2QNDA

Crystal structure of the kh1-kh2 domains from human fragile x mental retardation protein
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
141
structure length
141
Chain Sequence
FHEQFIVREDLMGLAIGTHGANIQQARKVPGVTAIDLDEDTCTFHIYGEDQDAVKKARSFLEFAEDVIQVPRNLVGKVIGKNGKLIQEIVDKSGVVRVRIEAENEKNVPQEEGMVPFVFVGTKDSIANATVLLDYHLNYLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords FMR1 protein
publication title Fragile X mental retardation syndrome: structure of the KH1-KH2 domains of fragile X mental retardation protein.
pubmed doi rcsb
source organism Homo sapiens
total genus 44
structure length 141
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 2qndA02
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 2qndA01
2HH3A 2Z0SA 2NN6G 5K36G 2BA0A 3U1KA 1VIHA 1J4WA 3L7ZC 1K1GA 4BA2I 4AM3A 2JA9A 2CTJA 2PQUA 2CPQA 2ANNA 1WVNA 4LIJA 4QMFB 2JZXA 5C0XG 2CTKA 4WANA 2FMRA 4BA1I 3VKEA 5JEAG 4NBQA 2CTMA 1TUAA 4JVHA 1WE8A 2JEAI 1ZZKA 2BL5A 2E3UA 1DTJA 1ZTGA 4IFDG 1X4MA 1J5KA 2QNDA 3AEVB 2CTEA 2AXYA 1X4NA 2JE6I 2OPVA 4B8TA 2MJHA 3V69A 4AIMA 1KHMA 1DT4A 2OPUA 2YQRA 4OO1G 2JVZA 1ZZIA 4JVYA 2CTLA 2JEBI 2PY9A 2DGRA 1ZZJA 2P2RA 2HH2A 1VIGA 2ANRA 2CTFA 4WALA 1EC6A
chains in the Genus database with same CATH superfamily
4LF9H 1UG8A 4B3RH 1FJGH 4AM3A 1VIHA 2Y3MA 3L7ZC 4AQYH 2UUCH 4BA2I 4DR7H 5LL6b 2JA9A 2CTJA 4DV3H 4LFAH 1WVNA 3FAUA 1XNQH 1VBIA 3I0PA 4X62H 5C0XG 4YHHH 4JI6H 2FMRA 2G8YA 4DV7H 4NBQA 4NZTM 4JVHA 2LF0A 5A2QW 4NXNH 1HNWH 4JI8H 2QNDA 5LMNH 4B8CD 1F0XA 4NZRM 1DT4A 2OPUA 2YQRA 1XMOH 1NXUA 5BR8H 3EZJA 4X64H 4JI7H 4JVYA 2CTLA 2PY9A 2DGRA 2UU9H 4DR1H 2CTFA 2ZQEA 4DV0H 2HHHH 2PT7G 4B3MH 3NCVA 1HNZH 4DR3H 4DR6H 2BA0A 5FLXW 4LF8H 3OSSD 1N32H 2ANNA 4OX9H 4LIJA 2D9IA 4JYAH 4DUYH 1WHRA 2E5LH 1I6UA 4WANA 3VKEA 3GABA 4BA1I 3J81W 4YY3H 1V9NA 2CTMA 1WE8A 1S03G 2LRRA 2E3UA 4JI0H 4IFDG 5IWAH 1XNRH 2UXCH 4KHPH 3QD7X 4X66H 3AEVB 4OD6A 2K1HA 4B8TA 4AIMA 4OO1G 1IBMH 2JVZA 1ZZIA 2JEBI 2FPHX 4JI4H 3GR5A 2P2RA 4EC5A 4JI1H 1Z2IA 4LF6H 2F4VH 2ANRA 2VQFH 4H8AA 4B3SH 1WTJA 1MSZA 2A1SA 3GKUA 4NXMH 3OTOH 1EC6A 2CWFA 1XMQH 4LFBH 3U1KA 5IT9W 4JI2H 4GKJH 2CPQA 4DUZH 3T1YH 2FFMA 2JZXA 4QMFB 1AN7A 2CTKA 4JI5H 5JEAG 2UXBH 4PDBA 2BL5A 3JAMW 1DTJA 2VQEH 4G08A 1X4MA 2AXYA 4B3TH 5DT9A 2OPVA 4DV2H 1PQXA 2MJHA 3V69A 3J7AK 4OCHA 1N36H 1KHMA 1FKAH 4JI3H 4GKKH 1S20A 4DV5H 1ODHA 2HH2A 1VIGA 4LFCH 3RF2A 4JV5H 2Z0SA 2CPMA 2LTLA 1J4WA 1IBKH 2HH3A 4DV4H 2NN6G 5K36G 1N34H 2O4CA 1SEIA 1K1GA 1X9ZA 1N33H 2PQUA 4DR5H 4LF5H 3KDKA 1J5EH 1V8CA 4FJSA 3UOEA 1XRHA 2LTMA 4DR2H 2M8WA 4LF7H 4K0KH 1X0AA 2UUAH 1TUAA 2JEAI 1ZZKA 3T1HH 1HR0H 1ZTGA 2CWHA 1J5KA 1IBLH 2CTEA 2VKCA 1HNXH 2UXDH 1X4NA 3KDGA 4DV1H 2JE6I 4FJUA 4LF4H 1I94H 4E9JA 4DV6H 4DR4H 4X65H 5LMUH 2M6QA 1ZZJA 2ZM6H 3J80W 2X06A 3SB1A 4WALA 3OETA 2UUBH
chains in the Genus database with same CATH topology
2HH3A 2Z0SA 2NN6G 5K36G 2BA0A 3U1KA 1VIHA 1J4WA 3L7ZC 1K1GA 4BA2I 4AM3A 2JA9A 2CTJA 2PQUA 2CPQA 2ANNA 1WVNA 4LIJA 4QMFB 2JZXA 5C0XG 2CTKA 4WANA 2FMRA 4BA1I 3VKEA 5JEAG 4NBQA 2CTMA 1TUAA 4JVHA 1WE8A 2JEAI 1ZZKA 2BL5A 2E3UA 1DTJA 1ZTGA 4IFDG 1X4MA 1J5KA 2QNDA 3AEVB 2CTEA 2AXYA 1X4NA 2JE6I 2OPVA 4B8TA 2MJHA 3V69A 4AIMA 1KHMA 1DT4A 2OPUA 2YQRA 4OO1G 2JVZA 1ZZIA 4JVYA 2CTLA 2JEBI 2PY9A 2DGRA 1ZZJA 2P2RA 2HH2A 1VIGA 2ANRA 2CTFA 4WALA 1EC6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HH3 A;  2Z0S A;  2NN6 G;  5K36 G;  2BA0 A;  3U1K A;  1VIH A;  1J4W A;  3L7Z C;  1K1G A;  4BA2 I;  4AM3 A;  2JA9 A;  2CTJ A;  2PQU A;  2CPQ A;  2ANN A;  1WVN A;  4LIJ A;  4QMF B;  2JZX A;  5C0X G;  2CTK A;  4WAN A;  2FMR A;  4BA1 I;  3VKE A;  5JEA G;  4NBQ A;  2CTM A;  1TUA A;  4JVH A;  1WE8 A;  2JEA I;  1ZZK A;  2BL5 A;  2E3U A;  1DTJ A;  1ZTG A;  4IFD G;  1X4M A;  1J5K A;  2QND A;  3AEV B;  2CTE A;  2AXY A;  1X4N A;  2JE6 I;  2OPV A;  4B8T A;  2MJH A;  3V69 A;  4AIM A;  1KHM A;  1DT4 A;  2OPU A;  2YQR A;  4OO1 G;  2JVZ A;  1ZZI A;  4JVY A;  2CTL A;  2JEB I;  2PY9 A;  2DGR A;  1ZZJ A;  2P2R A;  2HH2 A;  1VIG A;  2ANR A;  2CTF A;  4WAL A;  1EC6 A; 
#chains in the Genus database with same CATH topology
 4LF9 H;  1UG8 A;  4B3R H;  1FJG H;  4AM3 A;  1VIH A;  2Y3M A;  3L7Z C;  4AQY H;  2UUC H;  4BA2 I;  4DR7 H;  5LL6 b;  2JA9 A;  2CTJ A;  4DV3 H;  4LFA H;  1WVN A;  3FAU A;  1XNQ H;  1VBI A;  3I0P A;  4X62 H;  5C0X G;  4YHH H;  4JI6 H;  2FMR A;  2G8Y A;  4DV7 H;  4NBQ A;  4NZT M;  4JVH A;  2LF0 A;  5A2Q W;  4NXN H;  1HNW H;  4JI8 H;  2QND A;  5LMN H;  4B8C D;  1F0X A;  4NZR M;  1DT4 A;  2OPU A;  2YQR A;  1XMO H;  1NXU A;  5BR8 H;  3EZJ A;  4X64 H;  4JI7 H;  4JVY A;  2CTL A;  2PY9 A;  2DGR A;  2UU9 H;  4DR1 H;  2CTF A;  2ZQE A;  4DV0 H;  2HHH H;  2PT7 G;  4B3M H;  3NCV A;  1HNZ H;  4DR3 H;  4DR6 H;  2BA0 A;  5FLX W;  4LF8 H;  3OSS D;  1N32 H;  2ANN A;  4OX9 H;  4LIJ A;  2D9I A;  4JYA H;  4DUY H;  1WHR A;  2E5L H;  1I6U A;  4WAN A;  3VKE A;  3GAB A;  4BA1 I;  3J81 W;  4YY3 H;  1V9N A;  2CTM A;  1WE8 A;  1S03 G;  2LRR A;  2E3U A;  4JI0 H;  4IFD G;  5IWA H;  1XNR H;  2UXC H;  4KHP H;  3QD7 X;  4X66 H;  3AEV B;  4OD6 A;  2K1H A;  4B8T A;  4AIM A;  4OO1 G;  1IBM H;  2JVZ A;  1ZZI A;  2JEB I;  2FPH X;  4JI4 H;  3GR5 A;  2P2R A;  4EC5 A;  4JI1 H;  1Z2I A;  4LF6 H;  2F4V H;  2ANR A;  2VQF H;  4H8A A;  4B3S H;  1WTJ A;  1MSZ A;  2A1S A;  3GKU A;  4NXM H;  3OTO H;  1EC6 A;  2CWF A;  1XMQ H;  4LFB H;  3U1K A;  5IT9 W;  4JI2 H;  4GKJ H;  2CPQ A;  4DUZ H;  3T1Y H;  2FFM A;  2JZX A;  4QMF B;  1AN7 A;  2CTK A;  4JI5 H;  5JEA G;  2UXB H;  4PDB A;  2BL5 A;  3JAM W;  1DTJ A;  2VQE H;  4G08 A;  1X4M A;  2AXY A;  4B3T H;  5DT9 A;  2OPV A;  4DV2 H;  1PQX A;  2MJH A;  3V69 A;  3J7A K;  4OCH A;  1N36 H;  1KHM A;  1FKA H;  4JI3 H;  4GKK H;  1S20 A;  4DV5 H;  1ODH A;  2HH2 A;  1VIG A;  4LFC H;  3RF2 A;  4JV5 H;  2Z0S A;  2CPM A;  2LTL A;  1J4W A;  1IBK H;  2HH3 A;  4DV4 H;  2NN6 G;  5K36 G;  1N34 H;  2O4C A;  1SEI A;  1K1G A;  1X9Z A;  1N33 H;  2PQU A;  4DR5 H;  4LF5 H;  3KDK A;  1J5E H;  1V8C A;  4FJS A;  3UOE A;  1XRH A;  2LTM A;  4DR2 H;  2M8W A;  4LF7 H;  4K0K H;  1X0A A;  2UUA H;  1TUA A;  2JEA I;  1ZZK A;  3T1H H;  1HR0 H;  1ZTG A;  2CWH A;  1J5K A;  1IBL H;  2CTE A;  2VKC A;  1HNX H;  2UXD H;  1X4N A;  3KDG A;  4DV1 H;  2JE6 I;  4FJU A;  4LF4 H;  1I94 H;  4E9J A;  4DV6 H;  4DR4 H;  4X65 H;  5LMU H;  2M6Q A;  1ZZJ A;  2ZM6 H;  3J80 W;  2X06 A;  3SB1 A;  4WAL A;  3OET A;  2UUB H; 
#chains in the Genus database with same CATH homology
 2HH3 A;  2Z0S A;  2NN6 G;  5K36 G;  2BA0 A;  3U1K A;  1VIH A;  1J4W A;  3L7Z C;  1K1G A;  4BA2 I;  4AM3 A;  2JA9 A;  2CTJ A;  2PQU A;  2CPQ A;  2ANN A;  1WVN A;  4LIJ A;  4QMF B;  2JZX A;  5C0X G;  2CTK A;  4WAN A;  2FMR A;  4BA1 I;  3VKE A;  5JEA G;  4NBQ A;  2CTM A;  1TUA A;  4JVH A;  1WE8 A;  2JEA I;  1ZZK A;  2BL5 A;  2E3U A;  1DTJ A;  1ZTG A;  4IFD G;  1X4M A;  1J5K A;  2QND A;  3AEV B;  2CTE A;  2AXY A;  1X4N A;  2JE6 I;  2OPV A;  4B8T A;  2MJH A;  3V69 A;  4AIM A;  1KHM A;  1DT4 A;  2OPU A;  2YQR A;  4OO1 G;  2JVZ A;  1ZZI A;  4JVY A;  2CTL A;  2JEB I;  2PY9 A;  2DGR A;  1ZZJ A;  2P2R A;  2HH2 A;  1VIG A;  2ANR A;  2CTF A;  4WAL A;  1EC6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...