2G8YA

The structure of a putative malate/lactate dehydrogenase from e. coli.
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
359
structure length
359
Chain Sequence
SGHRFDAQTLHSFIQAVFRQMGSEEQEAKLVADHLIAANLAGHDSHGIGMFPSYVRSWSQGHLQINHHAKTVKEAGAAVTLDGDRAFGQVAAHEAMALGIEKAHQHGIAAVALHNSHHIGRIGYWAEQCAAAGFVSIHFVSVVGIPMVAPFHGRDSRFGTNPFCVVFPRKDNFPLLLDYATSAIAFGKTRVAWHKGVPVPPGCLIDVNGVPTTNPAVMQESPLGSLLTFAEHKGYALAAMCEILGGALSGGKTTHQETLQTSPDAILNCMTTIIINPELFGAPDCNAQTEAFAEWVKASPHDDDKPILLPGEWEVNTRRERQKQGIPLDAGSWQAICDAARQIGMPEETLQAFCQQLAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Malate/L-lactate dehydrogenases
publication title The structure of a putative malate/lactate dehydrogenase from E. coli.
rcsb
source organism Escherichia coli
total genus 113
structure length 359
sequence length 359
chains with identical sequence B
ec nomenclature ec 1.1.1.237: Hydroxyphenylpyruvate reductase.
pdb deposition date 2006-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02615 Ldh_2 Malate/L-lactate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1530.10 Mainly Alpha Orthogonal Bundle Hypothetical Oxidoreductase Yiak; Chain: A, domain 1 Hypothetical Oxidoreductase Yiak; Chain: A, domain 1 2g8yA01
1.20.5.460 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2g8yA03
3.30.1370.60 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Hypothetical oxidoreductase yiak; domain 2 2g8yA02
2G8YA 1XRHA 1FDOA 1OMIA 2X06A 1ZMEC 1VBIA 4H8AA 2CWHA 2P10A 3IN6A 3EWKA 4FJSA 1WTJA 1WMKA 1S20A 1AJYA 3O6QA 3UOEA 1NXUA 2CWFA 3H25A 1FDIA 4FJUA 1V9NA 3I0PA 1X0AA 1Z2IA
chains in the Genus database with same CATH superfamily
1L0NJ 1VQ8P 2KLUA 4RKUJ 3KDKA 3MIWA 2PT7G 3QH9A 1RY3A 2P58A 1QLED 4DR4H 2H7HA 1SQXG 1ZXGA 4L75A 1X9VA 3K5BA 1J1EC 1DEEG 3U1KA 4D6TD 3OA7A 5IWAH 5DJTB 1CI6A 2Q6QA 1KTMA 1NU1J 2X06A 1T3UA 2LXBA 3TGUG 2PGDA 2GUVA 1WTJA 5KLVK 4K0KH 4ASVA 1S20A 2YIUC 3L75E 1LT9C 1ZZIA 1KHMA 1WT6A 4YXWH 5AW0B 2OYHC 1OVRA 1N32H 1G1IA 1RH5B 4JYBA 3CMEP 2ZFCA 5CJ0A 3CX5I 1GDTA 1IFJA 1DEBA 3L73G 3M9HA 2FBWC 2VQFH 3V6IA 1X22A 1RE3A 2LTMA 2HR3A 1V8CA 1J1EB 1OXZA 2A1SA 1KORA 1VIGA 1SQPE 5IT9W 1NAFA 2UWJE 3AEAC 1BCCG 1YITP 1AA0A 3H1LG 4OWFA 2YQRA 2W6AA 3H1HG 5AVXB 2M6QA 2YIUB 1LT9B 2E75D 4B3RH 2OYHB 2FYUD 1MV8A 1VBIA 2QA4P 1DT4A 1HNZH 1KYOI 5AVQB 1KB9I 3EWKA 1ZZJA 4JI6H 3VOPA 1SQQJ 1NVOA 2UUCH 3GMAA 4NPEA 4TT3H 1OW7A 2XZRA 2YXQB 3PH0A 1SQXK 3USSA 1LTJB 4LFAH 1HVVA 3H32B 1DIPA 1HWTC 3CWBD 2WT7A 3VTPC 1BE3J 1JTHB 2AXTE 4H0LD 1HF9A 4X64H 2K37A 1ZRTD 4DV6H 2G3AA 2F4VH 2K9YA 5AVRB 2BL5A 3HRNA 5AVYB 1E5WA 4DR7H 2SPZA 2GA1A 4GKKH 1G2CA 1GL2A 3FX0A 2HG5D 5KLVE 3MHVA 3GLMA 4Z1MH 1AN7A 3V2QA 3CCUP 1S1CX 2YKOA 4AUWA 2O4CA 3M06A 1DD4A 1JNMA 3CXHD 4JI5H 5AVVB 2WSFJ 3V4QA 3EFGA 3E1IA 5KAFE 1ZMEC 4LF8H 2ZQEA 1URQD 5AW4B 2JKVA 3S9OA 1EC6A 1HBWA 1HJBA 3VMXA 5CCGD 1M1JA 1USDA 5CCHD 1GU4A 2D2CD 2FFMA 1BGYE 2Y0DA 3CX5E 3II6A 3KZIH 2HYNA 3WUVA 2M3BA 2HH2A 3H1JD 3O8ZA 1LGHB 3W68A 1M8OB 2AXYA 4JVHA 4C7RA 3D6ZA 5TISH 1FAVA 1X4NA 1RE3C 2ZVNB 1S4XA 1SFCD 1EDLA 4PD4D 1SQBG 1LTSC 4I7ZC 2OTJP 5KLIC 2E74C 1LTBC 3R4YA 3H1IE 1CI6B 1PP9E 3PRJA 4Y99C 4C7NA 2Y9ZA 2UXDH 1QX8A 3CXHH 2Y9YA 3RGUA 1QVFO 3T1HH 1SQXE 2N1TA 2LRRA 1XMOH 2KSEA 1KYOE 1KB9E 1R5SA 1L0NG 1YJWP 2MJHA 1WE8A 1U57A 3TGUE 4I1LA 3A7OA 4HH2A 3L37A 1S2EA 3WU2E 3P8CD 1PGPA 1GW4A 1YBKA 1NTZJ 5AVTB 2FYNC 2ITAA 4EIJA 1VQOP 4I7ZB 2G8YA 5KLIB 2OTLP 2NPSA 3V5BA 2E74B 2FXOA 2WPQA 1NU1G 1UG8A 4PD4H 4B3SH 2C0WA 3AE7C 4NZRM 1NTKJ 4Y99B 1FOSE 1NJIQ 3L73E 2XNDH 1NKNA 1JY3O 1FZEA 2RMZA 4IL6X 1S72P 2KZJA 1K9MQ 2O3JA 1L0LD 3L70J 3Q5SA 1GL2C 1MSZA 2PY9A 1NH4A 1CSBA 2C0XA 3SWFA 3MGNA 4E9JA 2ZYAA 4GOFA 1ZR2A 3IF4A 1T3JA 2H8PD 1JMMA 3SWKA 3MUDA 1VQ4P 3H1HE 1G1JA 4U3FD 1HR0H 4IL6E 3I0PA 4PDBA 1PZQA 2FYNB 5KAIE 1SQBK 2WPSA 1Y47A 3VMAA 4WB4A 2VKCA 2RKLA 4KT0J 5KLVD 1M1JC 2WT7B 5GTIH 3UOEA 3RK3C 1ZOYC 5KKZC 2CTKA 5AW3B 2Q3EA 1X0AA 1GMJA 4KHPH 1G2CB 3F5HA 2JP3A 1BCCJ 4DV2H 1K04A 1L0NK 3JCUE 2C9NY 1AJYA 2XDJA 3SWYA 1SQQG 1KQLA 2BCCD 2WVRA 1J4WA 4JPZB 3CX5D 2H43A 3L74J 1HUCA 3G71P 4DR2H 3CCSP 1Q86Q 2AXTH 3L72J 3CCEP 3AE9C 1YIJP 5CJ4A 4BXLA 1EZVG 2Y0EA 2YMKA 1OIPA 2OPUA 1NU1K 1M1JB 1BE3G 3L71D 2W83C 1FBMA 2N1TC 2Q7CA 1VQMP 3RK3B 5KKZB 2OGUA 3H1ID 1NGMB 1PP9D 3M91A 4QMFB 1SQVD 4DJGA 2Z4EA 2IZ1A 2A45H 2E5LH 5H2FH 1SQXD 2POHA 3I56P 1PPJG 1IBMH 4LFCH 3AE8C 1KYOD 1LTGC 2NPSC 2YKQA 2HFED 1EDJA 2XU6A 4DT0A 3QD7X 1HH0A 3TGUD 3E7KA 1YTZI 3CX5H 3SFEC 3CD6P 4OGQB 2I8DA 2H89C 1GD2E 1J2JB 1OW8A 5CBOA 1SQBE 3SSUA 2OPVA 1JCCA 5APXA 1LTJA 2E42A 2K9JB 3KPEA 3CCRP 1AFOA 3MUDC 1RF1A 3A5TA 2LTLA 2ANNA 2LXCB 3ITKA 1EZVI 5CMZA 3LW5J 2CTEA 4OVNF 1WHRA 2NPSB 1OVUA 1P84E 4EDFA 4DR1H 1VF5C 1L0NE 4WWIA 2JR8A 3JC22 1KYOH 4M3LA 3TDKA 3H1HD 1NKZB 1VDFA 3BCCD 3CCLP 1N7LA 3RK3E 4B86A 5AW6B 2KI7B 4K35A 4AYCA 4DUYH 3I55P 2NZ2A 3PLNA 1SS1A 3AEDC 4LGDE 3H25A 3Q1MA 1GU5A 2HODA 4HKZH 3T97A 1NTZG 1N73A 1J1DC 3B5NA 3LIEA 3RF2A 4UB6H 1R8EA 4LF6H 2OYIA 1XNQH 3PP5A 3KYQA 2O1KA 3M9QA 1UIXA 2JJLA 1VF5B 4Y28J 2ZYGA 1FC2C 2YMYA 4LLHA 1NTKG 1S9KE 2JWDA 4N3YB 4DV7H 5C39A 4DV1H 1PIXA 1KD1Q 1JY3N 3L70G 1SLQA 2E74D 3H1KD 4IL6H 4BWNA 2Y0CA 1MFTA 1RE4A 5KAIH 3GW6A 3C9IA 3J7AK 4NXMH 4I6MC 1PV3A 4RESB 1Q2NA 3VMYA 1HGZA 1KQFB 2IDBA 1NYHA 1J1DB 3TK1A 2IX7C 4OCHA 1ODHA 3BRVB 1IO4A 1OW6A 1F0XA 2P10A 4HJGH 1PGOA 1K1GA 3AEVB 3D6YA 1NTMJ 1Q7YQ 2JA9A 1SQQE 5BR8H 1U7JA 4C46A 5APSA 1HTLC 1H0TA 1LTJC 3JCUH 3JSVC 4PV1B 2XKMA 5FLXW 2FKWB 2OQQA 1EZVE 3AE6C 2PAJA 3L7ZC 1RF1C 1LP1A 1AQ5A 5GTHH 1BE3E 2J59M 3H1JJ 3L74G 2I1KA 2UXCH 1NTZK 2KNCA 3L72G 2IFMA 2KP8A 2XNXA 2CTLA 1ZP0C 3GG2A 1GL2D 3NXSA 3G4SP 3OJAB 3Q3DA 2XV5A 1DD3A 1VQKP 5LMNH 5AVSB 1JY3P 1NTKK 1YQ4C 4R4LA 3AEEC 1PPJE 2R44A 3SFDC 1P84D 1FJPA 4AQYH 1FOSF 4EOTA 1L0ND 4QMAA 1JO5A 4JQ0D 4HB1A 3HE4A 1GZLA 4JYCA 1RF1B 1FJGH 1N73C 3B5NC 5AW1B 3RK3D 1EXJA 2WSEH 3EZJA 2AEMA 3CPWO 2OYIC 4YTPC 5B66E 1J5KA 3OAKA 2WWWA 4W7YA 4DV4H 3AEBC 1HGVA 2YKPA 2Q5UA 1OZHA 4JI8H 1W5CE 4AIMA 2PQUA 3BRTB 3Q5PA 4B3MH 1A02J 3CMAP 1JM0A 3P8MC 1RE4C 2O01H 2KIKA 2P7JA 2MJZA 2HODB 4FJUA 1P84H 4XA4A 1L0LJ 1BDCA 3T97B 1N73B 2N1TD 5CHXA 3U1AA 3B5NB 1XRHA 1FDMA 2OYIB 5B5EH 1PQXA 2CPSA 1JY2O 3D70A 3V4WA 3WUUA 4U3FJ 3P7KA 2Q1KA 1LNQA 4L74A 3L75D 4BA2I 3SB1A 4JBZA 4NPDA 1NTZE 2P67A 4JI3H 5K5GB 2NPSD 3CCVP 2KSJA 4FJSA 2ZAEB 2E76C 2R5DA 3AEFC 4AM3A 2WQYC 2CTMA 1NTKE 2QJPC 1SQQD 2JWAA 2QJYC 1V9NA 1GK4A 4GIFA 4JV5H 1SQPD 3AEGC 2NN6G 4WY4D 3P32A 2K9JA 5BU5A 2IZ0A 2BCCJ 1JOCA 3L70E 4OD6A 2FY8A 1Q82Q 1EZVD 1EC5A 4U7JA 3HE5A 1IFNA 1BE3D 3ZDMA 1KILA 1FZCA 1KFNA 1UIIA 3TNUA 1H0TB 2FPHX 2HPCA 5E79E 5APTA 3NMDA 3L71J 2BA0A 4X62H 1VF5D 2E76B 2JDIH 3L4FA 1ZR4A 3CCJP 1I6UA 1LP1B 2ZM6H 3FAUA 4JI4H 1PP9J 2QJPB 4YXDC 2QJYB 1SQVJ 5KTBA 2KNCB 2W8ZA 2K3RA 1M57D 1BSHA 3VN0A 1BCCE 1XMQH 1NTMG 3H1LE 2D9IA 1N7SA 4LF7H 2FMRA 3BATA 2JZXA 4W7ZA 4RJTA 2W6JH 3L74E 4N78E 4GKJH 3L72E 4DV0H 3KHUA 3HE4B 2QEXP 1EDKA 3TSIA 4DOJA 3H1JG 1YQ3C 2DGRA 4TLFA 1N8RQ 3M9BA 2OTKE 2BASA 1NOHA 4B8TA 2M0BA 1LTIC 4H0LC 1IZNB 1L4AA 1GTWA 5L8RJ 4KHXA 2YO2A 2PRRA 2WSSH 1IFIA 2JE6I 1XNRH 3B71A 2KXPB 5TJHA 3M0AA 1BGYD 3C8VA 3FXEA 2V7QH 1GK6A 3Q2YA 3IFMA 3G9RA 2KB7P 2CTJA 2N9BA 1BDDA 3L35A 3BCCJ 4OGQC 1S03G 1DX7A 1W2EA 1NAYA 5B66H 1QL2A 5C0XG 1T2KC 3ABVC 1JMBA 1KV4A 1NTZD 1ZV8A 4LFBH 4K3AA 1Z56A 4H0LB 3HUSB 2W6BA 1K8AQ 1JEKA 3W67A 1FZCC 1KILC 5KAFH 1Q81Q 4JF7A 1NTMK 4NPFX 3J80W 4JI2H 4ZKUA 1FDOA 1KB9D 1R5LA 2VRSA 2CWHA 4DR5H 3BASA 4KJMA 3NFQA 3EQ2A 3TF5A 5BVZA 2O01N 4A7PA 4D6TJ 5AW9B 2CPQA 5LMUH 4GKGA 5AW8B 1VQ9P 2GM4A 1MKMA 4UB8E 1L0LG 3A0BE 4PD4I 1IBKH 3H1KJ 4ZKPA 2J58A 1T8ZA 2ZXEB 1WVNA 1FZBA 1PGJA 1M56D 2IYPA 3L73D 4DCKA 3MZWB 3PJSK 4WANA 4U3FG 1N7SC 2QRXA 3RBXA 3HE5B 1BSNA 3IAOA 1JY2N 3RL0g 1FZCB 1KILB 2C9LY 1NWQA 3TNUB 2HPCB 3B5ND 1TUAA 3Q5RA 1N34H 3AECC 4LF4H 1BCCD 3H1LD 3V2PA 4HYTB 2A45G 1KB9H 2OARA 2CPBA 3RL0C 5AVWB 1YHQP 5K36G 3JAMW 2M8WA 3GABA 4EYYQ 2WSEJ 1CZQA 3D71A 2A06G 1FU1A 1YJNP 1L4AC 4CPGA 1HJ0A 3KZIE 1EQ7A 3WU2H 4EC5A 5APQA 1N36H 2Q3IA 3L72D 1NU1E 2BCCG 2FFDA 3I5CA 1ZRTE 5LL6b 5JEAG 3CCQP 5APUA 1N7SB 2FYUJ 1WRGA 1LJ2A 1AQTA 2BEZF 5KJ7A 2WSCH 3FWLA 1N86A 1IC2A 4ZMDA 4JVYA 1K05A 2PP6A 3L71G 3CC2P 4H13C 1L2PA 1VIHA 3FWNA 2Z5HA 4DR3H 1NTME 2W27A 3RL0B 1PP9G 5APWA 4PV1C 1SQVG 3GF7A 3CWBJ 4X65H 1AVOA 1L0LK 2QM7A 1JY2P 2QVAA 1L4AB 1X9ZA 2CTFA 2IBZG 3GHGA 2L91A 4WALA 2WZ7A 1QL1A 2E76D 1VQPP 1K73Q 1VPCA 4DUZH 1M90Q 3T1YH 4GOEA 4JI7H 4NXNH 2QG4A 2V4HA 3H1JE 1KILE 3L36A 2QJKC 2A45I 1KN7A 1AVYA 5M1BA 2Z0SA 3HD7A 1M1KQ 2E43A 2YXRB 1ZLLA 4H13B 1Y9BA 4R4MA 2JEBI 4PD4E 2R3SA 2WMMA 4GODA 4LIJA 3S1KA 4L73A 4PJ0E 5CBNA 3GR5A 2CWFA 4GT1A 4OH8B 2B87A 2IYOA 1VQLP 1KQGB 5AW7B 3KXDA 4H44C 1SQBD 2KS1B 1OX3A 3CLQA 2YNYA 1PFIA 2QE7H 2QJKB 1AV1A 3OW2O 3L75J 2QM8A 1RF0A 2AXCA 1WMKA 3VKEA 1RQUA 1HNWH 3BCCG 2AEFA 3P8CE 1SEIA 1N33H 1KFMA 1XTGB 5GTIE 2IBZI 1IFDA 2KLVA 1S5LX 1QVGO 1EDIA 1KQSO 3AE4C 2K1AA 1JB0J 1SQVK 1S3JA 1GW3A 2FYZA 4WVZA 5A2QW 2FFDC 1IK7A 1SQPJ 2W90A 3LW5H 4H44B 3HTKA 1S5LE 1L0LE 2JEEA 1YI2P 2ZYDA 5KJ7C 3B4SA 5AVZB 1NU1D 1VQ5P 2BEQD 4UB8H 3A0BH 3V69A 3RK2C 4D6TG 2E5YA 4U3FE 3CC4P 2I1JA 4IOIH 4B3TH 2JEAI 1SVFA 5AW2B 3UIAA 2LKMA 2Y3MA 3H1KG 1X8YA 1I94H 2K1HA 4W80A 3VYIA 3GHGC 2KK7A 3A0HE 1OVVA 5APYA 3GF3A 2FFDB 2RN0A 2WPVB 1S9KD 1NTMD 4OGQD 2GUSA 4L76A 2M5AA 5H2FE 2V7QJ 1T2KD 3VP8A 2ZT9C 2A06E 3HD7C 3G6EP 1ZZKA 3HUSA 3N7NA 1NXUA 2M8RA 2BCCE 4RO0A 1XTCC 2K88A 1KC8Q 3RK2B 1X4MA 3VMZA 3H6PA 3CI9A 2IPPA 3PTZA 3IR9A 5KLVJ 1KILD 1LWUA 4H8AA 2R3CA 3IN6A 2JO1A 4LF5H 3MD0A 2E3UA 2CPMA 2MKVA 1VQ7P 2B9BA 3GHGB 3A3YB 3L71E 3U59A 3OSSD 4X66H 3R2PA 2QNDA 2WPRA 2FYUG 2P1JA 1URQA 3CC7P 2HHHH 3OTOH 1EXIA 4YY3H 1SQVE 5CCGA 2KUBA 2ZT9B 5CCHA 2JVZA 1RF0C 3HD7B 5AVUB 2L5GB 2QIWA 1BGYJ 2R32A 2IBZE 4OX9H 1IK9A 1JUNA 4MN4C 1N7SD 3PHLA 3KQGA 3RBZA 1VL2A 1RQVA 2KOGA 3CWBG 4BRYA 1SFCA 2FXPA 3LIDA 1SP4A 3OETA 1E79H 3O6QA 3U1CA 4DV5H 1USEA 2B87B 5DJUB 1YYCA 3H1IJ 1IJDB 3C1LA 1PPJD 2IFNA 3RL0D 1FJKA 1M7LA 1QEXA 2N9YB 4XFJA 4UB6E 1PGQA 1SQXJ 1L4AD 4IFFA 3AE1C 2E75C 1U7MA 3AE2C 3FXDA 1RHZB 1HNXH 4WY4A 3B8EB 2O1JA 4PJ0H 2AEJA 2P2UA 3J81W 5APVA 3TGUJ 5BU8B 4G08A 2HLOA 2E5TA 2PFXA 1X0TA 1FZFA 2UXBH 3AE5C 3BCCE 4H13D 3NCVA 3HTKB 1OMIA 2FYUK 1H88A 4AQRD 3L73J 4IFDG 2WSCJ 2WITA 3A2AA 1KZUB 4PV1D 1P84I 3KDPB 3HUSC 3L75G 4JI1H 2E75B 3E1RA 2WSFH 1LTAC 3CL3D 1FKAH 1Z2IA 3WUTA 1LWUC 3BVHA 2M3EA 2Q9IA 4OO1G 1ZTGA 1OWAA 1GL2B 1MUUA 2A06D 3H1LJ 3H1HJ 1IBLH 1QGKB 1S5LH 3F89A 3KDGA 1D7MA 2KYVA 1SQPG 3VP9A 4D6TE 1LT1A 4JYAH 3M0DA 1IFMA 1URQC 2M5AB 1MZ9A 5GTHE 1FE6A 3EFFK 4YPCA 3CCMP 1FZAA 3CXHI 5CCGC 3S4RA 4DZOA 5CCHC 2D2CC 3H1KE 4YHHH 3QWOC 2ZJSE 1H89A 4NZTM 1KMIZ 5DT9A 1Y8AA 3MP7B 1NTKD 4EI2A 1FZGA 2DW3A 2P2RA 2RH0A 2KS1A 2ZVOB 4ASWA 3A0HH 4H44D 1LTTC 1LWUB 4DV3H 1SFCC 1YJ9P 4LC1A 3V2NA 4XE5B 3L70D 1CW5A 1DTJA 2UUAH 2IBZD 4BA1I 1OFCX 1MFZA 4IFMA 2VQEH 3N4XA 1FDIA 1LT9A 1IFPA 1H8AA 2OYHA 4ZNCA 4B8CD 2Z5IA 5AW5B 1URQB 3WMM0 4NBQA 2B88A 1VQNP 3MTUE 4C7NB 1T6AA 2OYOA 1NO4A 2R5BA 2D2CB 2QSIA 3GKUA 4IFDK 1VQ6P 2ZXXA 2N1TB 1FS0E 4WY4C 1ZW0A 2WTYA 4LF9H 2FYUE 5KLVG 1W2BO 3H32A 1TU3F 2UU9H 4BRYB 1SFCB 1Q90D 5KJ7D 1JTHA 4GDOA 3O6QB 1NHLA 1DH3A 1N2DC 1SQQK 2UUBH 3RK2D 1X79B 1SQPK 3NTNA 2HH3A 1ZN5A 3L74D 3TYYA 2J5UA 4N78D 3V2RA 2LF0A 3CWBE 4I2LC 3AE3C 2CK3H 1A02F 4WBAA 2KZIA 2FXMA 5B5EE 1SQBJ 1PL5A 3G3ZA 4N6JA 2NRGA 1BGYG 5TISE 2LR2A 5E79H 4JI0H 4DR6H 4O9BA 2B89A 4WY4B 1JCDA 2YO3A 2H88C 2ZT9D 3FGAD 3HD7D 2O01J 2ANRA 1YTZT 5EFWB 3M0DC 1J5EH 3CXHE 3H1IG
chains in the Genus database with same CATH topology
1NGMB 1OMIA 1KILE 4PV1B 2QJKC 3Q5PA 1VBIA 3Q5SA 1EXIA 4RKUJ 3Q2YA 5M1BA 2WSCJ 3D6ZA 3G9RA 2ZT9B 4PV1D 3Q5RA 3EWKA 2D2CB 2NZ2A 2BEQD 2QSIA 2OQQA 3AECC 3AE6C 2QIWA 4OGQC 3AEDC 1VF5D 2E76B 4H13B 1Y9BA 3GMAA 3H25A 4R4MA 3Q1MA 4TT3H 1OW7A 2E75B 4FJUA 4I7ZC 3I0PA 4YXDC 3AE8C 5KLIC 3T97B 3ABVC 1Z2IA 2E74C 1XRHA 2WSEJ 3R4YA 1KTMA 3D71A 1R8EA 2X06A 1VL2A 1RQVA 1TU3F 1UIXA 1HJ0A 4KT0J 1DIPA 4H0LB 1VF5B 4Y28J 3D70A 1Q90D 1ZP0C 2FXPA 1WTJA 1S20A 3O6QA 4GDOA 3SFEC 3UOEA 4OGQB 2CWFA 4H0LD 1HF9A 1ZRTE 3GF3A 3Q3DA 1DD3A 2WPVB 2YIUC 1ZOYC 2G3AA 1KQGB 5KKZC 2H89C 2K9YA 4H44C 4OGQD 1YQ4C 1OW8A 1X0AA 4R4LA 1GMJA 3AEEC 2BEZF 1FDOA 3SFDC 2V7QJ 1PIXA 2CWHA 2JP3A 2ZT9C 2J5UA 2E74D 4XFJA 1U57A 2D2CC 3GLMA 4Z1MH 1K05A 4FJSA 2FBWC 3AE3C 2E76C 1K04A 1WMKA 4H13C 3AEFC 1AJYA 1RQUA 1NXUA 1S1CX 2WQYC 3AE1C 1KMIZ 2E75C 1PL5A 2QJPC 3AE2C 1PV3A 2QJYC 1V9NA 1DD4A 1MKMA 2FYNC 1KQFB 2IDBA 1KORA 1YQ3C 2WSFJ 3LW5J 4I7ZB 1EXJA 1NYHA 2G8YA 4PV1C 3AEGC 3GF7A 4H44D 1S5LX 2E74B 4YTPC 1ZMEC 4H8AA 1OW6A 2P10A 3AE9C 3IN6A 4H0LC 3AEAC 1VF5C 2JO1A 3AE4C 1JB0J 3S9OA 2H88C 5L8RJ 3AE7C 3D6YA 3AEBC 2YMKA 2MKVA 1IK7A 2ZT9D 3FGAD 4U7JA 2D2CD 3B71A 2O01J 3AE5C 1FDIA 3IAOA 2E76D 4H13D 3RL0g 4IL6X 2E75D 4H44B 3C8VA 3RK3E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G8Y A;  1XRH A;  1FDO A;  1OMI A;  2X06 A;  1ZME C;  1VBI A;  4H8A A;  2CWH A;  2P10 A;  3IN6 A;  3EWK A;  4FJS A;  1WTJ A;  1WMK A;  1S20 A;  1AJY A;  3O6Q A;  3UOE A;  1NXU A;  2CWF A;  3H25 A;  1FDI A;  4FJU A;  1V9N A;  3I0P A;  1X0A A;  1Z2I A; 
#chains in the Genus database with same CATH topology
 1L0N J;  1VQ8 P;  2KLU A;  4RKU J;  3KDK A;  3MIW A;  2PT7 G;  3QH9 A;  1RY3 A;  2P58 A;  1QLE D;  4DR4 H;  2H7H A;  1SQX G;  1ZXG A;  4L75 A;  1X9V A;  3K5B A;  1J1E C;  1DEE G;  3U1K A;  4D6T D;  3OA7 A;  5IWA H;  5DJT B;  1CI6 A;  2Q6Q A;  1KTM A;  1NU1 J;  2X06 A;  1T3U A;  2LXB A;  3TGU G;  2PGD A;  2GUV A;  1WTJ A;  5KLV K;  4K0K H;  4ASV A;  1S20 A;  2YIU C;  3L75 E;  1LT9 C;  1ZZI A;  1KHM A;  1WT6 A;  4YXW H;  5AW0 B;  2OYH C;  1OVR A;  1N32 H;  1G1I A;  1RH5 B;  4JYB A;  3CME P;  2ZFC A;  5CJ0 A;  3CX5 I;  1GDT A;  1IFJ A;  1DEB A;  3L73 G;  3M9H A;  2FBW C;  2VQF H;  3V6I A;  1X22 A;  1RE3 A;  2LTM A;  2HR3 A;  1V8C A;  1J1E B;  1OXZ A;  2A1S A;  1KOR A;  1VIG A;  1SQP E;  5IT9 W;  1NAF A;  2UWJ E;  3AEA C;  1BCC G;  1YIT P;  1AA0 A;  3H1L G;  4OWF A;  2YQR A;  2W6A A;  3H1H G;  5AVX B;  2M6Q A;  2YIU B;  1LT9 B;  2E75 D;  4B3R H;  2OYH B;  2FYU D;  1MV8 A;  1VBI A;  2QA4 P;  1DT4 A;  1HNZ H;  1KYO I;  5AVQ B;  1KB9 I;  3EWK A;  1ZZJ A;  4JI6 H;  3VOP A;  1SQQ J;  1NVO A;  2UUC H;  3GMA A;  4NPE A;  4TT3 H;  1OW7 A;  2XZR A;  2YXQ B;  3PH0 A;  1SQX K;  3USS A;  1LTJ B;  4LFA H;  1HVV A;  3H32 B;  1DIP A;  1HWT C;  3CWB D;  2WT7 A;  3VTP C;  1BE3 J;  1JTH B;  2AXT E;  4H0L D;  1HF9 A;  4X64 H;  2K37 A;  1ZRT D;  4DV6 H;  2G3A A;  2F4V H;  2K9Y A;  5AVR B;  2BL5 A;  3HRN A;  5AVY B;  1E5W A;  4DR7 H;  2SPZ A;  2GA1 A;  4GKK H;  1G2C A;  1GL2 A;  3FX0 A;  2HG5 D;  5KLV E;  3MHV A;  3GLM A;  4Z1M H;  1AN7 A;  3V2Q A;  3CCU P;  1S1C X;  2YKO A;  4AUW A;  2O4C A;  3M06 A;  1DD4 A;  1JNM A;  3CXH D;  4JI5 H;  5AVV B;  2WSF J;  3V4Q A;  3EFG A;  3E1I A;  5KAF E;  1ZME C;  4LF8 H;  2ZQE A;  1URQ D;  5AW4 B;  2JKV A;  3S9O A;  1EC6 A;  1HBW A;  1HJB A;  3VMX A;  5CCG D;  1M1J A;  1USD A;  5CCH D;  1GU4 A;  2D2C D;  2FFM A;  1BGY E;  2Y0D A;  3CX5 E;  3II6 A;  3KZI H;  2HYN A;  3WUV A;  2M3B A;  2HH2 A;  3H1J D;  3O8Z A;  1LGH B;  3W68 A;  1M8O B;  2AXY A;  4JVH A;  4C7R A;  3D6Z A;  5TIS H;  1FAV A;  1X4N A;  1RE3 C;  2ZVN B;  1S4X A;  1SFC D;  1EDL A;  4PD4 D;  1SQB G;  1LTS C;  4I7Z C;  2OTJ P;  5KLI C;  2E74 C;  1LTB C;  3R4Y A;  3H1I E;  1CI6 B;  1PP9 E;  3PRJ A;  4Y99 C;  4C7N A;  2Y9Z A;  2UXD H;  1QX8 A;  3CXH H;  2Y9Y A;  3RGU A;  1QVF O;  3T1H H;  1SQX E;  2N1T A;  2LRR A;  1XMO H;  2KSE A;  1KYO E;  1KB9 E;  1R5S A;  1L0N G;  1YJW P;  2MJH A;  1WE8 A;  1U57 A;  3TGU E;  4I1L A;  3A7O A;  4HH2 A;  3L37 A;  1S2E A;  3WU2 E;  3P8C D;  1PGP A;  1GW4 A;  1YBK A;  1NTZ J;  5AVT B;  2FYN C;  2ITA A;  4EIJ A;  1VQO P;  4I7Z B;  2G8Y A;  5KLI B;  2OTL P;  2NPS A;  3V5B A;  2E74 B;  2FXO A;  2WPQ A;  1NU1 G;  1UG8 A;  4PD4 H;  4B3S H;  2C0W A;  3AE7 C;  4NZR M;  1NTK J;  4Y99 B;  1FOS E;  1NJI Q;  3L73 E;  2XND H;  1NKN A;  1JY3 O;  1FZE A;  2RMZ A;  4IL6 X;  1S72 P;  2KZJ A;  1K9M Q;  2O3J A;  1L0L D;  3L70 J;  3Q5S A;  1GL2 C;  1MSZ A;  2PY9 A;  1NH4 A;  1CSB A;  2C0X A;  3SWF A;  3MGN A;  4E9J A;  2ZYA A;  4GOF A;  1ZR2 A;  3IF4 A;  1T3J A;  2H8P D;  1JMM A;  3SWK A;  3MUD A;  1VQ4 P;  3H1H E;  1G1J A;  4U3F D;  1HR0 H;  4IL6 E;  3I0P A;  4PDB A;  1PZQ A;  2FYN B;  5KAI E;  1SQB K;  2WPS A;  1Y47 A;  3VMA A;  4WB4 A;  2VKC A;  2RKL A;  4KT0 J;  5KLV D;  1M1J C;  2WT7 B;  5GTI H;  3UOE A;  3RK3 C;  1ZOY C;  5KKZ C;  2CTK A;  5AW3 B;  2Q3E A;  1X0A A;  1GMJ A;  4KHP H;  1G2C B;  3F5H A;  2JP3 A;  1BCC J;  4DV2 H;  1K04 A;  1L0N K;  3JCU E;  2C9N Y;  1AJY A;  2XDJ A;  3SWY A;  1SQQ G;  1KQL A;  2BCC D;  2WVR A;  1J4W A;  4JPZ B;  3CX5 D;  2H43 A;  3L74 J;  1HUC A;  3G71 P;  4DR2 H;  3CCS P;  1Q86 Q;  2AXT H;  3L72 J;  3CCE P;  3AE9 C;  1YIJ P;  5CJ4 A;  4BXL A;  1EZV G;  2Y0E A;  2YMK A;  1OIP A;  2OPU A;  1NU1 K;  1M1J B;  1BE3 G;  3L71 D;  2W83 C;  1FBM A;  2N1T C;  2Q7C A;  1VQM P;  3RK3 B;  5KKZ B;  2OGU A;  3H1I D;  1NGM B;  1PP9 D;  3M91 A;  4QMF B;  1SQV D;  4DJG A;  2Z4E A;  2IZ1 A;  2A45 H;  2E5L H;  5H2F H;  1SQX D;  2POH A;  3I56 P;  1PPJ G;  1IBM H;  4LFC H;  3AE8 C;  1KYO D;  1LTG C;  2NPS C;  2YKQ A;  2HFE D;  1EDJ A;  2XU6 A;  4DT0 A;  3QD7 X;  1HH0 A;  3TGU D;  3E7K A;  1YTZ I;  3CX5 H;  3SFE C;  3CD6 P;  4OGQ B;  2I8D A;  2H89 C;  1GD2 E;  1J2J B;  1OW8 A;  5CBO A;  1SQB E;  3SSU A;  2OPV A;  1JCC A;  5APX A;  1LTJ A;  2E42 A;  2K9J B;  3KPE A;  3CCR P;  1AFO A;  3MUD C;  1RF1 A;  3A5T A;  2LTL A;  2ANN A;  2LXC B;  3ITK A;  1EZV I;  5CMZ A;  3LW5 J;  2CTE A;  4OVN F;  1WHR A;  2NPS B;  1OVU A;  1P84 E;  4EDF A;  4DR1 H;  1VF5 C;  1L0N E;  4WWI A;  2JR8 A;  3JC2 2;  1KYO H;  4M3L A;  3TDK A;  3H1H D;  1NKZ B;  1VDF A;  3BCC D;  3CCL P;  1N7L A;  3RK3 E;  4B86 A;  5AW6 B;  2KI7 B;  4K35 A;  4AYC A;  4DUY H;  3I55 P;  2NZ2 A;  3PLN A;  1SS1 A;  3AED C;  4LGD E;  3H25 A;  3Q1M A;  1GU5 A;  2HOD A;  4HKZ H;  3T97 A;  1NTZ G;  1N73 A;  1J1D C;  3B5N A;  3LIE A;  3RF2 A;  4UB6 H;  1R8E A;  4LF6 H;  2OYI A;  1XNQ H;  3PP5 A;  3KYQ A;  2O1K A;  3M9Q A;  1UIX A;  2JJL A;  1VF5 B;  4Y28 J;  2ZYG A;  1FC2 C;  2YMY A;  4LLH A;  1NTK G;  1S9K E;  2JWD A;  4N3Y B;  4DV7 H;  5C39 A;  4DV1 H;  1PIX A;  1KD1 Q;  1JY3 N;  3L70 G;  1SLQ A;  2E74 D;  3H1K D;  4IL6 H;  4BWN A;  2Y0C A;  1MFT A;  1RE4 A;  5KAI H;  3GW6 A;  3C9I A;  3J7A K;  4NXM H;  4I6M C;  1PV3 A;  4RES B;  1Q2N A;  3VMY A;  1HGZ A;  1KQF B;  2IDB A;  1NYH A;  1J1D B;  3TK1 A;  2IX7 C;  4OCH A;  1ODH A;  3BRV B;  1IO4 A;  1OW6 A;  1F0X A;  2P10 A;  4HJG H;  1PGO A;  1K1G A;  3AEV B;  3D6Y A;  1NTM J;  1Q7Y Q;  2JA9 A;  1SQQ E;  5BR8 H;  1U7J A;  4C46 A;  5APS A;  1HTL C;  1H0T A;  1LTJ C;  3JCU H;  3JSV C;  4PV1 B;  2XKM A;  5FLX W;  2FKW B;  2OQQ A;  1EZV E;  3AE6 C;  2PAJ A;  3L7Z C;  1RF1 C;  1LP1 A;  1AQ5 A;  5GTH H;  1BE3 E;  2J59 M;  3H1J J;  3L74 G;  2I1K A;  2UXC H;  1NTZ K;  2KNC A;  3L72 G;  2IFM A;  2KP8 A;  2XNX A;  2CTL A;  1ZP0 C;  3GG2 A;  1GL2 D;  3NXS A;  3G4S P;  3OJA B;  3Q3D A;  2XV5 A;  1DD3 A;  1VQK P;  5LMN H;  5AVS B;  1JY3 P;  1NTK K;  1YQ4 C;  4R4L A;  3AEE C;  1PPJ E;  2R44 A;  3SFD C;  1P84 D;  1FJP A;  4AQY H;  1FOS F;  4EOT A;  1L0N D;  4QMA A;  1JO5 A;  4JQ0 D;  4HB1 A;  3HE4 A;  1GZL A;  4JYC A;  1RF1 B;  1FJG H;  1N73 C;  3B5N C;  5AW1 B;  3RK3 D;  1EXJ A;  2WSE H;  3EZJ A;  2AEM A;  3CPW O;  2OYI C;  4YTP C;  5B66 E;  1J5K A;  3OAK A;  2WWW A;  4W7Y A;  4DV4 H;  3AEB C;  1HGV A;  2YKP A;  2Q5U A;  1OZH A;  4JI8 H;  1W5C E;  4AIM A;  2PQU A;  3BRT B;  3Q5P A;  4B3M H;  1A02 J;  3CMA P;  1JM0 A;  3P8M C;  1RE4 C;  2O01 H;  2KIK A;  2P7J A;  2MJZ A;  2HOD B;  4FJU A;  1P84 H;  4XA4 A;  1L0L J;  1BDC A;  3T97 B;  1N73 B;  2N1T D;  5CHX A;  3U1A A;  3B5N B;  1XRH A;  1FDM A;  2OYI B;  5B5E H;  1PQX A;  2CPS A;  1JY2 O;  3D70 A;  3V4W A;  3WUU A;  4U3F J;  3P7K A;  2Q1K A;  1LNQ A;  4L74 A;  3L75 D;  4BA2 I;  3SB1 A;  4JBZ A;  4NPD A;  1NTZ E;  2P67 A;  4JI3 H;  5K5G B;  2NPS D;  3CCV P;  2KSJ A;  4FJS A;  2ZAE B;  2E76 C;  2R5D A;  3AEF C;  4AM3 A;  2WQY C;  2CTM A;  1NTK E;  2QJP C;  1SQQ D;  2JWA A;  2QJY C;  1V9N A;  1GK4 A;  4GIF A;  4JV5 H;  1SQP D;  3AEG C;  2NN6 G;  4WY4 D;  3P32 A;  2K9J A;  5BU5 A;  2IZ0 A;  2BCC J;  1JOC A;  3L70 E;  4OD6 A;  2FY8 A;  1Q82 Q;  1EZV D;  1EC5 A;  4U7J A;  3HE5 A;  1IFN A;  1BE3 D;  3ZDM A;  1KIL A;  1FZC A;  1KFN A;  1UII A;  3TNU A;  1H0T B;  2FPH X;  2HPC A;  5E79 E;  5APT A;  3NMD A;  3L71 J;  2BA0 A;  4X62 H;  1VF5 D;  2E76 B;  2JDI H;  3L4F A;  1ZR4 A;  3CCJ P;  1I6U A;  1LP1 B;  2ZM6 H;  3FAU A;  4JI4 H;  1PP9 J;  2QJP B;  4YXD C;  2QJY B;  1SQV J;  5KTB A;  2KNC B;  2W8Z A;  2K3R A;  1M57 D;  1BSH A;  3VN0 A;  1BCC E;  1XMQ H;  1NTM G;  3H1L E;  2D9I A;  1N7S A;  4LF7 H;  2FMR A;  3BAT A;  2JZX A;  4W7Z A;  4RJT A;  2W6J H;  3L74 E;  4N78 E;  4GKJ H;  3L72 E;  4DV0 H;  3KHU A;  3HE4 B;  2QEX P;  1EDK A;  3TSI A;  4DOJ A;  3H1J G;  1YQ3 C;  2DGR A;  4TLF A;  1N8R Q;  3M9B A;  2OTK E;  2BAS A;  1NOH A;  4B8T A;  2M0B A;  1LTI C;  4H0L C;  1IZN B;  1L4A A;  1GTW A;  5L8R J;  4KHX A;  2YO2 A;  2PRR A;  2WSS H;  1IFI A;  2JE6 I;  1XNR H;  3B71 A;  2KXP B;  5TJH A;  3M0A A;  1BGY D;  3C8V A;  3FXE A;  2V7Q H;  1GK6 A;  3Q2Y A;  3IFM A;  3G9R A;  2KB7 P;  2CTJ A;  2N9B A;  1BDD A;  3L35 A;  3BCC J;  4OGQ C;  1S03 G;  1DX7 A;  1W2E A;  1NAY A;  5B66 H;  1QL2 A;  5C0X G;  1T2K C;  3ABV C;  1JMB A;  1KV4 A;  1NTZ D;  1ZV8 A;  4LFB H;  4K3A A;  1Z56 A;  4H0L B;  3HUS B;  2W6B A;  1K8A Q;  1JEK A;  3W67 A;  1FZC C;  1KIL C;  5KAF H;  1Q81 Q;  4JF7 A;  1NTM K;  4NPF X;  3J80 W;  4JI2 H;  4ZKU A;  1FDO A;  1KB9 D;  1R5L A;  2VRS A;  2CWH A;  4DR5 H;  3BAS A;  4KJM A;  3NFQ A;  3EQ2 A;  3TF5 A;  5BVZ A;  2O01 N;  4A7P A;  4D6T J;  5AW9 B;  2CPQ A;  5LMU H;  4GKG A;  5AW8 B;  1VQ9 P;  2GM4 A;  1MKM A;  4UB8 E;  1L0L G;  3A0B E;  4PD4 I;  1IBK H;  3H1K J;  4ZKP A;  2J58 A;  1T8Z A;  2ZXE B;  1WVN A;  1FZB A;  1PGJ A;  1M56 D;  2IYP A;  3L73 D;  4DCK A;  3MZW B;  3PJS K;  4WAN A;  4U3F G;  1N7S C;  2QRX A;  3RBX A;  3HE5 B;  1BSN A;  3IAO A;  1JY2 N;  3RL0 g;  1FZC B;  1KIL B;  2C9L Y;  1NWQ A;  3TNU B;  2HPC B;  3B5N D;  1TUA A;  3Q5R A;  1N34 H;  3AEC C;  4LF4 H;  1BCC D;  3H1L D;  3V2P A;  4HYT B;  2A45 G;  1KB9 H;  2OAR A;  2CPB A;  3RL0 C;  5AVW B;  1YHQ P;  5K36 G;  3JAM W;  2M8W A;  3GAB A;  4EYY Q;  2WSE J;  1CZQ A;  3D71 A;  2A06 G;  1FU1 A;  1YJN P;  1L4A C;  4CPG A;  1HJ0 A;  3KZI E;  1EQ7 A;  3WU2 H;  4EC5 A;  5APQ A;  1N36 H;  2Q3I A;  3L72 D;  1NU1 E;  2BCC G;  2FFD A;  3I5C A;  1ZRT E;  5LL6 b;  5JEA G;  3CCQ P;  5APU A;  1N7S B;  2FYU J;  1WRG A;  1LJ2 A;  1AQT A;  2BEZ F;  5KJ7 A;  2WSC H;  3FWL A;  1N86 A;  1IC2 A;  4ZMD A;  4JVY A;  1K05 A;  2PP6 A;  3L71 G;  3CC2 P;  4H13 C;  1L2P A;  1VIH A;  3FWN A;  2Z5H A;  4DR3 H;  1NTM E;  2W27 A;  3RL0 B;  1PP9 G;  5APW A;  4PV1 C;  1SQV G;  3GF7 A;  3CWB J;  4X65 H;  1AVO A;  1L0L K;  2QM7 A;  1JY2 P;  2QVA A;  1L4A B;  1X9Z A;  2CTF A;  2IBZ G;  3GHG A;  2L91 A;  4WAL A;  2WZ7 A;  1QL1 A;  2E76 D;  1VQP P;  1K73 Q;  1VPC A;  4DUZ H;  1M90 Q;  3T1Y H;  4GOE A;  4JI7 H;  4NXN H;  2QG4 A;  2V4H A;  3H1J E;  1KIL E;  3L36 A;  2QJK C;  2A45 I;  1KN7 A;  1AVY A;  5M1B A;  2Z0S A;  3HD7 A;  1M1K Q;  2E43 A;  2YXR B;  1ZLL A;  4H13 B;  1Y9B A;  4R4M A;  2JEB I;  4PD4 E;  2R3S A;  2WMM A;  4GOD A;  4LIJ A;  3S1K A;  4L73 A;  4PJ0 E;  5CBN A;  3GR5 A;  2CWF A;  4GT1 A;  4OH8 B;  2B87 A;  2IYO A;  1VQL P;  1KQG B;  5AW7 B;  3KXD A;  4H44 C;  1SQB D;  2KS1 B;  1OX3 A;  3CLQ A;  2YNY A;  1PFI A;  2QE7 H;  2QJK B;  1AV1 A;  3OW2 O;  3L75 J;  2QM8 A;  1RF0 A;  2AXC A;  1WMK A;  3VKE A;  1RQU A;  1HNW H;  3BCC G;  2AEF A;  3P8C E;  1SEI A;  1N33 H;  1KFM A;  1XTG B;  5GTI E;  2IBZ I;  1IFD A;  2KLV A;  1S5L X;  1QVG O;  1EDI A;  1KQS O;  3AE4 C;  2K1A A;  1JB0 J;  1SQV K;  1S3J A;  1GW3 A;  2FYZ A;  4WVZ A;  5A2Q W;  2FFD C;  1IK7 A;  1SQP J;  2W90 A;  3LW5 H;  4H44 B;  3HTK A;  1S5L E;  1L0L E;  2JEE A;  1YI2 P;  2ZYD A;  5KJ7 C;  3B4S A;  5AVZ B;  1NU1 D;  1VQ5 P;  2BEQ D;  4UB8 H;  3A0B H;  3V69 A;  3RK2 C;  4D6T G;  2E5Y A;  4U3F E;  3CC4 P;  2I1J A;  4IOI H;  4B3T H;  2JEA I;  1SVF A;  5AW2 B;  3UIA A;  2LKM A;  2Y3M A;  3H1K G;  1X8Y A;  1I94 H;  2K1H A;  4W80 A;  3VYI A;  3GHG C;  2KK7 A;  3A0H E;  1OVV A;  5APY A;  3GF3 A;  2FFD B;  2RN0 A;  2WPV B;  1S9K D;  1NTM D;  4OGQ D;  2GUS A;  4L76 A;  2M5A A;  5H2F E;  2V7Q J;  1T2K D;  3VP8 A;  2ZT9 C;  2A06 E;  3HD7 C;  3G6E P;  1ZZK A;  3HUS A;  3N7N A;  1NXU A;  2M8R A;  2BCC E;  4RO0 A;  1XTC C;  2K88 A;  1KC8 Q;  3RK2 B;  1X4M A;  3VMZ A;  3H6P A;  3CI9 A;  2IPP A;  3PTZ A;  3IR9 A;  5KLV J;  1KIL D;  1LWU A;  4H8A A;  2R3C A;  3IN6 A;  2JO1 A;  4LF5 H;  3MD0 A;  2E3U A;  2CPM A;  2MKV A;  1VQ7 P;  2B9B A;  3GHG B;  3A3Y B;  3L71 E;  3U59 A;  3OSS D;  4X66 H;  3R2P A;  2QND A;  2WPR A;  2FYU G;  2P1J A;  1URQ A;  3CC7 P;  2HHH H;  3OTO H;  1EXI A;  4YY3 H;  1SQV E;  5CCG A;  2KUB A;  2ZT9 B;  5CCH A;  2JVZ A;  1RF0 C;  3HD7 B;  5AVU B;  2L5G B;  2QIW A;  1BGY J;  2R32 A;  2IBZ E;  4OX9 H;  1IK9 A;  1JUN A;  4MN4 C;  1N7S D;  3PHL A;  3KQG A;  3RBZ A;  1VL2 A;  1RQV A;  2KOG A;  3CWB G;  4BRY A;  1SFC A;  2FXP A;  3LID A;  1SP4 A;  3OET A;  1E79 H;  3O6Q A;  3U1C A;  4DV5 H;  1USE A;  2B87 B;  5DJU B;  1YYC A;  3H1I J;  1IJD B;  3C1L A;  1PPJ D;  2IFN A;  3RL0 D;  1FJK A;  1M7L A;  1QEX A;  2N9Y B;  4XFJ A;  4UB6 E;  1PGQ A;  1SQX J;  1L4A D;  4IFF A;  3AE1 C;  2E75 C;  1U7M A;  3AE2 C;  3FXD A;  1RHZ B;  1HNX H;  4WY4 A;  3B8E B;  2O1J A;  4PJ0 H;  2AEJ A;  2P2U A;  3J81 W;  5APV A;  3TGU J;  5BU8 B;  4G08 A;  2HLO A;  2E5T A;  2PFX A;  1X0T A;  1FZF A;  2UXB H;  3AE5 C;  3BCC E;  4H13 D;  3NCV A;  3HTK B;  1OMI A;  2FYU K;  1H88 A;  4AQR D;  3L73 J;  4IFD G;  2WSC J;  2WIT A;  3A2A A;  1KZU B;  4PV1 D;  1P84 I;  3KDP B;  3HUS C;  3L75 G;  4JI1 H;  2E75 B;  3E1R A;  2WSF H;  1LTA C;  3CL3 D;  1FKA H;  1Z2I A;  3WUT A;  1LWU C;  3BVH A;  2M3E A;  2Q9I A;  4OO1 G;  1ZTG A;  1OWA A;  1GL2 B;  1MUU A;  2A06 D;  3H1L J;  3H1H J;  1IBL H;  1QGK B;  1S5L H;  3F89 A;  3KDG A;  1D7M A;  2KYV A;  1SQP G;  3VP9 A;  4D6T E;  1LT1 A;  4JYA H;  3M0D A;  1IFM A;  1URQ C;  2M5A B;  1MZ9 A;  5GTH E;  1FE6 A;  3EFF K;  4YPC A;  3CCM P;  1FZA A;  3CXH I;  5CCG C;  3S4R A;  4DZO A;  5CCH C;  2D2C C;  3H1K E;  4YHH H;  3QWO C;  2ZJS E;  1H89 A;  4NZT M;  1KMI Z;  5DT9 A;  1Y8A A;  3MP7 B;  1NTK D;  4EI2 A;  1FZG A;  2DW3 A;  2P2R A;  2RH0 A;  2KS1 A;  2ZVO B;  4ASW A;  3A0H H;  4H44 D;  1LTT C;  1LWU B;  4DV3 H;  1SFC C;  1YJ9 P;  4LC1 A;  3V2N A;  4XE5 B;  3L70 D;  1CW5 A;  1DTJ A;  2UUA H;  2IBZ D;  4BA1 I;  1OFC X;  1MFZ A;  4IFM A;  2VQE H;  3N4X A;  1FDI A;  1LT9 A;  1IFP A;  1H8A A;  2OYH A;  4ZNC A;  4B8C D;  2Z5I A;  5AW5 B;  1URQ B;  3WMM 0;  4NBQ A;  2B88 A;  1VQN P;  3MTU E;  4C7N B;  1T6A A;  2OYO A;  1NO4 A;  2R5B A;  2D2C B;  2QSI A;  3GKU A;  4IFD K;  1VQ6 P;  2ZXX A;  2N1T B;  1FS0 E;  4WY4 C;  1ZW0 A;  2WTY A;  4LF9 H;  2FYU E;  5KLV G;  1W2B O;  3H32 A;  1TU3 F;  2UU9 H;  4BRY B;  1SFC B;  1Q90 D;  5KJ7 D;  1JTH A;  4GDO A;  3O6Q B;  1NHL A;  1DH3 A;  1N2D C;  1SQQ K;  2UUB H;  3RK2 D;  1X79 B;  1SQP K;  3NTN A;  2HH3 A;  1ZN5 A;  3L74 D;  3TYY A;  2J5U A;  4N78 D;  3V2R A;  2LF0 A;  3CWB E;  4I2L C;  3AE3 C;  2CK3 H;  1A02 F;  4WBA A;  2KZI A;  2FXM A;  5B5E E;  1SQB J;  1PL5 A;  3G3Z A;  4N6J A;  2NRG A;  1BGY G;  5TIS E;  2LR2 A;  5E79 H;  4JI0 H;  4DR6 H;  4O9B A;  2B89 A;  4WY4 B;  1JCD A;  2YO3 A;  2H88 C;  2ZT9 D;  3FGA D;  3HD7 D;  2O01 J;  2ANR A;  1YTZ T;  5EFW B;  3M0D C;  1J5E H;  3CXH E;  3H1I G; 
#chains in the Genus database with same CATH homology
 1NGM B;  1OMI A;  1KIL E;  4PV1 B;  2QJK C;  3Q5P A;  1VBI A;  3Q5S A;  1EXI A;  4RKU J;  3Q2Y A;  5M1B A;  2WSC J;  3D6Z A;  3G9R A;  2ZT9 B;  4PV1 D;  3Q5R A;  3EWK A;  2D2C B;  2NZ2 A;  2BEQ D;  2QSI A;  2OQQ A;  3AEC C;  3AE6 C;  2QIW A;  4OGQ C;  3AED C;  1VF5 D;  2E76 B;  4H13 B;  1Y9B A;  3GMA A;  3H25 A;  4R4M A;  3Q1M A;  4TT3 H;  1OW7 A;  2E75 B;  4FJU A;  4I7Z C;  3I0P A;  4YXD C;  3AE8 C;  5KLI C;  3T97 B;  3ABV C;  1Z2I A;  2E74 C;  1XRH A;  2WSE J;  3R4Y A;  1KTM A;  3D71 A;  1R8E A;  2X06 A;  1VL2 A;  1RQV A;  1TU3 F;  1UIX A;  1HJ0 A;  4KT0 J;  1DIP A;  4H0L B;  1VF5 B;  4Y28 J;  3D70 A;  1Q90 D;  1ZP0 C;  2FXP A;  1WTJ A;  1S20 A;  3O6Q A;  4GDO A;  3SFE C;  3UOE A;  4OGQ B;  2CWF A;  4H0L D;  1HF9 A;  1ZRT E;  3GF3 A;  3Q3D A;  1DD3 A;  2WPV B;  2YIU C;  1ZOY C;  2G3A A;  1KQG B;  5KKZ C;  2H89 C;  2K9Y A;  4H44 C;  4OGQ D;  1YQ4 C;  1OW8 A;  1X0A A;  4R4L A;  1GMJ A;  3AEE C;  2BEZ F;  1FDO A;  3SFD C;  2V7Q J;  1PIX A;  2CWH A;  2JP3 A;  2ZT9 C;  2J5U A;  2E74 D;  4XFJ A;  1U57 A;  2D2C C;  3GLM A;  4Z1M H;  1K05 A;  4FJS A;  2FBW C;  3AE3 C;  2E76 C;  1K04 A;  1WMK A;  4H13 C;  3AEF C;  1AJY A;  1RQU A;  1NXU A;  1S1C X;  2WQY C;  3AE1 C;  1KMI Z;  2E75 C;  1PL5 A;  2QJP C;  3AE2 C;  1PV3 A;  2QJY C;  1V9N A;  1DD4 A;  1MKM A;  2FYN C;  1KQF B;  2IDB A;  1KOR A;  1YQ3 C;  2WSF J;  3LW5 J;  4I7Z B;  1EXJ A;  1NYH A;  2G8Y A;  4PV1 C;  3AEG C;  3GF7 A;  4H44 D;  1S5L X;  2E74 B;  4YTP C;  1ZME C;  4H8A A;  1OW6 A;  2P10 A;  3AE9 C;  3IN6 A;  4H0L C;  3AEA C;  1VF5 C;  2JO1 A;  3AE4 C;  1JB0 J;  3S9O A;  2H88 C;  5L8R J;  3AE7 C;  3D6Y A;  3AEB C;  2YMK A;  2MKV A;  1IK7 A;  2ZT9 D;  3FGA D;  4U7J A;  2D2C D;  3B71 A;  2O01 J;  3AE5 C;  1FDI A;  3IAO A;  2E76 D;  4H13 D;  3RL0 g;  4IL6 X;  2E75 D;  4H44 B;  3C8V A;  3RK3 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...