4PDBA

Crystal structure of bacillus anthracis ribosomal protein s8 in complex with an rna aptamer
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
129
structure length
129
Chain Sequence
TDPIADMLTRIRNANMVRHEKLEVPASKIKKEIAELLKREGFIRDVEYIEDNKQGILRIFLKYGANNERVITGLKRISKPGLRVYAKADEVPRVLNGLGIALVSTSKGVMTDKDARQLQTGGEVVAYVW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 30S ribosomal protein S8
publication title Structure analysis of free and bound states of an RNA aptamer against ribosomal protein S8 from Bacillus anthracis.
pubmed doi rcsb
source organism Bacillus anthracis
molecule tags Ribosomal protein/rna
total genus 33
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2014-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00410 Ribosomal_S8 Ribosomal protein S8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.30 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 4pdbA01
3.30.1490.10 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4pdbA02
4LF7H 1HR0H 1XNRH 4LF8H 3JAMW 3OTOH 4PDBA 3RF2A 2ZM6H 4DV1H 1IBLH 4LF9H 1XMOH 4DV4H 2UUCH 5FLXW 4DV0H 4JI3H 4YHHH 4DR6H 4KHPH 4JI5H 2E5LH 2UXCH 1FKAH 3T1HH 4GKKH 3J80W 4JI8H 2F4VH 1S03G 4GKJH 4DV3H 4OX9H 1N32H 2UXDH 4DR7H 4LF4H 1SEIA 4X64H 4B3MH 4JI2H 1I94H 2UUBH 4LFBH 4DR1H 4DR5H 4DV2H 1XMQH 4DV6H 4JI4H 3J7AK 4DR3H 5BR8H 2UUAH 4JI7H 4LFCH 1N34H 5LL6b 2HHHH 5LMUH 2UU9H 3T1YH 4DR2H 1FJGH 2VQEH 1J5EH 5IWAH 4K0KH 4JI1H 4X65H 1I6UA 4X66H 2VQFH 4DV7H 4NXNH 4B3SH 5A2QW 4LF5H 1IBKH 4B3RH 4LFAH 4JYAH 3J81W 1AN7A 4X62H 4JV5H 1IBMH 1HNWH 4DR4H 1XNQH 4B3TH 4JI0H 4DUZH 1N33H 4DV5H 4LF6H 2UXBH 5IT9W 4NXMH 1HNXH 1N36H 4DUYH 4AQYH 4YY3H 5LMNH 1HNZH 4JI6H
chains in the Genus database with same CATH superfamily
4DL3A 2WTFA 3VKEA 4DL5A 4LF7H 2PMZA 3KAKA 5C3EG 4OD6A 3I12A 3PW0A 3UOEA 2I80A 2OLSA 2XIGA 2ZM6H 3GTQA 3GTPA 4A3BG 3BA8A 5HV6A 4EFEA 1KC7A 2FK1A 4G3IA 3N41B 5KFZA 5CA0F 3N43B 2V58A 5FLXW 2BL5A 3TQTA 1BNCA 2OH2A 2OPUA 2PQUA 3G8CA 4DLKA 2CTLA 1F0XA 2I87A 1M7JA 2JA6A 2BR0A 4JI5H 2WYOA 2UXCH 4J9OA 5IYCG 2UVRA 1N48A 4UFZA 2J6UA 3H3VH 3QZ7A 3JSLA 3M4IA 4WBNF 2V4QA 2F4VH 2KSWA 5L1JA 1SCUB 5KT5A 2JEGA 3U9TA 3HOZG 3GTMA 2BA0A 4R8UA 4OX9H 4AIMA 1BXRA 1TWCA 3N6XA 4BY1G 2HH2A 4TUYF 2UXDH 4XZ3B 2Q2TA 4HQ6A 2AGPA 2W6NA 1S0OA 2VPSA 3Q8QB 5KFFA 2MCTA 4ECTA 4H8AA 3V4ZA 2FMRA 3Q8PB 4LH6A 2Z0SA 4DR1H 4QW9A 3I4NG 2ATLA 4IR9A 1V51A 3LP8A 4HYKA 2YRWA 2CQYA 1E4GT 3OUZA 4RAYA 4DV6H 4DL7A 2CWFA 3GV5B 1X9NA 3JSNA 2XCAA 1PQXA 1MSZA 2AQ4A 2OWOA 2JA9A 5D1OB 2R7ZA 1K1SA 3J7AK 3K3PA 2YS7A 2XC9A 2PVPA 1IOWA 5BR8H 4IWXA 2R8HA 1KJQA 4FJUA 2UUAH 3VMMA 4I4TF 1TWHA 4YJ3F 3RBEA 1W96A 4XYMB 1RJQA 1NXUA 4JUZA 2HHHH 5LL6b 5DG7A 2DPIA 3KHGA 1VIHA 2R7MA 4I50F 3I4MG 3HXLA 4M7EA 2XCPA 2O03A 2ANRA 1I3QA 2FPHX 3MR5A 1S0MA 1I7LA 3KDKA 4RZQA 3GIQA 4I7HA 5KFDA 3BQ2A 2HH3A 1FJGH 2ANNA 3FMAA 3V69A 5JH7F 3MWEA 4LSXA 1KJJA 2QNDA 2CTEA 5BPHA 1KHMA 5CB4F 3GIDA 3RGXA 3EZJA 3FKIG 3C0FB 4ZHQF 3G6YA 4J9QA 4A3FG 5IWAH 1DT4A 3MJFA 4K0KH 5EWGA 2ALZA 2R93A 3SE7A 2UVWA 2C2RA 1I6UA 3PZPA 4BA2I 3T5JA 4C5CA 3PR5B 2YRXA 4DL4A 5J2UF 2D9IA 4EBCA 3RJ0A 1IBKH 2ZJTA 5KT3A 4B8CD 2JEFA 1AN7A 4IRCA 4YJ2F 3GILA 3RFCA 2RF4A 5LOVF 2W71A 2YZMA 4WD3A 3GIMA 1X4MA 4AYBE 2AGQA 2QYZA 1E4EA 1IBMH 2DZDA 2WB1E 3LMLA 1HNWH 4MA0A 4MTDA 2UVVA 1XNQH 1FVIA 2DLNA 2PN1A 4DUZH 1N33H 5KFOA 5DG9A 2R86A 3UQ8A 2LRRA 1Z2IA 3GV8B 5KFNA 4LF6H 2NU9B 2UXBH 2XCLA 4QJFA 3L4KA 3RBDA 1JDBB 5IT9W 4NXMH 1ZZIA 2R87A 4RZRA 2V5AA 4YQWA 2K1HA 4AQYH 2YL2A 2NU6B 4A3LG 3L7ZC 5KFXA 2FPGB 4QWDA 4YY3H 4EG0A 5KFPA 4ED8A 1TA8A 2YQRA 2NU7B 2W57A 4WALA 1R9TA 1JKJB 1UC9A 2R8KA 2R82A 3LWBA 3BG5A 3GV7B 2XGPA 3KHHA 2CW8A 1W93A 2J6TA 3DF7A 4CC5A 5KFIA 2CKZB 1XNRH 4LF8H 3JAMW 3GIKA 3PO3G 4RUCA 3RF2A 3GIJA 3BQ1A 1IBLH 1KJ8A 4AYBA 4FS2A 1RK5A 2WB1A 4DV4H 4XX0B 4C5BA 4QWEA 4EYIB 4Y8VB 3Q8SB 2JEJA 4QW8A 4HR7A 2JA5G 3H20A 4U6PA 2W6OA 4DV0H 2C00A 4J9SA 1WVNA 5KT6A 2NUAB 4QWCA 1EC6A 3EPIA 5DQGA 1RYRA 1V8CA 3RV3A 1ZHSA 4RB2C 2AXYA 1VIGA 1PX2A 2FB9A 4JI8H 3MWDA 5DQIA 3FAUA 2CTKA 4TQRA 4ECZA 4O3SA 3KXYT 2BQRA 2V4RA 2B63G 4ECQA 1Z2PX 2VUMA 1B6SA 5JVLA 1DIKA 3BABA 4B3MH 5FD6A 1I94H 1BGWA 2YYAA 4LFBH 1M0TA 5IYZF 4MTEA 3U9SA 3HOYG 2Y0SE 1B04A 3N42B 2VA3A 3T5HA 4YB8B 1PK8A 2W70A 1ZQ7A 4ME6A 4UCVA 4O3QA 4FM9A 3E5NA 4A3JG 1CE8A 2FFMA 4F50A 2HJWA 1GSOA 2E2IA 4JI4H 2W9CA 4ZOLF 2YCHA 4LH7A 4RNMA 2DPJA 2NN6G 1TWFA 2LTLA 4WANA 4DR3H 2YZGA 3GIPA 5DLFA 2FLNA 2W6ZA 2JEBI 4IR1A 3K5HA 2VUGA 5KFCA 4DL6A 1N56A 4JI7H 1VKZA 5LXTF 4O3RA 5KFBA 3AEVB 2JZXA 2R85A 1N34H 2JEAI 3GTKA 1KJIA 3WNZA 3RIZA 4LMYA 2AU0A 2CPQA 4ECUA 4A3IG 1KEEA 4ECRA 2BQ3A 2HVRA 1A0IA 3T1YH 3QD7X 1E4FT 5J2TF 3RGZA 4DR2H 2FP4B 2HVSA 4JVHA 1J5EH 3JRXA 3Q2OA 4MAMA 3UFXB 1ODHA 1MZBA 5DGBA 3RAQA 4U7CA 3MFIA 1T3NA 4J9LA 1K83A 1I7NA 4UCRA 5L1KA 2RDJA 2JA7G 2FJZA 2Y0SA 2JEIA 2Q2UA 2WDTA 4J0MA 1TAEA 4IRDA 1I50A 2VQFH 4DV7H 2W8KA 4NXNH 2C22A 4B3SH 4DL2A 2NU8B 4F4WA 4A3DG 4QWAA 4LF5H 5KG4A 3J81W 4OCHA 5LYJF 1JIHA 5KX5F 3TINA 2VA2A 5L1IA 3HOXG 5BPFA 4RNOA 3EYYA 4R8UB 3BJYA 4IZOA 4YAKB 5KFJA 4ZQIA 3H4BA 4ECWA 4NBQA 2ZDGA 2JA8G 2O4CA 5FPRA 2Y3MA 4DV5H 4RU9A 4UCOA 3HOWG 4Q45A 4Q44A 5KFAA 2FKLA 1SFOA 2LTMA 5KFGA 3KDGA 3NGDA 3RUPA 4OO1G 2YZNA 3WO0A 3GABA 1S20A 4CC6A 4EBDA 1WCMG 1Y1WG 4L1KA 1JX4A 5KFRA 2PY9A 5LMNH 3V6HA 4NZTM 3OSNA 2J9GA 2BQUA 3M9NB 5IYBG 2VKCA 3MR3A 3R23A 5L9XA 2R6FA 5IYDG 2AGOA 4AM3A 3G6VA 1GLVA 1HR0H 4BBSG 1TWGA 2RDIA 5GONF 5DQHA 3T5KA 5D1PA 3OTOH 2R7NA 4A2AA 4G08A 4DV1H 3BA9A 1J5KA 4O3OA 2ASLA 1RK6A 5C44G 4LF9H 2R8IA 2UUCH 5DG8A 1S68A 1K1GA 3VPBA 5KFEA 3KHRA 1X0AA 2FPPB 5F9NA 3V6KA 4YBZB 3ETHA 4HNVA 1EZ1A 2PBZA 4UCTA 4RB3C 4MA5A 3K3VA 3EPGA 2CW7A 4JI3H 3ORQA 4YHHH 4DR6H 4IWYA 2W9BB 1S0NA 4NLGA 3R5XA 4QMFB 1EUCB 4RB0A 3PW2A 2E5LH 4MV6A 2UVUA 4C5AA 1FKAH 3BAAA 4IFDG 3U1KA 3T1HH 1AUXA 4IAJA 4UCUA 5KFLA 4ZI7F 4ED6A 3GTLA 2C28A 2RGRA 4DV3H 4GC6A 1N32H 2NVYA 3N40P 1WSCA 3CQZA 5CA1F 4EGQA 4A3EG 4LF4H 3CVZA 5JQWA 4QWBA 1S9FA 4A93G 1UG8A 2G8YA 1GO3E 4X64H 4O2AF 4JI2H 1DGSA 1E4EB 3FKIA 3ORRA 5BMVF 5IP9G 4RUAA 4BY7G 2HVQA 2DGRA 4YR3A 4BXXG 5KFWA 1JDEA 4FBTA 2W9AA 5L1LA 1K1QA 4DV2H 4FS1A 3HOUG 2R7ZG 1XMQH 4EGJA 3GTGA 4LIJA 4HNUA 5K36G 1TWAA 2ZDQA 1P8LA 4ED1A 2CTJA 2FK2A 2HGSA 2VQDA 5T14A 4ED3A 2CWHA 3GLKA 1GSAA 3PW7A 2YW2A 2PMZE 2R84A 3K5IA 3M9MB 1T94A 5FD5A 4J9NA 4F4ZA 4ECSA 1JLLB 3WO1A 2YU9A 2JA6G 1GYFA 4LFCH 1OWTA 5I47A 1XRHA 1VS0A 4JV2A 4GLXA 1L2ZA 4APMA 5KG5A 1Z2OX 3OSPA 2UU9H 5JEAG 5EWFA 3HBLA 3KALA 2WAQE 4BBRG 5KFUA 4TQSA 3V4SA 1C3OA 2VQEH 2JVZA 5KG2A 1O75A 1EYZA 1TUAA 3F8NA 2W7OA 5H80A 4A3KG 4F4XA 3GR5A 4JI1H 2W8LA 2X06A 1GSHA 4X66H 4PWQA 1CQJB 3H4DA 1VBHA 4EBEA 4ECVA 3SI8A 5KFVA 2JE6I 2FPIB 3R5FA 5FPOA 5DGAA 2ZQEA 5KFMA 4LFAH 4JYAH 4BWSC 3MR6A 1BJTA 1GGOA 2CPMA 5KG1A 2OPVA 3H0GG 3RV4A 5KG0A 3GIIA 3HKZE 2ZDHA 4O3NA 3PR4A 2VR1A 2C2EA 2A1SA 2FE3A 3PO2G 3RB0A 4JI0H 4YR2A 5KG3A 1Y1VG 1V4YA 5KT7A 2IBKA 3HOVG 4MV9A 5KFHA 4ECYA 4MV7A 2JA5A 2R8JA 4E9JA 5KG6A 2ASDA 2R92G 1ZTGA 4JV1A 2WAQA 3GKUA 4C2MA 5D1OA 1KJ9A 4J9KA 2LF0A 3TIIA 1CQIB 4DUYH 2W9CB 3HB9A 2CTMA 2QK4A 2X0SA 2FLLA 4ED0A 2R93G 4A3MG 2B63A 2CTFA 5KT4A 1SYXB 5JUMA 4JI6H 3OETA 2C2DA 3N44B 3ETJA 4MV8A 3PW5A 5KFYA 4YP3A 4IRKA 5EDWA 4A3CG 2M8WA 3OHBA 4PDBA 4Q43A 4EYHB 3SB1A 2V59A 5F9LA 4I55F 3HKZA 4Q8FA 2CZGA 2M05A 1XMOH 2WE6A 3GTOA 2V9WA 1ZHQA 5KFQA 1VBIA 3FDSA 4FU0A 3I0PA 4RB1A 2W7PA 4FBUA 4JVYA 1DTJA 1EHIA 4NZRM 2M6QA 4GC7A 3AYHB 1UNNC 1VAJA 5LP6F 2NVXA 4KHPH 5C1OA 2XD4A 3Q1KA 3H0GA 3N8DA 4RNNA 4JV0A 1RJPA 3OUUA 3OHAA 1RJRA 2I8CA 4J9RA 3GTJA 5EWEA 1XDNA 4GKKH 2ASJA 3J80W 2VOBA 5DLGA 4YAJB 5JVDF 5KG7A 5IP7G 1S03G 4M9UA 1Y1VA 2R7LA 4GKJH 4EEYA 4ECXA 4TV8F 3IG0A 2PT7G 2R7KA 2GPWA 4BA1I 4R7RA 5C5JA 2FLPA 4DR7H 1Z2NX 1ULZA 2R92A 1SEIA 2VPQA 3RB6A 3PN1A 1J4WA 2UUBH 4O4LF 1DV2A 4EEQA 1S97A 2JA7A 2FK3A 1IOVA 3TIGA 4O4HF 2W9BA 4DR5H 1Y14B 4XYLB 4A2BA 4QIWE 4EC5A 1X4NA 2C35B 4ED2A 3KHLA 1VBGA 4LSAA 3TQ1A 2IMWP 2GPSA 4EFBA 5DT9A 5K2MA 1UC8A 1C30A 4TV9F 5LA6F 1JXLA 1B33N 4O3PA 3NCVA 2E2HA 4UCSA 5FLMG 1ZZKA 2FMAA 5KFKA 3M9OB 4MV3A 5LMUH 3PVXA 3BQ0A 3OSSD 5EOYA 2P2RA 1WHRA 3L2PA 5KKNB 1Y1WA 1WCMA 2VUMG 4FJSA 4ETSA 2XGQA 3IN5A 5C4XG 4O4IF 4X65H 2W6QA 1A9XA 2GLTA 5CAEB 3JZIA 4QIWA 4J9MA 5C1PA 3RTXA 5C8YF 2W6PA 4J9PA 1X9ZA 4Q8EA 4HNTA 2DIKA 5A2QW 4B3RH 3MWMA 2SCUB 5KT2A 2RGVA 2IA6A 4X62H 3RB4A 4B8TA 4JV5H 1ZZJA 4RAZA 1KBLA 1ZETA 1T36A 1V9PA 4DR4H 1WH2A 1EUDB 2MJHA 2E3UA 4MV4A 1WR2A 1M6VA 1WTJA 5HBRB 3JRWA 4F4YA 4B3TH 3RB3A 1V9NA 5KFTA 3QZ8A 4IHJF 2W6MA 3H40A 1RYSA 3VPDA 4A3GG 3VPCA 4E4TA 3MR2A 4O2BF 2P0AA 2DWCA 5FJ8G 1WE8A 5EZYF 5KFSA 3PW4A 3RAXA 1HNXH 2YS6A 1N36H 3KTMA 4MV1A 3GQCA 2J6SA 4ED7A 1B6RA 1M0WA 4Q0YA 3V6JA 1AUVA 3MFHA 1S10A 2R8GA 1HNZH 3KAJA 3R5HA 3Q8RB 5C0XG 2IP4A 3QFFA 1CS0A 4YR0A 3L4JA 3G6XA 3T5LA 5D8DA 1DV1A
chains in the Genus database with same CATH topology
2CW8A 4LF7H 3DF7A 1HR0H 3KAKA 4OD6A 4CC5A 1XNRH 4LF8H 3JAMW 5D1PA 3OTOH 5FD6A 4PDBA 3RF2A 4A2AA 4G08A 2XIGA 2ZM6H 3SB1A 4DV1H 3BA9A 1IBLH 3BA8A 4EFEA 4LF9H 2WE6A 1XMOH 3N41B 4DV4H 2UUCH 3N43B 1S68A 1ZHQA 5FLXW 4RB1A 3H20A 4NZRM 4DV0H 4UCTA 4RB3C 3K3VA 2CW7A 4JI3H 4YHHH 1F0XA 4DR6H 4KHPH 4RB0A 4JI5H 2WYOA 2E5LH 2UXCH 1ZHSA 4UFZA 4RB2C 1FKAH 3BAAA 4UCUA 3T1HH 1XDNA 4GKKH 4IAJA 3J80W 2VOBA 3JSLA 4JI8H 3M4IA 2F4VH 1S03G 2KSWA 4GKJH 3FAUA 2RGRA 4DV3H 3IG0A 2PT7G 4OX9H 1N32H 3KXYT 3N40P 3N6XA 4R7RA 2Q2TA 2UXDH 4DR7H 4LF4H 1Z2NX 1Z2PX 3CVZA 2VPSA 1SEIA 2MCTA 4X64H 3BABA 4B3MH 4JI2H 1DGSA 1I94H 2UUBH 1BGWA 3PN1A 4LFBH 1M0TA 4LH6A 2HVQA 4MTEA 4DR1H 4EEQA 1B04A 3N42B 4DR5H 4A2BA 4EC5A 4DV2H 4UCVA 4FM9A 1XMQH 4LSAA 4RAYA 1E4GT 4DV6H 4EFBA 1X9NA 5DT9A 4JI4H 3JSNA 2OWOA 1P8LA 2YCHA 4LH7A 5D1OB 2HGSA 3J7AK 4DR3H 5FD5A 3NCVA 5BR8H 2VUGA 2UUAH 4JI7H 1GYFA 4LFCH 4UCSA 1VS0A 1N34H 5LL6b 2HHHH 4GLXA 1L2ZA 4APMA 4LMYA 3RIZA 2HVRA 5LMUH 1Z2OX 2UU9H 3HXLA 4M7EA 2O03A 1A0IA 3KALA 3T1YH 2FPHX 3OSSD 3QD7X 1E4FT 5EOYA 3KDKA 3RGZA 4RZQA 4I7HA 4DR2H 3L2PA 1FJGH 2VQEH 1J5EH 3FMAA 2HVSA 1O75A 4LSXA 1ODHA 1MZBA 3F8NA 3RGXA 3EZJA 3C0FB 5IWAH 4ETSA 4K0KH 4UCRA 3GR5A 4JI1H 2Q2UA 4X65H 2WDTA 1I6UA 4J0MA 4X66H 1TAEA 2VQFH 4DV7H 2D9IA 4NXNH 3RTXA 4B3SH 1X9ZA 3RJ0A 5FPOA 2ZQEA 5A2QW 4LF5H 1IBKH 4B3RH 4LFAH 4B8CD 3J81W 1AN7A 4OCHA 4X62H 4JYAH 1BJTA 2RGVA 4BWSC 4JV5H 4RAZA 2ZJTA 1V9PA 1IBMH 3LMLA 4MTDA 1HNWH 4DR4H 1WH2A 3EYYA 1XNQH 1FVIA 2FE3A 4B3TH 2O4CA 4DUZH 4JI0H 1N33H 2Y3MA 4DV5H 5FPRA 3UQ8A 4MV9A 4MV7A 4UCOA 4E9JA 4LF6H 3MWMA 2UXBH 3L4KA 3KDGA 5IT9W 4NXMH 5D1OA 1HNXH 3GABA 4CC6A 2LF0A 1N36H 4DUYH 4AQYH 1M0WA 4Q0YA 4YY3H 5LMNH 1HNZH 4NZTM 1TA8A 3KAJA 1SYXB 2W57A 2VKCA 4JI6H 3OETA 3L4JA 3N44B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF7 H;  1HR0 H;  1XNR H;  4LF8 H;  3JAM W;  3OTO H;  4PDB A;  3RF2 A;  2ZM6 H;  4DV1 H;  1IBL H;  4LF9 H;  1XMO H;  4DV4 H;  2UUC H;  5FLX W;  4DV0 H;  4JI3 H;  4YHH H;  4DR6 H;  4KHP H;  4JI5 H;  2E5L H;  2UXC H;  1FKA H;  3T1H H;  4GKK H;  3J80 W;  4JI8 H;  2F4V H;  1S03 G;  4GKJ H;  4DV3 H;  4OX9 H;  1N32 H;  2UXD H;  4DR7 H;  4LF4 H;  1SEI A;  4X64 H;  4B3M H;  4JI2 H;  1I94 H;  2UUB H;  4LFB H;  4DR1 H;  4DR5 H;  4DV2 H;  1XMQ H;  4DV6 H;  4JI4 H;  3J7A K;  4DR3 H;  5BR8 H;  2UUA H;  4JI7 H;  4LFC H;  1N34 H;  5LL6 b;  2HHH H;  5LMU H;  2UU9 H;  3T1Y H;  4DR2 H;  1FJG H;  2VQE H;  1J5E H;  5IWA H;  4K0K H;  4JI1 H;  4X65 H;  1I6U A;  4X66 H;  2VQF H;  4DV7 H;  4NXN H;  4B3S H;  5A2Q W;  4LF5 H;  1IBK H;  4B3R H;  4LFA H;  4JYA H;  3J81 W;  1AN7 A;  4X62 H;  4JV5 H;  1IBM H;  1HNW H;  4DR4 H;  1XNQ H;  4B3T H;  4JI0 H;  4DUZ H;  1N33 H;  4DV5 H;  4LF6 H;  2UXB H;  5IT9 W;  4NXM H;  1HNX H;  1N36 H;  4DUY H;  4AQY H;  4YY3 H;  5LMN H;  1HNZ H;  4JI6 H; 
#chains in the Genus database with same CATH topology
 4DL3 A;  2WTF A;  3VKE A;  4DL5 A;  4LF7 H;  2PMZ A;  3KAK A;  5C3E G;  4OD6 A;  3I12 A;  3PW0 A;  3UOE A;  2I80 A;  2OLS A;  2XIG A;  2ZM6 H;  3GTQ A;  3GTP A;  4A3B G;  3BA8 A;  5HV6 A;  4EFE A;  1KC7 A;  2FK1 A;  4G3I A;  3N41 B;  5KFZ A;  5CA0 F;  3N43 B;  2V58 A;  5FLX W;  2BL5 A;  3TQT A;  1BNC A;  2OH2 A;  2OPU A;  2PQU A;  3G8C A;  4DLK A;  2CTL A;  1F0X A;  2I87 A;  1M7J A;  2JA6 A;  2BR0 A;  4JI5 H;  2WYO A;  2UXC H;  4J9O A;  5IYC G;  2UVR A;  1N48 A;  4UFZ A;  2J6U A;  3H3V H;  3QZ7 A;  3JSL A;  3M4I A;  4WBN F;  2V4Q A;  2F4V H;  2KSW A;  5L1J A;  1SCU B;  5KT5 A;  2JEG A;  3U9T A;  3HOZ G;  3GTM A;  2BA0 A;  4R8U A;  4OX9 H;  4AIM A;  1BXR A;  1TWC A;  3N6X A;  4BY1 G;  2HH2 A;  4TUY F;  2UXD H;  4XZ3 B;  2Q2T A;  4HQ6 A;  2AGP A;  2W6N A;  1S0O A;  2VPS A;  3Q8Q B;  5KFF A;  2MCT A;  4ECT A;  4H8A A;  3V4Z A;  2FMR A;  3Q8P B;  4LH6 A;  2Z0S A;  4DR1 H;  4QW9 A;  3I4N G;  2ATL A;  4IR9 A;  1V51 A;  3LP8 A;  4HYK A;  2YRW A;  2CQY A;  1E4G T;  3OUZ A;  4RAY A;  4DV6 H;  4DL7 A;  2CWF A;  3GV5 B;  1X9N A;  3JSN A;  2XCA A;  1PQX A;  1MSZ A;  2AQ4 A;  2OWO A;  2JA9 A;  5D1O B;  2R7Z A;  1K1S A;  3J7A K;  3K3P A;  2YS7 A;  2XC9 A;  2PVP A;  1IOW A;  5BR8 H;  4IWX A;  2R8H A;  1KJQ A;  4FJU A;  2UUA H;  3VMM A;  4I4T F;  1TWH A;  4YJ3 F;  3RBE A;  1W96 A;  4XYM B;  1RJQ A;  1NXU A;  4JUZ A;  2HHH H;  5LL6 b;  5DG7 A;  2DPI A;  3KHG A;  1VIH A;  2R7M A;  4I50 F;  3I4M G;  3HXL A;  4M7E A;  2XCP A;  2O03 A;  2ANR A;  1I3Q A;  2FPH X;  3MR5 A;  1S0M A;  1I7L A;  3KDK A;  4RZQ A;  3GIQ A;  4I7H A;  5KFD A;  3BQ2 A;  2HH3 A;  1FJG H;  2ANN A;  3FMA A;  3V69 A;  5JH7 F;  3MWE A;  4LSX A;  1KJJ A;  2QND A;  2CTE A;  5BPH A;  1KHM A;  5CB4 F;  3GID A;  3RGX A;  3EZJ A;  3FKI G;  3C0F B;  4ZHQ F;  3G6Y A;  4J9Q A;  4A3F G;  5IWA H;  1DT4 A;  3MJF A;  4K0K H;  5EWG A;  2ALZ A;  2R93 A;  3SE7 A;  2UVW A;  2C2R A;  1I6U A;  3PZP A;  4BA2 I;  3T5J A;  4C5C A;  3PR5 B;  2YRX A;  4DL4 A;  5J2U F;  2D9I A;  4EBC A;  3RJ0 A;  1IBK H;  2ZJT A;  5KT3 A;  4B8C D;  2JEF A;  1AN7 A;  4IRC A;  4YJ2 F;  3GIL A;  3RFC A;  2RF4 A;  5LOV F;  2W71 A;  2YZM A;  4WD3 A;  3GIM A;  1X4M A;  4AYB E;  2AGQ A;  2QYZ A;  1E4E A;  1IBM H;  2DZD A;  2WB1 E;  3LML A;  1HNW H;  4MA0 A;  4MTD A;  2UVV A;  1XNQ H;  1FVI A;  2DLN A;  2PN1 A;  4DUZ H;  1N33 H;  5KFO A;  5DG9 A;  2R86 A;  3UQ8 A;  2LRR A;  1Z2I A;  3GV8 B;  5KFN A;  4LF6 H;  2NU9 B;  2UXB H;  2XCL A;  4QJF A;  3L4K A;  3RBD A;  1JDB B;  5IT9 W;  4NXM H;  1ZZI A;  2R87 A;  4RZR A;  2V5A A;  4YQW A;  2K1H A;  4AQY H;  2YL2 A;  2NU6 B;  4A3L G;  3L7Z C;  5KFX A;  2FPG B;  4QWD A;  4YY3 H;  4EG0 A;  5KFP A;  4ED8 A;  1TA8 A;  2YQR A;  2NU7 B;  2W57 A;  4WAL A;  1R9T A;  1JKJ B;  1UC9 A;  2R8K A;  2R82 A;  3LWB A;  3BG5 A;  3GV7 B;  2XGP A;  3KHH A;  2CW8 A;  1W93 A;  2J6T A;  3DF7 A;  4CC5 A;  5KFI A;  2CKZ B;  1XNR H;  4LF8 H;  3JAM W;  3GIK A;  3PO3 G;  4RUC A;  3RF2 A;  3GIJ A;  3BQ1 A;  1IBL H;  1KJ8 A;  4AYB A;  4FS2 A;  1RK5 A;  2WB1 A;  4DV4 H;  4XX0 B;  4C5B A;  4QWE A;  4EYI B;  4Y8V B;  3Q8S B;  2JEJ A;  4QW8 A;  4HR7 A;  2JA5 G;  3H20 A;  4U6P A;  2W6O A;  4DV0 H;  2C00 A;  4J9S A;  1WVN A;  5KT6 A;  2NUA B;  4QWC A;  1EC6 A;  3EPI A;  5DQG A;  1RYR A;  1V8C A;  3RV3 A;  1ZHS A;  4RB2 C;  2AXY A;  1VIG A;  1PX2 A;  2FB9 A;  4JI8 H;  3MWD A;  5DQI A;  3FAU A;  2CTK A;  4TQR A;  4ECZ A;  4O3S A;  3KXY T;  2BQR A;  2V4R A;  2B63 G;  4ECQ A;  1Z2P X;  2VUM A;  1B6S A;  5JVL A;  1DIK A;  3BAB A;  4B3M H;  5FD6 A;  1I94 H;  1BGW A;  2YYA A;  4LFB H;  1M0T A;  5IYZ F;  4MTE A;  3U9S A;  3HOY G;  2Y0S E;  1B04 A;  3N42 B;  2VA3 A;  3T5H A;  4YB8 B;  1PK8 A;  2W70 A;  1ZQ7 A;  4ME6 A;  4UCV A;  4O3Q A;  4FM9 A;  3E5N A;  4A3J G;  1CE8 A;  2FFM A;  4F50 A;  2HJW A;  1GSO A;  2E2I A;  4JI4 H;  2W9C A;  4ZOL F;  2YCH A;  4LH7 A;  4RNM A;  2DPJ A;  2NN6 G;  1TWF A;  2LTL A;  4WAN A;  4DR3 H;  2YZG A;  3GIP A;  5DLF A;  2FLN A;  2W6Z A;  2JEB I;  4IR1 A;  3K5H A;  2VUG A;  5KFC A;  4DL6 A;  1N56 A;  4JI7 H;  1VKZ A;  5LXT F;  4O3R A;  5KFB A;  3AEV B;  2JZX A;  2R85 A;  1N34 H;  2JEA I;  3GTK A;  1KJI A;  3WNZ A;  3RIZ A;  4LMY A;  2AU0 A;  2CPQ A;  4ECU A;  4A3I G;  1KEE A;  4ECR A;  2BQ3 A;  2HVR A;  1A0I A;  3T1Y H;  3QD7 X;  1E4F T;  5J2T F;  3RGZ A;  4DR2 H;  2FP4 B;  2HVS A;  4JVH A;  1J5E H;  3JRX A;  3Q2O A;  4MAM A;  3UFX B;  1ODH A;  1MZB A;  5DGB A;  3RAQ A;  4U7C A;  3MFI A;  1T3N A;  4J9L A;  1K83 A;  1I7N A;  4UCR A;  5L1K A;  2RDJ A;  2JA7 G;  2FJZ A;  2Y0S A;  2JEI A;  2Q2U A;  2WDT A;  4J0M A;  1TAE A;  4IRD A;  1I50 A;  2VQF H;  4DV7 H;  2W8K A;  4NXN H;  2C22 A;  4B3S H;  4DL2 A;  2NU8 B;  4F4W A;  4A3D G;  4QWA A;  4LF5 H;  5KG4 A;  3J81 W;  4OCH A;  5LYJ F;  1JIH A;  5KX5 F;  3TIN A;  2VA2 A;  5L1I A;  3HOX G;  5BPF A;  4RNO A;  3EYY A;  4R8U B;  3BJY A;  4IZO A;  4YAK B;  5KFJ A;  4ZQI A;  3H4B A;  4ECW A;  4NBQ A;  2ZDG A;  2JA8 G;  2O4C A;  5FPR A;  2Y3M A;  4DV5 H;  4RU9 A;  4UCO A;  3HOW G;  4Q45 A;  4Q44 A;  5KFA A;  2FKL A;  1SFO A;  2LTM A;  5KFG A;  3KDG A;  3NGD A;  3RUP A;  4OO1 G;  2YZN A;  3WO0 A;  3GAB A;  1S20 A;  4CC6 A;  4EBD A;  1WCM G;  1Y1W G;  4L1K A;  1JX4 A;  5KFR A;  2PY9 A;  5LMN H;  3V6H A;  4NZT M;  3OSN A;  2J9G A;  2BQU A;  3M9N B;  5IYB G;  2VKC A;  3MR3 A;  3R23 A;  5L9X A;  2R6F A;  5IYD G;  2AGO A;  4AM3 A;  3G6V A;  1GLV A;  1HR0 H;  4BBS G;  1TWG A;  2RDI A;  5GON F;  5DQH A;  3T5K A;  5D1P A;  3OTO H;  2R7N A;  4A2A A;  4G08 A;  4DV1 H;  3BA9 A;  1J5K A;  4O3O A;  2ASL A;  1RK6 A;  5C44 G;  4LF9 H;  2R8I A;  2UUC H;  5DG8 A;  1S68 A;  1K1G A;  3VPB A;  5KFE A;  3KHR A;  1X0A A;  2FPP B;  5F9N A;  3V6K A;  4YBZ B;  3ETH A;  4HNV A;  1EZ1 A;  2PBZ A;  4UCT A;  4RB3 C;  4MA5 A;  3K3V A;  3EPG A;  2CW7 A;  4JI3 H;  3ORQ A;  4YHH H;  4DR6 H;  4IWY A;  2W9B B;  1S0N A;  4NLG A;  3R5X A;  4QMF B;  1EUC B;  4RB0 A;  3PW2 A;  2E5L H;  4MV6 A;  2UVU A;  4C5A A;  1FKA H;  3BAA A;  4IFD G;  3U1K A;  3T1H H;  1AUX A;  4IAJ A;  4UCU A;  5KFL A;  4ZI7 F;  4ED6 A;  3GTL A;  2C28 A;  2RGR A;  4DV3 H;  4GC6 A;  1N32 H;  2NVY A;  3N40 P;  1WSC A;  3CQZ A;  5CA1 F;  4EGQ A;  4A3E G;  4LF4 H;  3CVZ A;  5JQW A;  4QWB A;  1S9F A;  4A93 G;  1UG8 A;  2G8Y A;  1GO3 E;  4X64 H;  4O2A F;  4JI2 H;  1DGS A;  1E4E B;  3FKI A;  3ORR A;  5BMV F;  5IP9 G;  4RUA A;  4BY7 G;  2HVQ A;  2DGR A;  4YR3 A;  4BXX G;  5KFW A;  1JDE A;  4FBT A;  2W9A A;  5L1L A;  1K1Q A;  4DV2 H;  4FS1 A;  3HOU G;  2R7Z G;  1XMQ H;  4EGJ A;  3GTG A;  4LIJ A;  4HNU A;  5K36 G;  1TWA A;  2ZDQ A;  1P8L A;  4ED1 A;  2CTJ A;  2FK2 A;  2HGS A;  2VQD A;  5T14 A;  4ED3 A;  2CWH A;  3GLK A;  1GSA A;  3PW7 A;  2YW2 A;  2PMZ E;  2R84 A;  3K5I A;  3M9M B;  1T94 A;  5FD5 A;  4J9N A;  4F4Z A;  4ECS A;  1JLL B;  3WO1 A;  2YU9 A;  2JA6 G;  1GYF A;  4LFC H;  1OWT A;  5I47 A;  1XRH A;  1VS0 A;  4JV2 A;  4GLX A;  1L2Z A;  4APM A;  5KG5 A;  1Z2O X;  3OSP A;  2UU9 H;  5JEA G;  5EWF A;  3HBL A;  3KAL A;  2WAQ E;  4BBR G;  5KFU A;  4TQS A;  3V4S A;  1C3O A;  2VQE H;  2JVZ A;  5KG2 A;  1O75 A;  1EYZ A;  1TUA A;  3F8N A;  2W7O A;  5H80 A;  4A3K G;  4F4X A;  3GR5 A;  4JI1 H;  2W8L A;  2X06 A;  1GSH A;  4X66 H;  4PWQ A;  1CQJ B;  3H4D A;  1VBH A;  4EBE A;  4ECV A;  3SI8 A;  5KFV A;  2JE6 I;  2FPI B;  3R5F A;  5FPO A;  5DGA A;  2ZQE A;  5KFM A;  4LFA H;  4JYA H;  4BWS C;  3MR6 A;  1BJT A;  1GGO A;  2CPM A;  5KG1 A;  2OPV A;  3H0G G;  3RV4 A;  5KG0 A;  3GII A;  3HKZ E;  2ZDH A;  4O3N A;  3PR4 A;  2VR1 A;  2C2E A;  2A1S A;  2FE3 A;  3PO2 G;  3RB0 A;  4JI0 H;  4YR2 A;  5KG3 A;  1Y1V G;  1V4Y A;  5KT7 A;  2IBK A;  3HOV G;  4MV9 A;  5KFH A;  4ECY A;  4MV7 A;  2JA5 A;  2R8J A;  4E9J A;  5KG6 A;  2ASD A;  2R92 G;  1ZTG A;  4JV1 A;  2WAQ A;  3GKU A;  4C2M A;  5D1O A;  1KJ9 A;  4J9K A;  2LF0 A;  3TII A;  1CQI B;  4DUY H;  2W9C B;  3HB9 A;  2CTM A;  2QK4 A;  2X0S A;  2FLL A;  4ED0 A;  2R93 G;  4A3M G;  2B63 A;  2CTF A;  5KT4 A;  1SYX B;  5JUM A;  4JI6 H;  3OET A;  2C2D A;  3N44 B;  3ETJ A;  4MV8 A;  3PW5 A;  5KFY A;  4YP3 A;  4IRK A;  5EDW A;  4A3C G;  2M8W A;  3OHB A;  4PDB A;  4Q43 A;  4EYH B;  3SB1 A;  2V59 A;  5F9L A;  4I55 F;  3HKZ A;  4Q8F A;  2CZG A;  2M05 A;  1XMO H;  2WE6 A;  3GTO A;  2V9W A;  1ZHQ A;  5KFQ A;  1VBI A;  3FDS A;  4FU0 A;  3I0P A;  4RB1 A;  2W7P A;  4FBU A;  4JVY A;  1DTJ A;  1EHI A;  4NZR M;  2M6Q A;  4GC7 A;  3AYH B;  1UNN C;  1VAJ A;  5LP6 F;  2NVX A;  4KHP H;  5C1O A;  2XD4 A;  3Q1K A;  3H0G A;  3N8D A;  4RNN A;  4JV0 A;  1RJP A;  3OUU A;  3OHA A;  1RJR A;  2I8C A;  4J9R A;  3GTJ A;  5EWE A;  1XDN A;  4GKK H;  2ASJ A;  3J80 W;  2VOB A;  5DLG A;  4YAJ B;  5JVD F;  5KG7 A;  5IP7 G;  1S03 G;  4M9U A;  1Y1V A;  2R7L A;  4GKJ H;  4EEY A;  4ECX A;  4TV8 F;  3IG0 A;  2PT7 G;  2R7K A;  2GPW A;  4BA1 I;  4R7R A;  5C5J A;  2FLP A;  4DR7 H;  1Z2N X;  1ULZ A;  2R92 A;  1SEI A;  2VPQ A;  3RB6 A;  3PN1 A;  1J4W A;  2UUB H;  4O4L F;  1DV2 A;  4EEQ A;  1S97 A;  2JA7 A;  2FK3 A;  1IOV A;  3TIG A;  4O4H F;  2W9B A;  4DR5 H;  1Y14 B;  4XYL B;  4A2B A;  4QIW E;  4EC5 A;  1X4N A;  2C35 B;  4ED2 A;  3KHL A;  1VBG A;  4LSA A;  3TQ1 A;  2IMW P;  2GPS A;  4EFB A;  5DT9 A;  5K2M A;  1UC8 A;  1C30 A;  4TV9 F;  5LA6 F;  1JXL A;  1B33 N;  4O3P A;  3NCV A;  2E2H A;  4UCS A;  5FLM G;  1ZZK A;  2FMA A;  5KFK A;  3M9O B;  4MV3 A;  5LMU H;  3PVX A;  3BQ0 A;  3OSS D;  5EOY A;  2P2R A;  1WHR A;  3L2P A;  5KKN B;  1Y1W A;  1WCM A;  2VUM G;  4FJS A;  4ETS A;  2XGQ A;  3IN5 A;  5C4X G;  4O4I F;  4X65 H;  2W6Q A;  1A9X A;  2GLT A;  5CAE B;  3JZI A;  4QIW A;  4J9M A;  5C1P A;  3RTX A;  5C8Y F;  2W6P A;  4J9P A;  1X9Z A;  4Q8E A;  4HNT A;  2DIK A;  5A2Q W;  4B3R H;  3MWM A;  2SCU B;  5KT2 A;  2RGV A;  2IA6 A;  4X62 H;  3RB4 A;  4B8T A;  4JV5 H;  1ZZJ A;  4RAZ A;  1KBL A;  1ZET A;  1T36 A;  1V9P A;  4DR4 H;  1WH2 A;  1EUD B;  2MJH A;  2E3U A;  4MV4 A;  1WR2 A;  1M6V A;  1WTJ A;  5HBR B;  3JRW A;  4F4Y A;  4B3T H;  3RB3 A;  1V9N A;  5KFT A;  3QZ8 A;  4IHJ F;  2W6M A;  3H40 A;  1RYS A;  3VPD A;  4A3G G;  3VPC A;  4E4T A;  3MR2 A;  4O2B F;  2P0A A;  2DWC A;  5FJ8 G;  1WE8 A;  5EZY F;  5KFS A;  3PW4 A;  3RAX A;  1HNX H;  2YS6 A;  1N36 H;  3KTM A;  4MV1 A;  3GQC A;  2J6S A;  4ED7 A;  1B6R A;  1M0W A;  4Q0Y A;  3V6J A;  1AUV A;  3MFH A;  1S10 A;  2R8G A;  1HNZ H;  3KAJ A;  3R5H A;  3Q8R B;  5C0X G;  2IP4 A;  3QFF A;  1CS0 A;  4YR0 A;  3L4J A;  3G6X A;  3T5L A;  5D8D A;  1DV1 A; 
#chains in the Genus database with same CATH homology
 2CW8 A;  4LF7 H;  3DF7 A;  1HR0 H;  3KAK A;  4OD6 A;  4CC5 A;  1XNR H;  4LF8 H;  3JAM W;  5D1P A;  3OTO H;  5FD6 A;  4PDB A;  3RF2 A;  4A2A A;  4G08 A;  2XIG A;  2ZM6 H;  3SB1 A;  4DV1 H;  3BA9 A;  1IBL H;  3BA8 A;  4EFE A;  4LF9 H;  2WE6 A;  1XMO H;  3N41 B;  4DV4 H;  2UUC H;  3N43 B;  1S68 A;  1ZHQ A;  5FLX W;  4RB1 A;  3H20 A;  4NZR M;  4DV0 H;  4UCT A;  4RB3 C;  3K3V A;  2CW7 A;  4JI3 H;  4YHH H;  1F0X A;  4DR6 H;  4KHP H;  4RB0 A;  4JI5 H;  2WYO A;  2E5L H;  2UXC H;  1ZHS A;  4UFZ A;  4RB2 C;  1FKA H;  3BAA A;  4UCU A;  3T1H H;  1XDN A;  4GKK H;  4IAJ A;  3J80 W;  2VOB A;  3JSL A;  4JI8 H;  3M4I A;  2F4V H;  1S03 G;  2KSW A;  4GKJ H;  3FAU A;  2RGR A;  4DV3 H;  3IG0 A;  2PT7 G;  4OX9 H;  1N32 H;  3KXY T;  3N40 P;  3N6X A;  4R7R A;  2Q2T A;  2UXD H;  4DR7 H;  4LF4 H;  1Z2N X;  1Z2P X;  3CVZ A;  2VPS A;  1SEI A;  2MCT A;  4X64 H;  3BAB A;  4B3M H;  4JI2 H;  1DGS A;  1I94 H;  2UUB H;  1BGW A;  3PN1 A;  4LFB H;  1M0T A;  4LH6 A;  2HVQ A;  4MTE A;  4DR1 H;  4EEQ A;  1B04 A;  3N42 B;  4DR5 H;  4A2B A;  4EC5 A;  4DV2 H;  4UCV A;  4FM9 A;  1XMQ H;  4LSA A;  4RAY A;  1E4G T;  4DV6 H;  4EFB A;  1X9N A;  5DT9 A;  4JI4 H;  3JSN A;  2OWO A;  1P8L A;  2YCH A;  4LH7 A;  5D1O B;  2HGS A;  3J7A K;  4DR3 H;  5FD5 A;  3NCV A;  5BR8 H;  2VUG A;  2UUA H;  4JI7 H;  1GYF A;  4LFC H;  4UCS A;  1VS0 A;  1N34 H;  5LL6 b;  2HHH H;  4GLX A;  1L2Z A;  4APM A;  4LMY A;  3RIZ A;  2HVR A;  5LMU H;  1Z2O X;  2UU9 H;  3HXL A;  4M7E A;  2O03 A;  1A0I A;  3KAL A;  3T1Y H;  2FPH X;  3OSS D;  3QD7 X;  1E4F T;  5EOY A;  3KDK A;  3RGZ A;  4RZQ A;  4I7H A;  4DR2 H;  3L2P A;  1FJG H;  2VQE H;  1J5E H;  3FMA A;  2HVS A;  1O75 A;  4LSX A;  1ODH A;  1MZB A;  3F8N A;  3RGX A;  3EZJ A;  3C0F B;  5IWA H;  4ETS A;  4K0K H;  4UCR A;  3GR5 A;  4JI1 H;  2Q2U A;  4X65 H;  2WDT A;  1I6U A;  4J0M A;  4X66 H;  1TAE A;  2VQF H;  4DV7 H;  2D9I A;  4NXN H;  3RTX A;  4B3S H;  1X9Z A;  3RJ0 A;  5FPO A;  2ZQE A;  5A2Q W;  4LF5 H;  1IBK H;  4B3R H;  4LFA H;  4B8C D;  3J81 W;  1AN7 A;  4OCH A;  4X62 H;  4JYA H;  1BJT A;  2RGV A;  4BWS C;  4JV5 H;  4RAZ A;  2ZJT A;  1V9P A;  1IBM H;  3LML A;  4MTD A;  1HNW H;  4DR4 H;  1WH2 A;  3EYY A;  1XNQ H;  1FVI A;  2FE3 A;  4B3T H;  2O4C A;  4DUZ H;  4JI0 H;  1N33 H;  2Y3M A;  4DV5 H;  5FPR A;  3UQ8 A;  4MV9 A;  4MV7 A;  4UCO A;  4E9J A;  4LF6 H;  3MWM A;  2UXB H;  3L4K A;  3KDG A;  5IT9 W;  4NXM H;  5D1O A;  1HNX H;  3GAB A;  4CC6 A;  2LF0 A;  1N36 H;  4DUY H;  4AQY H;  1M0W A;  4Q0Y A;  4YY3 H;  5LMN H;  1HNZ H;  4NZT M;  1TA8 A;  3KAJ A;  1SYX B;  2W57 A;  2VKC A;  4JI6 H;  3OET A;  3L4J A;  3N44 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...