4PDBA

Crystal structure of bacillus anthracis ribosomal protein s8 in complex with an rna aptamer
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
129
structure length
129
Chain Sequence
TDPIADMLTRIRNANMVRHEKLEVPASKIKKEIAELLKREGFIRDVEYIEDNKQGILRIFLKYGANNERVITGLKRISKPGLRVYAKADEVPRVLNGLGIALVSTSKGVMTDKDARQLQTGGEVVAYVW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 30S ribosomal protein S8
publication title Structure analysis of free and bound states of an RNA aptamer against ribosomal protein S8 from Bacillus anthracis.
pubmed doi rcsb
source organism Bacillus anthracis
molecule tags Ribosomal protein/rna
total genus 33
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2014-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00410 Ribosomal_S8 Ribosomal protein S8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.30 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 4pdbA01
3.30.1490.10 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4pdbA02
2F4VH 5LMNH 4B3RH 1N32H 4JI7H 2UXDH 5LL6b 1IBLH 1N36H 2E5LH 2UXCH 3RF2A 4B3SH 4DR3H 4DV7H 4X65H 4LFAH 5FLXW 4JI5H 4X62H 4NXNH 1IBKH 4OX9H 4KHPH 1HR0H 4YHHH 4DR5H 4JI1H 1SEIA 4DUZH 5LMUH 4PDBA 1XNQH 2HHHH 4JI8H 4LF8H 4DV3H 4YY3H 1FKAH 4DV1H 1J5EH 4JI4H 4DV5H 1S03G 4X66H 1XNRH 4K0KH 4LF4H 4JV5H 4DR2H 5BR8H 4JI0H 3OTOH 1N33H 1FJGH 4GKJH 4DV0H 2UXBH 1N34H 2ZM6H 1HNZH 2UU9H 3T1HH 4B3TH 2VQEH 2UUAH 4DR7H 5A2QW 4LF7H 4DR1H 4JI6H 3J7AK 4GKKH 4DUYH 1XMQH 4LF6H 4JYAH 1AN7A 1IBMH 4DR6H 1HNXH 4JI3H 4DV6H 1XMOH 4LFBH 3JAMW 1HNWH 4AQYH 4JI2H 4LF5H 1I6UA 3J80W 4DR4H 4LFCH 4NXMH 5IT9W 3T1YH 4B3MH 1I94H 2VQFH 5IWAH 4LF9H 4DV4H 4X64H 2UUBH 4DV2H 3J81W 2UUCH
chains in the Genus database with same CATH superfamily
4IHJF 2J9GA 2BA0A 2W6MA 4A3DG 4O3OA 2F4VH 2R85A 2C2DA 2FKLA 2Y0SA 1O75A 2FLNA 5LMNH 5KFGA 5DG7A 2J6TA 4MV4A 3LP8A 5LP6F 1TWGA 5C1PA 5KFJA 4A2BA 3GIJA 2R6FA 4B8CD 5IYDG 2YQRA 4O3NA 2M8WA 1GLVA 3GV8B 4LIJA 5KG3A 2J6UA 4QWAA 4Q0YA 1M6VA 5L9XA 4IRDA 3GIKA 1B6RA 2UXCH 1WCMG 2YZMA 3KALA 4UCTA 5KFWA 2W9BA 4ECWA 2ASDA 5KFSA 2R7LA 4HQ6A 1PQXA 2W6PA 2PMZA 3Q8SB 5J2UF 5L1IA 4J9KA 4GC6A 4JV1A 5C1OA 5D8DA 2JA7A 1RK6A 3SB1A 5FLXW 1ULZA 3QFFA 1Y14B 4O4IF 5LA6F 5KG6A 4C2MA 3T5LA 3KAKA 4YP3A 3BA8A 5FLMG 4ED6A 4FM9A 3SI8A 1HR0H 4RB2C 1WH2A 3VPBA 2ZJTA 4DR5H 3KHGA 3GQCA 4O3RA 4PDBA 3TQTA 5KKNB 1XNQH 3I12A 3TQ1A 4EGJA 3PO3G 3GTQA 2YRWA 2JEGA 4BXXG 1ZETA 4JV0A 4FS2A 4MV3A 2IA6A 2ZDHA 3T5JA 2GPSA 2R8GA 4QWCA 3JSLA 4H8AA 1KJQA 2FK1A 2GPWA 5KFVA 3RGXA 4J9OA 4YY3H 3AYHB 2R8JA 1FKAH 3PW0A 4I7HA 1RJPA 5DGBA 3BAAA 2W8KA 4QWBA 4AM3A 4C5BA 4YJ2F 1Z2OX 2CZGA 4MV1A 5KFDA 4GC7A 3JSNA 3RAXA 2W6NA 3M9OB 1C3OA 2W57A 4J0MA 2W7PA 4MV6A 4DR2H 5BR8H 4O3QA 5F9NA 4A3JG 2CW7A 1RK5A 5FPOA 3RJ0A 5EDWA 2R8IA 2AGQA 1M7JA 1WE8A 1DGSA 2FPGB 2CTJA 1UNNC 3OETA 5KX5F 5KT7A 1FJGH 4DL4A 5KFOA 4YQWA 4CC6A 2YL2A 4GKJH 2UXBH 3MWEA 1JXLA 5KFRA 4A3BG 2AGPA 3U9TA 2HVQA 2A1SA 1VKZA 3HKZE 4ECRA 4G3IA 1GSAA 4O2AF 4YR2A 4DR7H 2CTFA 4BA1I 1A0IA 2YZGA 4A3IG 5IP9G 4UFZA 5KG7A 5KG1A 4WBNF 2C35B 3PW2A 2R86A 5KT4A 4EBEA 2W6ZA 1TWHA 2LTMA 5K2MA 1XMQH 1T94A 2GLTA 4LF6H 4YAJB 5KG4A 2VKCA 2VQDA 3BABA 3FKIA 4RNOA 5IP7G 4JYAH 4F4WA 2AXYA 1E4FT 1M0TA 1TWFA 4F4ZA 4XYMB 4ME6A 5KFZA 3TINA 5JEAG 2BR0A 2UVVA 4ED1A 1XMOH 4MV8A 3RIZA 4DL5A 3T5HA 1EHIA 3RTXA 1HNWH 4AQYH 4YAKB 4JI2H 4LF5H 5KT5A 3R5XA 3RB6A 2Q2TA 2Y0SE 4RAYA 2C2RA 3N6XA 1I7NA 4NXMH 4MV7A 4RZRA 5CA0F 3OHBA 2VUGA 3HB9A 3V4ZA 2W9BB 2JE6I 1V4YA 2O03A 2NVXA 2FPPB 3G6XA 1Z2IA 1VIHA 4L1KA 3PO2G 2HH3A 5EWEA 3GTPA 3HBLA 4I4TF 3QZ8A 2NU9B 2HVRA 1WVNA 4O4HF 1XRHA 2DLNA 3IG0A 3HOZG 5KFAA 2B63A 4C5CA 2PMZE 3BG5A 2ZDQA 1KHMA 3G8CA 4EFEA 4DL6A 4RB3C 2JA5G 3EPGA 2VUMA 4O2BF 4A3LG 2OWOA 1NXUA 1TA8A 5KFEA 3RV3A 3H0GA 3BQ0A 1KJ8A 1X4NA 3V6HA 3GIQA 4B3SH 1K1QA 2C00A 4UCVA 4DV7H 5FPRA 1I50A 4F50A 3ORQA 4X65H 4FJSA 1ZHSA 3LMLA 3OUZA 4MA0A 5D1OA 4QJFA 4EG0A 5JH7F 1RYRA 2DPIA 3H20A 2FK3A 2E3UA 4JI5H 5CAEB 2BQ3A 4MAMA 3VPDA 2AGOA 5LYJF 3KXYT 4KHPH 2D9IA 3KAJA 5BPFA 3I4MG 4EEYA 5JQWA 3MR6A 2R84A 1GO3E 3RAQA 2JEAI 4BA2I 1X0AA 2FPHX 5J2TF 1SEIA 1MSZA 4MA5A 4DUZH 3LWBA 4QIWA 4UCOA 2W70A 2ANNA 4FU0A 5I47A 2OPVA 3F8NA 4BBSG 4QW8A 5K36G 3GV5B 1Z2NX 2PBZA 4QW9A 2V58A 2NU8B 1V9NA 3FAUA 4JI8H 2X06A 4LF8H 1JDBB 5IYZF 1T3NA 2JA7G 4EEQA 4DV3H 2AU0A 4O3SA 1C30A 3FDSA 2WDTA 4JI4H 1P8LA 4JVYA 3Q8RB 5CB4F 3AEVB 4RZQA 4J9QA 4X66H 3DF7A 5KFLA 2W9CA 2ZQEA 4Q44A 3L4KA 2YCHA 5C3EG 4A3GG 4K0KH 4EBCA 2R92A 2M6QA 2UVWA 2IP4A 5FD5A 1BNCA 1S0MA 3V6KA 2FE3A 3L4JA 2Q2UA 5EWGA 3NCVA 1Z2PX 5IYBG 4PWQA 3CVZA 3CQZA 3M9NB 4WALA 3ORRA 4NZTM 2V9WA 3Q8PB 1SYXB 1JDEA 3H3VH 1HNZH 4OCHA 3T1HH 3GIDA 3HOWG 4B3TH 3RFCA 5KFIA 5KFFA 2UUAH 5C4XG 2FLPA 5IYCG 3HOYG 2FK2A 4JVHA 4ZHQF 5KFTA 3KTMA 3UFXB 5KFCA 1CQIB 2QK4A 3OUUA 3WO1A 5HV6A 3MR3A 4ZQIA 1IOWA 4JI6H 4Q43A 3PN1A 3ETHA 3PZPA 3PW5A 1I7LA 4ECXA 1EYZA 2LF0A 4ECZA 4AYBE 2OH2A 5DQIA 1TAEA 5DLGA 2RDIA 1WHRA 1ZZIA 4FBTA 3HOVG 4F4YA 4LH6A 4EFBA 4EYHB 2Z0SA 2CWFA 3TIIA 1AN7A 1V9PA 5C5JA 3V4SA 2JZXA 3ETJA 2BL5A 2ASJA 1S20A 5LXTF 3GTJA 4LFBH 1EZ1A 2IMWP 5L1JA 1OWTA 3JAMW 2E2HA 3GIIA 2R8HA 2WB1A 3J80W 1W93A 4QWEA 1E4EA 3RGZA 2VPSA 4IFDG 3FMAA 1RJQA 2R93A 4RUAA 2J6SA 1I94H 2VQFH 2WYOA 4BWSC 3OSPA 4LF9H 2VA3A 2VPQA 1ZZJA 2W6OA 2PQUA 4DV2H 3GTLA 3PW4A 2ANRA 2UUCH 3E5NA 1DV1A 5D1OB 5KFQA 4HR7A 2R7NA 4JUZA 5D1PA 2HJWA 4Q45A 2ATLA 5T14A 2RF4A 4J9MA 1MZBA 2R7ZG 4IR9A 4I55F 2DWCA 2I80A 5KFYA 3VPCA 4HNVA 4JI7H 1JIHA 2FMAA 3M4IA 2XCPA 1K1GA 3I0PA 1EC6A 2JEBI 1A9XA 4YR0A 5C8YF 2CTMA 1AUVA 1IBLH 1VS0A 2PVPA 2CQYA 4A2AA 1N36H 2R82A 2E5LH 3UQ8A 1V8CA 3RF2A 1BGWA 2KSWA 4E9JA 2OLSA 1KJ9A 4QIWE 3GR5A 4QWDA 1K83A 2MCTA 4LFAH 1W96A 4TUYF 2SCUB 2YYAA 3N40P 4WD3A 1ZQ7A 2B63G 5JUMA 3GTOA 1Y1WA 3M9MB 3MJFA 3BA9A 4TV9F 4Q8FA 4RB0A 3RV4A 4AIMA 5GONF 4X62H 2G8YA 4NXNH 4OX9H 5JVDF 1J5KA 2W9CB 2LRRA 1DT4A 1F0XA 3GTKA 2CWHA 1GYFA 3PW7A 3KDGA 4JI1H 1ZHQA 2R8KA 2AQ4A 2QYZA 4JV2A 4A3MG 3JZIA 4IR1A 1S0OA 5DT9A 3RB0A 3MR5A 4FS1A 2CKZB 3GTMA 3Q1KA 3EZJA 4IZOA 3WO0A 5KFMA 2FFMA 4DV1H 2FP4B 1J4WA 3TIGA 2YS7A 1S03G 5KFUA 4A3EG 2JA6A 5LOVF 4RB1A 3G6VA 2WE6A 1XNRH 2XIGA 4LF4H 4BY1G 3N41B 3U1KA 4J9SA 2P0AA 2BQUA 2Y3MA 5FD6A 3HKZA 3K3PA 5CA1F 3PR5B 1WTJA 5L1KA 2W71A 1M0WA 4RUCA 2RGVA 1B6SA 4IRKA 1UC8A 3H4DA 4ETSA 2JEJA 3Q8QB 3KHLA 1VBIA 5KT6A 4U6PA 2UVRA 4DV0H 1KJIA 2XD4A 2ZM6H 4YR3A 1IOVA 3R5FA 3MFIA 2UU9H 4Y8VB 4EBDA 3G6YA 1Y1VA 2CPMA 3R5HA 4GLXA 1WR2A 1BJTA 5A2QW 2ALZA 2FJZA 2JA5A 5C0XG 1GSHA 2WAQA 1KJJA 1TUAA 1I3QA 2W9AA 5HBRB 1KBLA 3BQ1A 3HOUG 2JEIA 2XCAA 1E4EB 4ECQA 5L1LA 4ECSA 4DR1H 4NZRM 1JKJB 4LSAA 4LMYA 4J9LA 3VKEA 1ODHA 4GKKH 2NU6B 4R7RA 4XX0B 2WB1E 4ZOLF 4R8UA 1WSCA 3BJYA 3MFHA 1S9FA 1UC9A 4TQRA 3QZ7A 5DG9A 3GV7B 5DLFA 1S10A 3K3VA 4EYIB 1ZTGA 2PY9A 4HNTA 3H40A 3R23A 3IN5A 4OO1G 1IBMH 3EYYA 3RB4A 2FB9A 4YJ3F 4JI3H 4NBQA 1CQJB 2HH2A 4EC5A 5KG5A 2W7OA 2IBKA 2I87A 3H4BA 4ED0A 3JRXA 2UVUA 4O3PA 2C22A 3GILA 4YB8B 5IT9W 2CTLA 4M7EA 3T1YH 5JVLA 3UOEA 4DV4H 4DL7A 3BQ2A 1X9NA 4XYLB 3JRWA 1WCMA 2R7MA 3J81W 5C44G 3K5IA 2V4RA 5DGAA 2OPUA 4TV8F 1E4GT 2ASLA 2VUMG 4BBRG 4HYKA 4A3CG 3SE7A 2PN1A 2JVZA 1AUXA 2R87A 4DL2A 1KEEA 5F9LA 1EUDB 1GGOA 4IWXA 1B33N 3VMMA 3GIPA 5EOYA 4B3RH 3L2PA 3N8DA 1N32H 3OSNA 2JA8G 4ED7A 2VR1A 4ECVA 2VA2A 2UXDH 2R93G 5LL6b 2YZNA 2R7KA 2HVSA 4MV9A 1RJRA 2CTKA 4F4XA 3PVXA 4MTEA 4ED8A 1KC7A 4APMA 2V4QA 1CS0A 2E2IA 2XGQA 2JEFA 3KDKA 2FLLA 4DR3H 4RAZA 5KFKA 3Q2OA 3RBEA 4OD6A 2CPQA 1XDNA 4U7CA 4ED2A 4A93G 4ED3A 3FKIG 5KG0A 5BMVF 1S68A 2NUAB 2XC9A 5KT3A 1BXRA 4ECTA 3C0FB 1X9ZA 1RYSA 3GTGA 4DL3A 4DLKA 1N56A 1IBKH 3K5HA 4FBUA 1L2ZA 3U9SA 3GKUA 2O4CA 4MTDA 5KT2A 4YHHH 3QD7X 4RU9A 4WANA 3MWDA 5DQGA 1DIKA 4HNUA 5LMUH 2DZDA 2NU7B 2XGPA 5KFPA 2YW2A 1FVIA 2V59A 2M05A 3PR4A 3V69A 2HHHH 3NGDA 4RNMA 3RBDA 1Y1WG 1GSOA 4E4TA 2CTEA 2K1HA 2X0SA 1SFOA 4IWYA 2RGRA 3N44B 4ECUA 1J5EH 4CC5A 4DV5H 4RNNA 2YS6A 1JX4A 4A3FG 4QMFB 3MWMA 5FJ8G 4IRCA 2C28A 4XZ3B 2HGSA 4JV5H 5DG8A 2P2RA 3KHHA 1T36A 1VIGA 4J9PA 4FJUA 1CE8A 1N48A 2YU9A 4JI0H 2WAQE 3OTOH 2LTLA 3OHAA 1PK8A 2DGRA 1N33H 4UCSA 4R8UB 4M9UA 5H80A 1R9TA 2W8LA 3H0GG 4Q8EA 3N42B 4A3KG 2DPJA 4J9NA 5KFNA 3I4NG 1N34H 3HOXG 4IAJA 2FMRA 2R7ZA 2JA6G 1VAJA 4AYBA 4I50F 1EUCB 5DQHA 5KG2A 1PX2A 2JA9A 2VQEH 5EWFA 4BY7G 2WTFA 2I8CA 2CW8A 3N43B 1S97A 4O4LF 1B04A 2YRXA 3MR2A 1TWAA 4TQSA 3GABA 4LF7H 1X4MA 2C2EA 2DIKA 2VOBA 2ZDGA 4DUYH 3RB3A 1S0NA 2PT7G 2W6QA 4LSXA 5KFHA 2BQRA 2V5AA 3EPIA 2MJHA 3T5KA 2XCLA 1DTJA 2NN6G 3L7ZC 3GLKA 5KFXA 4EGQA 1Y1VG 4UCUA 4ZI7F 4C5AA 1TWCA 1VBHA 4DR6H 4UCRA 5BPHA 3KHRA 3WNZA 2NVYA 1HNXH 2RDJA 3V6JA 4DV6H 4NLGA 3HXLA 3GIMA 1I6UA 1DV2A 1JLLB 4YBZB 4G08A 4ECYA 4DR4H 4LFCH 5KFBA 2R92G 3OSSD 1UG8A 1VBGA 4B3MH 2QNDA 5EZYF 2FPIB 1SCUB 5IWAH 1K1SA 1ZZKA 4X64H 1V51A 2UUBH 3RUPA 4LH7A 4B8TA 4J9RA 3J7AK
chains in the Genus database with same CATH topology
5D1OB 1E4GT 5D1PA 2F4VH 2HVRA 1O75A 1MZBA 5LMNH 3IG0A 3L2PA 5EOYA 4B3RH 1N32H 4EFEA 4JI7H 4A2BA 4B8CD 2UXDH 4RB3C 3M4IA 5LL6b 2HVSA 1IBLH 1VS0A 4MV9A 2OWOA 4Q0YA 4MTEA 4A2AA 1N36H 1TA8A 2E5LH 2UXCH 4APMA 3KALA 3RF2A 1BGWA 2KSWA 4UCTA 4E9JA 3UQ8A 3KDKA 4B3SH 4DR3H 4RAZA 4DV7H 4UCVA 3GR5A 5FPRA 4OD6A 4X65H 1XDNA 1ZHSA 4LFAH 2MCTA 3LMLA 5D1OA 3N40P 3H20A 3SB1A 5FLXW 1S68A 3BA9A 3C0FB 1X9ZA 4RB0A 4JI5H 4X62H 3KAKA 4NXNH 1IBKH 4OX9H 3BA8A 3KXYT 4KHPH 2D9IA 3KAJA 1F0XA 1GYFA 4FM9A 1L2ZA 2O4CA 1HR0H 4RB2C 1WH2A 4YHHH 3QD7X 4DR5H 3KDGA 2FPHX 4JI1H 1ZHQA 1SEIA 2ZJTA 4UCOA 4DUZH 5LMUH 4PDBA 1XNQH 3F8NA 1FVIA 5DT9A 2HHHH 1Z2NX 4JI8H 3FAUA 4LF8H 3EZJA 4EEQA 4DV3H 3JSLA 2RGRA 3N44B 3RGXA 4YY3H 1FKAH 4DV1H 4I7HA 1J5EH 2WDTA 4JI4H 1P8LA 4DV5H 3BAAA 4CC5A 1S03G 1Z2OX 3MWMA 4RZQA 4X66H 3DF7A 3JSNA 2ZQEA 3L4KA 2YCHA 2HGSA 2WE6A 1XNRH 2XIGA 4RB1A 4K0KH 4LF4H 4JV5H 2W57A 3N41B 4J0MA 4DR2H 5BR8H 5FD5A 2Y3MA 5FD6A 2CW7A 5FPOA 3RJ0A 2FE3A 3L4JA 2Q2UA 4JI0H 1DGSA 1M0WA 3OTOH 3NCVA 1Z2PX 2RGVA 1N33H 4UCSA 3OETA 4ETSA 1FJGH 3CVZA 4CC6A 3N42B 4GKJH 4NZTM 4DV0H 1N34H 2UXBH 2ZM6H 4IAJA 1SYXB 1HNZH 2UU9H 4OCHA 3T1HH 2HVQA 4B3TH 2VQEH 2UUAH 4DR7H 1A0IA 2CW8A 3N43B 4GLXA 1BJTA 5A2QW 1B04A 4UFZA 3GABA 4LF7H 4DR1H 4NZRM 4JI6H 3PN1A 3J7AK 4LMYA 4LSAA 1ODHA 4GKKH 2VOBA 4DUYH 1XMQH 2LF0A 4R7RA 4LF6H 2PT7G 4LSXA 1TAEA 2VKCA 3BABA 3K3VA 4JYAH 1E4FT 1M0TA 4LH6A 4EFBA 4MTDA 4UCUA 1AN7A 1IBMH 1V9PA 3EYYA 4DR6H 4UCRA 1HNXH 4JI3H 4DV6H 1XMOH 3RIZA 4LFBH 4EC5A 3JAMW 3RTXA 1HNWH 4AQYH 4JI2H 4LF5H 3HXLA 2Q2TA 1I6UA 3J80W 4G08A 4DR4H 4LFCH 4RAYA 3N6XA 3RGZA 4NXMH 2VPSA 4MV7A 3OSSD 5IT9W 3FMAA 4M7EA 3T1YH 4B3MH 2VUGA 1I94H 2VQFH 2WYOA 4BWSC 5IWAH 4LF9H 4DV4H 4X64H 1X9NA 2UUBH 4LH7A 4DV2H 2O03A 3J81W 2UUCH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F4V H;  5LMN H;  4B3R H;  1N32 H;  4JI7 H;  2UXD H;  5LL6 b;  1IBL H;  1N36 H;  2E5L H;  2UXC H;  3RF2 A;  4B3S H;  4DR3 H;  4DV7 H;  4X65 H;  4LFA H;  5FLX W;  4JI5 H;  4X62 H;  4NXN H;  1IBK H;  4OX9 H;  4KHP H;  1HR0 H;  4YHH H;  4DR5 H;  4JI1 H;  1SEI A;  4DUZ H;  5LMU H;  4PDB A;  1XNQ H;  2HHH H;  4JI8 H;  4LF8 H;  4DV3 H;  4YY3 H;  1FKA H;  4DV1 H;  1J5E H;  4JI4 H;  4DV5 H;  1S03 G;  4X66 H;  1XNR H;  4K0K H;  4LF4 H;  4JV5 H;  4DR2 H;  5BR8 H;  4JI0 H;  3OTO H;  1N33 H;  1FJG H;  4GKJ H;  4DV0 H;  2UXB H;  1N34 H;  2ZM6 H;  1HNZ H;  2UU9 H;  3T1H H;  4B3T H;  2VQE H;  2UUA H;  4DR7 H;  5A2Q W;  4LF7 H;  4DR1 H;  4JI6 H;  3J7A K;  4GKK H;  4DUY H;  1XMQ H;  4LF6 H;  4JYA H;  1AN7 A;  1IBM H;  4DR6 H;  1HNX H;  4JI3 H;  4DV6 H;  1XMO H;  4LFB H;  3JAM W;  1HNW H;  4AQY H;  4JI2 H;  4LF5 H;  1I6U A;  3J80 W;  4DR4 H;  4LFC H;  4NXM H;  5IT9 W;  3T1Y H;  4B3M H;  1I94 H;  2VQF H;  5IWA H;  4LF9 H;  4DV4 H;  4X64 H;  2UUB H;  4DV2 H;  3J81 W;  2UUC H; 
#chains in the Genus database with same CATH topology
 4IHJ F;  2J9G A;  2BA0 A;  2W6M A;  4A3D G;  4O3O A;  2F4V H;  2R85 A;  2C2D A;  2FKL A;  2Y0S A;  1O75 A;  2FLN A;  5LMN H;  5KFG A;  5DG7 A;  2J6T A;  4MV4 A;  3LP8 A;  5LP6 F;  1TWG A;  5C1P A;  5KFJ A;  4A2B A;  3GIJ A;  2R6F A;  4B8C D;  5IYD G;  2YQR A;  4O3N A;  2M8W A;  1GLV A;  3GV8 B;  4LIJ A;  5KG3 A;  2J6U A;  4QWA A;  4Q0Y A;  1M6V A;  5L9X A;  4IRD A;  3GIK A;  1B6R A;  2UXC H;  1WCM G;  2YZM A;  3KAL A;  4UCT A;  5KFW A;  2W9B A;  4ECW A;  2ASD A;  5KFS A;  2R7L A;  4HQ6 A;  1PQX A;  2W6P A;  2PMZ A;  3Q8S B;  5J2U F;  5L1I A;  4J9K A;  4GC6 A;  4JV1 A;  5C1O A;  5D8D A;  2JA7 A;  1RK6 A;  3SB1 A;  5FLX W;  1ULZ A;  3QFF A;  1Y14 B;  4O4I F;  5LA6 F;  5KG6 A;  4C2M A;  3T5L A;  3KAK A;  4YP3 A;  3BA8 A;  5FLM G;  4ED6 A;  4FM9 A;  3SI8 A;  1HR0 H;  4RB2 C;  1WH2 A;  3VPB A;  2ZJT A;  4DR5 H;  3KHG A;  3GQC A;  4O3R A;  4PDB A;  3TQT A;  5KKN B;  1XNQ H;  3I12 A;  3TQ1 A;  4EGJ A;  3PO3 G;  3GTQ A;  2YRW A;  2JEG A;  4BXX G;  1ZET A;  4JV0 A;  4FS2 A;  4MV3 A;  2IA6 A;  2ZDH A;  3T5J A;  2GPS A;  2R8G A;  4QWC A;  3JSL A;  4H8A A;  1KJQ A;  2FK1 A;  2GPW A;  5KFV A;  3RGX A;  4J9O A;  4YY3 H;  3AYH B;  2R8J A;  1FKA H;  3PW0 A;  4I7H A;  1RJP A;  5DGB A;  3BAA A;  2W8K A;  4QWB A;  4AM3 A;  4C5B A;  4YJ2 F;  1Z2O X;  2CZG A;  4MV1 A;  5KFD A;  4GC7 A;  3JSN A;  3RAX A;  2W6N A;  3M9O B;  1C3O A;  2W57 A;  4J0M A;  2W7P A;  4MV6 A;  4DR2 H;  5BR8 H;  4O3Q A;  5F9N A;  4A3J G;  2CW7 A;  1RK5 A;  5FPO A;  3RJ0 A;  5EDW A;  2R8I A;  2AGQ A;  1M7J A;  1WE8 A;  1DGS A;  2FPG B;  2CTJ A;  1UNN C;  3OET A;  5KX5 F;  5KT7 A;  1FJG H;  4DL4 A;  5KFO A;  4YQW A;  4CC6 A;  2YL2 A;  4GKJ H;  2UXB H;  3MWE A;  1JXL A;  5KFR A;  4A3B G;  2AGP A;  3U9T A;  2HVQ A;  2A1S A;  1VKZ A;  3HKZ E;  4ECR A;  4G3I A;  1GSA A;  4O2A F;  4YR2 A;  4DR7 H;  2CTF A;  4BA1 I;  1A0I A;  2YZG A;  4A3I G;  5IP9 G;  4UFZ A;  5KG7 A;  5KG1 A;  4WBN F;  2C35 B;  3PW2 A;  2R86 A;  5KT4 A;  4EBE A;  2W6Z A;  1TWH A;  2LTM A;  5K2M A;  1XMQ H;  1T94 A;  2GLT A;  4LF6 H;  4YAJ B;  5KG4 A;  2VKC A;  2VQD A;  3BAB A;  3FKI A;  4RNO A;  5IP7 G;  4JYA H;  4F4W A;  2AXY A;  1E4F T;  1M0T A;  1TWF A;  4F4Z A;  4XYM B;  4ME6 A;  5KFZ A;  3TIN A;  5JEA G;  2BR0 A;  2UVV A;  4ED1 A;  1XMO H;  4MV8 A;  3RIZ A;  4DL5 A;  3T5H A;  1EHI A;  3RTX A;  1HNW H;  4AQY H;  4YAK B;  4JI2 H;  4LF5 H;  5KT5 A;  3R5X A;  3RB6 A;  2Q2T A;  2Y0S E;  4RAY A;  2C2R A;  3N6X A;  1I7N A;  4NXM H;  4MV7 A;  4RZR A;  5CA0 F;  3OHB A;  2VUG A;  3HB9 A;  3V4Z A;  2W9B B;  2JE6 I;  1V4Y A;  2O03 A;  2NVX A;  2FPP B;  3G6X A;  1Z2I A;  1VIH A;  4L1K A;  3PO2 G;  2HH3 A;  5EWE A;  3GTP A;  3HBL A;  4I4T F;  3QZ8 A;  2NU9 B;  2HVR A;  1WVN A;  4O4H F;  1XRH A;  2DLN A;  3IG0 A;  3HOZ G;  5KFA A;  2B63 A;  4C5C A;  2PMZ E;  3BG5 A;  2ZDQ A;  1KHM A;  3G8C A;  4EFE A;  4DL6 A;  4RB3 C;  2JA5 G;  3EPG A;  2VUM A;  4O2B F;  4A3L G;  2OWO A;  1NXU A;  1TA8 A;  5KFE A;  3RV3 A;  3H0G A;  3BQ0 A;  1KJ8 A;  1X4N A;  3V6H A;  3GIQ A;  4B3S H;  1K1Q A;  2C00 A;  4UCV A;  4DV7 H;  5FPR A;  1I50 A;  4F50 A;  3ORQ A;  4X65 H;  4FJS A;  1ZHS A;  3LML A;  3OUZ A;  4MA0 A;  5D1O A;  4QJF A;  4EG0 A;  5JH7 F;  1RYR A;  2DPI A;  3H20 A;  2FK3 A;  2E3U A;  4JI5 H;  5CAE B;  2BQ3 A;  4MAM A;  3VPD A;  2AGO A;  5LYJ F;  3KXY T;  4KHP H;  2D9I A;  3KAJ A;  5BPF A;  3I4M G;  4EEY A;  5JQW A;  3MR6 A;  2R84 A;  1GO3 E;  3RAQ A;  2JEA I;  4BA2 I;  1X0A A;  2FPH X;  5J2T F;  1SEI A;  1MSZ A;  4MA5 A;  4DUZ H;  3LWB A;  4QIW A;  4UCO A;  2W70 A;  2ANN A;  4FU0 A;  5I47 A;  2OPV A;  3F8N A;  4BBS G;  4QW8 A;  5K36 G;  3GV5 B;  1Z2N X;  2PBZ A;  4QW9 A;  2V58 A;  2NU8 B;  1V9N A;  3FAU A;  4JI8 H;  2X06 A;  4LF8 H;  1JDB B;  5IYZ F;  1T3N A;  2JA7 G;  4EEQ A;  4DV3 H;  2AU0 A;  4O3S A;  1C30 A;  3FDS A;  2WDT A;  4JI4 H;  1P8L A;  4JVY A;  3Q8R B;  5CB4 F;  3AEV B;  4RZQ A;  4J9Q A;  4X66 H;  3DF7 A;  5KFL A;  2W9C A;  2ZQE A;  4Q44 A;  3L4K A;  2YCH A;  5C3E G;  4A3G G;  4K0K H;  4EBC A;  2R92 A;  2M6Q A;  2UVW A;  2IP4 A;  5FD5 A;  1BNC A;  1S0M A;  3V6K A;  2FE3 A;  3L4J A;  2Q2U A;  5EWG A;  3NCV A;  1Z2P X;  5IYB G;  4PWQ A;  3CVZ A;  3CQZ A;  3M9N B;  4WAL A;  3ORR A;  4NZT M;  2V9W A;  3Q8P B;  1SYX B;  1JDE A;  3H3V H;  1HNZ H;  4OCH A;  3T1H H;  3GID A;  3HOW G;  4B3T H;  3RFC A;  5KFI A;  5KFF A;  2UUA H;  5C4X G;  2FLP A;  5IYC G;  3HOY G;  2FK2 A;  4JVH A;  4ZHQ F;  5KFT A;  3KTM A;  3UFX B;  5KFC A;  1CQI B;  2QK4 A;  3OUU A;  3WO1 A;  5HV6 A;  3MR3 A;  4ZQI A;  1IOW A;  4JI6 H;  4Q43 A;  3PN1 A;  3ETH A;  3PZP A;  3PW5 A;  1I7L A;  4ECX A;  1EYZ A;  2LF0 A;  4ECZ A;  4AYB E;  2OH2 A;  5DQI A;  1TAE A;  5DLG A;  2RDI A;  1WHR A;  1ZZI A;  4FBT A;  3HOV G;  4F4Y A;  4LH6 A;  4EFB A;  4EYH B;  2Z0S A;  2CWF A;  3TII A;  1AN7 A;  1V9P A;  5C5J A;  3V4S A;  2JZX A;  3ETJ A;  2BL5 A;  2ASJ A;  1S20 A;  5LXT F;  3GTJ A;  4LFB H;  1EZ1 A;  2IMW P;  5L1J A;  1OWT A;  3JAM W;  2E2H A;  3GII A;  2R8H A;  2WB1 A;  3J80 W;  1W93 A;  4QWE A;  1E4E A;  3RGZ A;  2VPS A;  4IFD G;  3FMA A;  1RJQ A;  2R93 A;  4RUA A;  2J6S A;  1I94 H;  2VQF H;  2WYO A;  4BWS C;  3OSP A;  4LF9 H;  2VA3 A;  2VPQ A;  1ZZJ A;  2W6O A;  2PQU A;  4DV2 H;  3GTL A;  3PW4 A;  2ANR A;  2UUC H;  3E5N A;  1DV1 A;  5D1O B;  5KFQ A;  4HR7 A;  2R7N A;  4JUZ A;  5D1P A;  2HJW A;  4Q45 A;  2ATL A;  5T14 A;  2RF4 A;  4J9M A;  1MZB A;  2R7Z G;  4IR9 A;  4I55 F;  2DWC A;  2I80 A;  5KFY A;  3VPC A;  4HNV A;  4JI7 H;  1JIH A;  2FMA A;  3M4I A;  2XCP A;  1K1G A;  3I0P A;  1EC6 A;  2JEB I;  1A9X A;  4YR0 A;  5C8Y F;  2CTM A;  1AUV A;  1IBL H;  1VS0 A;  2PVP A;  2CQY A;  4A2A A;  1N36 H;  2R82 A;  2E5L H;  3UQ8 A;  1V8C A;  3RF2 A;  1BGW A;  2KSW A;  4E9J A;  2OLS A;  1KJ9 A;  4QIW E;  3GR5 A;  4QWD A;  1K83 A;  2MCT A;  4LFA H;  1W96 A;  4TUY F;  2SCU B;  2YYA A;  3N40 P;  4WD3 A;  1ZQ7 A;  2B63 G;  5JUM A;  3GTO A;  1Y1W A;  3M9M B;  3MJF A;  3BA9 A;  4TV9 F;  4Q8F A;  4RB0 A;  3RV4 A;  4AIM A;  5GON F;  4X62 H;  2G8Y A;  4NXN H;  4OX9 H;  5JVD F;  1J5K A;  2W9C B;  2LRR A;  1DT4 A;  1F0X A;  3GTK A;  2CWH A;  1GYF A;  3PW7 A;  3KDG A;  4JI1 H;  1ZHQ A;  2R8K A;  2AQ4 A;  2QYZ A;  4JV2 A;  4A3M G;  3JZI A;  4IR1 A;  1S0O A;  5DT9 A;  3RB0 A;  3MR5 A;  4FS1 A;  2CKZ B;  3GTM A;  3Q1K A;  3EZJ A;  4IZO A;  3WO0 A;  5KFM A;  2FFM A;  4DV1 H;  2FP4 B;  1J4W A;  3TIG A;  2YS7 A;  1S03 G;  5KFU A;  4A3E G;  2JA6 A;  5LOV F;  4RB1 A;  3G6V A;  2WE6 A;  1XNR H;  2XIG A;  4LF4 H;  4BY1 G;  3N41 B;  3U1K A;  4J9S A;  2P0A A;  2BQU A;  2Y3M A;  5FD6 A;  3HKZ A;  3K3P A;  5CA1 F;  3PR5 B;  1WTJ A;  5L1K A;  2W71 A;  1M0W A;  4RUC A;  2RGV A;  1B6S A;  4IRK A;  1UC8 A;  3H4D A;  4ETS A;  2JEJ A;  3Q8Q B;  3KHL A;  1VBI A;  5KT6 A;  4U6P A;  2UVR A;  4DV0 H;  1KJI A;  2XD4 A;  2ZM6 H;  4YR3 A;  1IOV A;  3R5F A;  3MFI A;  2UU9 H;  4Y8V B;  4EBD A;  3G6Y A;  1Y1V A;  2CPM A;  3R5H A;  4GLX A;  1WR2 A;  1BJT A;  5A2Q W;  2ALZ A;  2FJZ A;  2JA5 A;  5C0X G;  1GSH A;  2WAQ A;  1KJJ A;  1TUA A;  1I3Q A;  2W9A A;  5HBR B;  1KBL A;  3BQ1 A;  3HOU G;  2JEI A;  2XCA A;  1E4E B;  4ECQ A;  5L1L A;  4ECS A;  4DR1 H;  4NZR M;  1JKJ B;  4LSA A;  4LMY A;  4J9L A;  3VKE A;  1ODH A;  4GKK H;  2NU6 B;  4R7R A;  4XX0 B;  2WB1 E;  4ZOL F;  4R8U A;  1WSC A;  3BJY A;  3MFH A;  1S9F A;  1UC9 A;  4TQR A;  3QZ7 A;  5DG9 A;  3GV7 B;  5DLF A;  1S10 A;  3K3V A;  4EYI B;  1ZTG A;  2PY9 A;  4HNT A;  3H40 A;  3R23 A;  3IN5 A;  4OO1 G;  1IBM H;  3EYY A;  3RB4 A;  2FB9 A;  4YJ3 F;  4JI3 H;  4NBQ A;  1CQJ B;  2HH2 A;  4EC5 A;  5KG5 A;  2W7O A;  2IBK A;  2I87 A;  3H4B A;  4ED0 A;  3JRX A;  2UVU A;  4O3P A;  2C22 A;  3GIL A;  4YB8 B;  5IT9 W;  2CTL A;  4M7E A;  3T1Y H;  5JVL A;  3UOE A;  4DV4 H;  4DL7 A;  3BQ2 A;  1X9N A;  4XYL B;  3JRW A;  1WCM A;  2R7M A;  3J81 W;  5C44 G;  3K5I A;  2V4R A;  5DGA A;  2OPU A;  4TV8 F;  1E4G T;  2ASL A;  2VUM G;  4BBR G;  4HYK A;  4A3C G;  3SE7 A;  2PN1 A;  2JVZ A;  1AUX A;  2R87 A;  4DL2 A;  1KEE A;  5F9L A;  1EUD B;  1GGO A;  4IWX A;  1B33 N;  3VMM A;  3GIP A;  5EOY A;  4B3R H;  3L2P A;  3N8D A;  1N32 H;  3OSN A;  2JA8 G;  4ED7 A;  2VR1 A;  4ECV A;  2VA2 A;  2UXD H;  2R93 G;  5LL6 b;  2YZN A;  2R7K A;  2HVS A;  4MV9 A;  1RJR A;  2CTK A;  4F4X A;  3PVX A;  4MTE A;  4ED8 A;  1KC7 A;  4APM A;  2V4Q A;  1CS0 A;  2E2I A;  2XGQ A;  2JEF A;  3KDK A;  2FLL A;  4DR3 H;  4RAZ A;  5KFK A;  3Q2O A;  3RBE A;  4OD6 A;  2CPQ A;  1XDN A;  4U7C A;  4ED2 A;  4A93 G;  4ED3 A;  3FKI G;  5KG0 A;  5BMV F;  1S68 A;  2NUA B;  2XC9 A;  5KT3 A;  1BXR A;  4ECT A;  3C0F B;  1X9Z A;  1RYS A;  3GTG A;  4DL3 A;  4DLK A;  1N56 A;  1IBK H;  3K5H A;  4FBU A;  1L2Z A;  3U9S A;  3GKU A;  2O4C A;  4MTD A;  5KT2 A;  4YHH H;  3QD7 X;  4RU9 A;  4WAN A;  3MWD A;  5DQG A;  1DIK A;  4HNU A;  5LMU H;  2DZD A;  2NU7 B;  2XGP A;  5KFP A;  2YW2 A;  1FVI A;  2V59 A;  2M05 A;  3PR4 A;  3V69 A;  2HHH H;  3NGD A;  4RNM A;  3RBD A;  1Y1W G;  1GSO A;  4E4T A;  2CTE A;  2K1H A;  2X0S A;  1SFO A;  4IWY A;  2RGR A;  3N44 B;  4ECU A;  1J5E H;  4CC5 A;  4DV5 H;  4RNN A;  2YS6 A;  1JX4 A;  4A3F G;  4QMF B;  3MWM A;  5FJ8 G;  4IRC A;  2C28 A;  4XZ3 B;  2HGS A;  4JV5 H;  5DG8 A;  2P2R A;  3KHH A;  1T36 A;  1VIG A;  4J9P A;  4FJU A;  1CE8 A;  1N48 A;  2YU9 A;  4JI0 H;  2WAQ E;  3OTO H;  2LTL A;  3OHA A;  1PK8 A;  2DGR A;  1N33 H;  4UCS A;  4R8U B;  4M9U A;  5H80 A;  1R9T A;  2W8L A;  3H0G G;  4Q8E A;  3N42 B;  4A3K G;  2DPJ A;  4J9N A;  5KFN A;  3I4N G;  1N34 H;  3HOX G;  4IAJ A;  2FMR A;  2R7Z A;  2JA6 G;  1VAJ A;  4AYB A;  4I50 F;  1EUC B;  5DQH A;  5KG2 A;  1PX2 A;  2JA9 A;  2VQE H;  5EWF A;  4BY7 G;  2WTF A;  2I8C A;  2CW8 A;  3N43 B;  1S97 A;  4O4L F;  1B04 A;  2YRX A;  3MR2 A;  1TWA A;  4TQS A;  3GAB A;  4LF7 H;  1X4M A;  2C2E A;  2DIK A;  2VOB A;  2ZDG A;  4DUY H;  3RB3 A;  1S0N A;  2PT7 G;  2W6Q A;  4LSX A;  5KFH A;  2BQR A;  2V5A A;  3EPI A;  2MJH A;  3T5K A;  2XCL A;  1DTJ A;  2NN6 G;  3L7Z C;  3GLK A;  5KFX A;  4EGQ A;  1Y1V G;  4UCU A;  4ZI7 F;  4C5A A;  1TWC A;  1VBH A;  4DR6 H;  4UCR A;  5BPH A;  3KHR A;  3WNZ A;  2NVY A;  1HNX H;  2RDJ A;  3V6J A;  4DV6 H;  4NLG A;  3HXL A;  3GIM A;  1I6U A;  1DV2 A;  1JLL B;  4YBZ B;  4G08 A;  4ECY A;  4DR4 H;  4LFC H;  5KFB A;  2R92 G;  3OSS D;  1UG8 A;  1VBG A;  4B3M H;  2QND A;  5EZY F;  2FPI B;  1SCU B;  5IWA H;  1K1S A;  1ZZK A;  4X64 H;  1V51 A;  2UUB H;  3RUP A;  4LH7 A;  4B8T A;  4J9R A;  3J7A K; 
#chains in the Genus database with same CATH homology
 5D1O B;  1E4G T;  5D1P A;  2F4V H;  2HVR A;  1O75 A;  1MZB A;  5LMN H;  3IG0 A;  3L2P A;  5EOY A;  4B3R H;  1N32 H;  4EFE A;  4JI7 H;  4A2B A;  4B8C D;  2UXD H;  4RB3 C;  3M4I A;  5LL6 b;  2HVS A;  1IBL H;  1VS0 A;  4MV9 A;  2OWO A;  4Q0Y A;  4MTE A;  4A2A A;  1N36 H;  1TA8 A;  2E5L H;  2UXC H;  4APM A;  3KAL A;  3RF2 A;  1BGW A;  2KSW A;  4UCT A;  4E9J A;  3UQ8 A;  3KDK A;  4B3S H;  4DR3 H;  4RAZ A;  4DV7 H;  4UCV A;  3GR5 A;  5FPR A;  4OD6 A;  4X65 H;  1XDN A;  1ZHS A;  4LFA H;  2MCT A;  3LML A;  5D1O A;  3N40 P;  3H20 A;  3SB1 A;  5FLX W;  1S68 A;  3BA9 A;  3C0F B;  1X9Z A;  4RB0 A;  4JI5 H;  4X62 H;  3KAK A;  4NXN H;  1IBK H;  4OX9 H;  3BA8 A;  3KXY T;  4KHP H;  2D9I A;  3KAJ A;  1F0X A;  1GYF A;  4FM9 A;  1L2Z A;  2O4C A;  1HR0 H;  4RB2 C;  1WH2 A;  4YHH H;  3QD7 X;  4DR5 H;  3KDG A;  2FPH X;  4JI1 H;  1ZHQ A;  1SEI A;  2ZJT A;  4UCO A;  4DUZ H;  5LMU H;  4PDB A;  1XNQ H;  3F8N A;  1FVI A;  5DT9 A;  2HHH H;  1Z2N X;  4JI8 H;  3FAU A;  4LF8 H;  3EZJ A;  4EEQ A;  4DV3 H;  3JSL A;  2RGR A;  3N44 B;  3RGX A;  4YY3 H;  1FKA H;  4DV1 H;  4I7H A;  1J5E H;  2WDT A;  4JI4 H;  1P8L A;  4DV5 H;  3BAA A;  4CC5 A;  1S03 G;  1Z2O X;  3MWM A;  4RZQ A;  4X66 H;  3DF7 A;  3JSN A;  2ZQE A;  3L4K A;  2YCH A;  2HGS A;  2WE6 A;  1XNR H;  2XIG A;  4RB1 A;  4K0K H;  4LF4 H;  4JV5 H;  2W57 A;  3N41 B;  4J0M A;  4DR2 H;  5BR8 H;  5FD5 A;  2Y3M A;  5FD6 A;  2CW7 A;  5FPO A;  3RJ0 A;  2FE3 A;  3L4J A;  2Q2U A;  4JI0 H;  1DGS A;  1M0W A;  3OTO H;  3NCV A;  1Z2P X;  2RGV A;  1N33 H;  4UCS A;  3OET A;  4ETS A;  1FJG H;  3CVZ A;  4CC6 A;  3N42 B;  4GKJ H;  4NZT M;  4DV0 H;  1N34 H;  2UXB H;  2ZM6 H;  4IAJ A;  1SYX B;  1HNZ H;  2UU9 H;  4OCH A;  3T1H H;  2HVQ A;  4B3T H;  2VQE H;  2UUA H;  4DR7 H;  1A0I A;  2CW8 A;  3N43 B;  4GLX A;  1BJT A;  5A2Q W;  1B04 A;  4UFZ A;  3GAB A;  4LF7 H;  4DR1 H;  4NZR M;  4JI6 H;  3PN1 A;  3J7A K;  4LMY A;  4LSA A;  1ODH A;  4GKK H;  2VOB A;  4DUY H;  1XMQ H;  2LF0 A;  4R7R A;  4LF6 H;  2PT7 G;  4LSX A;  1TAE A;  2VKC A;  3BAB A;  3K3V A;  4JYA H;  1E4F T;  1M0T A;  4LH6 A;  4EFB A;  4MTD A;  4UCU A;  1AN7 A;  1IBM H;  1V9P A;  3EYY A;  4DR6 H;  4UCR A;  1HNX H;  4JI3 H;  4DV6 H;  1XMO H;  3RIZ A;  4LFB H;  4EC5 A;  3JAM W;  3RTX A;  1HNW H;  4AQY H;  4JI2 H;  4LF5 H;  3HXL A;  2Q2T A;  1I6U A;  3J80 W;  4G08 A;  4DR4 H;  4LFC H;  4RAY A;  3N6X A;  3RGZ A;  4NXM H;  2VPS A;  4MV7 A;  3OSS D;  5IT9 W;  3FMA A;  4M7E A;  3T1Y H;  4B3M H;  2VUG A;  1I94 H;  2VQF H;  2WYO A;  4BWS C;  5IWA H;  4LF9 H;  4DV4 H;  4X64 H;  1X9N A;  2UUB H;  4LH7 A;  4DV2 H;  2O03 A;  3J81 W;  2UUC H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...