4UFZA 4HQ6A 4ECWA 1E4EB 2W6ZA 2C35B 3T5KA 4NLGA 3HOZG 4C5BA 4FS2A 1BNCA 2C2DA 4IWYA 2W9AA 1N48A 2R92A 1N36H 4XX0B 3AEVB 3MWDA 1UC8A 4O3NA 2GPSA 1ZZKA 3ORQA 2FFMA 1I7LA 1JIHA 3GIDA 3RJ0A 5KT5A 2W8KA 5DQGA 2BQ3A 4FS1A 2UVRA 2JA8G 4BA2I 4DLKA 4A3LG 1VKZA 5KKNB 2JA7G 2ZQEA 3JZIA 2AU0A 3K5HA 5KFNA 2YRWA 4RUCA 2YYAA 4DV3H 4K0KH 5J2TF 3TIIA 5BPFA 1VBIA 4JI3H 1RK5A 4YQWA 4ME6A 5EWFA 3HOUG 1GSAA 3ORRA 4UCUA 2CWHA 2YRXA 3GV5B 4J9OA 2C2EA 1SFOA 4LF7H 2FE3A 3BAAA 2R86A 2RGVA 2V9WA 4O4LF 1M0TA 4QWEA 2HHHH 3H20A 1FKAH 4I7HA 2XC9A 1RYRA 2PVPA 1XRHA 5FPRA 5FLMG 4LFAH 3KTMA 3HB9A 4MA5A 1JDEA 1CQIB 1P8LA 4RNMA 2C00A 3PO2G 2UVUA 5FD5A 1ZQ7A 2QYZA 2VPSA 4LF9H 4YR2A 4A3FG 2Y0SA 3KDGA 3K3PA 2W7PA 1GSOA 4DR4H 2JE6I 4O2AF 2IP4A 2ZJTA 4TV9F 3V6HA 4WBNF 3RB3A 3GTMA 3GTJA 2M6QA 3TIGA 4DR5H 4M9UA 2W9BA 4RUAA 3MR5A 5T14A 2VR1A 4I50F 4RB2C 1K83A 1AN7A 2DWCA 2NU9B 2ANNA 2R85A 1RK6A 1IBMH 2FK2A 2VQDA 3E5NA 2V59A 3M4IA 2NU8B 2OH2A 4AM3A 3PO3G 3K5IA 3OHBA 5KFAA 4AYBA 5LP6F 4LH7A 1KJ8A 4J9NA 4F50A 4L1KA 2BA0A 4DL3A 1K1SA 2ASJA 5KFEA 4U7CA 4J9MA 2OWOA 2YW2A 3OUZA 5KFIA 4M7EA 1GYFA 3I4MG 4DV4H 1B6SA 4OX9H 2AGOA 4X64H 1XDNA 1GSHA 3L2PA 4I55F 3OHAA 2JEAI 2BR0A 4KHPH 1IOVA 4RNOA 1C3OA 1S9FA 5C8YF 2LF0A 1WH2A 1V8CA 4LH6A 1EUCB 4MV4A 3FDSA 4Q44A 3GIMA 2W9CA 2C22A 3TQTA 5KFHA 4FBUA 5A2QW 2JZXA 2FJZA 3CVZA 5JUMA 2JA5A 2AQ4A 3PW5A 2UVWA 2E5LH 2UUBH 2RF4A 1K1GA 4MV9A 4A3MG 2JEJA 4ECZA 2K1HA 4O3RA 2ZDQA 2CWFA 4DV5H 4U6PA 1S03G 1V4YA 5D1OA 2CTEA 2DLNA 2ZDHA 5KG3A 5IWAH 1KHMA 4R7RA 2W71A 5KFQA 1ZTGA 3I12A 1BGWA 1Z2IA 4TUYF 5LMNH 1J5EH 4R8UA 3UFXB 5DLGA 2W9CB 4J9PA 1E4EA 3U1KA 5C1OA 5H80A 2CTKA 4RB0A 4YHHH 1Y1VA 3K3VA 3NGDA 2R6FA 4MV3A 3FAUA 1V9PA 3CQZA 3TQ1A 4NXNH 4EG0A 1JX4A 1FJGH 4HR7A 3UOEA 2W6MA 5KG6A 4F4WA 5BPHA 4A3CG 3JAMW 1CS0A 5EWEA 4EYHB 2DZDA 1WVNA 1EUDB 1RJPA 2ZDGA 4ZQIA 3QFFA 3RB4A 3L4JA 3H0GG 2FK1A 3V4SA 4G3IA 3VKEA 4FJSA 4ECTA 1W96A 4MTDA 1S97A 4DR7H 2CTLA 3T1HH 1L2ZA 1DV1A 4B8TA 1B04A 5DG8A 2HGSA 3SE7A 2XCLA 2R87A
chains in the Genus database with same CATH topology
2CW7A 3N40P 5DT9A 4B3SH 3RJ0A 4DR3H 2UXDH 5BR8H 3LMLA 1A0IA 2ZQEA 4LSXA 1X9NA 4DV3H 4GKKH 4E9JA 4K0KH 3RGXA 4JI3H 2HVQA 1XNQH 3KXYT 4UCUA 3EZJA 5IT9W 1IBKH 3DF7A 4LF7H 2FE3A 3BAAA 4UCOA 2RGVA 4EC5A 1M0TA 2HHHH 3H20A 1FKAH 5LMUH 4I7HA 4Q0YA 4A2AA 3IG0A 4LF6H 5FPRA 4LFAH 2WYOA 3N44B 3N6XA 3N42B 1P8LA 4RAYA 4BWSC 4G08A 5FD5A 4X65H 2VPSA 4LF9H 4NXMH 5FLXW 3N43B 3KDGA 4IAJA 2UXBH 4DR4H 1FVIA 4MV7A 2ZJTA 2CW8A 4DUYH 1Z2OX 5D1OB 3RGZA 1X9ZA 4JI4H 3EYYA 4DR5H 3F8NA 4JI5H 2VOBA 2Q2UA 4JYAH 5FD6A 3QD7X 2MCTA 4LSAA 4DV7H 4APMA 3JSLA 2UUCH 4RB2C 3KDKA 1AN7A 3T1YH 4GKJH 2UXCH 2PT7G 1TA8A 3BABA 2O4CA 2O03A 3KALA 2ZM6H 2VQFH 3BA8A 1IBMH 4DUZH 3M4IA 4UCTA 4B3MH 4DR6H 4LH7A 4YY3H 1N34H 4LMYA 4EFBA 1I94H 1O75A 4JI0H 4X62H 2KSWA 4B8CD 4CC6A 4DR2H 2OWOA 3NCVA 4OD6A 4EFEA 3JSNA 3BA9A 4M7EA 2VQEH 4A2BA 1GYFA 2YCHA 4DV4H 4EEQA 4OX9H 4X64H 1XDNA 4RB3C 3L2PA 1N33H 1XMOH 4JI7H 2WDTA 2UUAH 3GABA 3OETA 4DV2H 1XMQH 1HR0H 4KHPH 1N32H 4LF5H 4UCRA 4MTEA 1VS0A 5EOYA 1HNZH 4LFBH 2LF0A 4NZTM 4B3TH 1WH2A 3J80W 1BJTA 4LH6A 3FMAA 4J0MA 2VKCA 1DGSA 1M0WA 5A2QW 3CVZA 3PN1A 2RGRA 2XIGA 1HNWH 4FM9A 4UCVA 4AQYH 2E5LH 2UUBH 2HVRA 4MV9A 2D9IA 4X66H 2W57A 4DV0H 2F4VH 1E4FT 4NZRM 1HNXH 2VUGA 1ODHA 3RF2A 4RZQA 3RIZA 4DV5H 2WE6A 3N41B 1S03G 5D1OA 4LF8H 3KAKA 4DV6H 5IWAH 3SB1A 1IBLH 4CC5A 4R7RA 4UCSA 1BGWA 3KAJA 5LMNH 1J5EH 1TAEA 1Z2PX 1ZHQA 4JI6H 3RTXA 3OTOH 4RB0A 4YHHH 3K3VA 2Y3MA 4GLXA 4B3RH 3FAUA 1V9PA 5FPOA 1E4GT 3J81W 4NXNH 1XNRH 4DR1H 1FJGH 1SYXB 4LF4H 5LL6b 4DV1H 2HVSA 3JAMW 1Z2NX 4RB1A 4OCHA 3L4JA 3J7AK 4RAZA 4ETSA 3GR5A 4JV5H 3UQ8A 3L4KA 4JI2H 3C0FB 1SEIA 4MTDA 2Q2TA 1ZHSA 3MWMA 4DR7H 4JI8H 5D1PA 3T1HH 1F0XA 4JI1H 4LFCH 1I6UA 1MZBA 4UFZA 1L2ZA 3OSSD 3HXLA 1B04A 4PDBA 2HGSA 2FPHX 1S68A 1N36H 2UU9H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B3S H;  4DR3 H;  2UXD H;  5BR8 H;  4DV3 H;  4GKK H;  4K0K H;  4JI3 H;  1XNQ H;  5IT9 W;  1IBK H;  4LF7 H;  2HHH H;  1FKA H;  5LMU H;  4LF6 H;  4LFA H;  4X65 H;  4LF9 H;  4NXM H;  5FLX W;  2UXB H;  4DR4 H;  4DUY H;  4JI4 H;  4DR5 H;  4JI5 H;  4JYA H;  4DV7 H;  2UUC H;  1AN7 A;  3T1Y H;  4GKJ H;  2UXC H;  2VQF H;  1IBM H;  4DUZ H;  4B3M H;  4DR6 H;  4YY3 H;  1N34 H;  1I94 H;  4JI0 H;  4X62 H;  4DR2 H;  2VQE H;  4DV4 H;  4OX9 H;  4X64 H;  1N33 H;  1XMO H;  4JI7 H;  2UUA H;  4DV2 H;  1XMQ H;  1HR0 H;  4KHP H;  1N32 H;  4LF5 H;  1HNZ H;  4LFB H;  4B3T H;  3J80 W;  5A2Q W;  1HNW H;  4AQY H;  2E5L H;  2UUB H;  4X66 H;  4DV0 H;  2F4V H;  1HNX H;  3RF2 A;  4DV5 H;  1S03 G;  4LF8 H;  4DV6 H;  5IWA H;  1IBL H;  5LMN H;  1J5E H;  4JI6 H;  3OTO H;  4YHH H;  4B3R H;  3J81 W;  4NXN H;  1XNR H;  4DR1 H;  1FJG H;  4LF4 H;  5LL6 b;  4DV1 H;  3JAM W;  3J7A K;  4JV5 H;  4JI2 H;  1SEI A;  4DR7 H;  4JI8 H;  3T1H H;  4JI1 H;  4LFC H;  1I6U A;  4PDB A;  2ZM6 H;  1N36 H;  2UU9 H; 
#chains in the Genus database with same CATH topology
 4Q43 A;  5EZY F;  4IWX A;  5DT9 A;  4B3S H;  1PX2 A;  3R5F A;  2HH3 A;  2LTM A;  4HNV A;  1PK8 A;  4JVY A;  3GIL A;  2CPQ A;  1A0I A;  2NU6 B;  2RDJ A;  1X9N A;  3Q8S B;  4BBS G;  4E9J A;  3MWE A;  3RGX A;  2R8J A;  2JEB I;  1KEE A;  3KXY T;  3GTK A;  2JA9 A;  4FJU A;  2WB1 E;  5BMV F;  3OSP A;  3VPD A;  3VMM A;  3HKZ E;  4ZOL F;  4Q0Y A;  3IG0 A;  2FB9 A;  3N6X A;  2CTF A;  2V58 A;  4Q8F A;  4H8A A;  4G08 A;  4LIJ A;  1TWC A;  2R7Z A;  4X65 H;  5KFY A;  2R93 A;  4EYI B;  1AUX A;  4ZI7 F;  3MR6 A;  3PZP A;  1FVI A;  2WAQ A;  1JKJ B;  4IRK A;  4DUY H;  4O3O A;  5IP7 G;  4ZHQ F;  1WCM A;  5D1O B;  4RZR A;  4JI4 H;  1RJR A;  5EWG A;  3GQC A;  4JI5 H;  2VOB A;  1EC6 A;  2A1S A;  4ECQ A;  2XGQ A;  5KX5 F;  2VA2 A;  3T1Y H;  5K2M A;  3GII A;  4GKJ H;  4ED8 A;  3V6J A;  2UXC H;  1KJ9 A;  2PT7 G;  4EEY A;  2O4C A;  4E4T A;  2YU9 A;  2DGR A;  4B3M H;  5CB4 F;  1GO3 E;  4YY3 H;  1N34 H;  4O2B F;  5KFJ A;  1V51 A;  3G6V A;  5DG9 A;  1EYZ A;  4WAN A;  4JI0 H;  4A93 G;  2QND A;  2KSW A;  1S0O A;  1CE8 A;  4DR2 H;  1JLL B;  1VBH A;  5KFD A;  5L1K A;  4ED6 A;  2YZN A;  4A2B A;  3U9S A;  2FMR A;  2YCH A;  5KFM A;  5KFL A;  3R23 A;  5IYD G;  2W6P A;  2WB1 A;  1N33 H;  2W70 A;  4JV0 A;  2WDT A;  4BWS C;  3HOX G;  3GAB A;  3OET A;  4DV2 H;  1N32 H;  5KFO A;  4RNN A;  5DG7 A;  1VS0 A;  4YJ2 F;  4QW8 A;  1HNZ H;  4ED2 A;  4HNU A;  4ED1 A;  4IZO A;  3RBE A;  1X4M A;  4HNT A;  2E2I A;  2VKC A;  4A3B G;  1M0W A;  2R82 A;  2XD4 A;  1V9N A;  4J9S A;  3T5H A;  1J5K A;  3H40 A;  4Y8V B;  4JVH A;  4QIW E;  4RU9 A;  2XGP A;  5KT3 A;  5C44 G;  4ECV A;  5GON F;  4X66 H;  2W57 A;  4DV0 H;  4YB8 B;  4NZR M;  1UC9 A;  4FU0 A;  5L9X A;  1EHI A;  3EPG A;  1TWA A;  4RZQ A;  2R84 A;  5KFC A;  5IYB G;  3H3V H;  4DV6 H;  2JEG A;  4CC5 A;  2E3U A;  5FJ8 G;  3PVX A;  4UCS A;  4O3S A;  2X06 A;  1B6R A;  3KAJ A;  3IN5 A;  4AYB E;  1VBG A;  1Z2P X;  1KJJ A;  2YL2 A;  3RTX A;  4A3G G;  3OTO H;  1CQJ B;  2Y3M A;  3BG5 A;  4GLX A;  5FPO A;  1E4G T;  3J81 W;  1T94 A;  5HV6 A;  5LOV F;  1TUA A;  3I4N G;  2UVV A;  2Z0S A;  3BQ0 A;  4DV1 H;  1A9X A;  3ETH A;  5KT2 A;  4IHJ F;  4RB1 A;  4XZ3 B;  1EZ1 A;  4NBQ A;  4RAZ A;  3GIK A;  4JV5 H;  3L4K A;  2I80 A;  1WE8 A;  2NUA B;  4TQR A;  4Q8E A;  4O4I F;  4ECR A;  5K36 G;  3M9N B;  3WNZ A;  1ZHS A;  2C2R A;  2Q2T A;  2IA6 A;  4JV1 A;  4XYM B;  4J9K A;  3RAQ A;  3OSS D;  3KHH A;  3H4B A;  2CKZ B;  2YS7 A;  3HXL A;  5KFK A;  2W8L A;  4PDB A;  1S10 A;  3BAB A;  2XCA A;  1S68 A;  2UU9 H;  2I8C A;  4QJF A;  4ETS A;  2CW7 A;  2GPW A;  3PW0 A;  5JVL A;  2B63 G;  5KG0 A;  3Q2O A;  2W6O A;  3JRW A;  2UXD H;  4IR1 A;  3LML A;  3GLK A;  5KFT A;  4LSX A;  1TWH A;  2PY9 A;  2FPI B;  3PR4 A;  4ED0 A;  3SI8 A;  2HVQ A;  1DIK A;  1XNQ H;  3OUU A;  4O3Q A;  5IT9 W;  4YAK B;  4OO1 G;  5DGA A;  3DF7 A;  3KHL A;  4F4Z A;  5JEA G;  4YR3 A;  1DT4 A;  2V4Q A;  2ATL A;  4EC5 A;  2ANR A;  3U9T A;  3V69 A;  1S0M A;  3WO0 A;  1UNN C;  2CZG A;  2WYO A;  3N44 B;  4RAY A;  3N42 B;  1WHR A;  4YR0 A;  4A3I G;  1WSC A;  1N56 A;  5KFS A;  2FLP A;  2ASL A;  5KG5 A;  1I50 A;  5FLX W;  3N43 B;  1PQX A;  2DIK A;  4IAJ A;  2J6S A;  4MV7 A;  3H4D A;  1VIH A;  1X9Z A;  3R5X A;  4YBZ B;  3EYY A;  1KJI A;  1W93 A;  3GTO A;  1M7J A;  3MFI A;  4JYA H;  2VUM A;  2PN1 A;  4LSA A;  1J4W A;  2UUC H;  2PBZ A;  3KDK A;  3G6Y A;  4BY7 G;  4MA0 A;  3PW7 A;  3GV7 B;  2OPU A;  2AXY A;  4AIM A;  4UCT A;  2NU7 B;  1TWF A;  2G8Y A;  2OLS A;  1I94 H;  5LA6 F;  1O75 A;  2PMZ A;  4C5A A;  3H0G A;  2C28 A;  2R92 G;  3NCV A;  4EFE A;  2P2R A;  4QMF B;  2J6T A;  3Q8P B;  4JV2 A;  2VQE H;  3I0P A;  3FKI A;  2CPM A;  4EEQ A;  3MR3 A;  5C0X G;  4DL6 A;  3HOV G;  2R7Z G;  2R93 G;  2R7K A;  2ALZ A;  2XCP A;  4RB3 C;  4YJ3 F;  4EBC A;  2FLN A;  4BXX G;  4JI7 H;  3JSN A;  3R5H A;  1ZET A;  1HR0 H;  1XMQ H;  2HJW A;  4UCR A;  4MV6 A;  5D8D A;  4C2M A;  4Q45 A;  5L1L A;  4MTE A;  3LP8 A;  4MV1 A;  4LFB H;  4J9R A;  2CQY A;  3RBD A;  3J80 W;  1BJT A;  3JRX A;  2J9G A;  1K1Q A;  4EBE A;  1KBL A;  4A3J G;  2JA6 A;  4J0M A;  4O3P A;  1ZZI A;  1DGS A;  2YS6 A;  3Q8Q B;  3BJY A;  4F4X A;  1GGO A;  1DTJ A;  3PN1 A;  2RGR A;  4GC6 A;  4A3D G;  4QWD A;  1HNW H;  4FM9 A;  5JH7 F;  4AQY H;  2PQU A;  1S0N A;  2D9I A;  2SCU B;  5KFP A;  2F4V H;  2YZM A;  2B63 A;  1ZZJ A;  2VUG A;  2DPJ A;  2RDI A;  5KG7 A;  3PW2 A;  3RUP A;  5C1P A;  3RIZ A;  3HOW G;  3KHG A;  2WE6 A;  2YZG A;  2NVY A;  1NXU A;  2R8G A;  3RAX A;  5KG1 A;  2VPQ A;  3KAK A;  2CTM A;  3LWB A;  3VPB A;  2J6U A;  3GV8 B;  2R7L A;  3GIJ A;  2FMA A;  5IP9 G;  1T36 A;  1WCM G;  4I4T F;  1M6V A;  3N8D A;  4QWB A;  1JXL A;  4B3R H;  3G8C A;  4DR1 H;  1Y14 B;  5C4X G;  4J9Q A;  2Y0S E;  3GKU A;  4LF4 H;  3RV3 A;  1B33 N;  1Z2N X;  2R7N A;  5KFX A;  5EDW A;  1AUV A;  5L1I A;  4YAJ B;  5L1J A;  4J9L A;  2R8I A;  3AYH B;  4JI2 H;  4IFD G;  3C0F B;  1SEI A;  3MWM A;  1KC7 A;  4JI1 H;  1I6U A;  5KFV A;  3V4Z A;  1I3Q A;  3M9O B;  4C5C A;  5F9N A;  3V6K A;  5IYZ F;  2HVS A;  4QWA A;  2FPH X;  2ZM6 H;  2WTF A;  4O4H F;  2ASD A;  1Y1W G;  2FP4 B;  2AGP A;  3N40 P;  2NN6 G;  5CA1 F;  5DGB A;  4DR3 H;  3M9M B;  3FKI G;  3HOY G;  5BR8 H;  5J2U F;  3RB0 A;  1X4N A;  2FK3 A;  3GIQ A;  4JUZ A;  3EPI A;  4DL7 A;  4GKK H;  4DL5 A;  1BXR A;  5KFW A;  3EZJ A;  4EGJ A;  1IBK H;  4UCO A;  4QW9 A;  3QZ8 A;  4ECS A;  3ETJ A;  4GC7 A;  3HKZ A;  4A3E G;  5LMU H;  4A2A A;  3G6X A;  4LF6 H;  2JA7 A;  1SCU B;  2DPI A;  4EGQ A;  2JEI A;  1I7N A;  2BQU A;  2JVZ A;  3PR5 B;  4NXM H;  2UXB H;  4R8U B;  1R9T A;  2CW8 A;  2LTL A;  2GLT A;  5DLF A;  5KG4 A;  1Z2O X;  2M05 A;  5KT4 A;  3RGZ A;  1Y1V G;  2W6N A;  5JQW A;  1VIG A;  3F8N A;  2IBK A;  2Q2U A;  5FD6 A;  3L7Z C;  1MSZ A;  3QD7 X;  2MCT A;  4DV7 H;  4APM A;  3JSL A;  4ECX A;  2BL5 A;  2FKL A;  4ED7 A;  5KFR A;  1ULZ A;  3RFC A;  3RB6 A;  1TA8 A;  2FPP B;  2O03 A;  3KAL A;  2VQF H;  2W6Q A;  3BA8 A;  5KT6 A;  4ECU A;  2IMW P;  4DUZ H;  4IR9 A;  4DR6 H;  2WAQ E;  5DQH A;  2AGQ A;  4QIW A;  4LMY A;  2LRR A;  1IOW A;  5KFZ A;  4EFB A;  2X0S A;  3MR2 A;  2I87 A;  2V5A A;  4XYL B;  2FLL A;  2CTJ A;  2PMZ E;  4X62 H;  4WD3 A;  4B8C D;  4CC6 A;  2V4R A;  5C3E G;  2NVX A;  4OD6 A;  3RV4 A;  4EBD A;  3BQ2 A;  1DV2 A;  1WR2 A;  3BA9 A;  4MAM A;  1UG8 A;  2P0A A;  3OSN A;  1XMO H;  2UUA H;  3KHR A;  2VA3 A;  4LF5 H;  4IRC A;  5EOY A;  3T5J A;  4ECY A;  2VUM G;  4NZT M;  4B3T H;  5CAE B;  2MJH A;  1KJQ A;  3FMA A;  4YP3 A;  1T3N A;  3WO1 A;  1C30 A;  5LYJ F;  3T5L A;  2BQR A;  1RJQ A;  4BA1 I;  2XIG A;  3Q1K A;  1X0A A;  4PWQ A;  4UCV A;  3TIN A;  4DL2 A;  5LXT F;  5I47 A;  2HVR A;  3HBL A;  2FPG B;  3MJF A;  1RYS A;  1E4F T;  4ED3 A;  5F9L A;  1HNX H;  1TWG A;  4QWC A;  1VAJ A;  1ODH A;  3PW4 A;  5HBR B;  3RF2 A;  2HH2 A;  5KFG A;  2JA5 G;  4WAL A;  3N41 B;  2R7M A;  5JVD F;  2R8K A;  4LF8 H;  2W9B B;  5KFU A;  2R8H A;  3GIP A;  3GTL A;  1GLV A;  3SB1 A;  3MFH A;  5KFB A;  4HYK A;  1IBL H;  4BY1 G;  2JEF A;  4FBT A;  4TQS A;  1ZHQ A;  1TAE A;  5KT7 A;  4JI6 H;  3BQ1 A;  1WTJ A;  3Q8R B;  1OWT A;  5CA0 F;  2JA6 G;  5DQI A;  2QK4 A;  2W7O A;  4F4Y A;  1XNR H;  3GTP A;  2M8W A;  1SYX B;  2YQR A;  5LL6 b;  3GTQ A;  4OCH A;  5C5J A;  5KG2 A;  3J7A K;  3GR5 A;  3UQ8 A;  4MV8 A;  3GTG A;  4DL4 A;  2OPV A;  4BBR G;  2E2H A;  4A3K G;  4TV8 F;  5KFF A;  3QZ7 A;  4IRD A;  1Y1W A;  5D1P A;  4JI8 H;  1S20 A;  3VPC A;  5IYC G;  1F0X A;  4LFC H;  1JDB B;  1MZB A;  4UFZ A;  4HQ6 A;  4ECW A;  1E4E B;  2W6Z A;  2C35 B;  3T5K A;  4NLG A;  3HOZ G;  4C5B A;  4FS2 A;  1BNC A;  2C2D A;  4IWY A;  2W9A A;  1N48 A;  2R92 A;  1N36 H;  4XX0 B;  3AEV B;  3MWD A;  1UC8 A;  4O3N A;  2GPS A;  1ZZK A;  3ORQ A;  2FFM A;  1I7L A;  1JIH A;  3GID A;  3RJ0 A;  5KT5 A;  2W8K A;  5DQG A;  2BQ3 A;  4FS1 A;  2UVR A;  2JA8 G;  4BA2 I;  4DLK A;  4A3L G;  1VKZ A;  5KKN B;  2JA7 G;  2ZQE A;  3JZI A;  2AU0 A;  3K5H A;  5KFN A;  2YRW A;  4RUC A;  2YYA A;  4DV3 H;  4K0K H;  5J2T F;  3TII A;  5BPF A;  1VBI A;  4JI3 H;  1RK5 A;  4YQW A;  4ME6 A;  5EWF A;  3HOU G;  1GSA A;  3ORR A;  4UCU A;  2CWH A;  2YRX A;  3GV5 B;  4J9O A;  2C2E A;  1SFO A;  4LF7 H;  2FE3 A;  3BAA A;  2R86 A;  2RGV A;  2V9W A;  4O4L F;  1M0T A;  4QWE A;  2HHH H;  3H20 A;  1FKA H;  4I7H A;  2XC9 A;  1RYR A;  2PVP A;  1XRH A;  5FPR A;  5FLM G;  4LFA H;  3KTM A;  3HB9 A;  4MA5 A;  1JDE A;  1CQI B;  1P8L A;  4RNM A;  2C00 A;  3PO2 G;  2UVU A;  5FD5 A;  1ZQ7 A;  2QYZ A;  2VPS A;  4LF9 H;  4YR2 A;  4A3F G;  2Y0S A;  3KDG A;  3K3P A;  2W7P A;  1GSO A;  4DR4 H;  2JE6 I;  4O2A F;  2IP4 A;  2ZJT A;  4TV9 F;  3V6H A;  4WBN F;  3RB3 A;  3GTM A;  3GTJ A;  2M6Q A;  3TIG A;  4DR5 H;  4M9U A;  2W9B A;  4RUA A;  3MR5 A;  5T14 A;  2VR1 A;  4I50 F;  4RB2 C;  1K83 A;  1AN7 A;  2DWC A;  2NU9 B;  2ANN A;  2R85 A;  1RK6 A;  1IBM H;  2FK2 A;  2VQD A;  3E5N A;  2V59 A;  3M4I A;  2NU8 B;  2OH2 A;  4AM3 A;  3PO3 G;  3K5I A;  3OHB A;  5KFA A;  4AYB A;  5LP6 F;  4LH7 A;  1KJ8 A;  4J9N A;  4F50 A;  4L1K A;  2BA0 A;  4DL3 A;  1K1S A;  2ASJ A;  5KFE A;  4U7C A;  4J9M A;  2OWO A;  2YW2 A;  3OUZ A;  5KFI A;  4M7E A;  1GYF A;  3I4M G;  4DV4 H;  1B6S A;  4OX9 H;  2AGO A;  4X64 H;  1XDN A;  1GSH A;  3L2P A;  4I55 F;  3OHA A;  2JEA I;  2BR0 A;  4KHP H;  1IOV A;  4RNO A;  1C3O A;  1S9F A;  5C8Y F;  2LF0 A;  1WH2 A;  1V8C A;  4LH6 A;  1EUC B;  4MV4 A;  3FDS A;  4Q44 A;  3GIM A;  2W9C A;  2C22 A;  3TQT A;  5KFH A;  4FBU A;  5A2Q W;  2JZX A;  2FJZ A;  3CVZ A;  5JUM A;  2JA5 A;  2AQ4 A;  3PW5 A;  2UVW A;  2E5L H;  2UUB H;  2RF4 A;  1K1G A;  4MV9 A;  4A3M G;  2JEJ A;  4ECZ A;  2K1H A;  4O3R A;  2ZDQ A;  2CWF A;  4DV5 H;  4U6P A;  1S03 G;  1V4Y A;  5D1O A;  2CTE A;  2DLN A;  2ZDH A;  5KG3 A;  5IWA H;  1KHM A;  4R7R A;  2W71 A;  5KFQ A;  1ZTG A;  3I12 A;  1BGW A;  1Z2I A;  4TUY F;  5LMN H;  1J5E H;  4R8U A;  3UFX B;  5DLG A;  2W9C B;  4J9P A;  1E4E A;  3U1K A;  5C1O A;  5H80 A;  2CTK A;  4RB0 A;  4YHH H;  1Y1V A;  3K3V A;  3NGD A;  2R6F A;  4MV3 A;  3FAU A;  1V9P A;  3CQZ A;  3TQ1 A;  4NXN H;  4EG0 A;  1JX4 A;  1FJG H;  4HR7 A;  3UOE A;  2W6M A;  5KG6 A;  4F4W A;  5BPH A;  4A3C G;  3JAM W;  1CS0 A;  5EWE A;  4EYH B;  2DZD A;  1WVN A;  1EUD B;  1RJP A;  2ZDG A;  4ZQI A;  3QFF A;  3RB4 A;  3L4J A;  3H0G G;  2FK1 A;  3V4S A;  4G3I A;  3VKE A;  4FJS A;  4ECT A;  1W96 A;  4MTD A;  1S97 A;  4DR7 H;  2CTL A;  3T1H H;  1L2Z A;  1DV1 A;  4B8T A;  1B04 A;  5DG8 A;  2HGS A;  3SE7 A;  2XCL A;  2R87 A; 
#chains in the Genus database with same CATH homology
 2CW7 A;  3N40 P;  5DT9 A;  4B3S H;  3RJ0 A;  4DR3 H;  2UXD H;  5BR8 H;  3LML A;  1A0I A;  2ZQE A;  4LSX A;  1X9N A;  4DV3 H;  4GKK H;  4E9J A;  4K0K H;  3RGX A;  4JI3 H;  2HVQ A;  1XNQ H;  3KXY T;  4UCU A;  3EZJ A;  5IT9 W;  1IBK H;  3DF7 A;  4LF7 H;  2FE3 A;  3BAA A;  4UCO A;  2RGV A;  4EC5 A;  1M0T A;  2HHH H;  3H20 A;  1FKA H;  5LMU H;  4I7H A;  4Q0Y A;  4A2A A;  3IG0 A;  4LF6 H;  5FPR A;  4LFA H;  2WYO A;  3N44 B;  3N6X A;  3N42 B;  1P8L A;  4RAY A;  4BWS C;  4G08 A;  5FD5 A;  4X65 H;  2VPS A;  4LF9 H;  4NXM H;  5FLX W;  3N43 B;  3KDG A;  4IAJ A;  2UXB H;  4DR4 H;  1FVI A;  4MV7 A;  2ZJT A;  2CW8 A;  4DUY H;  1Z2O X;  5D1O B;  3RGZ A;  1X9Z A;  4JI4 H;  3EYY A;  4DR5 H;  3F8N A;  4JI5 H;  2VOB A;  2Q2U A;  4JYA H;  5FD6 A;  3QD7 X;  2MCT A;  4LSA A;  4DV7 H;  4APM A;  3JSL A;  2UUC H;  4RB2 C;  3KDK A;  1AN7 A;  3T1Y H;  4GKJ H;  2UXC H;  2PT7 G;  1TA8 A;  3BAB A;  2O4C A;  2O03 A;  3KAL A;  2ZM6 H;  2VQF H;  3BA8 A;  1IBM H;  4DUZ H;  3M4I A;  4UCT A;  4B3M H;  4DR6 H;  4LH7 A;  4YY3 H;  1N34 H;  4LMY A;  4EFB A;  1I94 H;  1O75 A;  4JI0 H;  4X62 H;  2KSW A;  4B8C D;  4CC6 A;  4DR2 H;  2OWO A;  3NCV A;  4OD6 A;  4EFE A;  3JSN A;  3BA9 A;  4M7E A;  2VQE H;  4A2B A;  1GYF A;  2YCH A;  4DV4 H;  4EEQ A;  4OX9 H;  4X64 H;  1XDN A;  4RB3 C;  3L2P A;  1N33 H;  1XMO H;  4JI7 H;  2WDT A;  2UUA H;  3GAB A;  3OET A;  4DV2 H;  1XMQ H;  1HR0 H;  4KHP H;  1N32 H;  4LF5 H;  4UCR A;  4MTE A;  1VS0 A;  5EOY A;  1HNZ H;  4LFB H;  2LF0 A;  4NZT M;  4B3T H;  1WH2 A;  3J80 W;  1BJT A;  4LH6 A;  3FMA A;  4J0M A;  2VKC A;  1DGS A;  1M0W A;  5A2Q W;  3CVZ A;  3PN1 A;  2RGR A;  2XIG A;  1HNW H;  4FM9 A;  4UCV A;  4AQY H;  2E5L H;  2UUB H;  2HVR A;  4MV9 A;  2D9I A;  4X66 H;  2W57 A;  4DV0 H;  2F4V H;  1E4F T;  4NZR M;  1HNX H;  2VUG A;  1ODH A;  3RF2 A;  4RZQ A;  3RIZ A;  4DV5 H;  2WE6 A;  3N41 B;  1S03 G;  5D1O A;  4LF8 H;  3KAK A;  4DV6 H;  5IWA H;  3SB1 A;  1IBL H;  4CC5 A;  4R7R A;  4UCS A;  1BGW A;  3KAJ A;  5LMN H;  1J5E H;  1TAE A;  1Z2P X;  1ZHQ A;  4JI6 H;  3RTX A;  3OTO H;  4RB0 A;  4YHH H;  3K3V A;  2Y3M A;  4GLX A;  4B3R H;  3FAU A;  1V9P A;  5FPO A;  1E4G T;  3J81 W;  4NXN H;  1XNR H;  4DR1 H;  1FJG H;  1SYX B;  4LF4 H;  5LL6 b;  4DV1 H;  2HVS A;  3JAM W;  1Z2N X;  4RB1 A;  4OCH A;  3L4J A;  3J7A K;  4RAZ A;  4ETS A;  3GR5 A;  4JV5 H;  3UQ8 A;  3L4K A;  4JI2 H;  3C0F B;  1SEI A;  4MTD A;  2Q2T A;  1ZHS A;  3MWM A;  4DR7 H;  4JI8 H;  5D1P A;  3T1H H;  1F0X A;  4JI1 H;  4LFC H;  1I6U A;  1MZB A;  4UFZ A;  1L2Z A;  3OSS D;  3HXL A;  1B04 A;  4PDB A;  2HGS A;  2FPH X;  1S68 A;  1N36 H;  2UU9 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...