4PDBA

Crystal structure of bacillus anthracis ribosomal protein s8 in complex with an rna aptamer
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
129
structure length
129
Chain Sequence
TDPIADMLTRIRNANMVRHEKLEVPASKIKKEIAELLKREGFIRDVEYIEDNKQGILRIFLKYGANNERVITGLKRISKPGLRVYAKADEVPRVLNGLGIALVSTSKGVMTDKDARQLQTGGEVVAYVW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure analysis of free and bound states of an RNA aptamer against ribosomal protein S8 from Bacillus anthracis.
pubmed doi rcsb
source organism Bacillus anthracis
molecule tags Ribosomal protein/rna
molecule keywords 30S ribosomal protein S8
total genus 33
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2014-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00410 Ribosomal_S8 Ribosomal protein S8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.30 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 4pdbA01
3.30.1490.10 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4pdbA02
2UUBH 1I6UA 1HNZH 4DR4H 3JAMW 3J80W 2E5LH 4OX9H 4K0KH 5LMUH 1N32H 4LF6H 1SEIA 4JV5H 4LF9H 4JI5H 4DV2H 3RF2A 4DR1H 2UUCH 2UXBH 4DR7H 4GKJH 1IBLH 5LL6b 4JI0H 1IBKH 4LF4H 4B3MH 1XMQH 4AQYH 2HHHH 5LMNH 4DR2H 2UU9H 1FJGH 4X65H 4LF5H 2VQEH 4DV0H 3T1YH 1FKAH 4DUYH 4JI7H 4DV1H 4LFBH 4DV6H 4B3RH 4DV7H 2VQFH 4X64H 4NXMH 4YHHH 4JI6H 2UXCH 4DV5H 4JI4H 1HNXH 4DUZH 1XNQH 1I94H 4KHPH 3J81W 4JI2H 3J7AK 1S03G 4DR3H 1XNRH 3OTOH 4JYAH 4X62H 4LFAH 1HR0H 1N36H 1N33H 3T1HH 1XMOH 4LFCH 1IBMH 2F4VH 5A2QW 5BR8H 2ZM6H 2UUAH 4NXNH 4JI1H 4JI8H 4JI3H 4X66H 4GKKH 4LF7H 4YY3H 5FLXW 1HNWH 1AN7A 4DV4H 5IT9W 4B3TH 4DR5H 1N34H 1J5EH 4DR6H 4PDBA 5IWAH 4LF8H 2UXDH 4DV3H 4B3SH
chains in the Genus database with same CATH superfamily
1RJPA 4ZQIA 1VIHA 1HNZH 1V9PA 4TQSA 4MTEA 3RB4A 5KFWA 4Q8FA 4GC6A 4RB0A 4YR2A 3MR3A 2NU6B 4IRDA 4UCOA 1X9ZA 3R5HA 3OSSD 2AGOA 1SFOA 4JI5H 3N8DA 2R7MA 3Q1KA 2FPGB 4O4IF 4MTDA 4R8UB 4DL2A 3HOZG 3GIDA 4JUZA 4DV2H 4AIMA 2R93G 4FU0A 2XCAA 3V6JA 4DR1H 3HB9A 1GGOA 3PO2G 2NU9B 2FLPA 1VAJA 1GO3E 1WR2A 4H8AA 1VBGA 2HH2A 4YAJB 5JVDF 5JVLA 5JUMA 2W9BA 3SE7A 3EYYA 5EDWA 3N6XA 2W7OA 5H80A 1T3NA 3FKIG 1TUAA 1BXRA 1JKJB 4QW9A 3MWEA 5KG7A 1N56A 4O2BF 4YR0A 5L1LA 3RV4A 4UCUA 4RNOA 4TV9F 2WAQE 4QWCA 4DL7A 4DR2H 5KFJA 4YP3A 3K3PA 4FM9A 4X65H 4BBRG 5KFVA 2XC9A 2R8HA 4NZRM 4BY1G 3H0GA 2YZMA 1ZZIA 1ZETA 2VQEH 2R7ZG 1JDEA 4G3IA 1R9TA 4ZOLF 5KFMA 4IWYA 2Q2TA 4A3JG 3N42B 2RDJA 4RB2C 3HBLA 2NU7B 5KG2A 4QIWA 3PVXA 1PQXA 2HVRA 3PW0A 5KFYA 2W6QA 4X64H 5KFNA 4ECTA 4ECXA 2DWCA 1T94A 2YS6A 1GSAA 3TQ1A 2UXCH 4IRKA 1C30A 2M8WA 1DTJA 3KHRA 4DUZH 1V51A 1WCMA 1I94H 4KHPH 5IYCG 4FS1A 2YZNA 2FLNA 4RZRA 4ZHQF 5KFBA 2OLSA 2R8JA 2J6TA 3VPCA 3EZJA 2VUMG 2JE6I 1KJJA 1XNRH 3OTOH 5DG9A 5L1KA 3U9SA 3EPGA 4EBDA 1M7JA 2PVPA 4EYHB 2P2RA 1KHMA 1ULZA 4BXXG 2ASJA 2I87A 5FPOA 2E2HA 2FPPB 2HJWA 1N33H 2HVSA 3PO3G 3ORQA 4Y8VB 3RFCA 3T1HH 1XMOH 4YR3A 4ECSA 5C1PA 3NGDA 1I7LA 2PMZE 2W57A 4XYMB 5DQHA 4XX0B 3MFHA 2F4VH 1WVNA 5BR8H 4OO1G 1VBHA 1E4FT 5LXTF 5KT4A 5C3EG 2W8KA 5K36G 3I4MG 2R92A 2KSWA 1I3QA 1CQIB 4HNTA 2FJZA 4IR1A 2YS7A 1WCMG 4A2AA 3RB0A 3RBEA 1KEEA 2RDIA 4JI3H 5CA0F 2DPJA 2JVZA 5JEAG 5K2MA 3U9TA 4LF7H 4WD3A 3L4KA 3H3VH 4YQWA 3OSPA 1EUCB 5KFFA 2WTFA 1Y1WA 4HQ6A 5KFSA 3V4SA 5EWFA 4DR5H 2YL2A 1TWCA 3RV3A 2QYZA 4BA1I 3HOYG 3R5XA 4DL6A 1VKZA 3GV8B 1EC6A 3MFIA 2DGRA 3T5KA 4A3IG 4F4ZA 2JA5G 5IWAH 5KFGA 2ANRA 3N43B 5LA6F 4YBZB 4YJ3F 4I4TF 2UUBH 3IG0A 1S0OA 4MV4A 5FD5A 2QNDA 4TQRA 3PN1A 4HNVA 2E2IA 4FJUA 3M9NB 5CAEB 4DL5A 2JEFA 4ED6A 4UCVA 2E5LH 4ED1A 2GPSA 2W8LA 4OX9H 4K0KH 4MV9A 3HKZE 5KFLA 2M05A 4HNUA 4LF6H 5DQIA 5KFPA 1SEIA 2R84A 1X4NA 4JV5H 2CTFA 5F9NA 4BA2I 2JA7A 3L7ZC 4EFBA 2NUAB 1RK5A 3UQ8A 2ALZA 2HGSA 4FBUA 4JV1A 2CQYA 2K1HA 2ANNA 2R7ZA 2JA9A 2IMWP 4DR7H 1O75A 4C5BA 1IBLH 4I55F 1SCUB 4ECZA 4A3GG 1V9NA 1TAEA 2ZJTA 2VPQA 4QIWE 5J2TF 2R87A 3IN5A 1IBKH 5KFTA 2W71A 1A9XA 1K1QA 5KFOA 3PZPA 4EC5A 1WE8A 4A3MG 1S68A 3L4JA 2JEIA 3KHGA 3RBDA 3RAXA 3JZIA 5EZYF 4HR7A 1S10A 2XCPA 1Z2NX 3RB6A 1L2ZA 2HHHH 2Q2UA 2JA6A 3U1KA 1FJGH 3AYHB 5KFKA 1B04A 4LSAA 3GIJA 4F4YA 4FJSA 5KG3A 1GYFA 3WO1A 2NN6G 4LMYA 2LF0A 1W96A 2W7PA 3T1YH 2CWHA 3MR5A 3R23A 2D9IA 2X06A 1GSHA 5KX5F 4Q44A 4LFBH 5BMVF 2AXYA 5DLGA 3R5FA 4YJ2F 5J2UF 4B3RH 2CW7A 1I7NA 2R6FA 3V4ZA 1XRHA 2M6QA 2PMZA 1KC7A 4O3PA 4RAZA 2VQFH 5FLMG 3BJYA 1J4WA 4JI6H 2W6NA 4J9SA 4MV3A 1Y14B 4O4HF 4J9OA 2FFMA 1V4YA 4DV5H 4JI4H 5KG5A 4LIJA 4EBCA 1CE8A 2DZDA 3Q8SB 5DT9A 2AU0A 3VPDA 3HOUG 1E4EB 2Y3MA 2W6OA 1SYXB 2WDTA 4I50F 3UFXB 4ECYA 4DR3H 3T5JA 5C1OA 3M9MB 4JYAH 1WHRA 4QJFA 4OD6A 2FE3A 4QWBA 3SB1A 1VIGA 2LRRA 4A2BA 4DLKA 4TV8F 2UVRA 3GTKA 4M9UA 1DGSA 4C5AA 1M0WA 1UC8A 5KFZA 5KKNB 4ED7A 4A3LG 5BPHA 1F0XA 2R8IA 3GIPA 2VOBA 3GIMA 4A3CG 5I47A 5IP7G 1M0TA 2YW2A 4RU9A 3GR5A 4ED8A 1NXUA 3QD7X 3BQ2A 4M7EA 2JEGA 2FK1A 4RUAA 2CKZB 2C35B 2C00A 4U6PA 2ZM6H 4MAMA 1DIKA 2UUAH 4NXNH 1BJTA 4C2MA 2GLTA 4JI1H 4ECQA 2IBKA 2AQ4A 3KTMA 2PT7G 4O3SA 1RYSA 1DV1A 2YYAA 5L1JA 3RIZA 1BGWA 2CTLA 2JEAI 4O3OA 1X0AA 4F4WA 4AYBA 1ZHSA 3BA8A 4EEQA 3QFFA 3HKZA 4Q45A 4EEYA 2W6PA 1AN7A 1UC9A 2W9CB 1K1SA 2FMAA 4O3NA 3KDGA 1N34H 2WYOA 4EGQA 1J5EH 1RYRA 1A0IA 5EWEA 1XDNA 2YU9A 1MZBA 4DL4A 2CWFA 2R82A 4A3FG 4LF8H 2UXDH 3N41B 3RUPA 1Z2PX 1IOWA 3GIKA 2PY9A 3RJ0A 1I6UA 3TQTA 3GTPA 2B63A 4UCTA 1JDBB 3M4IA 3OUUA 3TIIA 3JAMW 3J80W 3F8NA 4LH7A 2I80A 5KFUA 3PR5B 3BQ1A 1X4MA 1W93A 5LMUH 1N32H 5CB4F 5D1PA 3LP8A 1KJIA 2CZGA 2IP4A 1JX4A 1ZZKA 2JA5A 4WANA 3GLKA 1DV2A 4ZI7F 4EFEA 4AM3A 3H20A 3T5HA 2UVWA 3FAUA 2UXBH 4JV2A 2SCUB 2W6ZA 3KAJA 5KG0A 5FPRA 3Q8QB 3GIIA 1VBIA 4GKJH 2FP4B 3HOVG 5LL6b 1KJQA 3ETHA 3LWBA 4YAKB 1IOVA 2P0AA 2JZXA 4GLXA 5KG4A 2FK2A 4LF4H 3H0GG 5JH7F 2PN1A 3M9OB 5DG8A 4RUCA 3TINA 2R8GA 2R8KA 2CPQA 2G8YA 3PW5A 5BPFA 2ZDHA 1B6RA 2V59A 1MSZA 4Q8EA 3MR6A 5LMNH 2YCHA 5C4XG 2CTJA 3GTJA 2ZQEA 3V69A 4LSXA 5KFQA 4LF5H 2Y0SE 5KT6A 1ZQ7A 1JXLA 4QWEA 3GIQA 4CC5A 3GTOA 1UNNC 2E3UA 3H4DA 1DT4A 5LOVF 3RGXA 1S0NA 2X0SA 4ETSA 5DGBA 2OPUA 1E4EA 1AUVA 1C3OA 3JSNA 4DV6H 1RJQA 2XIGA 1S20A 4DV7H 4RNMA 2FLLA 2ASDA 1OWTA 1KJ9A 2V9WA 5F9LA 2WE6A 1S97A 2ZDGA 2JA6G 4NXMH 1FVIA 3RB3A 4RB3C 4APMA 1X9NA 3JSLA 3KAKA 4EYIB 5KFDA 2JEBI 5D8DA 2JEJA 3K5HA 3JRWA 2FMRA 3J81W 3EPIA 3KALA 4F50A 3BABA 2V4QA 4C5CA 4GC7A 3V6HA 2LTLA 2CTKA 3NCVA 2I8CA 1S03G 2R7LA 2W70A 3V6KA 5DG7A 3GTGA 2HH3A 5C5JA 2RF4A 3HXLA 3OUZA 4IR9A 3GTMA 2DLNA 2W9CA 3G6YA 4LFAH 4MA0A 2VQDA 2R86A 2YRXA 2XCLA 4J9PA 2R93A 2QK4A 4ECWA 2FK3A 2BQ3A 2A1SA 3MWDA 3KHHA 2ASLA 1N36H 4IRCA 1WSCA 2HVQA 4JVHA 1WTJA 3PR4A 3GABA 4R8UA 4U7CA 2DPIA 3G6XA 1CS0A 4LFCH 2JA7G 1Z2IA 5LP6F 4RZQA 2RGRA 5IP9G 4A3DG 2YQRA 4UCRA 4RNNA 5C0XG 4J9MA 3N40P 3T5LA 1JLLB 1B33N 3OETA 3GV7B 1JIHA 3GV5B 2NU8B 3PW4A 5D1OB 3Q8PB 4IHJF 4JI8H 3OSNA 4WBNF 4RB1A 4ED0A 3SI8A 5KFAA 5L9XA 4GKKH 4Q43A 2J6SA 1S0MA 4BY7G 4RAYA 3G6VA 1S9FA 4YY3H 4F4XA 4EGJA 2IA6A 1HNWH 2C22A 3WNZA 2OH2A 2CTEA 5IT9W 2CW8A 1PX2A 2GPWA 3OHAA 4FBTA 2O03A 1Y1WG 2FPIB 4DL3A 2WB1A 4AYBE 4DR6H 1EYZA 4PDBA 5KFHA 4BWSC 5KT2A 4QWDA 5DGAA 2LTMA 1ZHQA 4IZOA 4YB8B 3ETJA 3GKUA 5GONF 2W9AA 4R7RA 4UFZA 1CQJB 4XYLB 2FPHX 3BAAA 2R92G 2YZGA 4ECVA 4NZTM 3FDSA 3RTXA 3QZ7A 4NBQA 1ODHA 4DR4H 1GSOA 1PK8A 5KT7A 2BA0A 3I0PA 5KT5A 5KFXA 2XGQA 3K5IA 1UG8A 4EBEA 2XD4A 1J5KA 3I12A 1TWFA 5HBRB 2ATLA 4G08A 3FMAA 3MJFA 4FS2A 4LF9H 4IAJA 2OPVA 3GILA 5HV6A 2Y0SA 2VR1A 2DIKA 3L2PA 3RF2A 1B6SA 2UUCH 3CQZA 2C2EA 3C0FB 3I4NG 3QZ8A 2VUMA 4JV0A 1ZTGA 5KFIA 2YRWA 4JI0H 4TUYF 1TWHA 2PBZA 5L1IA 3VPBA 2BR0A 4B8CD 1V8CA 4L1KA 2B63G 4BBSG 2FKLA 4QMFB 2BQRA 4B3MH 4B8TA 1XMQH 4AQYH 2J6UA 4MV8A 5KFRA 4QW8A 3Q8RB 4I7HA 2UU9H 2V4RA 5IYBG 3AEVB 3BG5A 2MCTA 1K1GA 3WO0A 1N48A 2OWOA 3KDKA 1Y1VA 4MV6A 2J9GA 5KFEA 4DV0H 1EHIA 1FKAH 5DLFA 4ECRA 2W9BB 4DUYH 2UVUA 4E9JA 4JI7H 1AUXA 3HOXG 2C28A 4DV1H 1KBLA 2AGQA 2R85A 4ME6A 1RK6A 3H40A 4O3QA 3K3VA 4J9LA 3UOEA 2AGPA 2NVXA 2FB9A 4UCSA 4J9RA 3KXYT 4IWXA 5C8YF 4A3BG 3KHLA 1Y1VG 2WAQA 3G8CA 4OCHA 4YHHH 5JQWA 5DQGA 2CTMA 2Z0SA 3MWMA 4LH6A 5D1OA 4A3EG 2XGPA 1HNXH 5IYZF 1XNQH 4MA5A 1KJ8A 4E4TA 5CA1F 3GQCA 2VUGA 3VKEA 4CC6A 1WH2A 2R7NA 2C2RA 4JI2H 3J7AK 1VS0A 3TIGA 5T14A 3GTQA 5KG1A 2VA3A 2V5AA 1GLVA 5FJ8G 3H4BA 4NLGA 2VKCA 4IFDG 4QWAA 4X62H 3RAQA 3VMMA 2UVVA 1EZ1A 1T36A 4MV7A 3MR2A 3BA9A 1K83A 4J9NA 1HR0H 3E5NA 5FD6A 2C2DA 5KG6A 1EUDB 2WB1E 4O3RA 5KT3A 4J0MA 3LMLA 3N44B 2NVYA 2BL5A 3JRXA 4ED3A 1IBMH 5A2QW 2R7KA 2JA8G 3PW2A 3DF7A 4A93G 4EG0A 2O4CA 2VPSA 3OHBA 3PW7A 2W6MA 4ECUA 2BQUA 1I50A 4A3KG 1P8LA 5EWGA 3CVZA 4XZ3B 5IYDG 3FKIA 4J9KA 4O2AF 2CPMA 1TA8A 4X66H 4O4LF 1RJRA 3BQ0A 4JVYA 5FLXW 5KFCA 1Z2OX 4HYKA 2PQUA 3HOWG 4DV4H 2MJHA 5C44G 4PWQA 4WALA 4B3TH 5LYJF 1E4GT 4ED2A 2VA2A 2V58A 4Q0YA 4MV1A 3ORRA 3GTLA 1BNCA 1M6VA 5EOYA 1TWGA 1TWAA 3Q2OA 2RGVA 4J9QA 3RGZA 4DV3H 4B3SH 2ZDQA 1ZZJA
chains in the Genus database with same CATH topology
2FPHX 3BAAA 2UUBH 3RJ0A 3IG0A 1I6UA 1HNZH 5FD5A 4NZTM 1V9PA 4UCTA 3RTXA 3PN1A 3M4IA 4MTEA 1ODHA 4DR4H 3JAMW 3J80W 4UFZA 4RB0A 3F8NA 2E5LH 4UCVA 4LH7A 4OX9H 4K0KH 4MV9A 4UCOA 1X9ZA 5LMUH 1N32H 4G08A 4LF6H 5D1PA 3FMAA 1SEIA 3OSSD 4JV5H 4LF9H 4IAJA 4JI5H 4MTDA 4EFBA 4DV2H 3UQ8A 3RF2A 2HGSA 3L2PA 4EFEA 3H20A 3FAUA 4DR1H 2UUCH 2UXBH 4R7RA 4DR7H 1O75A 3KAJA 3C0FB 5FPRA 4GKJH 1IBLH 5LL6b 1TAEA 2ZJTA 4JI0H 3EYYA 3N6XA 1IBKH 4GLXA 4B8CD 4LF4H 4EC5A 1S68A 3L4JA 4UCUA 4B3MH 1XMQH 4AQYH 1Z2NX 1L2ZA 2HHHH 5LMNH 2YCHA 4DR2H 4I7HA 2Q2UA 2UU9H 1FJGH 4FM9A 2ZQEA 4X65H 1B04A 4LSAA 1GYFA 4NZRM 4LSXA 2MCTA 2OWOA 4LF5H 3KDKA 4LMYA 2LF0A 2VQEH 4DV0H 3T1YH 1FKAH 4CC5A 4DUYH 4E9JA 4JI7H 3RGXA 2D9IA 4ETSA 2Q2TA 4DV1H 4LFBH 3JSNA 3N42B 4DV6H 4B3RH 2CW7A 2XIGA 4RB2C 3K3VA 4DV7H 4RAZA 2VQFH 3KXYT 4UCSA 2HVRA 2WE6A 4X64H 4NXMH 4OCHA 4YHHH 4JI6H 1FVIA 4RB3C 2UXCH 3MWMA 4LH6A 5D1OA 4APMA 1X9NA 3JSLA 4DV5H 4JI4H 1HNXH 4DUZH 3KAKA 1XNQH 1I94H 4KHPH 5DT9A 3J81W 2VUGA 4CC6A 3KALA 1WH2A 4JI2H 3J7AK 1VS0A 3BABA 3NCVA 2Y3MA 1S03G 1SYXB 2WDTA 3EZJA 4DR3H 3HXLA 1XNRH 2VKCA 3OTOH 4JYAH 4X62H 4LFAH 4OD6A 2FE3A 4MV7A 3SB1A 4A2BA 3BA9A 1HR0H 5FD6A 5FPOA 1N36H 1DGSA 1M0WA 1N33H 2HVQA 2HVSA 3GABA 1F0XA 3T1HH 1XMOH 2VOBA 4LFCH 3LMLA 4J0MA 3N44B 4RZQA 2W57A 2RGRA 1M0TA 4UCRA 3GR5A 1IBMH 3N40P 2F4VH 5A2QW 3QD7X 5BR8H 4M7EA 3OETA 1E4FT 3DF7A 2O4CA 2ZM6H 2KSWA 2VPSA 2UUAH 4NXNH 1BJTA 5D1OB 4JI1H 1P8LA 3CVZA 2PT7G 4A2AA 4JI8H 4RB1A 3RIZA 1BGWA 4JI3H 1TA8A 4X66H 4GKKH 1ZHSA 4LF7H 3BA8A 4RAYA 4YY3H 5FLXW 1Z2OX 4EEQA 3L4KA 1HNWH 1AN7A 4DV4H 5IT9W 2CW8A 4B3TH 4DR5H 1E4GT 4Q0YA 3KDGA 1N34H 2O03A 2WYOA 1J5EH 5EOYA 1A0IA 1XDNA 4DR6H 4PDBA 4BWSC 1MZBA 1ZHQA 2RGVA 5IWAH 4LF8H 3N43B 2UXDH 3RGZA 3N41B 4DV3H 4B3SH 1Z2PX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UUB H;  1I6U A;  1HNZ H;  4DR4 H;  3JAM W;  3J80 W;  2E5L H;  4OX9 H;  4K0K H;  5LMU H;  1N32 H;  4LF6 H;  1SEI A;  4JV5 H;  4LF9 H;  4JI5 H;  4DV2 H;  3RF2 A;  4DR1 H;  2UUC H;  2UXB H;  4DR7 H;  4GKJ H;  1IBL H;  5LL6 b;  4JI0 H;  1IBK H;  4LF4 H;  4B3M H;  1XMQ H;  4AQY H;  2HHH H;  5LMN H;  4DR2 H;  2UU9 H;  1FJG H;  4X65 H;  4LF5 H;  2VQE H;  4DV0 H;  3T1Y H;  1FKA H;  4DUY H;  4JI7 H;  4DV1 H;  4LFB H;  4DV6 H;  4B3R H;  4DV7 H;  2VQF H;  4X64 H;  4NXM H;  4YHH H;  4JI6 H;  2UXC H;  4DV5 H;  4JI4 H;  1HNX H;  4DUZ H;  1XNQ H;  1I94 H;  4KHP H;  3J81 W;  4JI2 H;  3J7A K;  1S03 G;  4DR3 H;  1XNR H;  3OTO H;  4JYA H;  4X62 H;  4LFA H;  1HR0 H;  1N36 H;  1N33 H;  3T1H H;  1XMO H;  4LFC H;  1IBM H;  2F4V H;  5A2Q W;  5BR8 H;  2ZM6 H;  2UUA H;  4NXN H;  4JI1 H;  4JI8 H;  4JI3 H;  4X66 H;  4GKK H;  4LF7 H;  4YY3 H;  5FLX W;  1HNW H;  1AN7 A;  4DV4 H;  5IT9 W;  4B3T H;  4DR5 H;  1N34 H;  1J5E H;  4DR6 H;  4PDB A;  5IWA H;  4LF8 H;  2UXD H;  4DV3 H;  4B3S H; 
#chains in the Genus database with same CATH topology
 1RJP A;  4ZQI A;  1VIH A;  1HNZ H;  1V9P A;  4TQS A;  4MTE A;  3RB4 A;  5KFW A;  4Q8F A;  4GC6 A;  4RB0 A;  4YR2 A;  3MR3 A;  2NU6 B;  4IRD A;  4UCO A;  1X9Z A;  3R5H A;  3OSS D;  2AGO A;  1SFO A;  4JI5 H;  3N8D A;  2R7M A;  3Q1K A;  2FPG B;  4O4I F;  4MTD A;  4R8U B;  4DL2 A;  3HOZ G;  3GID A;  4JUZ A;  4DV2 H;  4AIM A;  2R93 G;  4FU0 A;  2XCA A;  3V6J A;  4DR1 H;  3HB9 A;  1GGO A;  3PO2 G;  2NU9 B;  2FLP A;  1VAJ A;  1GO3 E;  1WR2 A;  4H8A A;  1VBG A;  2HH2 A;  4YAJ B;  5JVD F;  5JVL A;  5JUM A;  2W9B A;  3SE7 A;  3EYY A;  5EDW A;  3N6X A;  2W7O A;  5H80 A;  1T3N A;  3FKI G;  1TUA A;  1BXR A;  1JKJ B;  4QW9 A;  3MWE A;  5KG7 A;  1N56 A;  4O2B F;  4YR0 A;  5L1L A;  3RV4 A;  4UCU A;  4RNO A;  4TV9 F;  2WAQ E;  4QWC A;  4DL7 A;  4DR2 H;  5KFJ A;  4YP3 A;  3K3P A;  4FM9 A;  4X65 H;  4BBR G;  5KFV A;  2XC9 A;  2R8H A;  4NZR M;  4BY1 G;  3H0G A;  2YZM A;  1ZZI A;  1ZET A;  2VQE H;  2R7Z G;  1JDE A;  4G3I A;  1R9T A;  4ZOL F;  5KFM A;  4IWY A;  2Q2T A;  4A3J G;  3N42 B;  2RDJ A;  4RB2 C;  3HBL A;  2NU7 B;  5KG2 A;  4QIW A;  3PVX A;  1PQX A;  2HVR A;  3PW0 A;  5KFY A;  2W6Q A;  4X64 H;  5KFN A;  4ECT A;  4ECX A;  2DWC A;  1T94 A;  2YS6 A;  1GSA A;  3TQ1 A;  2UXC H;  4IRK A;  1C30 A;  2M8W A;  1DTJ A;  3KHR A;  4DUZ H;  1V51 A;  1WCM A;  1I94 H;  4KHP H;  5IYC G;  4FS1 A;  2YZN A;  2FLN A;  4RZR A;  4ZHQ F;  5KFB A;  2OLS A;  2R8J A;  2J6T A;  3VPC A;  3EZJ A;  2VUM G;  2JE6 I;  1KJJ A;  1XNR H;  3OTO H;  5DG9 A;  5L1K A;  3U9S A;  3EPG A;  4EBD A;  1M7J A;  2PVP A;  4EYH B;  2P2R A;  1KHM A;  1ULZ A;  4BXX G;  2ASJ A;  2I87 A;  5FPO A;  2E2H A;  2FPP B;  2HJW A;  1N33 H;  2HVS A;  3PO3 G;  3ORQ A;  4Y8V B;  3RFC A;  3T1H H;  1XMO H;  4YR3 A;  4ECS A;  5C1P A;  3NGD A;  1I7L A;  2PMZ E;  2W57 A;  4XYM B;  5DQH A;  4XX0 B;  3MFH A;  2F4V H;  1WVN A;  5BR8 H;  4OO1 G;  1VBH A;  1E4F T;  5LXT F;  5KT4 A;  5C3E G;  2W8K A;  5K36 G;  3I4M G;  2R92 A;  2KSW A;  1I3Q A;  1CQI B;  4HNT A;  2FJZ A;  4IR1 A;  2YS7 A;  1WCM G;  4A2A A;  3RB0 A;  3RBE A;  1KEE A;  2RDI A;  4JI3 H;  5CA0 F;  2DPJ A;  2JVZ A;  5JEA G;  5K2M A;  3U9T A;  4LF7 H;  4WD3 A;  3L4K A;  3H3V H;  4YQW A;  3OSP A;  1EUC B;  5KFF A;  2WTF A;  1Y1W A;  4HQ6 A;  5KFS A;  3V4S A;  5EWF A;  4DR5 H;  2YL2 A;  1TWC A;  3RV3 A;  2QYZ A;  4BA1 I;  3HOY G;  3R5X A;  4DL6 A;  1VKZ A;  3GV8 B;  1EC6 A;  3MFI A;  2DGR A;  3T5K A;  4A3I G;  4F4Z A;  2JA5 G;  5IWA H;  5KFG A;  2ANR A;  3N43 B;  5LA6 F;  4YBZ B;  4YJ3 F;  4I4T F;  2UUB H;  3IG0 A;  1S0O A;  4MV4 A;  5FD5 A;  2QND A;  4TQR A;  3PN1 A;  4HNV A;  2E2I A;  4FJU A;  3M9N B;  5CAE B;  4DL5 A;  2JEF A;  4ED6 A;  4UCV A;  2E5L H;  4ED1 A;  2GPS A;  2W8L A;  4OX9 H;  4K0K H;  4MV9 A;  3HKZ E;  5KFL A;  2M05 A;  4HNU A;  4LF6 H;  5DQI A;  5KFP A;  1SEI A;  2R84 A;  1X4N A;  4JV5 H;  2CTF A;  5F9N A;  4BA2 I;  2JA7 A;  3L7Z C;  4EFB A;  2NUA B;  1RK5 A;  3UQ8 A;  2ALZ A;  2HGS A;  4FBU A;  4JV1 A;  2CQY A;  2K1H A;  2ANN A;  2R7Z A;  2JA9 A;  2IMW P;  4DR7 H;  1O75 A;  4C5B A;  1IBL H;  4I55 F;  1SCU B;  4ECZ A;  4A3G G;  1V9N A;  1TAE A;  2ZJT A;  2VPQ A;  4QIW E;  5J2T F;  2R87 A;  3IN5 A;  1IBK H;  5KFT A;  2W71 A;  1A9X A;  1K1Q A;  5KFO A;  3PZP A;  4EC5 A;  1WE8 A;  4A3M G;  1S68 A;  3L4J A;  2JEI A;  3KHG A;  3RBD A;  3RAX A;  3JZI A;  5EZY F;  4HR7 A;  1S10 A;  2XCP A;  1Z2N X;  3RB6 A;  1L2Z A;  2HHH H;  2Q2U A;  2JA6 A;  3U1K A;  1FJG H;  3AYH B;  5KFK A;  1B04 A;  4LSA A;  3GIJ A;  4F4Y A;  4FJS A;  5KG3 A;  1GYF A;  3WO1 A;  2NN6 G;  4LMY A;  2LF0 A;  1W96 A;  2W7P A;  3T1Y H;  2CWH A;  3MR5 A;  3R23 A;  2D9I A;  2X06 A;  1GSH A;  5KX5 F;  4Q44 A;  4LFB H;  5BMV F;  2AXY A;  5DLG A;  3R5F A;  4YJ2 F;  5J2U F;  4B3R H;  2CW7 A;  1I7N A;  2R6F A;  3V4Z A;  1XRH A;  2M6Q A;  2PMZ A;  1KC7 A;  4O3P A;  4RAZ A;  2VQF H;  5FLM G;  3BJY A;  1J4W A;  4JI6 H;  2W6N A;  4J9S A;  4MV3 A;  1Y14 B;  4O4H F;  4J9O A;  2FFM A;  1V4Y A;  4DV5 H;  4JI4 H;  5KG5 A;  4LIJ A;  4EBC A;  1CE8 A;  2DZD A;  3Q8S B;  5DT9 A;  2AU0 A;  3VPD A;  3HOU G;  1E4E B;  2Y3M A;  2W6O A;  1SYX B;  2WDT A;  4I50 F;  3UFX B;  4ECY A;  4DR3 H;  3T5J A;  5C1O A;  3M9M B;  4JYA H;  1WHR A;  4QJF A;  4OD6 A;  2FE3 A;  4QWB A;  3SB1 A;  1VIG A;  2LRR A;  4A2B A;  4DLK A;  4TV8 F;  2UVR A;  3GTK A;  4M9U A;  1DGS A;  4C5A A;  1M0W A;  1UC8 A;  5KFZ A;  5KKN B;  4ED7 A;  4A3L G;  5BPH A;  1F0X A;  2R8I A;  3GIP A;  2VOB A;  3GIM A;  4A3C G;  5I47 A;  5IP7 G;  1M0T A;  2YW2 A;  4RU9 A;  3GR5 A;  4ED8 A;  1NXU A;  3QD7 X;  3BQ2 A;  4M7E A;  2JEG A;  2FK1 A;  4RUA A;  2CKZ B;  2C35 B;  2C00 A;  4U6P A;  2ZM6 H;  4MAM A;  1DIK A;  2UUA H;  4NXN H;  1BJT A;  4C2M A;  2GLT A;  4JI1 H;  4ECQ A;  2IBK A;  2AQ4 A;  3KTM A;  2PT7 G;  4O3S A;  1RYS A;  1DV1 A;  2YYA A;  5L1J A;  3RIZ A;  1BGW A;  2CTL A;  2JEA I;  4O3O A;  1X0A A;  4F4W A;  4AYB A;  1ZHS A;  3BA8 A;  4EEQ A;  3QFF A;  3HKZ A;  4Q45 A;  4EEY A;  2W6P A;  1AN7 A;  1UC9 A;  2W9C B;  1K1S A;  2FMA A;  4O3N A;  3KDG A;  1N34 H;  2WYO A;  4EGQ A;  1J5E H;  1RYR A;  1A0I A;  5EWE A;  1XDN A;  2YU9 A;  1MZB A;  4DL4 A;  2CWF A;  2R82 A;  4A3F G;  4LF8 H;  2UXD H;  3N41 B;  3RUP A;  1Z2P X;  1IOW A;  3GIK A;  2PY9 A;  3RJ0 A;  1I6U A;  3TQT A;  3GTP A;  2B63 A;  4UCT A;  1JDB B;  3M4I A;  3OUU A;  3TII A;  3JAM W;  3J80 W;  3F8N A;  4LH7 A;  2I80 A;  5KFU A;  3PR5 B;  3BQ1 A;  1X4M A;  1W93 A;  5LMU H;  1N32 H;  5CB4 F;  5D1P A;  3LP8 A;  1KJI A;  2CZG A;  2IP4 A;  1JX4 A;  1ZZK A;  2JA5 A;  4WAN A;  3GLK A;  1DV2 A;  4ZI7 F;  4EFE A;  4AM3 A;  3H20 A;  3T5H A;  2UVW A;  3FAU A;  2UXB H;  4JV2 A;  2SCU B;  2W6Z A;  3KAJ A;  5KG0 A;  5FPR A;  3Q8Q B;  3GII A;  1VBI A;  4GKJ H;  2FP4 B;  3HOV G;  5LL6 b;  1KJQ A;  3ETH A;  3LWB A;  4YAK B;  1IOV A;  2P0A A;  2JZX A;  4GLX A;  5KG4 A;  2FK2 A;  4LF4 H;  3H0G G;  5JH7 F;  2PN1 A;  3M9O B;  5DG8 A;  4RUC A;  3TIN A;  2R8G A;  2R8K A;  2CPQ A;  2G8Y A;  3PW5 A;  5BPF A;  2ZDH A;  1B6R A;  2V59 A;  1MSZ A;  4Q8E A;  3MR6 A;  5LMN H;  2YCH A;  5C4X G;  2CTJ A;  3GTJ A;  2ZQE A;  3V69 A;  4LSX A;  5KFQ A;  4LF5 H;  2Y0S E;  5KT6 A;  1ZQ7 A;  1JXL A;  4QWE A;  3GIQ A;  4CC5 A;  3GTO A;  1UNN C;  2E3U A;  3H4D A;  1DT4 A;  5LOV F;  3RGX A;  1S0N A;  2X0S A;  4ETS A;  5DGB A;  2OPU A;  1E4E A;  1AUV A;  1C3O A;  3JSN A;  4DV6 H;  1RJQ A;  2XIG A;  1S20 A;  4DV7 H;  4RNM A;  2FLL A;  2ASD A;  1OWT A;  1KJ9 A;  2V9W A;  5F9L A;  2WE6 A;  1S97 A;  2ZDG A;  2JA6 G;  4NXM H;  1FVI A;  3RB3 A;  4RB3 C;  4APM A;  1X9N A;  3JSL A;  3KAK A;  4EYI B;  5KFD A;  2JEB I;  5D8D A;  2JEJ A;  3K5H A;  3JRW A;  2FMR A;  3J81 W;  3EPI A;  3KAL A;  4F50 A;  3BAB A;  2V4Q A;  4C5C A;  4GC7 A;  3V6H A;  2LTL A;  2CTK A;  3NCV A;  2I8C A;  1S03 G;  2R7L A;  2W70 A;  3V6K A;  5DG7 A;  3GTG A;  2HH3 A;  5C5J A;  2RF4 A;  3HXL A;  3OUZ A;  4IR9 A;  3GTM A;  2DLN A;  2W9C A;  3G6Y A;  4LFA H;  4MA0 A;  2VQD A;  2R86 A;  2YRX A;  2XCL A;  4J9P A;  2R93 A;  2QK4 A;  4ECW A;  2FK3 A;  2BQ3 A;  2A1S A;  3MWD A;  3KHH A;  2ASL A;  1N36 H;  4IRC A;  1WSC A;  2HVQ A;  4JVH A;  1WTJ A;  3PR4 A;  3GAB A;  4R8U A;  4U7C A;  2DPI A;  3G6X A;  1CS0 A;  4LFC H;  2JA7 G;  1Z2I A;  5LP6 F;  4RZQ A;  2RGR A;  5IP9 G;  4A3D G;  2YQR A;  4UCR A;  4RNN A;  5C0X G;  4J9M A;  3N40 P;  3T5L A;  1JLL B;  1B33 N;  3OET A;  3GV7 B;  1JIH A;  3GV5 B;  2NU8 B;  3PW4 A;  5D1O B;  3Q8P B;  4IHJ F;  4JI8 H;  3OSN A;  4WBN F;  4RB1 A;  4ED0 A;  3SI8 A;  5KFA A;  5L9X A;  4GKK H;  4Q43 A;  2J6S A;  1S0M A;  4BY7 G;  4RAY A;  3G6V A;  1S9F A;  4YY3 H;  4F4X A;  4EGJ A;  2IA6 A;  1HNW H;  2C22 A;  3WNZ A;  2OH2 A;  2CTE A;  5IT9 W;  2CW8 A;  1PX2 A;  2GPW A;  3OHA A;  4FBT A;  2O03 A;  1Y1W G;  2FPI B;  4DL3 A;  2WB1 A;  4AYB E;  4DR6 H;  1EYZ A;  4PDB A;  5KFH A;  4BWS C;  5KT2 A;  4QWD A;  5DGA A;  2LTM A;  1ZHQ A;  4IZO A;  4YB8 B;  3ETJ A;  3GKU A;  5GON F;  2W9A A;  4R7R A;  4UFZ A;  1CQJ B;  4XYL B;  2FPH X;  3BAA A;  2R92 G;  2YZG A;  4ECV A;  4NZT M;  3FDS A;  3RTX A;  3QZ7 A;  4NBQ A;  1ODH A;  4DR4 H;  1GSO A;  1PK8 A;  5KT7 A;  2BA0 A;  3I0P A;  5KT5 A;  5KFX A;  2XGQ A;  3K5I A;  1UG8 A;  4EBE A;  2XD4 A;  1J5K A;  3I12 A;  1TWF A;  5HBR B;  2ATL A;  4G08 A;  3FMA A;  3MJF A;  4FS2 A;  4LF9 H;  4IAJ A;  2OPV A;  3GIL A;  5HV6 A;  2Y0S A;  2VR1 A;  2DIK A;  3L2P A;  3RF2 A;  1B6S A;  2UUC H;  3CQZ A;  2C2E A;  3C0F B;  3I4N G;  3QZ8 A;  2VUM A;  4JV0 A;  1ZTG A;  5KFI A;  2YRW A;  4JI0 H;  4TUY F;  1TWH A;  2PBZ A;  5L1I A;  3VPB A;  2BR0 A;  4B8C D;  1V8C A;  4L1K A;  2B63 G;  4BBS G;  2FKL A;  4QMF B;  2BQR A;  4B3M H;  4B8T A;  1XMQ H;  4AQY H;  2J6U A;  4MV8 A;  5KFR A;  4QW8 A;  3Q8R B;  4I7H A;  2UU9 H;  2V4R A;  5IYB G;  3AEV B;  3BG5 A;  2MCT A;  1K1G A;  3WO0 A;  1N48 A;  2OWO A;  3KDK A;  1Y1V A;  4MV6 A;  2J9G A;  5KFE A;  4DV0 H;  1EHI A;  1FKA H;  5DLF A;  4ECR A;  2W9B B;  4DUY H;  2UVU A;  4E9J A;  4JI7 H;  1AUX A;  3HOX G;  2C28 A;  4DV1 H;  1KBL A;  2AGQ A;  2R85 A;  4ME6 A;  1RK6 A;  3H40 A;  4O3Q A;  3K3V A;  4J9L A;  3UOE A;  2AGP A;  2NVX A;  2FB9 A;  4UCS A;  4J9R A;  3KXY T;  4IWX A;  5C8Y F;  4A3B G;  3KHL A;  1Y1V G;  2WAQ A;  3G8C A;  4OCH A;  4YHH H;  5JQW A;  5DQG A;  2CTM A;  2Z0S A;  3MWM A;  4LH6 A;  5D1O A;  4A3E G;  2XGP A;  1HNX H;  5IYZ F;  1XNQ H;  4MA5 A;  1KJ8 A;  4E4T A;  5CA1 F;  3GQC A;  2VUG A;  3VKE A;  4CC6 A;  1WH2 A;  2R7N A;  2C2R A;  4JI2 H;  3J7A K;  1VS0 A;  3TIG A;  5T14 A;  3GTQ A;  5KG1 A;  2VA3 A;  2V5A A;  1GLV A;  5FJ8 G;  3H4B A;  4NLG A;  2VKC A;  4IFD G;  4QWA A;  4X62 H;  3RAQ A;  3VMM A;  2UVV A;  1EZ1 A;  1T36 A;  4MV7 A;  3MR2 A;  3BA9 A;  1K83 A;  4J9N A;  1HR0 H;  3E5N A;  5FD6 A;  2C2D A;  5KG6 A;  1EUD B;  2WB1 E;  4O3R A;  5KT3 A;  4J0M A;  3LML A;  3N44 B;  2NVY A;  2BL5 A;  3JRX A;  4ED3 A;  1IBM H;  5A2Q W;  2R7K A;  2JA8 G;  3PW2 A;  3DF7 A;  4A93 G;  4EG0 A;  2O4C A;  2VPS A;  3OHB A;  3PW7 A;  2W6M A;  4ECU A;  2BQU A;  1I50 A;  4A3K G;  1P8L A;  5EWG A;  3CVZ A;  4XZ3 B;  5IYD G;  3FKI A;  4J9K A;  4O2A F;  2CPM A;  1TA8 A;  4X66 H;  4O4L F;  1RJR A;  3BQ0 A;  4JVY A;  5FLX W;  5KFC A;  1Z2O X;  4HYK A;  2PQU A;  3HOW G;  4DV4 H;  2MJH A;  5C44 G;  4PWQ A;  4WAL A;  4B3T H;  5LYJ F;  1E4G T;  4ED2 A;  2VA2 A;  2V58 A;  4Q0Y A;  4MV1 A;  3ORR A;  3GTL A;  1BNC A;  1M6V A;  5EOY A;  1TWG A;  1TWA A;  3Q2O A;  2RGV A;  4J9Q A;  3RGZ A;  4DV3 H;  4B3S H;  2ZDQ A;  1ZZJ A; 
#chains in the Genus database with same CATH homology
 2FPH X;  3BAA A;  2UUB H;  3RJ0 A;  3IG0 A;  1I6U A;  1HNZ H;  5FD5 A;  4NZT M;  1V9P A;  4UCT A;  3RTX A;  3PN1 A;  3M4I A;  4MTE A;  1ODH A;  4DR4 H;  3JAM W;  3J80 W;  4UFZ A;  4RB0 A;  3F8N A;  2E5L H;  4UCV A;  4LH7 A;  4OX9 H;  4K0K H;  4MV9 A;  4UCO A;  1X9Z A;  5LMU H;  1N32 H;  4G08 A;  4LF6 H;  5D1P A;  3FMA A;  1SEI A;  3OSS D;  4JV5 H;  4LF9 H;  4IAJ A;  4JI5 H;  4MTD A;  4EFB A;  4DV2 H;  3UQ8 A;  3RF2 A;  2HGS A;  3L2P A;  4EFE A;  3H20 A;  3FAU A;  4DR1 H;  2UUC H;  2UXB H;  4R7R A;  4DR7 H;  1O75 A;  3KAJ A;  3C0F B;  5FPR A;  4GKJ H;  1IBL H;  5LL6 b;  1TAE A;  2ZJT A;  4JI0 H;  3EYY A;  3N6X A;  1IBK H;  4GLX A;  4B8C D;  4LF4 H;  4EC5 A;  1S68 A;  3L4J A;  4UCU A;  4B3M H;  1XMQ H;  4AQY H;  1Z2N X;  1L2Z A;  2HHH H;  5LMN H;  2YCH A;  4DR2 H;  4I7H A;  2Q2U A;  2UU9 H;  1FJG H;  4FM9 A;  2ZQE A;  4X65 H;  1B04 A;  4LSA A;  1GYF A;  4NZR M;  4LSX A;  2MCT A;  2OWO A;  4LF5 H;  3KDK A;  4LMY A;  2LF0 A;  2VQE H;  4DV0 H;  3T1Y H;  1FKA H;  4CC5 A;  4DUY H;  4E9J A;  4JI7 H;  3RGX A;  2D9I A;  4ETS A;  2Q2T A;  4DV1 H;  4LFB H;  3JSN A;  3N42 B;  4DV6 H;  4B3R H;  2CW7 A;  2XIG A;  4RB2 C;  3K3V A;  4DV7 H;  4RAZ A;  2VQF H;  3KXY T;  4UCS A;  2HVR A;  2WE6 A;  4X64 H;  4NXM H;  4OCH A;  4YHH H;  4JI6 H;  1FVI A;  4RB3 C;  2UXC H;  3MWM A;  4LH6 A;  5D1O A;  4APM A;  1X9N A;  3JSL A;  4DV5 H;  4JI4 H;  1HNX H;  4DUZ H;  3KAK A;  1XNQ H;  1I94 H;  4KHP H;  5DT9 A;  3J81 W;  2VUG A;  4CC6 A;  3KAL A;  1WH2 A;  4JI2 H;  3J7A K;  1VS0 A;  3BAB A;  3NCV A;  2Y3M A;  1S03 G;  1SYX B;  2WDT A;  3EZJ A;  4DR3 H;  3HXL A;  1XNR H;  2VKC A;  3OTO H;  4JYA H;  4X62 H;  4LFA H;  4OD6 A;  2FE3 A;  4MV7 A;  3SB1 A;  4A2B A;  3BA9 A;  1HR0 H;  5FD6 A;  5FPO A;  1N36 H;  1DGS A;  1M0W A;  1N33 H;  2HVQ A;  2HVS A;  3GAB A;  1F0X A;  3T1H H;  1XMO H;  2VOB A;  4LFC H;  3LML A;  4J0M A;  3N44 B;  4RZQ A;  2W57 A;  2RGR A;  1M0T A;  4UCR A;  3GR5 A;  1IBM H;  3N40 P;  2F4V H;  5A2Q W;  3QD7 X;  5BR8 H;  4M7E A;  3OET A;  1E4F T;  3DF7 A;  2O4C A;  2ZM6 H;  2KSW A;  2VPS A;  2UUA H;  4NXN H;  1BJT A;  5D1O B;  4JI1 H;  1P8L A;  3CVZ A;  2PT7 G;  4A2A A;  4JI8 H;  4RB1 A;  3RIZ A;  1BGW A;  4JI3 H;  1TA8 A;  4X66 H;  4GKK H;  1ZHS A;  4LF7 H;  3BA8 A;  4RAY A;  4YY3 H;  5FLX W;  1Z2O X;  4EEQ A;  3L4K A;  1HNW H;  1AN7 A;  4DV4 H;  5IT9 W;  2CW8 A;  4B3T H;  4DR5 H;  1E4G T;  4Q0Y A;  3KDG A;  1N34 H;  2O03 A;  2WYO A;  1J5E H;  5EOY A;  1A0I A;  1XDN A;  4DR6 H;  4PDB A;  4BWS C;  1MZB A;  1ZHQ A;  2RGV A;  5IWA H;  4LF8 H;  3N43 B;  2UXD H;  3RGZ A;  3N41 B;  4DV3 H;  4B3S H;  1Z2P X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...