4PDBA

Crystal structure of bacillus anthracis ribosomal protein s8 in complex with an rna aptamer
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
129
structure length
129
Chain Sequence
TDPIADMLTRIRNANMVRHEKLEVPASKIKKEIAELLKREGFIRDVEYIEDNKQGILRIFLKYGANNERVITGLKRISKPGLRVYAKADEVPRVLNGLGIALVSTSKGVMTDKDARQLQTGGEVVAYVW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosomal protein/rna
molecule keywords 30S ribosomal protein S8
publication title Structure analysis of free and bound states of an RNA aptamer against ribosomal protein S8 from Bacillus anthracis.
pubmed doi rcsb
source organism Bacillus anthracis
total genus 33
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2014-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00410 Ribosomal_S8 Ribosomal protein S8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.30 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 4pdbA01
3.30.1490.10 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4pdbA02
3T1HH 1IBLH 1XNRH 1HNWH 2UXBH 1S03G 4AQYH 3OTOH 2F4VH 4B3RH 4DR7H 5LMNH 5FLXW 4JI5H 2UUCH 1HNZH 4YY3H 4DR6H 2ZM6H 4JI4H 2E5LH 2UUAH 4LFAH 4X66H 1I6UA 1XMQH 4JI7H 2HHHH 3J80W 4DR2H 5IWAH 1FJGH 4JV5H 4PDBA 4LFCH 4B3MH 1IBKH 4B3TH 4JI1H 4NXNH 4JI6H 4JI2H 3J81W 1N33H 4GKKH 1FKAH 4LFBH 1SEIA 2VQEH 5LMUH 4K0KH 2UXDH 4DV6H 5A2QW 3RF2A 2UUBH 1XNQH 4DV3H 4YHHH 4DV2H 1N32H 1XMOH 4DUZH 2VQFH 1IBMH 4JI8H 4GKJH 4LF5H 1N36H 3JAMW 4X65H 3J7AK 4DV5H 4KHPH 1J5EH 5LL6b 4DUYH 4DV7H 1HR0H 4B3SH 4DR1H 4OX9H 5IT9W 4JI0H 4DR3H 4LF9H 1I94H 1HNXH 4LF7H 4JI3H 4LF4H 4X64H 4LF8H 2UXCH 4DR5H 1N34H 5BR8H 2UU9H 4DR4H 4X62H 4LF6H 4DV1H 1AN7A 3T1YH 4DV4H 4DV0H 4NXMH 4JYAH
chains in the Genus database with same CATH superfamily
1EZ1A 4ECWA 2C2EA 4IRCA 2R92G 1VAJA 2LRRA 1IBLH 3L7ZC 2XD4A 4ZOLF 2R6FA 2W70A 1KC7A 5FPRA 2G8YA 4C2MA 2JA7G 1Z2IA 4AQYH 5KFBA 1K1QA 2R8IA 2Q2TA 2W9BB 5BPHA 2DLNA 4YR3A 5KT2A 4RUCA 4ED2A 4F4XA 3LMLA 5IYDG 1TWAA 5KFWA 4EBDA 1GGOA 3JRWA 3L4JA 4IR9A 2E5LH 3EPGA 4RB0A 5FD5A 1JKJB 3RTXA 2FLPA 2E2HA 3CVZA 1I6UA 5D8DA 2HHHH 5F9NA 5KX5F 3PR5B 3Q2OA 5JEAG 1GO3E 3H20A 5KFTA 1A9XA 2R7LA 3RGXA 2XGQA 1W93A 4IWXA 4YJ2F 4J9RA 4PDBA 2YZMA 3H0GG 4APMA 4WANA 4EG0A 1T36A 4O3RA 2E3UA 1P8LA 3NCVA 2V4QA 3QFFA 5KFFA 3JSLA 4TV9F 4JV0A 2J9GA 5DLFA 2NVXA 4JI1H 1VIGA 4JI2H 5KT7A 2CKZB 4MTDA 4BY1G 5KFXA 4L1KA 3KHHA 4Y8VB 3V6KA 1CS0A 3RB3A 3BJYA 3K3PA 4AIMA 2ZJTA 3I0PA 5JVDF 4A3FG 4J9OA 2DPIA 3N40P 3HOYG 3V69A 4RAZA 2XGPA 2M8WA 4ECXA 3R5XA 2C22A 2R7KA 4BBRG 4CC6A 3QD7X 2SCUB 5LXTF 4EGQA 4XYLB 1WE8A 1Z2OX 3RBEA 4A3GG 5JVLA 2P2RA 3E5NA 1I50A 3BQ1A 2FLNA 4EC5A 5C8YF 1CE8A 4YHHH 3MWDA 1C30A 1WTJA 4DV2H 3PW5A 3LWBA 4TUYF 3BAAA 4O3SA 4RUAA 3GIJA 1IBMH 4XYMB 3ORQA 3H4DA 2J6TA 4A93G 4IAJA 4LF5H 4C5AA 4UCRA 4RB3C 4LIJA 1N36H 1WH2A 1Z2PX 2CW8A 4HQ6A 2NUAB 3G6XA 2YS7A 1M0WA 4UFZA 4X65H 3U9SA 4A3BG 1N56A 4ETSA 3PR4A 3HOWG 4DV5H 2NU8B 2W6OA 4KHPH 1I7NA 4ME6A 2CTEA 3HOUG 2OLSA 3KHGA 4O2AF 3RGZA 3BABA 4NBQA 4O4LF 3HOXG 2VR1A 1T94A 3U1KA 2HJWA 4JV1A 5LL6b 3FDSA 1KBLA 4DUYH 4YBZB 2CPMA 1I7LA 1VS0A 5KG6A 2R85A 3OUZA 4ECQA 4O3NA 2JEJA 2YL2A 5IT9W 3GABA 2W6QA 2YCHA 2UVRA 4JI0H 3PO2G 3GTPA 2E2IA 3JSNA 3GV8B 2B63G 2ATLA 2VUMA 3Q8SB 2UXCH 2R8JA 4CC5A 5HV6A 4QWAA 1VBHA 2C35B 3BQ2A 4M9UA 4DR4H 4X62H 3R5FA 2WAQA 2LF0A 2RF4A 2LTMA 2WYOA 3T1YH 2CQYA 2R7ZG 4YAKB 1KHMA 1A0IA 1PX2A 3VPCA 2Q2UA 2JEGA 3T1HH 2P0AA 3SE7A 2DGRA 3KALA 5KFSA 4QW9A 1VBIA 2FK2A 2VPQA 4HNVA 2W9CA 5IP7G 5L1LA 4QJFA 5EWFA 1XNRH 2PMZE 3V4SA 1S03G 4UCSA 4YQWA 5KFAA 3Q8RB 4ED7A 4RB2C 4YJ3F 5KG3A 3MR6A 2VPSA 3VPBA 3OTOH 4DR7H 4H8AA 4QIWE 3WO0A 3IN5A 1IOWA 2RDIA 1KJ9A 3RV3A 3PO3G 1E4GT 5J2TF 3WNZA 2UUCH 3M9NB 4OCHA 4YY3H 2Y0SA 4LSAA 1S0OA 1KJIA 5KFRA 2DPJA 5IYBG 4YAJB 2XC9A 4EBEA 2VQDA 4ECZA 4DR6H 1N48A 2W71A 2HVRA 3KXYT 3N8DA 2I8CA 1B33N 3K5IA 5F9LA 4MV6A 2YU9A 4UCOA 2M6QA 3Q8PB 1S97A 1GYFA 1ZZIA 2UUAH 1XRHA 5KKNB 3MR2A 2OPUA 4X66H 3OSSD 3L2PA 2RGVA 4JI7H 1B6SA 1TWHA 5D1OA 4C5BA 2C28A 1ZETA 2JEIA 1FJGH 5IWAH 4UCUA 5DG8A 4JV5H 3KTMA 2V59A 5BMVF 3RAXA 2Y3MA 4LFCH 2ASJA 1VKZA 4FJUA 2FKLA 3CQZA 2CTKA 3M9OB 4B3TH 2FPIB 5DLGA 3GQCA 4JI6H 2R7ZA 3TIGA 4A2AA 2VOBA 5T14A 3GIMA 4I4TF 1N33H 3M9MB 1UNNC 2VKCA 4FU0A 3Q8QB 2YRWA 4FS1A 3TQTA 3RFCA 3MWEA 3V4ZA 4A3KG 4ED8A 2JEBI 4LFBH 5FPOA 3KHLA 3PW4A 3V6HA 2R8GA 4K0KH 3GIKA 2W6PA 3RIZA 2AXYA 3U9TA 3JRXA 4A3DG 1RJQA 1X9ZA 2GPSA 2OPVA 1ZTGA 2YW2A 4Q44A 4J9NA 3SI8A 3PW0A 2JEFA 5KFKA 3T5HA 2HGSA 4OO1G 3C0FB 4O3PA 4J9LA 1K1SA 2HH3A 4B8CD 4HR7A 5D1OB 2RDJA 4ECTA 1JIHA 5EOYA 4J9KA 5KFGA 3QZ7A 4F50A 5KFPA 4GKJH 4RZRA 3EZJA 1RK5A 4HNTA 4BA1I 4ED0A 4O4HF 3L4KA 2OWOA 1J4WA 3JAMW 1SFOA 1WCMA 1BGWA 1UC9A 4A3MG 2W8LA 2K1HA 4RZQA 3J7AK 1WSCA 4RB1A 5JUMA 4XZ3B 1GSHA 4QWEA 1R9TA 1V4YA 2FLLA 2LTLA 3DF7A 2O03A 2VUMG 4JV2A 2DWCA 5BPFA 2V9WA 2FPHX 1MZBA 2WB1A 5KFDA 5K36G 1WR2A 2XCLA 3F8NA 3G6VA 3RAQA 1L2ZA 3N6XA 1EHIA 2FK3A 3GV5B 2JA8G 1DV2A 5EDWA 4B3SH 3KDKA 4OX9H 4WBNF 3PVXA 3GIPA 5HBRB 2XCPA 5DQIA 5KFIA 4LF9H 4G3IA 1I94H 1E4EA 3RUPA 5DG7A 3K3VA 5KG2A 1N34H 1WVNA 3KHRA 2V5AA 5KFYA 2W8KA 4LF6H 2R7MA 4YP3A 1JLLB 1AN7A 4EEQA 3G8CA 3ETHA 4NXMH 4QMFB 4O4IF 1O75A 3HKZA 4FS2A 1JXLA 5KG0A 3TIIA 2AGQA 1RYRA 4NLGA 4MAMA 5IYCG 4F4YA 1S0NA 2J6SA 5DQHA 1TAEA 2UXBH 1VBGA 1KJ8A 2VA3A 2BR0A 2UVUA 1DV1A 3MR3A 3M4IA 3T5JA 4B3RH 1ODHA 3ORRA 4YR2A 2AGOA 5KFHA 5FLXW 5FJ8G 3AYHB 4MA0A 1F0XA 5H80A 5C1OA 4TQSA 2JA5A 3OHAA 2ANNA 1BXRA 5L1IA 1S9FA 4Q8FA 2PVPA 4JI4H 1RJRA 5DG9A 1JDBB 2WE6A 1ZHQA 3HOVG 4J9MA 4LFAH 2GPWA 2PMZA 4IR1A 1XMQH 2ASLA 2JA6A 4I50F 4J9QA 2R93G 2CTLA 3HBLA 2I80A 2R84A 3J80W 4A3IG 5IYZF 2J6UA 3H3VH 4DR2H 5C0XG 2YZNA 4QIWA 5CAEB 2UVWA 2C2RA 3R5HA 4MV9A 5KFVA 3GIQA 2QNDA 4ED1A 3GIIA 4LH7A 4B3MH 2C2DA 1M0TA 1CQJB 4IZOA 5KT3A 1NXUA 4J9PA 4NXNH 1TWFA 2HVQA 3PZPA 1S10A 2VA2A 4AYBA 3J81W 2DIKA 2W6ZA 3N42B 4R8UA 4I7HA 4RNMA 5L1JA 4EBCA 4ECVA 4B8TA 1DTJA 4QWBA 4LSXA 4Q43A 4GKKH 5KFOA 2FMAA 2YRXA 5DGBA 4M7EA 4BWSC 2GLTA 4QW8A 4A2BA 4J0MA 4NZTM 5LMUH 2MJHA 2UXDH 4U6PA 2W6NA 1TUAA 2AGPA 4ECYA 4MV8A 1T3NA 4MA5A 1ZZJA 2ANRA 5A2QW 2HVSA 1Z2NX 2I87A 2UUBH 2PY9A 1WCMG 3BA8A 5DGAA 3GTJA 4GLXA 4ED6A 1XNQH 2MCTA 5CA0F 2FJZA 3SB1A 2UVVA 3BQ0A 1N32H 3HB9A 4XX0B 2R8KA 4DL2A 1RYSA 4DUZH 3GTQA 2NU6B 3BG5A 1Y1WG 2W9CB 2CTFA 4JI8H 3GTLA 1UC8A 1W96A 2QYZA 4O3OA 1FVIA 3RB4A 2YZGA 1UG8A 4PWQA 4EYHB 4BXXG 1TWCA 1E4FT 5LA6F 2HH2A 5D1PA 2BA0A 3KAJA 1KJJA 1WHRA 1Y14B 2FE3A 2Y0SE 4O2BF 3UFXB 2R93A 5KFLA 3OSPA 5DT9A 2W9AA 4I55F 5DQGA 5CB4F 5KFQA 1X9NA 3GLKA 2OH2A 4IRKA 3N41B 5KFUA 4R8UB 3QZ8A 1J5EH 4F4ZA 5KG4A 1RK6A 2CTJA 5C4XG 3GV7B 4DL4A 4Q45A 3GTKA 2DZDA 3T5LA 4EFEA 4FBTA 3OUUA 2IBKA 5JQWA 3H40A 1HR0H 4EEYA 4NZRM 3MWMA 5I47A 2FPGB 4AM3A 1V8CA 3EYYA 3WO1A 4C5CA 4BBSG 1AUVA 2YS6A 2IP4A 1X0AA 2VUGA 4MV1A 2PQUA 4JI3H 4LF4H 4X64H 4LF7H 4LF8H 4DR5H 3HXLA 1GSAA 3ETJA 4RNNA 3H4BA 3RB0A 4FBUA 1PK8A 2W57A 2UU9H 4R7RA 2CTMA 4MV4A 2FFMA 5GONF 4DV1H 4E9JA 4IRDA 2ZDHA 4DV4H 4A3JG 3BA9A 2FB9A 4JYAH 2R87A 5C44G 4DL6A 2JA5G 1Y1VA 5KFCA 2X0SA 1EUDB 3OETA 4YB8B 5JH7F 5K2MA 5KFEA 2NU9B 1RJPA 1Y1WA 1HNWH 2NU7B 4ZQIA 5CA1F 2W6MA 3UOEA 3AEVB 3I4MG 3MJFA 2PT7G 4ECRA 2JA9A 4LMYA 5KT6A 3FMAA 4RU9A 4QWDA 2F4VH 3VKEA 5LMNH 5IP9G 2CPQA 3EPIA 2JA6G 1GSOA 2PN1A 4JI5H 3G6YA 1VIHA 3LP8A 1SYXB 1HNZH 1OWTA 4RNOA 2B63A 5FD6A 4BA2I 1TA8A 2WDTA 2ZDGA 4MTEA 5C3EG 3RB6A 2IA6A 1B04A 4A3LG 3KDGA 2ASDA 2FPPB 2ALZA 2ZDQA 4IFDG 2R92A 1X4NA 2ZM6H 1V9PA 1BNCA 1TWGA 3R23A 4RAYA 4WD3A 3FAUA 2R8HA 4HYKA 4ED3A 4DL3A 2JVZA 2XIGA 3VPDA 2JA7A 1EUCB 4GC6A 4TQRA 4YR0A 3GTGA 1GLVA 2W7OA 3RV4A 4JUZA 3HOZG 2CZGA 1CQIB 4QWCA 2BL5A 1EC6A 2FK1A 2WB1E 4F4WA 4DL7A 2RGRA 3JZIA 3TINA 5LYJF 2ZQEA 4UCVA 5KG5A 1PQXA 1IBKH 1B6RA 3K5HA 2M05A 4DL5A 4GC7A 2R82A 1J5KA 1JDEA 4UCTA 2YYAA 2V4RA 2AQ4A 1C3OA 2V58A 1M7JA 1ZHSA 4MV7A 3MFIA 4JVHA 1XDNA 2IMWP 5C5JA 1FKAH 5L9XA 3H0GA 3NGDA 2NN6G 4ZHQF 5LP6F 2AU0A 1SEIA 4IHJF 2BQUA 1K83A 2VQEH 4DLKA 3V6JA 1E4EB 1S20A 3GR5A 4HNUA 2D9IA 1S68A 4DV6H 1EYZA 2YQRA 1V9NA 4FJSA 3FKIG 2JEAI 3VMMA 4EFBA 3N44B 2FMRA 1BJTA 3GIDA 5LOVF 1KEEA 3RF2A 3HKZE 2FP4B 4TV8F 4O3QA 1K1GA 2XCAA 1V51A 1ZZKA 2CWHA 4DV3H 4Q8EA 4LH6A 3MR5A 5KG1A 3TQ1A 3MFHA 1DGSA 5KFNA 3GKUA 5J2UF 1XMOH 5KFMA 4Q0YA 1DIKA 2WTFA 2X06A 4BY7G 2VQFH 3IG0A 5KFJA 2JZXA 3OHBA 4ECUA 4OD6A 3PW7A 2BQRA 2PBZA 4ECSA 3PN1A 3T5KA 5EWEA 4J9SA 3RBDA 2R86A 1X4MA 4A3CG 5EWGA 2R7NA 2QK4A 2C00A 2WAQE 3KAKA 1MSZA 4FM9A 1ULZA 2Z0SA 3OSNA 2W9BA 4EYIB 4U7CA 3RJ0A 2KSWA 4EGJA 4DV7H 3GTOA 2JE6I 4DR1H 1KJQA 5KT4A 2O4CA 1JX4A 2BQ3A 3GTMA 4G08A 3UQ8A 4DR3H 1Y1VG 1M6VA 5EZYF 1S0MA 5KFZA 1IOVA 1HNXH 1AUXA 1I3QA 5FLMG 4IWYA 2CWFA 2CW7A 3N43B 2W7PA 1DT4A 3FKIA 4E4TA 5BR8H 2NVYA 1SCUB 4AYBE 5C1PA 5KT5A 2A1SA 5L1KA 3PW2A 5KG7A 4MV3A 4ZI7F 3GILA 3I4NG 1ZQ7A 4A3EG 4WALA 4DV0H 3I12A 3Q1KA 4JVYA
chains in the Genus database with same CATH topology
3T1HH 1O75A 3KALA 3OETA 1IBLH 1TAEA 1XNRH 1HNWH 2UXBH 1S03G 4UCSA 5FPRA 2OWOA 4AQYH 2PT7G 4RB2C 4LMYA 3FMAA 2VPSA 3M4IA 3OTOH 2F4VH 4B3RH 4DR7H 1ODHA 5LMNH 4EEQA 5FLXW 1E4GT 2Q2TA 4JI5H 2UUCH 1SYXB 4OCHA 1HNZH 1F0XA 4YY3H 2WDTA 1TA8A 4LSAA 5FD6A 4MTEA 3LMLA 1B04A 3KDGA 4DR6H 3L4JA 2ZM6H 3KXYT 4JI4H 2E5LH 1V9PA 4RAYA 2HVRA 3FAUA 4RB0A 5FD5A 4UCOA 2WE6A 2XIGA 1GYFA 1ZHQA 2UUAH 3RTXA 4X66H 3OSSD 4LFAH 1I6UA 3CVZA 1XMQH 3L2PA 2RGVA 4JI7H 2HHHH 5D1OA 3J80W 3H20A 4DR2H 5IWAH 1FJGH 4UCUA 3RGXA 2RGRA 4JV5H 4PDBA 4APMA 4MV9A 2ZQEA 4UCVA 2Y3MA 4LFCH 4LH7A 1P8LA 3NCVA 4B3MH 3JSLA 1IBKH 1M0TA 4B3TH 4JI1H 4NXNH 2HVQA 4JI6H 4JI2H 4A2AA 2VOBA 3J81W 4MTDA 3N42B 4UCTA 1N33H 4I7HA 2VKCA 1ZHSA 4LSXA 4MV7A 2ZJTA 1XDNA 4GKKH 1FKAH 4M7EA 4BWSC 4LFBH 3N40P 5FPOA 1SEIA 4NZTM 4RAZA 4A2BA 2VQEH 5LMUH 4K0KH 4J0MA 3GR5A 2UXDH 2D9IA 1S68A 3RIZA 4DV6H 4CC6A 3QD7X 4EFBA 5A2QW 3N44B 1BJTA 1Z2OX 1Z2NX 2HVSA 3RF2A 2UUBH 3BA8A 1X9ZA 4GLXA 1XNQH 2MCTA 4EC5A 3SB1A 4DV3H 2HGSA 4LH6A 4YHHH 3C0FB 4DV2H 1N32H 1DGSA 4B8CD 1XMOH 5D1OB 3BAAA 4DUZH 4Q0YA 5EOYA 2VQFH 1IBMH 4JI8H 3IG0A 4GKJH 1FVIA 4OD6A 4LF5H 3EZJA 4IAJA 4UCRA 1Z2PX 1N36H 1E4FT 1WH2A 2CW8A 3PN1A 4RB3C 5D1PA 3KAJA 3L4KA 3JAMW 1M0WA 2FE3A 4UFZA 4X65H 1BGWA 2Q2UA 4RZQA 4ETSA 3J7AK 5DT9A 4DV5H 4RB1A 1X9NA 4KHPH 3DF7A 2O03A 3N41B 1J5EH 3RGZA 3BABA 2FPHX 3KAKA 1MZBA 1L2ZA 3F8NA 4FM9A 3N6XA 5LL6b 4DUYH 3RJ0A 2KSWA 4DV7H 1VS0A 4EFEA 1HR0H 4B3SH 3KDKA 4DR1H 3GABA 4NZRM 2O4CA 4OX9H 5IT9W 3MWMA 2YCHA 4G08A 4JI0H 4DR3H 3UQ8A 3JSNA 4LF9H 3EYYA 1I94H 2VUGA 1HNXH 4LF7H 4JI3H 4LF4H 4X64H 4LF8H 2UXCH 4DR5H 3HXLA 3K3VA 2CW7A 4CC5A 3N43B 1N34H 5BR8H 2W57A 2UU9H 4R7RA 4DR4H 4X62H 4LF6H 4DV1H 2LF0A 4E9JA 1AN7A 2WYOA 3T1YH 4DV4H 4DV0H 1A0IA 3BA9A 4NXMH 4JYAH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T1H H;  1IBL H;  1XNR H;  1HNW H;  2UXB H;  1S03 G;  4AQY H;  3OTO H;  2F4V H;  4B3R H;  4DR7 H;  5LMN H;  5FLX W;  4JI5 H;  2UUC H;  1HNZ H;  4YY3 H;  4DR6 H;  2ZM6 H;  4JI4 H;  2E5L H;  2UUA H;  4LFA H;  4X66 H;  1I6U A;  1XMQ H;  4JI7 H;  2HHH H;  3J80 W;  4DR2 H;  5IWA H;  1FJG H;  4JV5 H;  4PDB A;  4LFC H;  4B3M H;  1IBK H;  4B3T H;  4JI1 H;  4NXN H;  4JI6 H;  4JI2 H;  3J81 W;  1N33 H;  4GKK H;  1FKA H;  4LFB H;  1SEI A;  2VQE H;  5LMU H;  4K0K H;  2UXD H;  4DV6 H;  5A2Q W;  3RF2 A;  2UUB H;  1XNQ H;  4DV3 H;  4YHH H;  4DV2 H;  1N32 H;  1XMO H;  4DUZ H;  2VQF H;  1IBM H;  4JI8 H;  4GKJ H;  4LF5 H;  1N36 H;  3JAM W;  4X65 H;  3J7A K;  4DV5 H;  4KHP H;  1J5E H;  5LL6 b;  4DUY H;  4DV7 H;  1HR0 H;  4B3S H;  4DR1 H;  4OX9 H;  5IT9 W;  4JI0 H;  4DR3 H;  4LF9 H;  1I94 H;  1HNX H;  4LF7 H;  4JI3 H;  4LF4 H;  4X64 H;  4LF8 H;  2UXC H;  4DR5 H;  1N34 H;  5BR8 H;  2UU9 H;  4DR4 H;  4X62 H;  4LF6 H;  4DV1 H;  1AN7 A;  3T1Y H;  4DV4 H;  4DV0 H;  4NXM H;  4JYA H; 
#chains in the Genus database with same CATH topology
 1EZ1 A;  4ECW A;  2C2E A;  4IRC A;  2R92 G;  1VAJ A;  2LRR A;  1IBL H;  3L7Z C;  2XD4 A;  4ZOL F;  2R6F A;  2W70 A;  1KC7 A;  5FPR A;  2G8Y A;  4C2M A;  2JA7 G;  1Z2I A;  4AQY H;  5KFB A;  1K1Q A;  2R8I A;  2Q2T A;  2W9B B;  5BPH A;  2DLN A;  4YR3 A;  5KT2 A;  4RUC A;  4ED2 A;  4F4X A;  3LML A;  5IYD G;  1TWA A;  5KFW A;  4EBD A;  1GGO A;  3JRW A;  3L4J A;  4IR9 A;  2E5L H;  3EPG A;  4RB0 A;  5FD5 A;  1JKJ B;  3RTX A;  2FLP A;  2E2H A;  3CVZ A;  1I6U A;  5D8D A;  2HHH H;  5F9N A;  5KX5 F;  3PR5 B;  3Q2O A;  5JEA G;  1GO3 E;  3H20 A;  5KFT A;  1A9X A;  2R7L A;  3RGX A;  2XGQ A;  1W93 A;  4IWX A;  4YJ2 F;  4J9R A;  4PDB A;  2YZM A;  3H0G G;  4APM A;  4WAN A;  4EG0 A;  1T36 A;  4O3R A;  2E3U A;  1P8L A;  3NCV A;  2V4Q A;  3QFF A;  5KFF A;  3JSL A;  4TV9 F;  4JV0 A;  2J9G A;  5DLF A;  2NVX A;  4JI1 H;  1VIG A;  4JI2 H;  5KT7 A;  2CKZ B;  4MTD A;  4BY1 G;  5KFX A;  4L1K A;  3KHH A;  4Y8V B;  3V6K A;  1CS0 A;  3RB3 A;  3BJY A;  3K3P A;  4AIM A;  2ZJT A;  3I0P A;  5JVD F;  4A3F G;  4J9O A;  2DPI A;  3N40 P;  3HOY G;  3V69 A;  4RAZ A;  2XGP A;  2M8W A;  4ECX A;  3R5X A;  2C22 A;  2R7K A;  4BBR G;  4CC6 A;  3QD7 X;  2SCU B;  5LXT F;  4EGQ A;  4XYL B;  1WE8 A;  1Z2O X;  3RBE A;  4A3G G;  5JVL A;  2P2R A;  3E5N A;  1I50 A;  3BQ1 A;  2FLN A;  4EC5 A;  5C8Y F;  1CE8 A;  4YHH H;  3MWD A;  1C30 A;  1WTJ A;  4DV2 H;  3PW5 A;  3LWB A;  4TUY F;  3BAA A;  4O3S A;  4RUA A;  3GIJ A;  1IBM H;  4XYM B;  3ORQ A;  3H4D A;  2J6T A;  4A93 G;  4IAJ A;  4LF5 H;  4C5A A;  4UCR A;  4RB3 C;  4LIJ A;  1N36 H;  1WH2 A;  1Z2P X;  2CW8 A;  4HQ6 A;  2NUA B;  3G6X A;  2YS7 A;  1M0W A;  4UFZ A;  4X65 H;  3U9S A;  4A3B G;  1N56 A;  4ETS A;  3PR4 A;  3HOW G;  4DV5 H;  2NU8 B;  2W6O A;  4KHP H;  1I7N A;  4ME6 A;  2CTE A;  3HOU G;  2OLS A;  3KHG A;  4O2A F;  3RGZ A;  3BAB A;  4NBQ A;  4O4L F;  3HOX G;  2VR1 A;  1T94 A;  3U1K A;  2HJW A;  4JV1 A;  5LL6 b;  3FDS A;  1KBL A;  4DUY H;  4YBZ B;  2CPM A;  1I7L A;  1VS0 A;  5KG6 A;  2R85 A;  3OUZ A;  4ECQ A;  4O3N A;  2JEJ A;  2YL2 A;  5IT9 W;  3GAB A;  2W6Q A;  2YCH A;  2UVR A;  4JI0 H;  3PO2 G;  3GTP A;  2E2I A;  3JSN A;  3GV8 B;  2B63 G;  2ATL A;  2VUM A;  3Q8S B;  2UXC H;  2R8J A;  4CC5 A;  5HV6 A;  4QWA A;  1VBH A;  2C35 B;  3BQ2 A;  4M9U A;  4DR4 H;  4X62 H;  3R5F A;  2WAQ A;  2LF0 A;  2RF4 A;  2LTM A;  2WYO A;  3T1Y H;  2CQY A;  2R7Z G;  4YAK B;  1KHM A;  1A0I A;  1PX2 A;  3VPC A;  2Q2U A;  2JEG A;  3T1H H;  2P0A A;  3SE7 A;  2DGR A;  3KAL A;  5KFS A;  4QW9 A;  1VBI A;  2FK2 A;  2VPQ A;  4HNV A;  2W9C A;  5IP7 G;  5L1L A;  4QJF A;  5EWF A;  1XNR H;  2PMZ E;  3V4S A;  1S03 G;  4UCS A;  4YQW A;  5KFA A;  3Q8R B;  4ED7 A;  4RB2 C;  4YJ3 F;  5KG3 A;  3MR6 A;  2VPS A;  3VPB A;  3OTO H;  4DR7 H;  4H8A A;  4QIW E;  3WO0 A;  3IN5 A;  1IOW A;  2RDI A;  1KJ9 A;  3RV3 A;  3PO3 G;  1E4G T;  5J2T F;  3WNZ A;  2UUC H;  3M9N B;  4OCH A;  4YY3 H;  2Y0S A;  4LSA A;  1S0O A;  1KJI A;  5KFR A;  2DPJ A;  5IYB G;  4YAJ B;  2XC9 A;  4EBE A;  2VQD A;  4ECZ A;  4DR6 H;  1N48 A;  2W71 A;  2HVR A;  3KXY T;  3N8D A;  2I8C A;  1B33 N;  3K5I A;  5F9L A;  4MV6 A;  2YU9 A;  4UCO A;  2M6Q A;  3Q8P B;  1S97 A;  1GYF A;  1ZZI A;  2UUA H;  1XRH A;  5KKN B;  3MR2 A;  2OPU A;  4X66 H;  3OSS D;  3L2P A;  2RGV A;  4JI7 H;  1B6S A;  1TWH A;  5D1O A;  4C5B A;  2C28 A;  1ZET A;  2JEI A;  1FJG H;  5IWA H;  4UCU A;  5DG8 A;  4JV5 H;  3KTM A;  2V59 A;  5BMV F;  3RAX A;  2Y3M A;  4LFC H;  2ASJ A;  1VKZ A;  4FJU A;  2FKL A;  3CQZ A;  2CTK A;  3M9O B;  4B3T H;  2FPI B;  5DLG A;  3GQC A;  4JI6 H;  2R7Z A;  3TIG A;  4A2A A;  2VOB A;  5T14 A;  3GIM A;  4I4T F;  1N33 H;  3M9M B;  1UNN C;  2VKC A;  4FU0 A;  3Q8Q B;  2YRW A;  4FS1 A;  3TQT A;  3RFC A;  3MWE A;  3V4Z A;  4A3K G;  4ED8 A;  2JEB I;  4LFB H;  5FPO A;  3KHL A;  3PW4 A;  3V6H A;  2R8G A;  4K0K H;  3GIK A;  2W6P A;  3RIZ A;  2AXY A;  3U9T A;  3JRX A;  4A3D G;  1RJQ A;  1X9Z A;  2GPS A;  2OPV A;  1ZTG A;  2YW2 A;  4Q44 A;  4J9N A;  3SI8 A;  3PW0 A;  2JEF A;  5KFK A;  3T5H A;  2HGS A;  4OO1 G;  3C0F B;  4O3P A;  4J9L A;  1K1S A;  2HH3 A;  4B8C D;  4HR7 A;  5D1O B;  2RDJ A;  4ECT A;  1JIH A;  5EOY A;  4J9K A;  5KFG A;  3QZ7 A;  4F50 A;  5KFP A;  4GKJ H;  4RZR A;  3EZJ A;  1RK5 A;  4HNT A;  4BA1 I;  4ED0 A;  4O4H F;  3L4K A;  2OWO A;  1J4W A;  3JAM W;  1SFO A;  1WCM A;  1BGW A;  1UC9 A;  4A3M G;  2W8L A;  2K1H A;  4RZQ A;  3J7A K;  1WSC A;  4RB1 A;  5JUM A;  4XZ3 B;  1GSH A;  4QWE A;  1R9T A;  1V4Y A;  2FLL A;  2LTL A;  3DF7 A;  2O03 A;  2VUM G;  4JV2 A;  2DWC A;  5BPF A;  2V9W A;  2FPH X;  1MZB A;  2WB1 A;  5KFD A;  5K36 G;  1WR2 A;  2XCL A;  3F8N A;  3G6V A;  3RAQ A;  1L2Z A;  3N6X A;  1EHI A;  2FK3 A;  3GV5 B;  2JA8 G;  1DV2 A;  5EDW A;  4B3S H;  3KDK A;  4OX9 H;  4WBN F;  3PVX A;  3GIP A;  5HBR B;  2XCP A;  5DQI A;  5KFI A;  4LF9 H;  4G3I A;  1I94 H;  1E4E A;  3RUP A;  5DG7 A;  3K3V A;  5KG2 A;  1N34 H;  1WVN A;  3KHR A;  2V5A A;  5KFY A;  2W8K A;  4LF6 H;  2R7M A;  4YP3 A;  1JLL B;  1AN7 A;  4EEQ A;  3G8C A;  3ETH A;  4NXM H;  4QMF B;  4O4I F;  1O75 A;  3HKZ A;  4FS2 A;  1JXL A;  5KG0 A;  3TII A;  2AGQ A;  1RYR A;  4NLG A;  4MAM A;  5IYC G;  4F4Y A;  1S0N A;  2J6S A;  5DQH A;  1TAE A;  2UXB H;  1VBG A;  1KJ8 A;  2VA3 A;  2BR0 A;  2UVU A;  1DV1 A;  3MR3 A;  3M4I A;  3T5J A;  4B3R H;  1ODH A;  3ORR A;  4YR2 A;  2AGO A;  5KFH A;  5FLX W;  5FJ8 G;  3AYH B;  4MA0 A;  1F0X A;  5H80 A;  5C1O A;  4TQS A;  2JA5 A;  3OHA A;  2ANN A;  1BXR A;  5L1I A;  1S9F A;  4Q8F A;  2PVP A;  4JI4 H;  1RJR A;  5DG9 A;  1JDB B;  2WE6 A;  1ZHQ A;  3HOV G;  4J9M A;  4LFA H;  2GPW A;  2PMZ A;  4IR1 A;  1XMQ H;  2ASL A;  2JA6 A;  4I50 F;  4J9Q A;  2R93 G;  2CTL A;  3HBL A;  2I80 A;  2R84 A;  3J80 W;  4A3I G;  5IYZ F;  2J6U A;  3H3V H;  4DR2 H;  5C0X G;  2YZN A;  4QIW A;  5CAE B;  2UVW A;  2C2R A;  3R5H A;  4MV9 A;  5KFV A;  3GIQ A;  2QND A;  4ED1 A;  3GII A;  4LH7 A;  4B3M H;  2C2D A;  1M0T A;  1CQJ B;  4IZO A;  5KT3 A;  1NXU A;  4J9P A;  4NXN H;  1TWF A;  2HVQ A;  3PZP A;  1S10 A;  2VA2 A;  4AYB A;  3J81 W;  2DIK A;  2W6Z A;  3N42 B;  4R8U A;  4I7H A;  4RNM A;  5L1J A;  4EBC A;  4ECV A;  4B8T A;  1DTJ A;  4QWB A;  4LSX A;  4Q43 A;  4GKK H;  5KFO A;  2FMA A;  2YRX A;  5DGB A;  4M7E A;  4BWS C;  2GLT A;  4QW8 A;  4A2B A;  4J0M A;  4NZT M;  5LMU H;  2MJH A;  2UXD H;  4U6P A;  2W6N A;  1TUA A;  2AGP A;  4ECY A;  4MV8 A;  1T3N A;  4MA5 A;  1ZZJ A;  2ANR A;  5A2Q W;  2HVS A;  1Z2N X;  2I87 A;  2UUB H;  2PY9 A;  1WCM G;  3BA8 A;  5DGA A;  3GTJ A;  4GLX A;  4ED6 A;  1XNQ H;  2MCT A;  5CA0 F;  2FJZ A;  3SB1 A;  2UVV A;  3BQ0 A;  1N32 H;  3HB9 A;  4XX0 B;  2R8K A;  4DL2 A;  1RYS A;  4DUZ H;  3GTQ A;  2NU6 B;  3BG5 A;  1Y1W G;  2W9C B;  2CTF A;  4JI8 H;  3GTL A;  1UC8 A;  1W96 A;  2QYZ A;  4O3O A;  1FVI A;  3RB4 A;  2YZG A;  1UG8 A;  4PWQ A;  4EYH B;  4BXX G;  1TWC A;  1E4F T;  5LA6 F;  2HH2 A;  5D1P A;  2BA0 A;  3KAJ A;  1KJJ A;  1WHR A;  1Y14 B;  2FE3 A;  2Y0S E;  4O2B F;  3UFX B;  2R93 A;  5KFL A;  3OSP A;  5DT9 A;  2W9A A;  4I55 F;  5DQG A;  5CB4 F;  5KFQ A;  1X9N A;  3GLK A;  2OH2 A;  4IRK A;  3N41 B;  5KFU A;  4R8U B;  3QZ8 A;  1J5E H;  4F4Z A;  5KG4 A;  1RK6 A;  2CTJ A;  5C4X G;  3GV7 B;  4DL4 A;  4Q45 A;  3GTK A;  2DZD A;  3T5L A;  4EFE A;  4FBT A;  3OUU A;  2IBK A;  5JQW A;  3H40 A;  1HR0 H;  4EEY A;  4NZR M;  3MWM A;  5I47 A;  2FPG B;  4AM3 A;  1V8C A;  3EYY A;  3WO1 A;  4C5C A;  4BBS G;  1AUV A;  2YS6 A;  2IP4 A;  1X0A A;  2VUG A;  4MV1 A;  2PQU A;  4JI3 H;  4LF4 H;  4X64 H;  4LF7 H;  4LF8 H;  4DR5 H;  3HXL A;  1GSA A;  3ETJ A;  4RNN A;  3H4B A;  3RB0 A;  4FBU A;  1PK8 A;  2W57 A;  2UU9 H;  4R7R A;  2CTM A;  4MV4 A;  2FFM A;  5GON F;  4DV1 H;  4E9J A;  4IRD A;  2ZDH A;  4DV4 H;  4A3J G;  3BA9 A;  2FB9 A;  4JYA H;  2R87 A;  5C44 G;  4DL6 A;  2JA5 G;  1Y1V A;  5KFC A;  2X0S A;  1EUD B;  3OET A;  4YB8 B;  5JH7 F;  5K2M A;  5KFE A;  2NU9 B;  1RJP A;  1Y1W A;  1HNW H;  2NU7 B;  4ZQI A;  5CA1 F;  2W6M A;  3UOE A;  3AEV B;  3I4M G;  3MJF A;  2PT7 G;  4ECR A;  2JA9 A;  4LMY A;  5KT6 A;  3FMA A;  4RU9 A;  4QWD A;  2F4V H;  3VKE A;  5LMN H;  5IP9 G;  2CPQ A;  3EPI A;  2JA6 G;  1GSO A;  2PN1 A;  4JI5 H;  3G6Y A;  1VIH A;  3LP8 A;  1SYX B;  1HNZ H;  1OWT A;  4RNO A;  2B63 A;  5FD6 A;  4BA2 I;  1TA8 A;  2WDT A;  2ZDG A;  4MTE A;  5C3E G;  3RB6 A;  2IA6 A;  1B04 A;  4A3L G;  3KDG A;  2ASD A;  2FPP B;  2ALZ A;  2ZDQ A;  4IFD G;  2R92 A;  1X4N A;  2ZM6 H;  1V9P A;  1BNC A;  1TWG A;  3R23 A;  4RAY A;  4WD3 A;  3FAU A;  2R8H A;  4HYK A;  4ED3 A;  4DL3 A;  2JVZ A;  2XIG A;  3VPD A;  2JA7 A;  1EUC B;  4GC6 A;  4TQR A;  4YR0 A;  3GTG A;  1GLV A;  2W7O A;  3RV4 A;  4JUZ A;  3HOZ G;  2CZG A;  1CQI B;  4QWC A;  2BL5 A;  1EC6 A;  2FK1 A;  2WB1 E;  4F4W A;  4DL7 A;  2RGR A;  3JZI A;  3TIN A;  5LYJ F;  2ZQE A;  4UCV A;  5KG5 A;  1PQX A;  1IBK H;  1B6R A;  3K5H A;  2M05 A;  4DL5 A;  4GC7 A;  2R82 A;  1J5K A;  1JDE A;  4UCT A;  2YYA A;  2V4R A;  2AQ4 A;  1C3O A;  2V58 A;  1M7J A;  1ZHS A;  4MV7 A;  3MFI A;  4JVH A;  1XDN A;  2IMW P;  5C5J A;  1FKA H;  5L9X A;  3H0G A;  3NGD A;  2NN6 G;  4ZHQ F;  5LP6 F;  2AU0 A;  1SEI A;  4IHJ F;  2BQU A;  1K83 A;  2VQE H;  4DLK A;  3V6J A;  1E4E B;  1S20 A;  3GR5 A;  4HNU A;  2D9I A;  1S68 A;  4DV6 H;  1EYZ A;  2YQR A;  1V9N A;  4FJS A;  3FKI G;  2JEA I;  3VMM A;  4EFB A;  3N44 B;  2FMR A;  1BJT A;  3GID A;  5LOV F;  1KEE A;  3RF2 A;  3HKZ E;  2FP4 B;  4TV8 F;  4O3Q A;  1K1G A;  2XCA A;  1V51 A;  1ZZK A;  2CWH A;  4DV3 H;  4Q8E A;  4LH6 A;  3MR5 A;  5KG1 A;  3TQ1 A;  3MFH A;  1DGS A;  5KFN A;  3GKU A;  5J2U F;  1XMO H;  5KFM A;  4Q0Y A;  1DIK A;  2WTF A;  2X06 A;  4BY7 G;  2VQF H;  3IG0 A;  5KFJ A;  2JZX A;  3OHB A;  4ECU A;  4OD6 A;  3PW7 A;  2BQR A;  2PBZ A;  4ECS A;  3PN1 A;  3T5K A;  5EWE A;  4J9S A;  3RBD A;  2R86 A;  1X4M A;  4A3C G;  5EWG A;  2R7N A;  2QK4 A;  2C00 A;  2WAQ E;  3KAK A;  1MSZ A;  4FM9 A;  1ULZ A;  2Z0S A;  3OSN A;  2W9B A;  4EYI B;  4U7C A;  3RJ0 A;  2KSW A;  4EGJ A;  4DV7 H;  3GTO A;  2JE6 I;  4DR1 H;  1KJQ A;  5KT4 A;  2O4C A;  1JX4 A;  2BQ3 A;  3GTM A;  4G08 A;  3UQ8 A;  4DR3 H;  1Y1V G;  1M6V A;  5EZY F;  1S0M A;  5KFZ A;  1IOV A;  1HNX H;  1AUX A;  1I3Q A;  5FLM G;  4IWY A;  2CWF A;  2CW7 A;  3N43 B;  2W7P A;  1DT4 A;  3FKI A;  4E4T A;  5BR8 H;  2NVY A;  1SCU B;  4AYB E;  5C1P A;  5KT5 A;  2A1S A;  5L1K A;  3PW2 A;  5KG7 A;  4MV3 A;  4ZI7 F;  3GIL A;  3I4N G;  1ZQ7 A;  4A3E G;  4WAL A;  4DV0 H;  3I12 A;  3Q1K A;  4JVY A; 
#chains in the Genus database with same CATH homology
 3T1H H;  1O75 A;  3KAL A;  3OET A;  1IBL H;  1TAE A;  1XNR H;  1HNW H;  2UXB H;  1S03 G;  4UCS A;  5FPR A;  2OWO A;  4AQY H;  2PT7 G;  4RB2 C;  4LMY A;  3FMA A;  2VPS A;  3M4I A;  3OTO H;  2F4V H;  4B3R H;  4DR7 H;  1ODH A;  5LMN H;  4EEQ A;  5FLX W;  1E4G T;  2Q2T A;  4JI5 H;  2UUC H;  1SYX B;  4OCH A;  1HNZ H;  1F0X A;  4YY3 H;  2WDT A;  1TA8 A;  4LSA A;  5FD6 A;  4MTE A;  3LML A;  1B04 A;  3KDG A;  4DR6 H;  3L4J A;  2ZM6 H;  3KXY T;  4JI4 H;  2E5L H;  1V9P A;  4RAY A;  2HVR A;  3FAU A;  4RB0 A;  5FD5 A;  4UCO A;  2WE6 A;  2XIG A;  1GYF A;  1ZHQ A;  2UUA H;  3RTX A;  4X66 H;  3OSS D;  4LFA H;  1I6U A;  3CVZ A;  1XMQ H;  3L2P A;  2RGV A;  4JI7 H;  2HHH H;  5D1O A;  3J80 W;  3H20 A;  4DR2 H;  5IWA H;  1FJG H;  4UCU A;  3RGX A;  2RGR A;  4JV5 H;  4PDB A;  4APM A;  4MV9 A;  2ZQE A;  4UCV A;  2Y3M A;  4LFC H;  4LH7 A;  1P8L A;  3NCV A;  4B3M H;  3JSL A;  1IBK H;  1M0T A;  4B3T H;  4JI1 H;  4NXN H;  2HVQ A;  4JI6 H;  4JI2 H;  4A2A A;  2VOB A;  3J81 W;  4MTD A;  3N42 B;  4UCT A;  1N33 H;  4I7H A;  2VKC A;  1ZHS A;  4LSX A;  4MV7 A;  2ZJT A;  1XDN A;  4GKK H;  1FKA H;  4M7E A;  4BWS C;  4LFB H;  3N40 P;  5FPO A;  1SEI A;  4NZT M;  4RAZ A;  4A2B A;  2VQE H;  5LMU H;  4K0K H;  4J0M A;  3GR5 A;  2UXD H;  2D9I A;  1S68 A;  3RIZ A;  4DV6 H;  4CC6 A;  3QD7 X;  4EFB A;  5A2Q W;  3N44 B;  1BJT A;  1Z2O X;  1Z2N X;  2HVS A;  3RF2 A;  2UUB H;  3BA8 A;  1X9Z A;  4GLX A;  1XNQ H;  2MCT A;  4EC5 A;  3SB1 A;  4DV3 H;  2HGS A;  4LH6 A;  4YHH H;  3C0F B;  4DV2 H;  1N32 H;  1DGS A;  4B8C D;  1XMO H;  5D1O B;  3BAA A;  4DUZ H;  4Q0Y A;  5EOY A;  2VQF H;  1IBM H;  4JI8 H;  3IG0 A;  4GKJ H;  1FVI A;  4OD6 A;  4LF5 H;  3EZJ A;  4IAJ A;  4UCR A;  1Z2P X;  1N36 H;  1E4F T;  1WH2 A;  2CW8 A;  3PN1 A;  4RB3 C;  5D1P A;  3KAJ A;  3L4K A;  3JAM W;  1M0W A;  2FE3 A;  4UFZ A;  4X65 H;  1BGW A;  2Q2U A;  4RZQ A;  4ETS A;  3J7A K;  5DT9 A;  4DV5 H;  4RB1 A;  1X9N A;  4KHP H;  3DF7 A;  2O03 A;  3N41 B;  1J5E H;  3RGZ A;  3BAB A;  2FPH X;  3KAK A;  1MZB A;  1L2Z A;  3F8N A;  4FM9 A;  3N6X A;  5LL6 b;  4DUY H;  3RJ0 A;  2KSW A;  4DV7 H;  1VS0 A;  4EFE A;  1HR0 H;  4B3S H;  3KDK A;  4DR1 H;  3GAB A;  4NZR M;  2O4C A;  4OX9 H;  5IT9 W;  3MWM A;  2YCH A;  4G08 A;  4JI0 H;  4DR3 H;  3UQ8 A;  3JSN A;  4LF9 H;  3EYY A;  1I94 H;  2VUG A;  1HNX H;  4LF7 H;  4JI3 H;  4LF4 H;  4X64 H;  4LF8 H;  2UXC H;  4DR5 H;  3HXL A;  3K3V A;  2CW7 A;  4CC5 A;  3N43 B;  1N34 H;  5BR8 H;  2W57 A;  2UU9 H;  4R7R A;  4DR4 H;  4X62 H;  4LF6 H;  4DV1 H;  2LF0 A;  4E9J A;  1AN7 A;  2WYO A;  3T1Y H;  4DV4 H;  4DV0 H;  1A0I A;  3BA9 A;  4NXM H;  4JYA H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...