2QNDA

Crystal structure of the kh1-kh2 domains from human fragile x mental retardation protein
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
141
structure length
141
Chain Sequence
b'FHEQFIVREDLMGLAIGTHGANIQQARKVPGVTAIDLDEDTCTFHIYGEDQDAVKKARSFLEFAEDVIQVPRNLVGKVIGKNGKLIQEIVDKSGVVRVRIEAENEKNVPQEEGMVPFVFVGTKDSIANATVLLDYHLNYLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FMR1 protein
molecule tags Rna binding protein
source organism Homo sapiens
publication title Fragile X mental retardation syndrome: structure of the KH1-KH2 domains of fragile X mental retardation protein.
pubmed doi rcsb
total genus 44
structure length 141
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 2qndA02
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 2qndA01
2JA9A 2YQRA 2PQUA 2JVZA 2P2RA 4AIMA 5K36G 1WE8A 2DGRA 2JZXA 1ZZJA 1ZZIA 1WVNA 1X4MA 4IFDG 2JEBI 2CTJA 2CPQA 4BA2I 2JE6I 1EC6A 4WALA 3AEVB 1VIHA 2CTFA 2BL5A 2HH3A 2NN6G 2FMRA 4LIJA 4NBQA 4BA1I 4AM3A 4OO1G 4JVHA 2CTEA 2OPUA 1DT4A 4B8TA 2QNDA 5C0XG 4JVYA 1ZTGA 1VIGA 5JEAG 3VKEA 4WANA 2ANRA 2E3UA 3L7ZC 2MJHA 1TUAA 1DTJA 1ZZKA 2CTLA 2Z0SA 2CTMA 3V69A 2PY9A 1J5KA 1K1GA 2JEAI 1X4NA 1KHMA 1J4WA 2OPVA 3U1KA 2CTKA 2AXYA 2ANNA 2BA0A 2HH2A 4QMFB
chains in the Genus database with same CATH superfamily
1XRHA 2PQUA 4DV0H 4KHPH 3RF2A 2CWFA 4YHHH 3KDKA 1ZZIA 1WVNA 1X4MA 2CPQA 3UOEA 2LTLA 1N33H 3J81W 3AEVB 1ODHA 2D9IA 4JI2H 4BA1I 4OCHA 1N36H 4DR1H 3QD7X 2QNDA 2E5LH 4LFBH 4NXMH 5JEAG 3VKEA 2UU9H 2VQFH 2G8YA 3EZJA 1UG8A 2E3UA 2PT7G 4LF4H 4LF6H 1DTJA 2PY9A 4K0KH 2UXDH 4DV7H 1K1GA 3FAUA 1Z2IA 3GKUA 1X4NA 4JI3H 4JV5H 2AXYA 3I0PA 2BA0A 2HH2A 4DV2H 4B3RH 4QMFB 1X9ZA 2JA9A 2YQRA 4GKKH 4EC5A 4JYAH 3J7AK 3T1YH 2JVZA 4LF9H 4YY3H 5K36G 4DR3H 1WE8A 4DR7H 1MSZA 1XNRH 1PQXA 4LF5H 4DR4H 4DV4H 2CTJA 1N34H 1IBKH 4JI8H 4JI4H 4DV5H 2ZM6H 5IT9W 2JE6I 2UUCH 1EC6A 4NZTM 4WALA 5BR8H 3NCVA 5DT9A 2CWHA 4LF8H 1DT4A 5A2QW 4JVYA 1AN7A 4X62H 1IBMH 4AQYH 4OX9H 2FPHX 4LFAH 3L7ZC 2MJHA 4BA2I 2CTLA 3V69A 3OTOH 4DV6H 1HR0H 4JI1H 1HNXH 3KDGA 1J5EH 1NXUA 2LF0A 4JI5H 2Y3MA 1I94H 2FFMA 2UUAH 2K1HA 2P2RA 4X66H 1IBLH 1FKAH 1S20A 2LRRA 4AIMA 3OETA 4B3MH 2LTMA 2JZXA 4PDBA 5LMNH 4NZRM 3JAMW 2BL5A 2NN6G 4LIJA 4NBQA 4LFCH 4AM3A 4JVHA 2CTEA 4B3SH 4B8TA 2M8WA 3GR5A 1ZTGA 1HNWH 1V8CA 1F0XA 4WANA 3GABA 4E9JA 4JI6H 4NXNH 4DV3H 1XMOH 2M6QA 1ZZKA 2CTMA 1J5KA 2JEAI 2O4CA 2VKCA 2A1SA 1SEIA 1KHMA 4FJUA 4FJSA 4H8AA 2OPVA 3U1KA 3OSSD 2ANNA 4DV1H 2UXBH 1WHRA 4B8CD 1X0AA 5IWAH 2UUBH 2CPMA 4DR2H 4GKJH 4DUYH 4DUZH 2DGRA 1ZZJA 1S03G 4IFDG 2JEBI 2ZQEA 1XMQH 4DR6H 1I6UA 1XNQH 3SB1A 1FJGH 1VIHA 2CTFA 2HH3A 1N32H 2FMRA 4OD6A 4JI0H 4OO1G 2OPUA 4B3TH 4X65H 5C0XG 4LF7H 1VIGA 5FLXW 5LMUH 2ANRA 2F4VH 2UXCH 3T1HH 1TUAA 2Z0SA 2HHHH 2VQEH 4X64H 4JI7H 1V9NA 5LL6b 1HNZH 1WTJA 3J80W 4G08A 1J4WA 4DR5H 2CTKA 2X06A 1VBIA
chains in the Genus database with same CATH topology
2JA9A 2YQRA 2PQUA 2JVZA 2P2RA 4AIMA 5K36G 1WE8A 2DGRA 2JZXA 1ZZJA 1ZZIA 1WVNA 1X4MA 4IFDG 2JEBI 2CTJA 2CPQA 4BA2I 2JE6I 1EC6A 4WALA 3AEVB 1VIHA 2CTFA 2BL5A 2HH3A 2NN6G 2FMRA 4LIJA 4NBQA 4BA1I 4AM3A 4OO1G 4JVHA 2CTEA 2OPUA 1DT4A 4B8TA 2QNDA 5C0XG 4JVYA 1ZTGA 1VIGA 5JEAG 3VKEA 4WANA 2ANRA 2E3UA 3L7ZC 2MJHA 1TUAA 1DTJA 1ZZKA 2CTLA 2Z0SA 2CTMA 3V69A 2PY9A 1J5KA 1K1GA 2JEAI 1X4NA 1KHMA 1J4WA 2OPVA 3U1KA 2CTKA 2AXYA 2ANNA 2BA0A 2HH2A 4QMFB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JA9 A;  2YQR A;  2PQU A;  2JVZ A;  2P2R A;  4AIM A;  5K36 G;  1WE8 A;  2DGR A;  2JZX A;  1ZZJ A;  1ZZI A;  1WVN A;  1X4M A;  4IFD G;  2JEB I;  2CTJ A;  2CPQ A;  4BA2 I;  2JE6 I;  1EC6 A;  4WAL A;  3AEV B;  1VIH A;  2CTF A;  2BL5 A;  2HH3 A;  2NN6 G;  2FMR A;  4LIJ A;  4NBQ A;  4BA1 I;  4AM3 A;  4OO1 G;  4JVH A;  2CTE A;  2OPU A;  1DT4 A;  4B8T A;  2QND A;  5C0X G;  4JVY A;  1ZTG A;  1VIG A;  5JEA G;  3VKE A;  4WAN A;  2ANR A;  2E3U A;  3L7Z C;  2MJH A;  1TUA A;  1DTJ A;  1ZZK A;  2CTL A;  2Z0S A;  2CTM A;  3V69 A;  2PY9 A;  1J5K A;  1K1G A;  2JEA I;  1X4N A;  1KHM A;  1J4W A;  2OPV A;  3U1K A;  2CTK A;  2AXY A;  2ANN A;  2BA0 A;  2HH2 A;  4QMF B; 
#chains in the Genus database with same CATH topology
 1XRH A;  2PQU A;  4DV0 H;  4KHP H;  3RF2 A;  2CWF A;  4YHH H;  3KDK A;  1ZZI A;  1WVN A;  1X4M A;  2CPQ A;  3UOE A;  2LTL A;  1N33 H;  3J81 W;  3AEV B;  1ODH A;  2D9I A;  4JI2 H;  4BA1 I;  4OCH A;  1N36 H;  4DR1 H;  3QD7 X;  2QND A;  2E5L H;  4LFB H;  4NXM H;  5JEA G;  3VKE A;  2UU9 H;  2VQF H;  2G8Y A;  3EZJ A;  1UG8 A;  2E3U A;  2PT7 G;  4LF4 H;  4LF6 H;  1DTJ A;  2PY9 A;  4K0K H;  2UXD H;  4DV7 H;  1K1G A;  3FAU A;  1Z2I A;  3GKU A;  1X4N A;  4JI3 H;  4JV5 H;  2AXY A;  3I0P A;  2BA0 A;  2HH2 A;  4DV2 H;  4B3R H;  4QMF B;  1X9Z A;  2JA9 A;  2YQR A;  4GKK H;  4EC5 A;  4JYA H;  3J7A K;  3T1Y H;  2JVZ A;  4LF9 H;  4YY3 H;  5K36 G;  4DR3 H;  1WE8 A;  4DR7 H;  1MSZ A;  1XNR H;  1PQX A;  4LF5 H;  4DR4 H;  4DV4 H;  2CTJ A;  1N34 H;  1IBK H;  4JI8 H;  4JI4 H;  4DV5 H;  2ZM6 H;  5IT9 W;  2JE6 I;  2UUC H;  1EC6 A;  4NZT M;  4WAL A;  5BR8 H;  3NCV A;  5DT9 A;  2CWH A;  4LF8 H;  1DT4 A;  5A2Q W;  4JVY A;  1AN7 A;  4X62 H;  1IBM H;  4AQY H;  4OX9 H;  2FPH X;  4LFA H;  3L7Z C;  2MJH A;  4BA2 I;  2CTL A;  3V69 A;  3OTO H;  4DV6 H;  1HR0 H;  4JI1 H;  1HNX H;  3KDG A;  1J5E H;  1NXU A;  2LF0 A;  4JI5 H;  2Y3M A;  1I94 H;  2FFM A;  2UUA H;  2K1H A;  2P2R A;  4X66 H;  1IBL H;  1FKA H;  1S20 A;  2LRR A;  4AIM A;  3OET A;  4B3M H;  2LTM A;  2JZX A;  4PDB A;  5LMN H;  4NZR M;  3JAM W;  2BL5 A;  2NN6 G;  4LIJ A;  4NBQ A;  4LFC H;  4AM3 A;  4JVH A;  2CTE A;  4B3S H;  4B8T A;  2M8W A;  3GR5 A;  1ZTG A;  1HNW H;  1V8C A;  1F0X A;  4WAN A;  3GAB A;  4E9J A;  4JI6 H;  4NXN H;  4DV3 H;  1XMO H;  2M6Q A;  1ZZK A;  2CTM A;  1J5K A;  2JEA I;  2O4C A;  2VKC A;  2A1S A;  1SEI A;  1KHM A;  4FJU A;  4FJS A;  4H8A A;  2OPV A;  3U1K A;  3OSS D;  2ANN A;  4DV1 H;  2UXB H;  1WHR A;  4B8C D;  1X0A A;  5IWA H;  2UUB H;  2CPM A;  4DR2 H;  4GKJ H;  4DUY H;  4DUZ H;  2DGR A;  1ZZJ A;  1S03 G;  4IFD G;  2JEB I;  2ZQE A;  1XMQ H;  4DR6 H;  1I6U A;  1XNQ H;  3SB1 A;  1FJG H;  1VIH A;  2CTF A;  2HH3 A;  1N32 H;  2FMR A;  4OD6 A;  4JI0 H;  4OO1 G;  2OPU A;  4B3T H;  4X65 H;  5C0X G;  4LF7 H;  1VIG A;  5FLX W;  5LMU H;  2ANR A;  2F4V H;  2UXC H;  3T1H H;  1TUA A;  2Z0S A;  2HHH H;  2VQE H;  4X64 H;  4JI7 H;  1V9N A;  5LL6 b;  1HNZ H;  1WTJ A;  3J80 W;  4G08 A;  1J4W A;  4DR5 H;  2CTK A;  2X06 A;  1VBI A; 
#chains in the Genus database with same CATH homology
 2JA9 A;  2YQR A;  2PQU A;  2JVZ A;  2P2R A;  4AIM A;  5K36 G;  1WE8 A;  2DGR A;  2JZX A;  1ZZJ A;  1ZZI A;  1WVN A;  1X4M A;  4IFD G;  2JEB I;  2CTJ A;  2CPQ A;  4BA2 I;  2JE6 I;  1EC6 A;  4WAL A;  3AEV B;  1VIH A;  2CTF A;  2BL5 A;  2HH3 A;  2NN6 G;  2FMR A;  4LIJ A;  4NBQ A;  4BA1 I;  4AM3 A;  4OO1 G;  4JVH A;  2CTE A;  2OPU A;  1DT4 A;  4B8T A;  2QND A;  5C0X G;  4JVY A;  1ZTG A;  1VIG A;  5JEA G;  3VKE A;  4WAN A;  2ANR A;  2E3U A;  3L7Z C;  2MJH A;  1TUA A;  1DTJ A;  1ZZK A;  2CTL A;  2Z0S A;  2CTM A;  3V69 A;  2PY9 A;  1J5K A;  1K1G A;  2JEA I;  1X4N A;  1KHM A;  1J4W A;  2OPV A;  3U1K A;  2CTK A;  2AXY A;  2ANN A;  2BA0 A;  2HH2 A;  4QMF B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...