4PDBA

Crystal structure of bacillus anthracis ribosomal protein s8 in complex with an rna aptamer
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
129
structure length
129
Chain Sequence
TDPIADMLTRIRNANMVRHEKLEVPASKIKKEIAELLKREGFIRDVEYIEDNKQGILRIFLKYGANNERVITGLKRISKPGLRVYAKADEVPRVLNGLGIALVSTSKGVMTDKDARQLQTGGEVVAYVW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure analysis of free and bound states of an RNA aptamer against ribosomal protein S8 from Bacillus anthracis.
pubmed doi rcsb
source organism Bacillus anthracis
molecule tags Ribosomal protein/rna
molecule keywords 30S ribosomal protein S8
total genus 33
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2014-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00410 Ribosomal_S8 Ribosomal protein S8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.30 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 4pdbA01
3.30.1490.10 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4pdbA02
4JI6H 4JI2H 1HNXH 2UU9H 4K0KH 4PDBA 1IBLH 1XNQH 4DR4H 2F4VH 1I6UA 5LMUH 1N34H 1N32H 4LF6H 2HHHH 4B3SH 4X66H 3J80W 4DV0H 4JYAH 4LF8H 1XNRH 5A2QW 2UXBH 2UXCH 5LMNH 4DR2H 3OTOH 2UUAH 4LF7H 1XMOH 4KHPH 2UUCH 4DV4H 1N33H 4DV5H 4JI1H 4GKJH 4B3TH 4NXNH 1HNZH 1I94H 4GKKH 4DR7H 5BR8H 4JI4H 4LF4H 1S03G 3J7AK 4DV7H 4JI8H 4DR1H 4DUYH 3T1YH 4X65H 4X64H 4DV3H 4JI7H 4LFBH 4OX9H 3T1HH 3RF2A 4NXMH 2UUBH 4X62H 4B3RH 1FJGH 2ZM6H 4DR3H 4LFAH 4JI0H 5LL6b 4JI5H 1N36H 4DV6H 4LF5H 2VQFH 3JAMW 4LF9H 1IBKH 2E5LH 4YHHH 5IWAH 1HR0H 4DR6H 4JI3H 5IT9W 1AN7A 1SEIA 4DUZH 1HNWH 4AQYH 1IBMH 4DV1H 4LFCH 4B3MH 4YY3H 1FKAH 4DV2H 2UXDH 3J81W 1XMQH 4DR5H 1J5EH 4JV5H 2VQEH 5FLXW
chains in the Genus database with same CATH superfamily
1V51A 1DTJA 3MFHA 4BXXG 1K1QA 3OETA 3HOXG 4K0KH 1GSHA 2FPPB 1IBLH 4IAJA 2O4CA 4DR4H 2QYZA 1X4MA 1KEEA 3H3VH 5EWGA 4J9NA 1BNCA 2C35B 2PVPA 2W57A 5K36G 2W6NA 4YJ3F 4YB8B 4LF6H 2VUGA 4RB0A 2AQ4A 3GTKA 4U6PA 4QMFB 3MR2A 3VPDA 5L1JA 4MAMA 3GTMA 4GLXA 1PK8A 1VIGA 4OCHA 5I47A 2JA5A 3V4ZA 4A93G 1VBHA 1BGWA 2FKLA 5JH7F 1B04A 3G6YA 4ED6A 4LF8H 5LOVF 2UXBH 2I87A 3GR5A 2BQ3A 4C5BA 2JEBI 1J4WA 4LH6A 4ECZA 3M9MB 1BXRA 2VA2A 2C2EA 4YR3A 2UUAH 2I8CA 2VPQA 5KFXA 4LIJA 4QWDA 4EBCA 2R93A 4ECTA 1WH2A 2JEAI 4MA5A 3PW2A 4HR7A 4KHPH 1RJQA 1GLVA 4ZQIA 5F9NA 3RGZA 2UUCH 1MSZA 4APMA 1N33H 5J2UF 3BABA 5DT9A 4DV5H 2M6QA 3DF7A 3NGDA 3GV5B 2ZDGA 5DLFA 4GKJH 2FE3A 2DLNA 3U9SA 5KFEA 5C1PA 5JQWA 5KFZA 5KFPA 2LF0A 3CVZA 2NU9B 1GSAA 5KFQA 3G6XA 5IYDG 3T5HA 2FLLA 2C22A 4RNNA 1XRHA 4DR7H 2W9AA 2CTJA 4RNMA 2GLTA 3N40P 4O3RA 5KFDA 3TINA 4LSXA 2I80A 2AGPA 1S0MA 4BA1I 4O3SA 4DV7H 1E4FT 4WD3A 2IA6A 1ZTGA 1EUDB 1X9NA 2YU9A 2M05A 2HVQA 3K5HA 1JXLA 3VMMA 1KJ9A 4X65H 1M0TA 3UOEA 3QFFA 4EFBA 2R86A 2W6QA 1WHRA 2ASDA 1S10A 2ASLA 4XX0B 5BPHA 1IOVA 5CA0F 2Y0SA 3OUUA 4J9LA 2DPIA 3GKUA 3N42B 4OX9H 4ETSA 5KFCA 1GGOA 4ECVA 2HH2A 5KG2A 2OWOA 4NXMH 2UUBH 4JVHA 4RAZA 4X62H 4B3RH 1EUCB 2JA5G 4EG0A 1Z2PX 1JKJB 1O75A 2WB1A 3H0GA 4LFAH 4O3NA 3KHLA 4QWBA 5C3EG 2Q2UA 4JI5H 2J6TA 3UFXB 4IZOA 2ANRA 4JVYA 2FLNA 3IG0A 3GIDA 3H20A 5C4XG 1VBIA 4ECXA 4YAJB 3OHAA 2VKCA 2ASJA 3MR3A 1IBKH 4AYBA 3HB9A 2FK1A 4I4TF 2PN1A 4PWQA 1P8LA 4HNVA 4I7HA 2V5AA 3KHGA 3G6VA 2SCUB 2BL5A 1TWAA 5IWAH 2FK3A 4DR6H 2PBZA 2RGRA 5KT4A 1AN7A 3V6JA 2JA6G 5KG0A 3TIIA 1IBMH 5JEAG 2YZMA 3GIQA 1C3OA 5KG6A 5C1OA 4TQSA 3E5NA 3H4BA 4Q45A 5KFGA 4J9OA 2W6MA 1WE8A 3AYHB 4HNUA 3KTMA 3GILA 4ED0A 4J9RA 3R5FA 3MWDA 4IRDA 3L7ZC 1JIHA 4JV5H 4M9UA 4QJFA 5EOYA 4J0MA 5C8YF 3RB4A 2FPGB 2VQEH 2XIGA 4RB2C 1AUVA 5KFTA 3OHBA 5KFYA 3ORRA 5KFVA 5CAEB 3NCVA 1J5KA 4O3OA 2JVZA 2V4QA 2BQRA 1RJRA 2JEIA 5IYCG 2YQRA 3QD7X 3H0GG 3GIIA 5D1OB 4IR9A 2F4VH 1I6UA 1VAJA 5LA6F 4JV0A 4A3MG 4GC6A 1N34H 3I12A 4EEQA 1N32H 5KFSA 3GIJA 4XYMB 2CZGA 4B3SH 4X66H 4MV9A 4O3PA 1FVIA 3FKIA 5FD5A 3GTJA 5EDWA 2ANNA 4JYAH 1T36A 2R6FA 3BA8A 2JA7G 2UXCH 4J9QA 3BAAA 1MZBA 2VOBA 4A2BA 1UG8A 2Z0SA 3GLKA 4RB1A 1A9XA 1WCMG 3H40A 1I7NA 2W7PA 2RDJA 4F50A 1GO3E 4RAYA 2YRWA 3T5JA 2W9CA 1A0IA 2ZJTA 4JUZA 2NU6B 4DL4A 5D8DA 3V6HA 1K1GA 3FKIG 4UCOA 5BPFA 5KFFA 4UCSA 4C5CA 5KFKA 3T5KA 4UCVA 3R5HA 4O2BF 1KJJA 2AGQA 3JZIA 2V4RA 5L1IA 3MJFA 1VKZA 4YP3A 4FS1A 3N6XA 4B3TH 2W9CB 1KHMA 3GIKA 2JZXA 2W8LA 4F4XA 2FJZA 2YCHA 2UVRA 1E4GT 1WSCA 4IFDG 4GKKH 4WBNF 5BMVF 4JI4H 5JVDF 4ED7A 2DPJA 2VA3A 3RGXA 2NVXA 5KT7A 3LWBA 2YS7A 4TUYF 1V8CA 1Y1VA 1V4YA 3PVXA 2CKZB 2YYAA 4F4YA 4JI8H 5K2MA 4NZRM 3RB0A 4DL6A 5DQIA 3RV3A 4A2AA 5DQHA 2YRXA 2LTLA 3GV8B 2CPMA 3KDKA 1K83A 3HOZG 4DL2A 4DV3H 2R7KA 2UVWA 1EC6A 3FDSA 1ZETA 5LYJF 4ECRA 4TV8F 3RF2A 4Q8FA 2P2RA 3RIZA 2R85A 2YL2A 5KG4A 5KFHA 3GABA 5KG7A 1M7JA 1EYZA 2VQDA 3JRWA 3K3VA 1KC7A 4TQRA 3M4IA 2C00A 2WB1E 3Q2OA 4O3QA 2WAQA 3BQ0A 1ULZA 2KSWA 4RU9A 2CW8A 4ED3A 3V6KA 4O4IF 3OSNA 2VQFH 4A3GG 4LF9H 1Z2OX 4J9SA 4WALA 3U9TA 2FMAA 4E9JA 4ME6A 5KT2A 5IP7G 2JEJA 4OD6A 4DL5A 1X0AA 5L9XA 4EEYA 3FMAA 4ED1A 2RGVA 3OSPA 4YHHH 1TWGA 2YZNA 2XD4A 5KFAA 1I3QA 2FMRA 4ECSA 4RB3C 2B63G 1SEIA 1OWTA 5FLMG 4H8AA 4DV1H 4LFCH 4B3MH 4RNOA 4I50F 4A3KG 2AU0A 2W8KA 4WANA 2CPQA 2E2IA 1WVNA 3I4MG 2MJHA 3HKZA 2UXDH 4LMYA 2J9GA 4UCUA 2V9WA 1Y1WG 5H80A 1PX2A 5KG3A 3H4DA 5KFLA 4R8UB 2R92G 2V58A 3HKZE 1RJPA 4B8TA 4QWEA 2D9IA 4MV7A 4ZOLF 3Q8RB 4J9KA 1GYFA 2R7NA 3ORQA 3HOYG 1ZQ7A 3U1KA 4ED8A 5FLXW 4EYHB 4BY1G 4JI6H 4Q44A 4G3IA 2A1SA 4JI2H 1KBLA 1TUAA 1HNXH 2W71A 5KFIA 5LP6F 3GQCA 1ZZIA 4IWYA 2W9BB 4C2MA 4XZ3B 4RUCA 1SFOA 3EYYA 4ECWA 3PN1A 3RTXA 4LSAA 5IYBG 2HHHH 2OPVA 4HYKA 1ZZJA 3K3PA 3MWMA 2BQUA 4XYLB 2YS6A 3VPCA 3GTPA 3Q8SB 4A3LG 4QWCA 2ATLA 1L2ZA 3HOVG 2FB9A 3I4NG 4Q43A 3HOUG 4DV0H 4Q0YA 1XNRH 3RBEA 2NU8B 3PW7A 5GONF 3Q1KA 4UCTA 1K1SA 3PZPA 3I0PA 4YR0A 1DV1A 4I55F 1JX4A 2XCLA 2OH2A 2B63A 3BG5A 5J2TF 1TWFA 3OTOH 3L2PA 3MR5A 2HVSA 3PW4A 2ZDHA 5KFWA 2R7MA 2PQUA 1TWHA 1SYXB 3QZ7A 4YJ2F 4DLKA 4EFEA 5KT5A 1Y1WA 4EGJA 4QW9A 4F4WA 3HOWG 5DLGA 4ZHQF 2DZDA 3OSSD 2X06A 4BY7G 5F9LA 4B8CD 4NLGA 5EWEA 5CB4F 3HBLA 4MV6A 2DGRA 4AM3A 2JEGA 5DGBA 2JA7A 4FM9A 1HNZH 2R8JA 4A3BG 3T5LA 1CQIB 3PO2G 1M0WA 3N41B 4HNTA 4DL7A 2JEFA 5BR8H 1CQJB 3KAKA 3VPBA 2FP4B 5KFRA 3FAUA 1W93A 2GPSA 2R8HA 1R9TA 3AEVB 3MFIA 3KHHA 5IYZF 3GTGA 1S03G 2ALZA 2JE6I 4GC7A 2JA8G 1IOWA 3HXLA 4J9PA 1S0NA 2NU7B 3V4SA 5FJ8G 3GTLA 4RUAA 2PY9A 3LP8A 5DGAA 3TQ1A 1C30A 3MWEA 5KG5A 4FS2A 2BR0A 2VUMA 1RK5A 2X0SA 4X64H 1WR2A 1EZ1A 3JRXA 2J6SA 4IHJF 3RJ0A 4YR2A 5KT3A 4NZTM 2DWCA 3RV4A 3RAQA 4IR1A 5KFJA 3RB6A 4FBTA 1VBGA 2AGOA 5T14A 3SE7A 3PR4A 5KFNA 5L1KA 2W70A 2ZM6H 1V9NA 2BA0A 5LL6b 2CWHA 1VS0A 2W6PA 2R87A 3KALA 4ECYA 2V59A 3BQ2A 2XGPA 4DL3A 2IBKA 1ZHQA 3EPIA 1N36H 4DV6H 4LF5H 3KDGA 1B6RA 5DG7A 5C5JA 1RYSA 4IRKA 5HV6A 2E3UA 3JAMW 4MTEA 3V69A 5KFBA 1DT4A 3R23A 5KT6A 3TIGA 3L4KA 1ODHA 4QIWE 2R92A 4EC5A 1Z2IA 2WE6A 1KJQA 5EZYF 4BBRG 1M6VA 3N44B 2E5LH 3OUZA 2LRRA 3WO1A 3EPGA 2R8IA 4A3IG 1DGSA 2IP4A 1B6SA 2FPHX 1Y14B 1HR0H 5IT9W 2HJWA 1UC8A 2M8WA 2CQYA 4MV3A 4A3JG 4Q8EA 4FBUA 3GTOA 4DUZH 1HNWH 4AQYH 4UFZA 4EBEA 5DG8A 1E4EA 5L1LA 5CA1F 4A3EG 3N8DA 3RFCA 1FKAH 2FPIB 4TV9F 2HH3A 4EGQA 2XGQA 4YQWA 3J81W 1XMQH 2O03A 4DR5H 4R7RA 1J5EH 2CTMA 2YZGA 1Z2NX 4QW8A 1XDNA 2NN6G 4LH7A 5KG1A 1WCMA 2XCPA 2G8YA 4E4TA 2WYOA 3L4JA 1VIHA 3M9OB 2UU9H 2W6OA 3N43B 4PDBA 2VUMG 1XNQH 4AYBE 4BA2I 1RK6A 4BBSG 4MV1A 1PQXA 4RZQA 2Y0SE 2JA6A 2LTMA 5LMUH 2CTFA 2DIKA 4EBDA 2R7ZG 3GIMA 1NXUA 1KJIA 5DG9A 4RZRA 1JLLB 3PO3G 4MTDA 4MA0A 3J80W 2NUAB 2R84A 3IN5A 5KKNB 1S68A 1EHIA 4A3CG 1N56A 4FJSA 5KFUA 5A2QW 4O4HF 4CC6A 4OO1G 3SI8A 2IMWP 3VKEA 2FFMA 2UVVA 5LMNH 4DR2H 1X9ZA 1ZHSA 2WAQE 5LXTF 1Y1VG 4R8UA 2AXYA 1DIKA 2K1HA 1JDEA 1S9FA 2C2DA 2E2HA 4LF7H 2CWFA 4FU0A 5IP9G 1UNNC 5FPOA 3ETJA 5HBRB 1XMOH 2R7LA 4M7EA 1I50A 4CC5A 2CTEA 4UCRA 4A3DG 4A3FG 3JSNA 2WDTA 4DV4H 3CQZA 5C44G 3WNZA 3EZJA 4JI1H 2QNDA 3C0FB 3GTQA 1CE8A 3PW5A 2Y3MA 3F8NA 2P0AA 4MV4A 3BA9A 3JSLA 3PW0A 3M9NB 4AIMA 4NXNH 4NBQA 1BJTA 2CW7A 1I94H 3K5IA 3WO0A 3Q8QB 4U7CA 5DQGA 2FLPA 5EWFA 3MR6A 4MV8A 4JV1A 5KFMA 3UQ8A 4LF4H 3J7AK 1X4NA 3GIPA 4JV2A 4QIWA 3Q8PB 3LMLA 1KJ8A 2VPSA 1DV2A 1W96A 2HGSA 4F4ZA 1RYRA 1V9PA 4DR1H 4DUYH 3T1YH 2XCAA 2PT7G 4HQ6A 1UC9A 1TA8A 4FJUA 3GV7B 3BQ1A 4J9MA 4ECUA 5C0XG 3PR5B 4JI7H 2R82A 3R5XA 2OPUA 2NVYA 2XC9A 2J6UA 4LFBH 2R8GA 3T1HH 2W9BA 2R7ZA 4YAKB 4O2AF 2MCTA 4O4LF 2WTFA 4IRCA 1F0XA 1TWCA 1WTJA 3RBDA 3ETHA 1FJGH 4DR3H 4JI0H 4ECQA 2HVRA 2RDIA 3TQTA 2GPWA 1S20A 2ZDQA 5FD6A 3KHRA 2QK4A 5JVLA 5FPRA 3QZ8A 2C28A 2OLSA 2YW2A 2R93G 2R8KA 1E4EB 2JA9A 1N48A 1I7LA 4EYIB 2Q2TA 2ZQEA 4C5AA 4YBZB 4IWXA 4QWAA 3RUPA 4G08A 2C2RA 4ZI7F 4JI3H 4BWSC 2CTLA 1S97A 3G8CA 1JDBB 5KX5F 1CS0A 3BJYA 5JUMA 4YY3H 2W7OA 3RAXA 2W6ZA 1ZZKA 3KAJA 1T94A 4DV2H 3RB3A 2FK2A 2PMZA 2RF4A 3KXYT 4ED2A 5D1PA 1S0OA 1GSOA 4Y8VB 1AUXA 2PMZE 1SCUB 3SB1A 2VR1A 4L1KA 1T3NA 1TAEA 2CTKA 2UVUA 5KFOA 1B33N 5D1OA
chains in the Genus database with same CATH topology
2WYOA 4RB2C 4JI6H 3NCVA 4JI2H 3L4JA 3OETA 1HNXH 2UU9H 3N43B 4K0KH 4PDBA 4IAJA 1IBLH 1XNQH 2O4CA 4DR4H 3QD7X 4RZQA 5D1OB 2F4VH 1I6UA 3EYYA 5LMUH 3PN1A 1N34H 2W57A 3RTXA 4LSAA 4EEQA 1N32H 4LF6H 2VUGA 2HHHH 4RB0A 3MWMA 4B3SH 4MTDA 4X66H 4GLXA 4OCHA 4MV9A 3J80W 1L2ZA 1FVIA 1BGWA 5FD5A 1S68A 4DV0H 1B04A 4Q0YA 4JYAH 3BA8A 4LF8H 1XNRH 5A2QW 2UXBH 2UXCH 4CC6A 4UCTA 3GR5A 3BAAA 1MZBA 2VOBA 4LH6A 4A2BA 5LMNH 4DR2H 1X9ZA 1ZHSA 4RB1A 3OTOH 2XIGA 3L2PA 2HVSA 2UUAH 4RAYA 1A0IA 4LF7H 2ZJTA 1SYXB 5FPOA 4EFEA 1WH2A 1XMOH 4M7EA 4CC5A 4KHPH 4UCRA 4UCOA 3OSSD 3JSNA 4UCSA 2WDTA 3RGZA 2UUCH 4B8CD 4UCVA 4DV4H 1N33H 4APMA 3BABA 5DT9A 4DV5H 3DF7A 3EZJA 4JI1H 3C0FB 4GKJH 2FE3A 2Y3MA 3F8NA 3N6XA 4B3TH 3BA9A 3JSLA 4FM9A 2LF0A 2YCHA 4NXNH 1BJTA 1HNZH 1E4GT 1I94H 2CW7A 3CVZA 1M0WA 3N41B 4GKKH 4DR7H 5BR8H 3KAKA 4JI4H 3FAUA 3N40P 3RGXA 4LSXA 3UQ8A 4LF4H 1S03G 3J7AK 4DV7H 1E4FT 3HXLA 3LMLA 2VPSA 4JI8H 1X9NA 2HGSA 2HVQA 4NZRM 1V9PA 4DR1H 4DUYH 3T1YH 2PT7G 4X65H 1M0TA 4EFBA 1TA8A 4A2AA 3KDKA 4X64H 4DV3H 4JI7H 4LFBH 3N42B 4OX9H 4ETSA 3RJ0A 3T1HH 4NZTM 2OWOA 3RF2A 4NXMH 2UUBH 2MCTA 4RAZA 1F0XA 4X62H 3RIZA 4B3RH 3GABA 1Z2PX 1FJGH 2ZM6H 4DR3H 1O75A 4LFAH 4JI0H 5LL6b 1VS0A 3K3VA 3KALA 2HVRA 2Q2UA 4JI5H 3M4IA 1ZHQA 2KSWA 1N36H 4DV6H 4LF5H 2CW8A 5FD6A 3KDGA 5FPRA 3IG0A 2VQFH 3JAMW 4LF9H 1Z2OX 3H20A 4MTEA 3L4KA 2VKCA 4E9JA 1ODHA 4OD6A 1IBKH 4EC5A 2WE6A 2Q2TA 2ZQEA 3FMAA 3N44B 2E5LH 1P8LA 4YHHH 2RGVA 4I7HA 4G08A 1DGSA 2FPHX 5IWAH 1HR0H 4DR6H 4JI3H 5IT9W 4BWSC 1AN7A 1SEIA 4RB3C 2RGRA 4DUZH 1HNWH 4AQYH 1IBMH 4DV1H 4LFCH 4B3MH 4YY3H 4UFZA 1FKAH 3KAJA 4DV2H 2UXDH 4LMYA 4UCUA 3KXYT 3J81W 1XMQH 2O03A 5D1PA 4DR5H 4R7RA 2D9IA 1J5EH 4MV7A 1GYFA 1Z2NX 3SB1A 4JV5H 1XDNA 1TAEA 4LH7A 5EOYA 4J0MA 2VQEH 5FLXW 5D1OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI6 H;  4JI2 H;  1HNX H;  2UU9 H;  4K0K H;  4PDB A;  1IBL H;  1XNQ H;  4DR4 H;  2F4V H;  1I6U A;  5LMU H;  1N34 H;  1N32 H;  4LF6 H;  2HHH H;  4B3S H;  4X66 H;  3J80 W;  4DV0 H;  4JYA H;  4LF8 H;  1XNR H;  5A2Q W;  2UXB H;  2UXC H;  5LMN H;  4DR2 H;  3OTO H;  2UUA H;  4LF7 H;  1XMO H;  4KHP H;  2UUC H;  4DV4 H;  1N33 H;  4DV5 H;  4JI1 H;  4GKJ H;  4B3T H;  4NXN H;  1HNZ H;  1I94 H;  4GKK H;  4DR7 H;  5BR8 H;  4JI4 H;  4LF4 H;  1S03 G;  3J7A K;  4DV7 H;  4JI8 H;  4DR1 H;  4DUY H;  3T1Y H;  4X65 H;  4X64 H;  4DV3 H;  4JI7 H;  4LFB H;  4OX9 H;  3T1H H;  3RF2 A;  4NXM H;  2UUB H;  4X62 H;  4B3R H;  1FJG H;  2ZM6 H;  4DR3 H;  4LFA H;  4JI0 H;  5LL6 b;  4JI5 H;  1N36 H;  4DV6 H;  4LF5 H;  2VQF H;  3JAM W;  4LF9 H;  1IBK H;  2E5L H;  4YHH H;  5IWA H;  1HR0 H;  4DR6 H;  4JI3 H;  5IT9 W;  1AN7 A;  1SEI A;  4DUZ H;  1HNW H;  4AQY H;  1IBM H;  4DV1 H;  4LFC H;  4B3M H;  4YY3 H;  1FKA H;  4DV2 H;  2UXD H;  3J81 W;  1XMQ H;  4DR5 H;  1J5E H;  4JV5 H;  2VQE H;  5FLX W; 
#chains in the Genus database with same CATH topology
 1V51 A;  1DTJ A;  3MFH A;  4BXX G;  1K1Q A;  3OET A;  3HOX G;  4K0K H;  1GSH A;  2FPP B;  1IBL H;  4IAJ A;  2O4C A;  4DR4 H;  2QYZ A;  1X4M A;  1KEE A;  3H3V H;  5EWG A;  4J9N A;  1BNC A;  2C35 B;  2PVP A;  2W57 A;  5K36 G;  2W6N A;  4YJ3 F;  4YB8 B;  4LF6 H;  2VUG A;  4RB0 A;  2AQ4 A;  3GTK A;  4U6P A;  4QMF B;  3MR2 A;  3VPD A;  5L1J A;  4MAM A;  3GTM A;  4GLX A;  1PK8 A;  1VIG A;  4OCH A;  5I47 A;  2JA5 A;  3V4Z A;  4A93 G;  1VBH A;  1BGW A;  2FKL A;  5JH7 F;  1B04 A;  3G6Y A;  4ED6 A;  4LF8 H;  5LOV F;  2UXB H;  2I87 A;  3GR5 A;  2BQ3 A;  4C5B A;  2JEB I;  1J4W A;  4LH6 A;  4ECZ A;  3M9M B;  1BXR A;  2VA2 A;  2C2E A;  4YR3 A;  2UUA H;  2I8C A;  2VPQ A;  5KFX A;  4LIJ A;  4QWD A;  4EBC A;  2R93 A;  4ECT A;  1WH2 A;  2JEA I;  4MA5 A;  3PW2 A;  4HR7 A;  4KHP H;  1RJQ A;  1GLV A;  4ZQI A;  5F9N A;  3RGZ A;  2UUC H;  1MSZ A;  4APM A;  1N33 H;  5J2U F;  3BAB A;  5DT9 A;  4DV5 H;  2M6Q A;  3DF7 A;  3NGD A;  3GV5 B;  2ZDG A;  5DLF A;  4GKJ H;  2FE3 A;  2DLN A;  3U9S A;  5KFE A;  5C1P A;  5JQW A;  5KFZ A;  5KFP A;  2LF0 A;  3CVZ A;  2NU9 B;  1GSA A;  5KFQ A;  3G6X A;  5IYD G;  3T5H A;  2FLL A;  2C22 A;  4RNN A;  1XRH A;  4DR7 H;  2W9A A;  2CTJ A;  4RNM A;  2GLT A;  3N40 P;  4O3R A;  5KFD A;  3TIN A;  4LSX A;  2I80 A;  2AGP A;  1S0M A;  4BA1 I;  4O3S A;  4DV7 H;  1E4F T;  4WD3 A;  2IA6 A;  1ZTG A;  1EUD B;  1X9N A;  2YU9 A;  2M05 A;  2HVQ A;  3K5H A;  1JXL A;  3VMM A;  1KJ9 A;  4X65 H;  1M0T A;  3UOE A;  3QFF A;  4EFB A;  2R86 A;  2W6Q A;  1WHR A;  2ASD A;  1S10 A;  2ASL A;  4XX0 B;  5BPH A;  1IOV A;  5CA0 F;  2Y0S A;  3OUU A;  4J9L A;  2DPI A;  3GKU A;  3N42 B;  4OX9 H;  4ETS A;  5KFC A;  1GGO A;  4ECV A;  2HH2 A;  5KG2 A;  2OWO A;  4NXM H;  2UUB H;  4JVH A;  4RAZ A;  4X62 H;  4B3R H;  1EUC B;  2JA5 G;  4EG0 A;  1Z2P X;  1JKJ B;  1O75 A;  2WB1 A;  3H0G A;  4LFA H;  4O3N A;  3KHL A;  4QWB A;  5C3E G;  2Q2U A;  4JI5 H;  2J6T A;  3UFX B;  4IZO A;  2ANR A;  4JVY A;  2FLN A;  3IG0 A;  3GID A;  3H20 A;  5C4X G;  1VBI A;  4ECX A;  4YAJ B;  3OHA A;  2VKC A;  2ASJ A;  3MR3 A;  1IBK H;  4AYB A;  3HB9 A;  2FK1 A;  4I4T F;  2PN1 A;  4PWQ A;  1P8L A;  4HNV A;  4I7H A;  2V5A A;  3KHG A;  3G6V A;  2SCU B;  2BL5 A;  1TWA A;  5IWA H;  2FK3 A;  4DR6 H;  2PBZ A;  2RGR A;  5KT4 A;  1AN7 A;  3V6J A;  2JA6 G;  5KG0 A;  3TII A;  1IBM H;  5JEA G;  2YZM A;  3GIQ A;  1C3O A;  5KG6 A;  5C1O A;  4TQS A;  3E5N A;  3H4B A;  4Q45 A;  5KFG A;  4J9O A;  2W6M A;  1WE8 A;  3AYH B;  4HNU A;  3KTM A;  3GIL A;  4ED0 A;  4J9R A;  3R5F A;  3MWD A;  4IRD A;  3L7Z C;  1JIH A;  4JV5 H;  4M9U A;  4QJF A;  5EOY A;  4J0M A;  5C8Y F;  3RB4 A;  2FPG B;  2VQE H;  2XIG A;  4RB2 C;  1AUV A;  5KFT A;  3OHB A;  5KFY A;  3ORR A;  5KFV A;  5CAE B;  3NCV A;  1J5K A;  4O3O A;  2JVZ A;  2V4Q A;  2BQR A;  1RJR A;  2JEI A;  5IYC G;  2YQR A;  3QD7 X;  3H0G G;  3GII A;  5D1O B;  4IR9 A;  2F4V H;  1I6U A;  1VAJ A;  5LA6 F;  4JV0 A;  4A3M G;  4GC6 A;  1N34 H;  3I12 A;  4EEQ A;  1N32 H;  5KFS A;  3GIJ A;  4XYM B;  2CZG A;  4B3S H;  4X66 H;  4MV9 A;  4O3P A;  1FVI A;  3FKI A;  5FD5 A;  3GTJ A;  5EDW A;  2ANN A;  4JYA H;  1T36 A;  2R6F A;  3BA8 A;  2JA7 G;  2UXC H;  4J9Q A;  3BAA A;  1MZB A;  2VOB A;  4A2B A;  1UG8 A;  2Z0S A;  3GLK A;  4RB1 A;  1A9X A;  1WCM G;  3H40 A;  1I7N A;  2W7P A;  2RDJ A;  4F50 A;  1GO3 E;  4RAY A;  2YRW A;  3T5J A;  2W9C A;  1A0I A;  2ZJT A;  4JUZ A;  2NU6 B;  4DL4 A;  5D8D A;  3V6H A;  1K1G A;  3FKI G;  4UCO A;  5BPF A;  5KFF A;  4UCS A;  4C5C A;  5KFK A;  3T5K A;  4UCV A;  3R5H A;  4O2B F;  1KJJ A;  2AGQ A;  3JZI A;  2V4R A;  5L1I A;  3MJF A;  1VKZ A;  4YP3 A;  4FS1 A;  3N6X A;  4B3T H;  2W9C B;  1KHM A;  3GIK A;  2JZX A;  2W8L A;  4F4X A;  2FJZ A;  2YCH A;  2UVR A;  1E4G T;  1WSC A;  4IFD G;  4GKK H;  4WBN F;  5BMV F;  4JI4 H;  5JVD F;  4ED7 A;  2DPJ A;  2VA3 A;  3RGX A;  2NVX A;  5KT7 A;  3LWB A;  2YS7 A;  4TUY F;  1V8C A;  1Y1V A;  1V4Y A;  3PVX A;  2CKZ B;  2YYA A;  4F4Y A;  4JI8 H;  5K2M A;  4NZR M;  3RB0 A;  4DL6 A;  5DQI A;  3RV3 A;  4A2A A;  5DQH A;  2YRX A;  2LTL A;  3GV8 B;  2CPM A;  3KDK A;  1K83 A;  3HOZ G;  4DL2 A;  4DV3 H;  2R7K A;  2UVW A;  1EC6 A;  3FDS A;  1ZET A;  5LYJ F;  4ECR A;  4TV8 F;  3RF2 A;  4Q8F A;  2P2R A;  3RIZ A;  2R85 A;  2YL2 A;  5KG4 A;  5KFH A;  3GAB A;  5KG7 A;  1M7J A;  1EYZ A;  2VQD A;  3JRW A;  3K3V A;  1KC7 A;  4TQR A;  3M4I A;  2C00 A;  2WB1 E;  3Q2O A;  4O3Q A;  2WAQ A;  3BQ0 A;  1ULZ A;  2KSW A;  4RU9 A;  2CW8 A;  4ED3 A;  3V6K A;  4O4I F;  3OSN A;  2VQF H;  4A3G G;  4LF9 H;  1Z2O X;  4J9S A;  4WAL A;  3U9T A;  2FMA A;  4E9J A;  4ME6 A;  5KT2 A;  5IP7 G;  2JEJ A;  4OD6 A;  4DL5 A;  1X0A A;  5L9X A;  4EEY A;  3FMA A;  4ED1 A;  2RGV A;  3OSP A;  4YHH H;  1TWG A;  2YZN A;  2XD4 A;  5KFA A;  1I3Q A;  2FMR A;  4ECS A;  4RB3 C;  2B63 G;  1SEI A;  1OWT A;  5FLM G;  4H8A A;  4DV1 H;  4LFC H;  4B3M H;  4RNO A;  4I50 F;  4A3K G;  2AU0 A;  2W8K A;  4WAN A;  2CPQ A;  2E2I A;  1WVN A;  3I4M G;  2MJH A;  3HKZ A;  2UXD H;  4LMY A;  2J9G A;  4UCU A;  2V9W A;  1Y1W G;  5H80 A;  1PX2 A;  5KG3 A;  3H4D A;  5KFL A;  4R8U B;  2R92 G;  2V58 A;  3HKZ E;  1RJP A;  4B8T A;  4QWE A;  2D9I A;  4MV7 A;  4ZOL F;  3Q8R B;  4J9K A;  1GYF A;  2R7N A;  3ORQ A;  3HOY G;  1ZQ7 A;  3U1K A;  4ED8 A;  5FLX W;  4EYH B;  4BY1 G;  4JI6 H;  4Q44 A;  4G3I A;  2A1S A;  4JI2 H;  1KBL A;  1TUA A;  1HNX H;  2W71 A;  5KFI A;  5LP6 F;  3GQC A;  1ZZI A;  4IWY A;  2W9B B;  4C2M A;  4XZ3 B;  4RUC A;  1SFO A;  3EYY A;  4ECW A;  3PN1 A;  3RTX A;  4LSA A;  5IYB G;  2HHH H;  2OPV A;  4HYK A;  1ZZJ A;  3K3P A;  3MWM A;  2BQU A;  4XYL B;  2YS6 A;  3VPC A;  3GTP A;  3Q8S B;  4A3L G;  4QWC A;  2ATL A;  1L2Z A;  3HOV G;  2FB9 A;  3I4N G;  4Q43 A;  3HOU G;  4DV0 H;  4Q0Y A;  1XNR H;  3RBE A;  2NU8 B;  3PW7 A;  5GON F;  3Q1K A;  4UCT A;  1K1S A;  3PZP A;  3I0P A;  4YR0 A;  1DV1 A;  4I55 F;  1JX4 A;  2XCL A;  2OH2 A;  2B63 A;  3BG5 A;  5J2T F;  1TWF A;  3OTO H;  3L2P A;  3MR5 A;  2HVS A;  3PW4 A;  2ZDH A;  5KFW A;  2R7M A;  2PQU A;  1TWH A;  1SYX B;  3QZ7 A;  4YJ2 F;  4DLK A;  4EFE A;  5KT5 A;  1Y1W A;  4EGJ A;  4QW9 A;  4F4W A;  3HOW G;  5DLG A;  4ZHQ F;  2DZD A;  3OSS D;  2X06 A;  4BY7 G;  5F9L A;  4B8C D;  4NLG A;  5EWE A;  5CB4 F;  3HBL A;  4MV6 A;  2DGR A;  4AM3 A;  2JEG A;  5DGB A;  2JA7 A;  4FM9 A;  1HNZ H;  2R8J A;  4A3B G;  3T5L A;  1CQI B;  3PO2 G;  1M0W A;  3N41 B;  4HNT A;  4DL7 A;  2JEF A;  5BR8 H;  1CQJ B;  3KAK A;  3VPB A;  2FP4 B;  5KFR A;  3FAU A;  1W93 A;  2GPS A;  2R8H A;  1R9T A;  3AEV B;  3MFI A;  3KHH A;  5IYZ F;  3GTG A;  1S03 G;  2ALZ A;  2JE6 I;  4GC7 A;  2JA8 G;  1IOW A;  3HXL A;  4J9P A;  1S0N A;  2NU7 B;  3V4S A;  5FJ8 G;  3GTL A;  4RUA A;  2PY9 A;  3LP8 A;  5DGA A;  3TQ1 A;  1C30 A;  3MWE A;  5KG5 A;  4FS2 A;  2BR0 A;  2VUM A;  1RK5 A;  2X0S A;  4X64 H;  1WR2 A;  1EZ1 A;  3JRX A;  2J6S A;  4IHJ F;  3RJ0 A;  4YR2 A;  5KT3 A;  4NZT M;  2DWC A;  3RV4 A;  3RAQ A;  4IR1 A;  5KFJ A;  3RB6 A;  4FBT A;  1VBG A;  2AGO A;  5T14 A;  3SE7 A;  3PR4 A;  5KFN A;  5L1K A;  2W70 A;  2ZM6 H;  1V9N A;  2BA0 A;  5LL6 b;  2CWH A;  1VS0 A;  2W6P A;  2R87 A;  3KAL A;  4ECY A;  2V59 A;  3BQ2 A;  2XGP A;  4DL3 A;  2IBK A;  1ZHQ A;  3EPI A;  1N36 H;  4DV6 H;  4LF5 H;  3KDG A;  1B6R A;  5DG7 A;  5C5J A;  1RYS A;  4IRK A;  5HV6 A;  2E3U A;  3JAM W;  4MTE A;  3V69 A;  5KFB A;  1DT4 A;  3R23 A;  5KT6 A;  3TIG A;  3L4K A;  1ODH A;  4QIW E;  2R92 A;  4EC5 A;  1Z2I A;  2WE6 A;  1KJQ A;  5EZY F;  4BBR G;  1M6V A;  3N44 B;  2E5L H;  3OUZ A;  2LRR A;  3WO1 A;  3EPG A;  2R8I A;  4A3I G;  1DGS A;  2IP4 A;  1B6S A;  2FPH X;  1Y14 B;  1HR0 H;  5IT9 W;  2HJW A;  1UC8 A;  2M8W A;  2CQY A;  4MV3 A;  4A3J G;  4Q8E A;  4FBU A;  3GTO A;  4DUZ H;  1HNW H;  4AQY H;  4UFZ A;  4EBE A;  5DG8 A;  1E4E A;  5L1L A;  5CA1 F;  4A3E G;  3N8D A;  3RFC A;  1FKA H;  2FPI B;  4TV9 F;  2HH3 A;  4EGQ A;  2XGQ A;  4YQW A;  3J81 W;  1XMQ H;  2O03 A;  4DR5 H;  4R7R A;  1J5E H;  2CTM A;  2YZG A;  1Z2N X;  4QW8 A;  1XDN A;  2NN6 G;  4LH7 A;  5KG1 A;  1WCM A;  2XCP A;  2G8Y A;  4E4T A;  2WYO A;  3L4J A;  1VIH A;  3M9O B;  2UU9 H;  2W6O A;  3N43 B;  4PDB A;  2VUM G;  1XNQ H;  4AYB E;  4BA2 I;  1RK6 A;  4BBS G;  4MV1 A;  1PQX A;  4RZQ A;  2Y0S E;  2JA6 A;  2LTM A;  5LMU H;  2CTF A;  2DIK A;  4EBD A;  2R7Z G;  3GIM A;  1NXU A;  1KJI A;  5DG9 A;  4RZR A;  1JLL B;  3PO3 G;  4MTD A;  4MA0 A;  3J80 W;  2NUA B;  2R84 A;  3IN5 A;  5KKN B;  1S68 A;  1EHI A;  4A3C G;  1N56 A;  4FJS A;  5KFU A;  5A2Q W;  4O4H F;  4CC6 A;  4OO1 G;  3SI8 A;  2IMW P;  3VKE A;  2FFM A;  2UVV A;  5LMN H;  4DR2 H;  1X9Z A;  1ZHS A;  2WAQ E;  5LXT F;  1Y1V G;  4R8U A;  2AXY A;  1DIK A;  2K1H A;  1JDE A;  1S9F A;  2C2D A;  2E2H A;  4LF7 H;  2CWF A;  4FU0 A;  5IP9 G;  1UNN C;  5FPO A;  3ETJ A;  5HBR B;  1XMO H;  2R7L A;  4M7E A;  1I50 A;  4CC5 A;  2CTE A;  4UCR A;  4A3D G;  4A3F G;  3JSN A;  2WDT A;  4DV4 H;  3CQZ A;  5C44 G;  3WNZ A;  3EZJ A;  4JI1 H;  2QND A;  3C0F B;  3GTQ A;  1CE8 A;  3PW5 A;  2Y3M A;  3F8N A;  2P0A A;  4MV4 A;  3BA9 A;  3JSL A;  3PW0 A;  3M9N B;  4AIM A;  4NXN H;  4NBQ A;  1BJT A;  2CW7 A;  1I94 H;  3K5I A;  3WO0 A;  3Q8Q B;  4U7C A;  5DQG A;  2FLP A;  5EWF A;  3MR6 A;  4MV8 A;  4JV1 A;  5KFM A;  3UQ8 A;  4LF4 H;  3J7A K;  1X4N A;  3GIP A;  4JV2 A;  4QIW A;  3Q8P B;  3LML A;  1KJ8 A;  2VPS A;  1DV2 A;  1W96 A;  2HGS A;  4F4Z A;  1RYR A;  1V9P A;  4DR1 H;  4DUY H;  3T1Y H;  2XCA A;  2PT7 G;  4HQ6 A;  1UC9 A;  1TA8 A;  4FJU A;  3GV7 B;  3BQ1 A;  4J9M A;  4ECU A;  5C0X G;  3PR5 B;  4JI7 H;  2R82 A;  3R5X A;  2OPU A;  2NVY A;  2XC9 A;  2J6U A;  4LFB H;  2R8G A;  3T1H H;  2W9B A;  2R7Z A;  4YAK B;  4O2A F;  2MCT A;  4O4L F;  2WTF A;  4IRC A;  1F0X A;  1TWC A;  1WTJ A;  3RBD A;  3ETH A;  1FJG H;  4DR3 H;  4JI0 H;  4ECQ A;  2HVR A;  2RDI A;  3TQT A;  2GPW A;  1S20 A;  2ZDQ A;  5FD6 A;  3KHR A;  2QK4 A;  5JVL A;  5FPR A;  3QZ8 A;  2C28 A;  2OLS A;  2YW2 A;  2R93 G;  2R8K A;  1E4E B;  2JA9 A;  1N48 A;  1I7L A;  4EYI B;  2Q2T A;  2ZQE A;  4C5A A;  4YBZ B;  4IWX A;  4QWA A;  3RUP A;  4G08 A;  2C2R A;  4ZI7 F;  4JI3 H;  4BWS C;  2CTL A;  1S97 A;  3G8C A;  1JDB B;  5KX5 F;  1CS0 A;  3BJY A;  5JUM A;  4YY3 H;  2W7O A;  3RAX A;  2W6Z A;  1ZZK A;  3KAJ A;  1T94 A;  4DV2 H;  3RB3 A;  2FK2 A;  2PMZ A;  2RF4 A;  3KXY T;  4ED2 A;  5D1P A;  1S0O A;  1GSO A;  4Y8V B;  1AUX A;  2PMZ E;  1SCU B;  3SB1 A;  2VR1 A;  4L1K A;  1T3N A;  1TAE A;  2CTK A;  2UVU A;  5KFO A;  1B33 N;  5D1O A; 
#chains in the Genus database with same CATH homology
 2WYO A;  4RB2 C;  4JI6 H;  3NCV A;  4JI2 H;  3L4J A;  3OET A;  1HNX H;  2UU9 H;  3N43 B;  4K0K H;  4PDB A;  4IAJ A;  1IBL H;  1XNQ H;  2O4C A;  4DR4 H;  3QD7 X;  4RZQ A;  5D1O B;  2F4V H;  1I6U A;  3EYY A;  5LMU H;  3PN1 A;  1N34 H;  2W57 A;  3RTX A;  4LSA A;  4EEQ A;  1N32 H;  4LF6 H;  2VUG A;  2HHH H;  4RB0 A;  3MWM A;  4B3S H;  4MTD A;  4X66 H;  4GLX A;  4OCH A;  4MV9 A;  3J80 W;  1L2Z A;  1FVI A;  1BGW A;  5FD5 A;  1S68 A;  4DV0 H;  1B04 A;  4Q0Y A;  4JYA H;  3BA8 A;  4LF8 H;  1XNR H;  5A2Q W;  2UXB H;  2UXC H;  4CC6 A;  4UCT A;  3GR5 A;  3BAA A;  1MZB A;  2VOB A;  4LH6 A;  4A2B A;  5LMN H;  4DR2 H;  1X9Z A;  1ZHS A;  4RB1 A;  3OTO H;  2XIG A;  3L2P A;  2HVS A;  2UUA H;  4RAY A;  1A0I A;  4LF7 H;  2ZJT A;  1SYX B;  5FPO A;  4EFE A;  1WH2 A;  1XMO H;  4M7E A;  4CC5 A;  4KHP H;  4UCR A;  4UCO A;  3OSS D;  3JSN A;  4UCS A;  2WDT A;  3RGZ A;  2UUC H;  4B8C D;  4UCV A;  4DV4 H;  1N33 H;  4APM A;  3BAB A;  5DT9 A;  4DV5 H;  3DF7 A;  3EZJ A;  4JI1 H;  3C0F B;  4GKJ H;  2FE3 A;  2Y3M A;  3F8N A;  3N6X A;  4B3T H;  3BA9 A;  3JSL A;  4FM9 A;  2LF0 A;  2YCH A;  4NXN H;  1BJT A;  1HNZ H;  1E4G T;  1I94 H;  2CW7 A;  3CVZ A;  1M0W A;  3N41 B;  4GKK H;  4DR7 H;  5BR8 H;  3KAK A;  4JI4 H;  3FAU A;  3N40 P;  3RGX A;  4LSX A;  3UQ8 A;  4LF4 H;  1S03 G;  3J7A K;  4DV7 H;  1E4F T;  3HXL A;  3LML A;  2VPS A;  4JI8 H;  1X9N A;  2HGS A;  2HVQ A;  4NZR M;  1V9P A;  4DR1 H;  4DUY H;  3T1Y H;  2PT7 G;  4X65 H;  1M0T A;  4EFB A;  1TA8 A;  4A2A A;  3KDK A;  4X64 H;  4DV3 H;  4JI7 H;  4LFB H;  3N42 B;  4OX9 H;  4ETS A;  3RJ0 A;  3T1H H;  4NZT M;  2OWO A;  3RF2 A;  4NXM H;  2UUB H;  2MCT A;  4RAZ A;  1F0X A;  4X62 H;  3RIZ A;  4B3R H;  3GAB A;  1Z2P X;  1FJG H;  2ZM6 H;  4DR3 H;  1O75 A;  4LFA H;  4JI0 H;  5LL6 b;  1VS0 A;  3K3V A;  3KAL A;  2HVR A;  2Q2U A;  4JI5 H;  3M4I A;  1ZHQ A;  2KSW A;  1N36 H;  4DV6 H;  4LF5 H;  2CW8 A;  5FD6 A;  3KDG A;  5FPR A;  3IG0 A;  2VQF H;  3JAM W;  4LF9 H;  1Z2O X;  3H20 A;  4MTE A;  3L4K A;  2VKC A;  4E9J A;  1ODH A;  4OD6 A;  1IBK H;  4EC5 A;  2WE6 A;  2Q2T A;  2ZQE A;  3FMA A;  3N44 B;  2E5L H;  1P8L A;  4YHH H;  2RGV A;  4I7H A;  4G08 A;  1DGS A;  2FPH X;  5IWA H;  1HR0 H;  4DR6 H;  4JI3 H;  5IT9 W;  4BWS C;  1AN7 A;  1SEI A;  4RB3 C;  2RGR A;  4DUZ H;  1HNW H;  4AQY H;  1IBM H;  4DV1 H;  4LFC H;  4B3M H;  4YY3 H;  4UFZ A;  1FKA H;  3KAJ A;  4DV2 H;  2UXD H;  4LMY A;  4UCU A;  3KXY T;  3J81 W;  1XMQ H;  2O03 A;  5D1P A;  4DR5 H;  4R7R A;  2D9I A;  1J5E H;  4MV7 A;  1GYF A;  1Z2N X;  3SB1 A;  4JV5 H;  1XDN A;  1TAE A;  4LH7 A;  5EOY A;  4J0M A;  2VQE H;  5FLX W;  5D1O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...