2QNDA

Crystal structure of the kh1-kh2 domains from human fragile x mental retardation protein
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
141
structure length
141
Chain Sequence
b'FHEQFIVREDLMGLAIGTHGANIQQARKVPGVTAIDLDEDTCTFHIYGEDQDAVKKARSFLEFAEDVIQVPRNLVGKVIGKNGKLIQEIVDKSGVVRVRIEAENEKNVPQEEGMVPFVFVGTKDSIANATVLLDYHLNYLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FMR1 protein
publication title Fragile X mental retardation syndrome: structure of the KH1-KH2 domains of fragile X mental retardation protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 44
structure length 141
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 2qndA02
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 2qndA01
3V69A 2E3UA 3L7ZC 4WANA 1VIGA 5JEAG 1ZZIA 2JZXA 4AM3A 1KHMA 4BA1I 2OPVA 1J5KA 1X4NA 1X4MA 1WE8A 2CTEA 2NN6G 2PY9A 2BL5A 4IFDG 1K1GA 2CTFA 2CPQA 2CTLA 1DT4A 2BA0A 3U1KA 4BA2I 1J4WA 2JEBI 4LIJA 2CTMA 1ZZJA 1ZZKA 2FMRA 5C0XG 4JVYA 4JVHA 2JE6I 2YQRA 2AXYA 2JVZA 1EC6A 2PQUA 2MJHA 2P2RA 2ANNA 2JA9A 2HH3A 1TUAA 4OO1G 2DGRA 1WVNA 2OPUA 2Z0SA 2ANRA 2HH2A 4B8TA 2QNDA 1VIHA 4WALA 1ZTGA 5K36G 4QMFB 3VKEA 2CTKA 2JEAI 3AEVB 2CTJA 4AIMA 1DTJA 4NBQA
chains in the Genus database with same CATH superfamily
3GKUA 4JI8H 4WANA 4DR1H 1X0AA 1VBIA 1Z2IA 2X06A 4H8AA 2M8WA 4BA1I 1J5EH 2F4VH 1KHMA 4DR2H 4B3SH 1FJGH 4IFDG 4DR5H 1K1GA 2CPQA 4DV1H 3J80W 2UXBH 4DV5H 4DUZH 1V8CA 2JEBI 4JI7H 2CTMA 4OX9H 4JI0H 1N36H 1WTJA 1HNWH 1ZZJA 4JVYA 2UU9H 4LF4H 4KHPH 1PQXA 2UUAH 3JAMW 4JI4H 2JA9A 2HH3A 1TUAA 2FPHX 4OO1G 4NXMH 2UXCH 4DV0H 2HH2A 3GR5A 3KDGA 2UUCH 4YY3H 4LFAH 2VQEH 2JEAI 1X9ZA 2ZQEA 1F0XA 3OSSD 3V69A 2E3UA 4JI5H 1VIGA 2JZXA 4G08A 2OPVA 1J5KA 4EC5A 4GKJH 1X4NA 1WE8A 2VQFH 2BL5A 1WHRA 4DR3H 4BA2I 4DV3H 4LF7H 5DT9A 1IBLH 1XNQH 4JYAH 4X66H 4JV5H 3QD7X 4OCHA 4LFBH 1N34H 1HNZH 4LF8H 4X62H 1N33H 2A1SA 2JE6I 4DUYH 2FFMA 2PQUA 3J7AK 4PDBA 2ANNA 1EC6A 2CPMA 2DGRA 5BR8H 2LTMA 1VIHA 2M6QA 2QNDA 3KDKA 4WALA 2CTJA 2HHHH 4DV4H 4AIMA 3U1KA 4NBQA 4B8TA 5FLXW 4AQYH 1HR0H 3UOEA 3FAUA 3L7ZC 1S20A 4DR6H 3RF2A 1ODHA 5JEAG 5IT9W 1XRHA 4AM3A 1X4MA 2NN6G 2UUBH 4JI1H 2PY9A 4DV6H 4B3TH 2CTFA 2CTLA 4E9JA 1NXUA 2PT7G 4FJUA 4B3RH 2LRRA 4LIJA 1HNXH 1XNRH 1XMQH 1V9NA 1ZZKA 2FMRA 3OETA 4NZRM 2LF0A 2YQRA 3GABA 1MSZA 2AXYA 4B3MH 1AN7A 2MJHA 3OTOH 2P2RA 4DV7H 3T1HH 4NXNH 4X65H 2ZM6H 2Z0SA 2ANRA 2E5LH 1ZTGA 4B8CD 3VKEA 2CTKA 1I94H 4DR7H 2LTLA 1DTJA 3I0PA 3T1YH 4JI3H 3EZJA 1FKAH 2G8YA 4LF6H 1ZZIA 4K0KH 2CWHA 4FJSA 2CTEA 4OD6A 1SEIA 2CWFA 4JI2H 4JI6H 1DT4A 2BA0A 2Y3MA 4NZTM 2K1HA 1IBKH 1J4WA 4LFCH 4DV2H 1I6UA 5LL6b 4DR4H 5A2QW 5LMNH 1XMOH 2D9IA 5C0XG 1S03G 4JVHA 4LF5H 2JVZA 5LMUH 3NCVA 3J81W 1N32H 1IBMH 1WVNA 2UXDH 2O4CA 2OPUA 4GKKH 5K36G 4LF9H 4QMFB 3AEVB 3SB1A 4YHHH 2VKCA 4X64H 5IWAH 1UG8A
chains in the Genus database with same CATH topology
3V69A 2E3UA 3L7ZC 4WANA 1VIGA 5JEAG 1ZZIA 2JZXA 4AM3A 1KHMA 4BA1I 2OPVA 1J5KA 1X4NA 1X4MA 1WE8A 2CTEA 2NN6G 2PY9A 2BL5A 4IFDG 1K1GA 2CTFA 2CPQA 2CTLA 1DT4A 2BA0A 3U1KA 4BA2I 1J4WA 2JEBI 4LIJA 2CTMA 1ZZJA 1ZZKA 2FMRA 5C0XG 4JVYA 4JVHA 2JE6I 2YQRA 2AXYA 2JVZA 1EC6A 2PQUA 2MJHA 2P2RA 2ANNA 2JA9A 2HH3A 1TUAA 4OO1G 2DGRA 1WVNA 2OPUA 2Z0SA 2ANRA 2HH2A 4B8TA 2QNDA 1VIHA 4WALA 1ZTGA 5K36G 4QMFB 3VKEA 2CTKA 2JEAI 3AEVB 2CTJA 4AIMA 1DTJA 4NBQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V69 A;  2E3U A;  3L7Z C;  4WAN A;  1VIG A;  5JEA G;  1ZZI A;  2JZX A;  4AM3 A;  1KHM A;  4BA1 I;  2OPV A;  1J5K A;  1X4N A;  1X4M A;  1WE8 A;  2CTE A;  2NN6 G;  2PY9 A;  2BL5 A;  4IFD G;  1K1G A;  2CTF A;  2CPQ A;  2CTL A;  1DT4 A;  2BA0 A;  3U1K A;  4BA2 I;  1J4W A;  2JEB I;  4LIJ A;  2CTM A;  1ZZJ A;  1ZZK A;  2FMR A;  5C0X G;  4JVY A;  4JVH A;  2JE6 I;  2YQR A;  2AXY A;  2JVZ A;  1EC6 A;  2PQU A;  2MJH A;  2P2R A;  2ANN A;  2JA9 A;  2HH3 A;  1TUA A;  4OO1 G;  2DGR A;  1WVN A;  2OPU A;  2Z0S A;  2ANR A;  2HH2 A;  4B8T A;  2QND A;  1VIH A;  4WAL A;  1ZTG A;  5K36 G;  4QMF B;  3VKE A;  2CTK A;  2JEA I;  3AEV B;  2CTJ A;  4AIM A;  1DTJ A;  4NBQ A; 
#chains in the Genus database with same CATH topology
 3GKU A;  4JI8 H;  4WAN A;  4DR1 H;  1X0A A;  1VBI A;  1Z2I A;  2X06 A;  4H8A A;  2M8W A;  4BA1 I;  1J5E H;  2F4V H;  1KHM A;  4DR2 H;  4B3S H;  1FJG H;  4IFD G;  4DR5 H;  1K1G A;  2CPQ A;  4DV1 H;  3J80 W;  2UXB H;  4DV5 H;  4DUZ H;  1V8C A;  2JEB I;  4JI7 H;  2CTM A;  4OX9 H;  4JI0 H;  1N36 H;  1WTJ A;  1HNW H;  1ZZJ A;  4JVY A;  2UU9 H;  4LF4 H;  4KHP H;  1PQX A;  2UUA H;  3JAM W;  4JI4 H;  2JA9 A;  2HH3 A;  1TUA A;  2FPH X;  4OO1 G;  4NXM H;  2UXC H;  4DV0 H;  2HH2 A;  3GR5 A;  3KDG A;  2UUC H;  4YY3 H;  4LFA H;  2VQE H;  2JEA I;  1X9Z A;  2ZQE A;  1F0X A;  3OSS D;  3V69 A;  2E3U A;  4JI5 H;  1VIG A;  2JZX A;  4G08 A;  2OPV A;  1J5K A;  4EC5 A;  4GKJ H;  1X4N A;  1WE8 A;  2VQF H;  2BL5 A;  1WHR A;  4DR3 H;  4BA2 I;  4DV3 H;  4LF7 H;  5DT9 A;  1IBL H;  1XNQ H;  4JYA H;  4X66 H;  4JV5 H;  3QD7 X;  4OCH A;  4LFB H;  1N34 H;  1HNZ H;  4LF8 H;  4X62 H;  1N33 H;  2A1S A;  2JE6 I;  4DUY H;  2FFM A;  2PQU A;  3J7A K;  4PDB A;  2ANN A;  1EC6 A;  2CPM A;  2DGR A;  5BR8 H;  2LTM A;  1VIH A;  2M6Q A;  2QND A;  3KDK A;  4WAL A;  2CTJ A;  2HHH H;  4DV4 H;  4AIM A;  3U1K A;  4NBQ A;  4B8T A;  5FLX W;  4AQY H;  1HR0 H;  3UOE A;  3FAU A;  3L7Z C;  1S20 A;  4DR6 H;  3RF2 A;  1ODH A;  5JEA G;  5IT9 W;  1XRH A;  4AM3 A;  1X4M A;  2NN6 G;  2UUB H;  4JI1 H;  2PY9 A;  4DV6 H;  4B3T H;  2CTF A;  2CTL A;  4E9J A;  1NXU A;  2PT7 G;  4FJU A;  4B3R H;  2LRR A;  4LIJ A;  1HNX H;  1XNR H;  1XMQ H;  1V9N A;  1ZZK A;  2FMR A;  3OET A;  4NZR M;  2LF0 A;  2YQR A;  3GAB A;  1MSZ A;  2AXY A;  4B3M H;  1AN7 A;  2MJH A;  3OTO H;  2P2R A;  4DV7 H;  3T1H H;  4NXN H;  4X65 H;  2ZM6 H;  2Z0S A;  2ANR A;  2E5L H;  1ZTG A;  4B8C D;  3VKE A;  2CTK A;  1I94 H;  4DR7 H;  2LTL A;  1DTJ A;  3I0P A;  3T1Y H;  4JI3 H;  3EZJ A;  1FKA H;  2G8Y A;  4LF6 H;  1ZZI A;  4K0K H;  2CWH A;  4FJS A;  2CTE A;  4OD6 A;  1SEI A;  2CWF A;  4JI2 H;  4JI6 H;  1DT4 A;  2BA0 A;  2Y3M A;  4NZT M;  2K1H A;  1IBK H;  1J4W A;  4LFC H;  4DV2 H;  1I6U A;  5LL6 b;  4DR4 H;  5A2Q W;  5LMN H;  1XMO H;  2D9I A;  5C0X G;  1S03 G;  4JVH A;  4LF5 H;  2JVZ A;  5LMU H;  3NCV A;  3J81 W;  1N32 H;  1IBM H;  1WVN A;  2UXD H;  2O4C A;  2OPU A;  4GKK H;  5K36 G;  4LF9 H;  4QMF B;  3AEV B;  3SB1 A;  4YHH H;  2VKC A;  4X64 H;  5IWA H;  1UG8 A; 
#chains in the Genus database with same CATH homology
 3V69 A;  2E3U A;  3L7Z C;  4WAN A;  1VIG A;  5JEA G;  1ZZI A;  2JZX A;  4AM3 A;  1KHM A;  4BA1 I;  2OPV A;  1J5K A;  1X4N A;  1X4M A;  1WE8 A;  2CTE A;  2NN6 G;  2PY9 A;  2BL5 A;  4IFD G;  1K1G A;  2CTF A;  2CPQ A;  2CTL A;  1DT4 A;  2BA0 A;  3U1K A;  4BA2 I;  1J4W A;  2JEB I;  4LIJ A;  2CTM A;  1ZZJ A;  1ZZK A;  2FMR A;  5C0X G;  4JVY A;  4JVH A;  2JE6 I;  2YQR A;  2AXY A;  2JVZ A;  1EC6 A;  2PQU A;  2MJH A;  2P2R A;  2ANN A;  2JA9 A;  2HH3 A;  1TUA A;  4OO1 G;  2DGR A;  1WVN A;  2OPU A;  2Z0S A;  2ANR A;  2HH2 A;  4B8T A;  2QND A;  1VIH A;  4WAL A;  1ZTG A;  5K36 G;  4QMF B;  3VKE A;  2CTK A;  2JEA I;  3AEV B;  2CTJ A;  4AIM A;  1DTJ A;  4NBQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...