2QNDA

Crystal structure of the kh1-kh2 domains from human fragile x mental retardation protein
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
141
structure length
141
Chain Sequence
FHEQFIVREDLMGLAIGTHGANIQQARKVPGVTAIDLDEDTCTFHIYGEDQDAVKKARSFLEFAEDVIQVPRNLVGKVIGKNGKLIQEIVDKSGVVRVRIEAENEKNVPQEEGMVPFVFVGTKDSIANATVLLDYHLNYLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FMR1 protein
publication title Fragile X mental retardation syndrome: structure of the KH1-KH2 domains of fragile X mental retardation protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 44
structure length 141
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 2qndA02
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 2qndA01
2BL5A 2E3UA 2FMRA 4BA1I 4JVYA 4NBQA 3L7ZC 1J4WA 4LIJA 2JEAI 2JE6I 2OPVA 4OO1G 1ZZJA 4IFDG 2YQRA 4WANA 1ZTGA 2QNDA 2OPUA 1J5KA 1DTJA 1X4MA 2CPQA 2HH3A 4AIMA 1ZZIA 4QMFB 1VIGA 2CTEA 2JVZA 3U1KA 2CTFA 5JEAG 2AXYA 2ANRA 2PY9A 4AM3A 2BA0A 2DGRA 1K1GA 5K36G 2Z0SA 1WE8A 2JA9A 3VKEA 2PQUA 2ANNA 3AEVB 1X4NA 1DT4A 4WALA 2JZXA 1WVNA 3V69A 2CTMA 5C0XG 2HH2A 1EC6A 1KHMA 1TUAA 1ZZKA 4BA2I 2NN6G 2JEBI 4JVHA 4B8TA 2CTKA 1VIHA 2CTLA 2MJHA 2CTJA 2P2RA
chains in the Genus database with same CATH superfamily
1N33H 2FFMA 4JI7H 4BA1I 2E5LH 4JVYA 4NBQA 1J4WA 1XNRH 3RF2A 1VBIA 3OSSD 4JI6H 1ZZJA 4DV4H 4IFDG 1AN7A 4JI4H 4DR7H 2QNDA 3T1HH 2OPUA 3J80W 1X4MA 2HH3A 1ZZIA 4AIMA 2PT7G 3I0PA 3UOEA 4EC5A 4DV0H 1X9ZA 2CTEA 2JVZA 1ODHA 4B3SH 2PY9A 4AM3A 2CPMA 4LFBH 1V9NA 4PDBA 2UXCH 4LF8H 1WE8A 2JA9A 3QD7X 2ANNA 2D9IA 2VQEH 5C0XG 2CTMA 4DR1H 1KHMA 4LF5H 3GKUA 2CTKA 1VIHA 2CTJA 4OD6A 4B3TH 4JI8H 2BL5A 5DT9A 1IBLH 4DR4H 1I6UA 3FAUA 1J5EH 4GKJH 4NZTM 2JE6I 1IBKH 2OPVA 4JI5H 1HR0H 4X66H 5LMNH 1ZTGA 4KHPH 5FLXW 5LMUH 1J5KA 2CPQA 2UXBH 2A1SA 3KDKA 4B8CD 3GR5A 2HHHH 4E9JA 4X64H 4JI3H 2CWHA 4DV2H 2VQFH 4DV7H 4JI0H 4K0KH 1X4NA 2JZXA 4FJUA 4LF9H 2UUAH 4DR2H 2UU9H 4BA2I 4AQYH 1PQXA 4NXNH 4LFCH 1UG8A 2CTLA 1F0XA 1FKAH 1WHRA 2E3UA 4B3RH 2LF0A 2FMRA 4LF4H 1NXUA 4DUYH 3L7ZC 4G08A 4LIJA 1FJGH 2UXDH 1MSZA 1X0AA 2CWFA 4H8AA 4DR5H 4GKKH 1HNWH 4OO1G 4WANA 2YQRA 1Z2IA 1HNZH 2F4VH 2UUBH 3J81W 2K1HA 2ZQEA 5LL6b 1XMQH 1SEIA 2ANRA 1S03G 3T1YH 1XNQH 4YY3H 2Z0SA 5A2QW 2PQUA 4JI2H 4DV6H 1DT4A 4WALA 3OETA 4B3MH 3V69A 1EC6A 3GABA 2HH2A 2FPHX 3KDGA 1TUAA 1ZZKA 1XMOH 2NN6G 4DV5H 2JEBI 4JVHA 3SB1A 4OX9H 4NZRM 2P2RA 1V8CA 4DR3H 4LF7H 2ZM6H 4JYAH 4DR6H 5BR8H 2VKCA 2JEAI 1WTJA 3OTOH 4NXMH 4DV1H 2X06A 3EZJA 4JI1H 2G8YA 2M6QA 2O4CA 4FJSA 1DTJA 4LF6H 2Y3MA 4QMFB 4OCHA 1N34H 1VIGA 3U1KA 5JEAG 2AXYA 2CTFA 1IBMH 3J7AK 5IT9W 2M8WA 2BA0A 1XRHA 2DGRA 4DV3H 1K1GA 5K36G 3AEVB 4X62H 3VKEA 3JAMW 1I94H 4YHHH 1HNXH 1WVNA 1N36H 4JV5H 2LTLA 2LRRA 3NCVA 2LTMA 1S20A 4X65H 4B8TA 2UUCH 1N32H 5IWAH 2MJHA 4DUZH 4LFAH
chains in the Genus database with same CATH topology
2BL5A 2E3UA 2FMRA 4BA1I 4JVYA 4NBQA 3L7ZC 1J4WA 4LIJA 2JEAI 2JE6I 2OPVA 4OO1G 1ZZJA 4IFDG 2YQRA 4WANA 1ZTGA 2QNDA 2OPUA 1J5KA 1DTJA 1X4MA 2CPQA 2HH3A 4AIMA 1ZZIA 4QMFB 1VIGA 2CTEA 2JVZA 3U1KA 2CTFA 5JEAG 2AXYA 2ANRA 2PY9A 4AM3A 2BA0A 2DGRA 1K1GA 5K36G 2Z0SA 1WE8A 2JA9A 3VKEA 2PQUA 2ANNA 3AEVB 1X4NA 1DT4A 4WALA 2JZXA 1WVNA 3V69A 2CTMA 5C0XG 2HH2A 1EC6A 1KHMA 1TUAA 1ZZKA 4BA2I 2NN6G 2JEBI 4JVHA 4B8TA 2CTKA 1VIHA 2CTLA 2MJHA 2CTJA 2P2RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BL5 A;  2E3U A;  2FMR A;  4BA1 I;  4JVY A;  4NBQ A;  3L7Z C;  1J4W A;  4LIJ A;  2JEA I;  2JE6 I;  2OPV A;  4OO1 G;  1ZZJ A;  4IFD G;  2YQR A;  4WAN A;  1ZTG A;  2QND A;  2OPU A;  1J5K A;  1DTJ A;  1X4M A;  2CPQ A;  2HH3 A;  4AIM A;  1ZZI A;  4QMF B;  1VIG A;  2CTE A;  2JVZ A;  3U1K A;  2CTF A;  5JEA G;  2AXY A;  2ANR A;  2PY9 A;  4AM3 A;  2BA0 A;  2DGR A;  1K1G A;  5K36 G;  2Z0S A;  1WE8 A;  2JA9 A;  3VKE A;  2PQU A;  2ANN A;  3AEV B;  1X4N A;  1DT4 A;  4WAL A;  2JZX A;  1WVN A;  3V69 A;  2CTM A;  5C0X G;  2HH2 A;  1EC6 A;  1KHM A;  1TUA A;  1ZZK A;  4BA2 I;  2NN6 G;  2JEB I;  4JVH A;  4B8T A;  2CTK A;  1VIH A;  2CTL A;  2MJH A;  2CTJ A;  2P2R A; 
#chains in the Genus database with same CATH topology
 1N33 H;  2FFM A;  4JI7 H;  4BA1 I;  2E5L H;  4JVY A;  4NBQ A;  1J4W A;  1XNR H;  3RF2 A;  1VBI A;  3OSS D;  4JI6 H;  1ZZJ A;  4DV4 H;  4IFD G;  1AN7 A;  4JI4 H;  4DR7 H;  2QND A;  3T1H H;  2OPU A;  3J80 W;  1X4M A;  2HH3 A;  1ZZI A;  4AIM A;  2PT7 G;  3I0P A;  3UOE A;  4EC5 A;  4DV0 H;  1X9Z A;  2CTE A;  2JVZ A;  1ODH A;  4B3S H;  2PY9 A;  4AM3 A;  2CPM A;  4LFB H;  1V9N A;  4PDB A;  2UXC H;  4LF8 H;  1WE8 A;  2JA9 A;  3QD7 X;  2ANN A;  2D9I A;  2VQE H;  5C0X G;  2CTM A;  4DR1 H;  1KHM A;  4LF5 H;  3GKU A;  2CTK A;  1VIH A;  2CTJ A;  4OD6 A;  4B3T H;  4JI8 H;  2BL5 A;  5DT9 A;  1IBL H;  4DR4 H;  1I6U A;  3FAU A;  1J5E H;  4GKJ H;  4NZT M;  2JE6 I;  1IBK H;  2OPV A;  4JI5 H;  1HR0 H;  4X66 H;  5LMN H;  1ZTG A;  4KHP H;  5FLX W;  5LMU H;  1J5K A;  2CPQ A;  2UXB H;  2A1S A;  3KDK A;  4B8C D;  3GR5 A;  2HHH H;  4E9J A;  4X64 H;  4JI3 H;  2CWH A;  4DV2 H;  2VQF H;  4DV7 H;  4JI0 H;  4K0K H;  1X4N A;  2JZX A;  4FJU A;  4LF9 H;  2UUA H;  4DR2 H;  2UU9 H;  4BA2 I;  4AQY H;  1PQX A;  4NXN H;  4LFC H;  1UG8 A;  2CTL A;  1F0X A;  1FKA H;  1WHR A;  2E3U A;  4B3R H;  2LF0 A;  2FMR A;  4LF4 H;  1NXU A;  4DUY H;  3L7Z C;  4G08 A;  4LIJ A;  1FJG H;  2UXD H;  1MSZ A;  1X0A A;  2CWF A;  4H8A A;  4DR5 H;  4GKK H;  1HNW H;  4OO1 G;  4WAN A;  2YQR A;  1Z2I A;  1HNZ H;  2F4V H;  2UUB H;  3J81 W;  2K1H A;  2ZQE A;  5LL6 b;  1XMQ H;  1SEI A;  2ANR A;  1S03 G;  3T1Y H;  1XNQ H;  4YY3 H;  2Z0S A;  5A2Q W;  2PQU A;  4JI2 H;  4DV6 H;  1DT4 A;  4WAL A;  3OET A;  4B3M H;  3V69 A;  1EC6 A;  3GAB A;  2HH2 A;  2FPH X;  3KDG A;  1TUA A;  1ZZK A;  1XMO H;  2NN6 G;  4DV5 H;  2JEB I;  4JVH A;  3SB1 A;  4OX9 H;  4NZR M;  2P2R A;  1V8C A;  4DR3 H;  4LF7 H;  2ZM6 H;  4JYA H;  4DR6 H;  5BR8 H;  2VKC A;  2JEA I;  1WTJ A;  3OTO H;  4NXM H;  4DV1 H;  2X06 A;  3EZJ A;  4JI1 H;  2G8Y A;  2M6Q A;  2O4C A;  4FJS A;  1DTJ A;  4LF6 H;  2Y3M A;  4QMF B;  4OCH A;  1N34 H;  1VIG A;  3U1K A;  5JEA G;  2AXY A;  2CTF A;  1IBM H;  3J7A K;  5IT9 W;  2M8W A;  2BA0 A;  1XRH A;  2DGR A;  4DV3 H;  1K1G A;  5K36 G;  3AEV B;  4X62 H;  3VKE A;  3JAM W;  1I94 H;  4YHH H;  1HNX H;  1WVN A;  1N36 H;  4JV5 H;  2LTL A;  2LRR A;  3NCV A;  2LTM A;  1S20 A;  4X65 H;  4B8T A;  2UUC H;  1N32 H;  5IWA H;  2MJH A;  4DUZ H;  4LFA H; 
#chains in the Genus database with same CATH homology
 2BL5 A;  2E3U A;  2FMR A;  4BA1 I;  4JVY A;  4NBQ A;  3L7Z C;  1J4W A;  4LIJ A;  2JEA I;  2JE6 I;  2OPV A;  4OO1 G;  1ZZJ A;  4IFD G;  2YQR A;  4WAN A;  1ZTG A;  2QND A;  2OPU A;  1J5K A;  1DTJ A;  1X4M A;  2CPQ A;  2HH3 A;  4AIM A;  1ZZI A;  4QMF B;  1VIG A;  2CTE A;  2JVZ A;  3U1K A;  2CTF A;  5JEA G;  2AXY A;  2ANR A;  2PY9 A;  4AM3 A;  2BA0 A;  2DGR A;  1K1G A;  5K36 G;  2Z0S A;  1WE8 A;  2JA9 A;  3VKE A;  2PQU A;  2ANN A;  3AEV B;  1X4N A;  1DT4 A;  4WAL A;  2JZX A;  1WVN A;  3V69 A;  2CTM A;  5C0X G;  2HH2 A;  1EC6 A;  1KHM A;  1TUA A;  1ZZK A;  4BA2 I;  2NN6 G;  2JEB I;  4JVH A;  4B8T A;  2CTK A;  1VIH A;  2CTL A;  2MJH A;  2CTJ A;  2P2R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...