2CTLA

Solution structure of the 13th kh type i domain from human vigilin
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
97
structure length
97
Chain Sequence
GSSGSSGEQEDRALRSFKLSVTVDPKYHPKIIGRKGAVITQIRLEHDVNIQFPDKDDGNQPQDQITITGYEKNTEAARDAILRIVGELEQMSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein, rna binding protein
molecule keywords Vigilin
publication title Solution structure of the 13th KH type I domain from human Vigilin
rcsb
source organism Homo sapiens
total genus 16
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2005-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 2ctlA00
1DTJA 2JEBI 2CPQA 2AXYA 4IFDG 2E3UA 4LIJA 4WANA 2PQUA 2HH2A 4B8TA 2JZXA 1J4WA 2YQRA 2JVZA 4BA1I 4AM3A 2PY9A 2CTJA 4AIMA 4WALA 1VIGA 2OPUA 3VKEA 2CTKA 2OPVA 2HH3A 2CTLA 4OO1G 4JVYA 4QMFB 2CTMA 2FMRA 2CTEA 5JEAG 4BA2I 1ZZJA 2ANNA 1EC6A 2MJHA 1WE8A 1DT4A 1VIHA 2JA9A 2BA0A 1K1GA 2NN6G 2P2RA 5C0XG 1J5KA 2ANRA 1ZZKA 1TUAA 1X4MA 3U1KA 4NBQA 2JEAI 1KHMA 1ZZIA 2JE6I 3AEVB 3L7ZC 4JVHA 2BL5A 2DGRA 2CTFA 3V69A 1WVNA 1ZTGA 2QNDA 2Z0SA 5K36G 1X4NA
chains in the Genus database with same CATH superfamily
1DTJA 1WTJA 2CPQA 2AXYA 4DR6H 4LFBH 4DV5H 2G8YA 1XNQH 2UUBH 5IWAH 2ZQEA 4LF5H 5LMNH 2UU9H 2YQRA 2M8WA 4GKKH 2LTLA 4X62H 2PY9A 1Z2IA 4WALA 1VIGA 4DV3H 4K0KH 1NXUA 4DR7H 4JYAH 3J7AK 1S03G 2ZM6H 1V8CA 4B8CD 4DR3H 1EC6A 4DV1H 5LL6b 1HR0H 4LFAH 1VIHA 1IBMH 4DV4H 4JI2H 1K1GA 2NN6G 2FFMA 4NZRM 1SEIA 5A2QW 1J5KA 1ZZKA 1TUAA 1X4MA 2K1HA 4YHHH 4B3TH 4EC5A 3KDKA 4DV6H 1HNZH 1ZZIA 4OX9H 4DV2H 1AN7A 2VKCA 3AEVB 4JVHA 2DGRA 1WHRA 3T1YH 4X66H 2QNDA 2Z0SA 2OPVA 2JEBI 4DR5H 4LFCH 4DUZH 1N36H 2X06A 4B8TA 1N32H 1X0AA 1J4WA 1HNWH 2JVZA 4BA1I 4JI4H 3SB1A 1ODHA 4GKJH 1N34H 2FPHX 1IBKH 2CTKA 4DR4H 4FJUA 3EZJA 2CPMA 1I6UA 2CTMA 3GR5A 5JEAG 4BA2I 3KDGA 3QD7X 1FJGH 1DT4A 2CWFA 2JA9A 2P2RA 3U1KA 4LF6H 1KHMA 1IBLH 2JEAI 3OETA 2JE6I 4LF4H 1F0XA 3L7ZC 3V69A 5BR8H 1XMQH 2ANRA 1HNXH 2O4CA 5FLXW 4IFDG 3GABA 4DR1H 3OSSD 2LRRA 4LIJA 5LMUH 4JI7H 2PQUA 4KHPH 5DT9A 4WANA 4JI1H 4PDBA 2Y3MA 4LF7H 4G08A 1WVNA 4AM3A 2VQFH 1I94H 1UG8A 4FJSA 3T1HH 2F4VH 1VBIA 4H8AA 4B3MH 4OO1G 4JI0H 4NXMH 4JVYA 1FKAH 2UXCH 2VQEH 3J81W 4JI3H 4JI8H 2LF0A 1ZZJA 2ANNA 1X9ZA 4AQYH 2UUCH 4LF9H 3OTOH 1XMOH 1V9NA 1J5EH 4JI5H 1MSZA 3FAUA 4JV5H 5C0XG 4DUYH 4OCHA 2PT7G 4NBQA 3GKUA 3UOEA 1XNRH 2BL5A 2CTFA 2CTEA 1ZTGA 4B3SH 1X4NA 2E3UA 4OD6A 1PQXA 3JAMW 4DV0H 2HH2A 2JZXA 4B3RH 2LTMA 4X65H 4E9JA 3J80W 3I0PA 2CTJA 4AIMA 2HHHH 1N33H 2OPUA 4DR2H 3VKEA 2HH3A 2CTLA 2A1SA 2CWHA 4DV7H 4QMFB 2FMRA 3NCVA 2UXDH 4NZTM 4X64H 4LF8H 2MJHA 4NXNH 1WE8A 5IT9W 2BA0A 2D9IA 2UXBH 4YY3H 2UUAH 4JI6H 2M6QA 3RF2A 1S20A 5K36G 2E5LH 1XRHA
chains in the Genus database with same CATH topology
1DTJA 2JEBI 2CPQA 2AXYA 4IFDG 2E3UA 4LIJA 4WANA 2PQUA 2HH2A 4B8TA 2JZXA 1J4WA 2YQRA 2JVZA 4BA1I 4AM3A 2PY9A 2CTJA 4AIMA 4WALA 1VIGA 2OPUA 3VKEA 2CTKA 2OPVA 2HH3A 2CTLA 4OO1G 4JVYA 4QMFB 2CTMA 2FMRA 2CTEA 5JEAG 4BA2I 1ZZJA 2ANNA 1EC6A 2MJHA 1WE8A 1DT4A 1VIHA 2JA9A 2BA0A 1K1GA 2NN6G 2P2RA 5C0XG 1J5KA 2ANRA 1ZZKA 1TUAA 1X4MA 3U1KA 4NBQA 2JEAI 1KHMA 1ZZIA 2JE6I 3AEVB 3L7ZC 4JVHA 2BL5A 2DGRA 2CTFA 3V69A 1WVNA 1ZTGA 2QNDA 2Z0SA 5K36G 1X4NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DTJ A;  2JEB I;  2CPQ A;  2AXY A;  4IFD G;  2E3U A;  4LIJ A;  4WAN A;  2PQU A;  2HH2 A;  4B8T A;  2JZX A;  1J4W A;  2YQR A;  2JVZ A;  4BA1 I;  4AM3 A;  2PY9 A;  2CTJ A;  4AIM A;  4WAL A;  1VIG A;  2OPU A;  3VKE A;  2CTK A;  2OPV A;  2HH3 A;  2CTL A;  4OO1 G;  4JVY A;  4QMF B;  2CTM A;  2FMR A;  2CTE A;  5JEA G;  4BA2 I;  1ZZJ A;  2ANN A;  1EC6 A;  2MJH A;  1WE8 A;  1DT4 A;  1VIH A;  2JA9 A;  2BA0 A;  1K1G A;  2NN6 G;  2P2R A;  5C0X G;  1J5K A;  2ANR A;  1ZZK A;  1TUA A;  1X4M A;  3U1K A;  4NBQ A;  2JEA I;  1KHM A;  1ZZI A;  2JE6 I;  3AEV B;  3L7Z C;  4JVH A;  2BL5 A;  2DGR A;  2CTF A;  3V69 A;  1WVN A;  1ZTG A;  2QND A;  2Z0S A;  5K36 G;  1X4N A; 
#chains in the Genus database with same CATH topology
 1DTJ A;  1WTJ A;  2CPQ A;  2AXY A;  4DR6 H;  4LFB H;  4DV5 H;  2G8Y A;  1XNQ H;  2UUB H;  5IWA H;  2ZQE A;  4LF5 H;  5LMN H;  2UU9 H;  2YQR A;  2M8W A;  4GKK H;  2LTL A;  4X62 H;  2PY9 A;  1Z2I A;  4WAL A;  1VIG A;  4DV3 H;  4K0K H;  1NXU A;  4DR7 H;  4JYA H;  3J7A K;  1S03 G;  2ZM6 H;  1V8C A;  4B8C D;  4DR3 H;  1EC6 A;  4DV1 H;  5LL6 b;  1HR0 H;  4LFA H;  1VIH A;  1IBM H;  4DV4 H;  4JI2 H;  1K1G A;  2NN6 G;  2FFM A;  4NZR M;  1SEI A;  5A2Q W;  1J5K A;  1ZZK A;  1TUA A;  1X4M A;  2K1H A;  4YHH H;  4B3T H;  4EC5 A;  3KDK A;  4DV6 H;  1HNZ H;  1ZZI A;  4OX9 H;  4DV2 H;  1AN7 A;  2VKC A;  3AEV B;  4JVH A;  2DGR A;  1WHR A;  3T1Y H;  4X66 H;  2QND A;  2Z0S A;  2OPV A;  2JEB I;  4DR5 H;  4LFC H;  4DUZ H;  1N36 H;  2X06 A;  4B8T A;  1N32 H;  1X0A A;  1J4W A;  1HNW H;  2JVZ A;  4BA1 I;  4JI4 H;  3SB1 A;  1ODH A;  4GKJ H;  1N34 H;  2FPH X;  1IBK H;  2CTK A;  4DR4 H;  4FJU A;  3EZJ A;  2CPM A;  1I6U A;  2CTM A;  3GR5 A;  5JEA G;  4BA2 I;  3KDG A;  3QD7 X;  1FJG H;  1DT4 A;  2CWF A;  2JA9 A;  2P2R A;  3U1K A;  4LF6 H;  1KHM A;  1IBL H;  2JEA I;  3OET A;  2JE6 I;  4LF4 H;  1F0X A;  3L7Z C;  3V69 A;  5BR8 H;  1XMQ H;  2ANR A;  1HNX H;  2O4C A;  5FLX W;  4IFD G;  3GAB A;  4DR1 H;  3OSS D;  2LRR A;  4LIJ A;  5LMU H;  4JI7 H;  2PQU A;  4KHP H;  5DT9 A;  4WAN A;  4JI1 H;  4PDB A;  2Y3M A;  4LF7 H;  4G08 A;  1WVN A;  4AM3 A;  2VQF H;  1I94 H;  1UG8 A;  4FJS A;  3T1H H;  2F4V H;  1VBI A;  4H8A A;  4B3M H;  4OO1 G;  4JI0 H;  4NXM H;  4JVY A;  1FKA H;  2UXC H;  2VQE H;  3J81 W;  4JI3 H;  4JI8 H;  2LF0 A;  1ZZJ A;  2ANN A;  1X9Z A;  4AQY H;  2UUC H;  4LF9 H;  3OTO H;  1XMO H;  1V9N A;  1J5E H;  4JI5 H;  1MSZ A;  3FAU A;  4JV5 H;  5C0X G;  4DUY H;  4OCH A;  2PT7 G;  4NBQ A;  3GKU A;  3UOE A;  1XNR H;  2BL5 A;  2CTF A;  2CTE A;  1ZTG A;  4B3S H;  1X4N A;  2E3U A;  4OD6 A;  1PQX A;  3JAM W;  4DV0 H;  2HH2 A;  2JZX A;  4B3R H;  2LTM A;  4X65 H;  4E9J A;  3J80 W;  3I0P A;  2CTJ A;  4AIM A;  2HHH H;  1N33 H;  2OPU A;  4DR2 H;  3VKE A;  2HH3 A;  2CTL A;  2A1S A;  2CWH A;  4DV7 H;  4QMF B;  2FMR A;  3NCV A;  2UXD H;  4NZT M;  4X64 H;  4LF8 H;  2MJH A;  4NXN H;  1WE8 A;  5IT9 W;  2BA0 A;  2D9I A;  2UXB H;  4YY3 H;  2UUA H;  4JI6 H;  2M6Q A;  3RF2 A;  1S20 A;  5K36 G;  2E5L H;  1XRH A; 
#chains in the Genus database with same CATH homology
 1DTJ A;  2JEB I;  2CPQ A;  2AXY A;  4IFD G;  2E3U A;  4LIJ A;  4WAN A;  2PQU A;  2HH2 A;  4B8T A;  2JZX A;  1J4W A;  2YQR A;  2JVZ A;  4BA1 I;  4AM3 A;  2PY9 A;  2CTJ A;  4AIM A;  4WAL A;  1VIG A;  2OPU A;  3VKE A;  2CTK A;  2OPV A;  2HH3 A;  2CTL A;  4OO1 G;  4JVY A;  4QMF B;  2CTM A;  2FMR A;  2CTE A;  5JEA G;  4BA2 I;  1ZZJ A;  2ANN A;  1EC6 A;  2MJH A;  1WE8 A;  1DT4 A;  1VIH A;  2JA9 A;  2BA0 A;  1K1G A;  2NN6 G;  2P2R A;  5C0X G;  1J5K A;  2ANR A;  1ZZK A;  1TUA A;  1X4M A;  3U1K A;  4NBQ A;  2JEA I;  1KHM A;  1ZZI A;  2JE6 I;  3AEV B;  3L7Z C;  4JVH A;  2BL5 A;  2DGR A;  2CTF A;  3V69 A;  1WVN A;  1ZTG A;  2QND A;  2Z0S A;  5K36 G;  1X4N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...