2CTLA

Solution structure of the 13th kh type i domain from human vigilin
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
97
structure length
97
Chain Sequence
GSSGSSGEQEDRALRSFKLSVTVDPKYHPKIIGRKGAVITQIRLEHDVNIQFPDKDDGNQPQDQITITGYEKNTEAARDAILRIVGELEQMSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vigilin
publication title Solution structure of the 13th KH type I domain from human Vigilin
rcsb
source organism Homo sapiens
molecule tags Transport protein, rna binding protein
total genus 16
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2005-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 2ctlA00
4JVYA 5K36G 4BA2I 2OPUA 1WVNA 2CTKA 1ZZIA 1WE8A 4LIJA 1DT4A 2HH2A 2JEBI 2YQRA 2JZXA 5C0XG 1VIGA 2PQUA 4BA1I 4IFDG 2CTMA 4NBQA 2QNDA 4B8TA 2ANNA 1VIHA 2NN6G 3AEVB 1ZZJA 4OO1G 2OPVA 2CTJA 2HH3A 4AIMA 3V69A 1X4NA 2JVZA 4WANA 1EC6A 3VKEA 2E3UA 2CTLA 1J4WA 1ZTGA 3U1KA 2Z0SA 2AXYA 1X4MA 2CTFA 1J5KA 4JVHA 2JE6I 1DTJA 2CTEA 2FMRA 2ANRA 2BA0A 2DGRA 2CPQA 2JA9A 2BL5A 5JEAG 1ZZKA 3L7ZC 4WALA 1K1GA 2P2RA 2JEAI 4AM3A 2PY9A 2MJHA 1TUAA 1KHMA 4QMFB
chains in the Genus database with same CATH superfamily
3EZJA 4E9JA 2VQEH 4DR2H 2LF0A 2LTLA 4DV0H 1I94H 4X65H 1WVNA 1N34H 1HNXH 2UU9H 4B3MH 1MSZA 5IWAH 2LTMA 2UXCH 4JI3H 2JEBI 2FPHX 1VIGA 3GKUA 1XNRH 2HH3A 4JI0H 2PT7G 4LF9H 4OCHA 3GR5A 1X4NA 4DR4H 4GKJH 4WANA 1IBKH 4LF6H 2CTLA 2Y3MA 1XMQH 1HNZH 1ZTGA 1N36H 2M6QA 1Z2IA 2AXYA 1NXUA 1X4MA 1FJGH 4JI7H 1I6UA 2ANRA 4YHHH 2PQUA 2JA9A 5JEAG 1IBMH 4WALA 4DV3H 3L7ZC 2JEAI 4H8AA 2P2RA 4AM3A 1N33H 2PY9A 2MJHA 4B3TH 1KHMA 2CTKA 1VBIA 1XRHA 4DV6H 1WTJA 2ZQEA 2HH2A 5BR8H 2YQRA 2JZXA 5C0XG 2UUCH 5IT9W 4BA1I 2CTMA 1IBLH 1ODHA 4FJSA 4YY3H 1VIHA 1AN7A 2FFMA 2A1SA 4DR5H 2OPVA 1ZZJA 4JI5H 4AIMA 3V69A 1S03G 1HNWH 4GKKH 2UXBH 4X62H 2JVZA 4OX9H 3VKEA 4X66H 1J4WA 4LFAH 4PDBA 3U1KA 2Z0SA 4B3SH 4FJUA 2CTFA 4DUZH 4NZRM 5DT9A 2FMRA 3J81W 4LF8H 2BA0A 4JI2H 1K1GA 3QD7X 2HHHH 1TUAA 1V8CA 4X64H 4JVYA 2CWHA 3OTOH 1XMOH 5K36G 1J5EH 4DV2H 1HR0H 2OPUA 4LF7H 4LFBH 1WE8A 3FAUA 1F0XA 4IFDG 4NXNH 3J80W 2E5LH 4JI8H 4NBQA 1PQXA 2ANNA 2G8YA 1XNQH 2NN6G 2UUAH 3AEVB 4OO1G 1EC6A 2CTJA 5FLXW 4DR1H 1V9NA 4NZTM 4DV5H 4B3RH 2E3UA 2LRRA 3NCVA 1X9ZA 1SEIA 3I0PA 3J7AK 3KDKA 4NXMH 1J5KA 4JVHA 2JE6I 1DTJA 3UOEA 4EC5A 1FKAH 3GABA 5LL6b 2UUBH 2DGRA 2O4CA 3KDGA 4DR7H 4OD6A 4JYAH 2CPMA 4DUYH 3JAMW 4QMFB 1N32H 1S20A 4BA2I 2VQFH 1ZZIA 1UG8A 4LIJA 4LF4H 4DR6H 4JV5H 1DT4A 1X0AA 2CWFA 4LF5H 4G08A 4DR3H 4AQYH 2D9IA 2QNDA 4B8TA 2F4VH 4K0KH 4JI4H 2K1HA 4DV4H 2M8WA 3OETA 3T1YH 3RF2A 4B8CD 2X06A 1WHRA 4JI6H 2VKCA 4KHPH 5A2QW 4LFCH 4JI1H 3OSSD 3SB1A 5LMNH 2CTEA 2CPQA 2BL5A 1ZZKA 2UXDH 4DV7H 5LMUH 2ZM6H 3T1HH 4DV1H
chains in the Genus database with same CATH topology
4JVYA 5K36G 4BA2I 2OPUA 1WVNA 2CTKA 1ZZIA 1WE8A 4LIJA 1DT4A 2HH2A 2JEBI 2YQRA 2JZXA 5C0XG 1VIGA 2PQUA 4BA1I 4IFDG 2CTMA 4NBQA 2QNDA 4B8TA 2ANNA 1VIHA 2NN6G 3AEVB 1ZZJA 4OO1G 2OPVA 2CTJA 2HH3A 4AIMA 3V69A 1X4NA 2JVZA 4WANA 1EC6A 3VKEA 2E3UA 2CTLA 1J4WA 1ZTGA 3U1KA 2Z0SA 2AXYA 1X4MA 2CTFA 1J5KA 4JVHA 2JE6I 1DTJA 2CTEA 2FMRA 2ANRA 2BA0A 2DGRA 2CPQA 2JA9A 2BL5A 5JEAG 1ZZKA 3L7ZC 4WALA 1K1GA 2P2RA 2JEAI 4AM3A 2PY9A 2MJHA 1TUAA 1KHMA 4QMFB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JVY A;  5K36 G;  4BA2 I;  2OPU A;  1WVN A;  2CTK A;  1ZZI A;  1WE8 A;  4LIJ A;  1DT4 A;  2HH2 A;  2JEB I;  2YQR A;  2JZX A;  5C0X G;  1VIG A;  2PQU A;  4BA1 I;  4IFD G;  2CTM A;  4NBQ A;  2QND A;  4B8T A;  2ANN A;  1VIH A;  2NN6 G;  3AEV B;  1ZZJ A;  4OO1 G;  2OPV A;  2CTJ A;  2HH3 A;  4AIM A;  3V69 A;  1X4N A;  2JVZ A;  4WAN A;  1EC6 A;  3VKE A;  2E3U A;  2CTL A;  1J4W A;  1ZTG A;  3U1K A;  2Z0S A;  2AXY A;  1X4M A;  2CTF A;  1J5K A;  4JVH A;  2JE6 I;  1DTJ A;  2CTE A;  2FMR A;  2ANR A;  2BA0 A;  2DGR A;  2CPQ A;  2JA9 A;  2BL5 A;  5JEA G;  1ZZK A;  3L7Z C;  4WAL A;  1K1G A;  2P2R A;  2JEA I;  4AM3 A;  2PY9 A;  2MJH A;  1TUA A;  1KHM A;  4QMF B; 
#chains in the Genus database with same CATH topology
 3EZJ A;  4E9J A;  2VQE H;  4DR2 H;  2LF0 A;  2LTL A;  4DV0 H;  1I94 H;  4X65 H;  1WVN A;  1N34 H;  1HNX H;  2UU9 H;  4B3M H;  1MSZ A;  5IWA H;  2LTM A;  2UXC H;  4JI3 H;  2JEB I;  2FPH X;  1VIG A;  3GKU A;  1XNR H;  2HH3 A;  4JI0 H;  2PT7 G;  4LF9 H;  4OCH A;  3GR5 A;  1X4N A;  4DR4 H;  4GKJ H;  4WAN A;  1IBK H;  4LF6 H;  2CTL A;  2Y3M A;  1XMQ H;  1HNZ H;  1ZTG A;  1N36 H;  2M6Q A;  1Z2I A;  2AXY A;  1NXU A;  1X4M A;  1FJG H;  4JI7 H;  1I6U A;  2ANR A;  4YHH H;  2PQU A;  2JA9 A;  5JEA G;  1IBM H;  4WAL A;  4DV3 H;  3L7Z C;  2JEA I;  4H8A A;  2P2R A;  4AM3 A;  1N33 H;  2PY9 A;  2MJH A;  4B3T H;  1KHM A;  2CTK A;  1VBI A;  1XRH A;  4DV6 H;  1WTJ A;  2ZQE A;  2HH2 A;  5BR8 H;  2YQR A;  2JZX A;  5C0X G;  2UUC H;  5IT9 W;  4BA1 I;  2CTM A;  1IBL H;  1ODH A;  4FJS A;  4YY3 H;  1VIH A;  1AN7 A;  2FFM A;  2A1S A;  4DR5 H;  2OPV A;  1ZZJ A;  4JI5 H;  4AIM A;  3V69 A;  1S03 G;  1HNW H;  4GKK H;  2UXB H;  4X62 H;  2JVZ A;  4OX9 H;  3VKE A;  4X66 H;  1J4W A;  4LFA H;  4PDB A;  3U1K A;  2Z0S A;  4B3S H;  4FJU A;  2CTF A;  4DUZ H;  4NZR M;  5DT9 A;  2FMR A;  3J81 W;  4LF8 H;  2BA0 A;  4JI2 H;  1K1G A;  3QD7 X;  2HHH H;  1TUA A;  1V8C A;  4X64 H;  4JVY A;  2CWH A;  3OTO H;  1XMO H;  5K36 G;  1J5E H;  4DV2 H;  1HR0 H;  2OPU A;  4LF7 H;  4LFB H;  1WE8 A;  3FAU A;  1F0X A;  4IFD G;  4NXN H;  3J80 W;  2E5L H;  4JI8 H;  4NBQ A;  1PQX A;  2ANN A;  2G8Y A;  1XNQ H;  2NN6 G;  2UUA H;  3AEV B;  4OO1 G;  1EC6 A;  2CTJ A;  5FLX W;  4DR1 H;  1V9N A;  4NZT M;  4DV5 H;  4B3R H;  2E3U A;  2LRR A;  3NCV A;  1X9Z A;  1SEI A;  3I0P A;  3J7A K;  3KDK A;  4NXM H;  1J5K A;  4JVH A;  2JE6 I;  1DTJ A;  3UOE A;  4EC5 A;  1FKA H;  3GAB A;  5LL6 b;  2UUB H;  2DGR A;  2O4C A;  3KDG A;  4DR7 H;  4OD6 A;  4JYA H;  2CPM A;  4DUY H;  3JAM W;  4QMF B;  1N32 H;  1S20 A;  4BA2 I;  2VQF H;  1ZZI A;  1UG8 A;  4LIJ A;  4LF4 H;  4DR6 H;  4JV5 H;  1DT4 A;  1X0A A;  2CWF A;  4LF5 H;  4G08 A;  4DR3 H;  4AQY H;  2D9I A;  2QND A;  4B8T A;  2F4V H;  4K0K H;  4JI4 H;  2K1H A;  4DV4 H;  2M8W A;  3OET A;  3T1Y H;  3RF2 A;  4B8C D;  2X06 A;  1WHR A;  4JI6 H;  2VKC A;  4KHP H;  5A2Q W;  4LFC H;  4JI1 H;  3OSS D;  3SB1 A;  5LMN H;  2CTE A;  2CPQ A;  2BL5 A;  1ZZK A;  2UXD H;  4DV7 H;  5LMU H;  2ZM6 H;  3T1H H;  4DV1 H; 
#chains in the Genus database with same CATH homology
 4JVY A;  5K36 G;  4BA2 I;  2OPU A;  1WVN A;  2CTK A;  1ZZI A;  1WE8 A;  4LIJ A;  1DT4 A;  2HH2 A;  2JEB I;  2YQR A;  2JZX A;  5C0X G;  1VIG A;  2PQU A;  4BA1 I;  4IFD G;  2CTM A;  4NBQ A;  2QND A;  4B8T A;  2ANN A;  1VIH A;  2NN6 G;  3AEV B;  1ZZJ A;  4OO1 G;  2OPV A;  2CTJ A;  2HH3 A;  4AIM A;  3V69 A;  1X4N A;  2JVZ A;  4WAN A;  1EC6 A;  3VKE A;  2E3U A;  2CTL A;  1J4W A;  1ZTG A;  3U1K A;  2Z0S A;  2AXY A;  1X4M A;  2CTF A;  1J5K A;  4JVH A;  2JE6 I;  1DTJ A;  2CTE A;  2FMR A;  2ANR A;  2BA0 A;  2DGR A;  2CPQ A;  2JA9 A;  2BL5 A;  5JEA G;  1ZZK A;  3L7Z C;  4WAL A;  1K1G A;  2P2R A;  2JEA I;  4AM3 A;  2PY9 A;  2MJH A;  1TUA A;  1KHM A;  4QMF B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...