2CTLA

Solution structure of the 13th kh type i domain from human vigilin
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
97
structure length
97
Chain Sequence
b'GSSGSSGEQEDRALRSFKLSVTVDPKYHPKIIGRKGAVITQIRLEHDVNIQFPDKDDGNQPQDQITITGYEKNTEAARDAILRIVGELEQMSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vigilin
publication title Solution structure of the 13th KH type I domain from human Vigilin
rcsb
source organism Homo sapiens
molecule tags Transport protein, rna binding protein
total genus 16
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2005-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 2ctlA00
5C0XG 2CTMA 2QNDA 1VIGA 2JEAI 2DGRA 1KHMA 2BL5A 1WVNA 1TUAA 3U1KA 4JVYA 2JA9A 2PQUA 2CPQA 2JZXA 2ANNA 2PY9A 2ANRA 4BA1I 2P2RA 2MJHA 4AM3A 2NN6G 1ZZJA 4IFDG 1VIHA 1X4NA 4LIJA 2BA0A 2CTLA 1ZZKA 1WE8A 4BA2I 2E3UA 2Z0SA 2JE6I 4B8TA 2CTKA 3AEVB 4NBQA 2HH2A 1ZTGA 1DT4A 4QMFB 1K1GA 4OO1G 2CTFA 5K36G 2OPUA 2FMRA 2YQRA 1J4WA 4WANA 1ZZIA 3L7ZC 3V69A 1J5KA 2HH3A 4WALA 1EC6A 1X4MA 2JVZA 3VKEA 1DTJA 4JVHA 4AIMA 5JEAG 2OPVA 2CTJA 2CTEA 2AXYA 2JEBI
chains in the Genus database with same CATH superfamily
5C0XG 2UUCH 5IT9W 1IBLH 2A1SA 4JI4H 4DV5H 4JVYA 1IBKH 4B8CD 2PQUA 2JZXA 4BA1I 2MJHA 4DR2H 1ZZJA 1ODHA 4JI8H 1HR0H 1X4NA 2M6QA 1SEIA 4X64H 4JI3H 2FFMA 2E5LH 1WE8A 4B3MH 4LF6H 1PQXA 1XMOH 2E3UA 4DR1H 1XNQH 4FJUA 5BR8H 1AN7A 1ZTGA 1VBIA 4DV2H 4LFCH 4OO1G 4DV7H 2K1HA 2UXDH 2OPUA 2FMRA 2YQRA 5K36G 1ZZIA 3L7ZC 2HH3A 2CWHA 3OTOH 1X4MA 2LF0A 4K0KH 2CWFA 5JEAG 4X65H 4DV1H 1S20A 4AQYH 4NXNH 2VQEH 4B3TH 3RF2A 4DUYH 1F0XA 2CTMA 2QNDA 3T1HH 1KHMA 2DGRA 1UG8A 1WVNA 4YHHH 4X62H 4DR6H 5LL6b 2ANRA 4G08A 2P2RA 3EZJA 2UU9H 1VIHA 5A2QW 1IBMH 4NXMH 3GR5A 4JI5H 1XRHA 3GKUA 4LFBH 1I6UA 2HHHH 1NXUA 5DT9A 4DUZH 1XNRH 2CTKA 4DR4H 4E9JA 2HH2A 1DT4A 4GKKH 1V9NA 2X06A 2CTFA 4YY3H 2VQFH 1I94H 1HNZH 4LF5H 1J4WA 1HNWH 3J7AK 1EC6A 4KHPH 2JVZA 3VKEA 2UUAH 4DV6H 2OPVA 3QD7X 2CTJA 4LF7H 4LFAH 2AXYA 2JEBI 1X0AA 3OSSD 1VIGA 4OCHA 4LF8H 2BL5A 1WTJA 3U1KA 2CPQA 1N32H 3UOEA 1J5EH 2ANNA 2PY9A 4JI2H 4DR3H 3JAMW 4JYAH 2NN6G 4NZTM 2LTLA 4LIJA 2CTLA 3I0PA 3KDKA 4BA2I 3GABA 2UUBH 2Z0SA 4X66H 3KDGA 4B8TA 3J81W 5LMNH 2LRRA 4DR5H 4B3SH 3J80W 4FJSA 2FPHX 2F4VH 1J5KA 2UXBH 4WALA 1V8CA 4LF9H 2G8YA 4AIMA 1HNXH 2CTEA 4DV0H 4JI6H 1N33H 5FLXW 1N34H 2JEAI 1X9ZA 4JI7H 3OETA 1TUAA 4JV5H 2JA9A 1Z2IA 1MSZA 2Y3MA 2PT7G 2VKCA 4AM3A 2ZM6H 2D9IA 4NZRM 5LMUH 4IFDG 1S03G 4JI0H 1FKAH 2BA0A 1ZZKA 4JI1H 1WHRA 1XMQH 2LTMA 4PDBA 2JE6I 3T1YH 2ZQEA 3AEVB 2CPMA 2M8WA 3FAUA 1N36H 4NBQA 4OX9H 4EC5A 4DR7H 4QMFB 1K1GA 4B3RH 2O4CA 4WANA 3V69A 3NCVA 3SB1A 4DV4H 2UXCH 5IWAH 1FJGH 4JVHA 1DTJA 4GKJH 4OD6A 4H8AA 4DV3H 4LF4H
chains in the Genus database with same CATH topology
5C0XG 2CTMA 2QNDA 1VIGA 2JEAI 2DGRA 1KHMA 2BL5A 1WVNA 1TUAA 3U1KA 4JVYA 2JA9A 2PQUA 2CPQA 2JZXA 2ANNA 2PY9A 2ANRA 4BA1I 2P2RA 2MJHA 4AM3A 2NN6G 1ZZJA 4IFDG 1VIHA 1X4NA 4LIJA 2BA0A 2CTLA 1ZZKA 1WE8A 4BA2I 2E3UA 2Z0SA 2JE6I 4B8TA 2CTKA 3AEVB 4NBQA 2HH2A 1ZTGA 1DT4A 4QMFB 1K1GA 4OO1G 2CTFA 5K36G 2OPUA 2FMRA 2YQRA 1J4WA 4WANA 1ZZIA 3L7ZC 3V69A 1J5KA 2HH3A 4WALA 1EC6A 1X4MA 2JVZA 3VKEA 1DTJA 4JVHA 4AIMA 5JEAG 2OPVA 2CTJA 2CTEA 2AXYA 2JEBI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C0X G;  2CTM A;  2QND A;  1VIG A;  2JEA I;  2DGR A;  1KHM A;  2BL5 A;  1WVN A;  1TUA A;  3U1K A;  4JVY A;  2JA9 A;  2PQU A;  2CPQ A;  2JZX A;  2ANN A;  2PY9 A;  2ANR A;  4BA1 I;  2P2R A;  2MJH A;  4AM3 A;  2NN6 G;  1ZZJ A;  4IFD G;  1VIH A;  1X4N A;  4LIJ A;  2BA0 A;  2CTL A;  1ZZK A;  1WE8 A;  4BA2 I;  2E3U A;  2Z0S A;  2JE6 I;  4B8T A;  2CTK A;  3AEV B;  4NBQ A;  2HH2 A;  1ZTG A;  1DT4 A;  4QMF B;  1K1G A;  4OO1 G;  2CTF A;  5K36 G;  2OPU A;  2FMR A;  2YQR A;  1J4W A;  4WAN A;  1ZZI A;  3L7Z C;  3V69 A;  1J5K A;  2HH3 A;  4WAL A;  1EC6 A;  1X4M A;  2JVZ A;  3VKE A;  1DTJ A;  4JVH A;  4AIM A;  5JEA G;  2OPV A;  2CTJ A;  2CTE A;  2AXY A;  2JEB I; 
#chains in the Genus database with same CATH topology
 5C0X G;  2UUC H;  5IT9 W;  1IBL H;  2A1S A;  4JI4 H;  4DV5 H;  4JVY A;  1IBK H;  4B8C D;  2PQU A;  2JZX A;  4BA1 I;  2MJH A;  4DR2 H;  1ZZJ A;  1ODH A;  4JI8 H;  1HR0 H;  1X4N A;  2M6Q A;  1SEI A;  4X64 H;  4JI3 H;  2FFM A;  2E5L H;  1WE8 A;  4B3M H;  4LF6 H;  1PQX A;  1XMO H;  2E3U A;  4DR1 H;  1XNQ H;  4FJU A;  5BR8 H;  1AN7 A;  1ZTG A;  1VBI A;  4DV2 H;  4LFC H;  4OO1 G;  4DV7 H;  2K1H A;  2UXD H;  2OPU A;  2FMR A;  2YQR A;  5K36 G;  1ZZI A;  3L7Z C;  2HH3 A;  2CWH A;  3OTO H;  1X4M A;  2LF0 A;  4K0K H;  2CWF A;  5JEA G;  4X65 H;  4DV1 H;  1S20 A;  4AQY H;  4NXN H;  2VQE H;  4B3T H;  3RF2 A;  4DUY H;  1F0X A;  2CTM A;  2QND A;  3T1H H;  1KHM A;  2DGR A;  1UG8 A;  1WVN A;  4YHH H;  4X62 H;  4DR6 H;  5LL6 b;  2ANR A;  4G08 A;  2P2R A;  3EZJ A;  2UU9 H;  1VIH A;  5A2Q W;  1IBM H;  4NXM H;  3GR5 A;  4JI5 H;  1XRH A;  3GKU A;  4LFB H;  1I6U A;  2HHH H;  1NXU A;  5DT9 A;  4DUZ H;  1XNR H;  2CTK A;  4DR4 H;  4E9J A;  2HH2 A;  1DT4 A;  4GKK H;  1V9N A;  2X06 A;  2CTF A;  4YY3 H;  2VQF H;  1I94 H;  1HNZ H;  4LF5 H;  1J4W A;  1HNW H;  3J7A K;  1EC6 A;  4KHP H;  2JVZ A;  3VKE A;  2UUA H;  4DV6 H;  2OPV A;  3QD7 X;  2CTJ A;  4LF7 H;  4LFA H;  2AXY A;  2JEB I;  1X0A A;  3OSS D;  1VIG A;  4OCH A;  4LF8 H;  2BL5 A;  1WTJ A;  3U1K A;  2CPQ A;  1N32 H;  3UOE A;  1J5E H;  2ANN A;  2PY9 A;  4JI2 H;  4DR3 H;  3JAM W;  4JYA H;  2NN6 G;  4NZT M;  2LTL A;  4LIJ A;  2CTL A;  3I0P A;  3KDK A;  4BA2 I;  3GAB A;  2UUB H;  2Z0S A;  4X66 H;  3KDG A;  4B8T A;  3J81 W;  5LMN H;  2LRR A;  4DR5 H;  4B3S H;  3J80 W;  4FJS A;  2FPH X;  2F4V H;  1J5K A;  2UXB H;  4WAL A;  1V8C A;  4LF9 H;  2G8Y A;  4AIM A;  1HNX H;  2CTE A;  4DV0 H;  4JI6 H;  1N33 H;  5FLX W;  1N34 H;  2JEA I;  1X9Z A;  4JI7 H;  3OET A;  1TUA A;  4JV5 H;  2JA9 A;  1Z2I A;  1MSZ A;  2Y3M A;  2PT7 G;  2VKC A;  4AM3 A;  2ZM6 H;  2D9I A;  4NZR M;  5LMU H;  4IFD G;  1S03 G;  4JI0 H;  1FKA H;  2BA0 A;  1ZZK A;  4JI1 H;  1WHR A;  1XMQ H;  2LTM A;  4PDB A;  2JE6 I;  3T1Y H;  2ZQE A;  3AEV B;  2CPM A;  2M8W A;  3FAU A;  1N36 H;  4NBQ A;  4OX9 H;  4EC5 A;  4DR7 H;  4QMF B;  1K1G A;  4B3R H;  2O4C A;  4WAN A;  3V69 A;  3NCV A;  3SB1 A;  4DV4 H;  2UXC H;  5IWA H;  1FJG H;  4JVH A;  1DTJ A;  4GKJ H;  4OD6 A;  4H8A A;  4DV3 H;  4LF4 H; 
#chains in the Genus database with same CATH homology
 5C0X G;  2CTM A;  2QND A;  1VIG A;  2JEA I;  2DGR A;  1KHM A;  2BL5 A;  1WVN A;  1TUA A;  3U1K A;  4JVY A;  2JA9 A;  2PQU A;  2CPQ A;  2JZX A;  2ANN A;  2PY9 A;  2ANR A;  4BA1 I;  2P2R A;  2MJH A;  4AM3 A;  2NN6 G;  1ZZJ A;  4IFD G;  1VIH A;  1X4N A;  4LIJ A;  2BA0 A;  2CTL A;  1ZZK A;  1WE8 A;  4BA2 I;  2E3U A;  2Z0S A;  2JE6 I;  4B8T A;  2CTK A;  3AEV B;  4NBQ A;  2HH2 A;  1ZTG A;  1DT4 A;  4QMF B;  1K1G A;  4OO1 G;  2CTF A;  5K36 G;  2OPU A;  2FMR A;  2YQR A;  1J4W A;  4WAN A;  1ZZI A;  3L7Z C;  3V69 A;  1J5K A;  2HH3 A;  4WAL A;  1EC6 A;  1X4M A;  2JVZ A;  3VKE A;  1DTJ A;  4JVH A;  4AIM A;  5JEA G;  2OPV A;  2CTJ A;  2CTE A;  2AXY A;  2JEB I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...