2G8YA

The structure of a putative malate/lactate dehydrogenase from e. coli.
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
359
structure length
359
Chain Sequence
SGHRFDAQTLHSFIQAVFRQMGSEEQEAKLVADHLIAANLAGHDSHGIGMFPSYVRSWSQGHLQINHHAKTVKEAGAAVTLDGDRAFGQVAAHEAMALGIEKAHQHGIAAVALHNSHHIGRIGYWAEQCAAAGFVSIHFVSVVGIPMVAPFHGRDSRFGTNPFCVVFPRKDNFPLLLDYATSAIAFGKTRVAWHKGVPVPPGCLIDVNGVPTTNPAVMQESPLGSLLTFAEHKGYALAAMCEILGGALSGGKTTHQETLQTSPDAILNCMTTIIINPELFGAPDCNAQTEAFAEWVKASPHDDDKPILLPGEWEVNTRRERQKQGIPLDAGSWQAICDAARQIGMPEETLQAFCQQLAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Malate/L-lactate dehydrogenases
publication title The structure of a putative malate/lactate dehydrogenase from E. coli.
rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 113
structure length 359
sequence length 359
chains with identical sequence B
ec nomenclature ec 1.1.1.237: Hydroxyphenylpyruvate reductase.
pdb deposition date 2006-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02615 Ldh_2 Malate/L-lactate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1530.10 Mainly Alpha Orthogonal Bundle Hypothetical Oxidoreductase Yiak; Chain: A, domain 1 Hypothetical Oxidoreductase Yiak; Chain: A, domain 1 2g8yA01
1.20.5.460 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2g8yA03
3.30.1370.60 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Hypothetical oxidoreductase yiak; domain 2 2g8yA02
1WTJA 3UOEA 4H8AA 1NXUA 1VBIA 3EWKA 2CWFA 1X0AA 1WMKA 1OMIA 1ZMEC 1FDOA 1AJYA 1S20A 2P10A 2CWHA 2X06A 1FDIA 2G8YA 1XRHA 3I0PA 3H25A 3IN6A 4FJSA 4FJUA 3O6QA 1Z2IA 1V9NA
chains in the Genus database with same CATH superfamily
1Q86Q 4YY3H 3KDKA 1YITP 2FY8A 3MIWA 1GL2D 3CWBD 1NTZE 3WUUA 3SWKA 1Z56A 1USDA 4OGQB 3ZDMA 2ZAEB 1J1DB 2O01J 4AM3A 3SWFA 3G6EP 3TYYA 2Z0SA 2H8PD 4LFBH 1IK7A 1IFMA 3I5CA 4DJGA 1HGVA 3KPEA 3MTUE 3M0DA 1SFCB 3L74E 3GR5A 2FYUD 2WWWA 1RY3A 4Y99B 4PV1D 3VTPC 2DGRA 2K9YA 1FE6A 1XTGB 1NU1K 1FDIA 1QVGO 1SQBG 1DT4A 1Y8AA 3TK1A 2B9BA 2KI7B 1L0LE 1SFCA 2ZT9D 1BCCJ 3PP5A 2WSCH 4PD4E 2E74B 3L72J 3TNUB 3H1HD 3H1LE 2WZ7A 2E76D 3GMAA 2B88A 2A06E 1JY3N 3MZWB 1EZVD 2E75C 5DJUB 4B8TA 2HR3A 1X0AA 2QNDA 3RBZA 3A0HE 1BDDA 1M56D 2B89A 4IOIH 1VQPP 1PL5A 1SFCD 1LTTC 1FZCC 1RE3A 1PPJG 2R5BA 1N34H 2CPMA 1E79H 4JYCA 2QJYC 3J81W 3TNUA 3LIEA 2IBZG 1XMQH 2MKVA 2AEMA 1AJYA 1BE3D 4OX9H 2FKWB 1NTZK 4L74A 1N86A 1X79B 3CC4P 4LF8H 3SWYA 2Q3EA 1NAYA 1GMJA 3H1KD 2KOGA 4R4MA 5CCHC 3L73J 1KORA 2OTJP 4NXMH 1LT1A 1KMIZ 2E74D 1S9KE 1S5LE 4GT1A 1ZR4A 1NTMG 1CSBA 3CXHI 4W80A 4ZKPA 4ASWA 2VKCA 2WVRA 1VQMP 2KUBA 1H88A 3Q2YA 3Q5PA 1EXJA 1N2DC 4QMFB 1LTGC 3VMYA 4GKKH 3CI9A 2BASA 5DJTB 4JI3H 1SQQG 4YHHH 1NXUA 5C39A 1QEXA 2YKOA 1UIIA 3H1IG 2JO1A 4JI8H 2JEEA 4H44C 1SQPJ 4TT3H 1SQVD 2WPVB 2KZIA 2I1JA 2OYHC 2JR8A 4B8CD 4LFAH 3O6QA 1L0LK 1OXZA 1PGQA 1EQ7A 3RK3D 3P8CD 4I1LA 1PIXA 2FYNC 2WMMA 1BCCE 3L70J 4AYCA 4N78E 1S20A 2DW3A 5KLIB 2OYIB 3L72E 5B66H 4LF7H 5BU8B 1LTJC 3H1JG 1VQ7P 2A45H 3UOEA 1NTKD 1J1EB 1S3JA 2L5GB 2LTMA 2FPHX 3NCVA 1SLQA 1EDJA 3K5BA 2OQQA 4JQ0D 2G3AA 2O3JA 1X9ZA 5KAFH 1IJDB 2Q1KA 3JSVC 2W8ZA 3BCCG 1Z2IA 2PQUA 3GF7A 4DV5H 4IFMA 4DCKA 4K35A 2YQRA 1GK6A 5APWA 2WSSH 3L7ZC 4RKUJ 4K3AA 4DR7H 1QL2A 4EYYQ 2E43A 1OIPA 2IYOA 1L4AB 4UB8E 4HKZH 1BGYE 3T1HH 2YKPA 3L73E 2PFXA 1IZNB 4L75A 1FS0E 2Y9YA 3CCJP 1M1JC 2IBZD 3KDGA 2KP8A 2ANRA 2B87B 2ZT9C 3CWBJ 3HE5A 5GTHH 2HPCB 3HD7C 1SQPG 3W67A 4AQYH 1S5LX 1MV8A 1J5EH 2YMKA 5E79H 1FZGA 3NTNA 1EDIA 5LMNH 2E76C 2RKLA 4GODA 4JYBA 4MN4C 3NMDA 3N7NA 4UB6H 2Y9ZA 2K88A 1KILA 4D6TG 2B87A 3W68A 4XFJA 5B5EH 4IL6H 1Q2NA 2HPCA 3CX5I 5AVZB 1YJNP 2YMYA 4N78D 3T97B 1PP9G 3TF5A 2O01N 3A0BE 4GIFA 4L76A 1H0TB 1NU1J 1K8AQ 5H2FH 2I8DA 3VP8A 3L70E 2FMRA 4LF6H 2Q6QA 1CI6B 2W83C 2WSFH 2W6AA 1JUNA 1X4NA 5AVRB 1FZCB 1KILD 4DOJA 4BWNA 3HUSC 3NXSA 2XZRA 4E9JA 4B3TH 3RK2D 3TGUD 1VL2A 2QJYB 4OCHA 3N4XA 2UXCH 2XNDH 1VQ9P 3H1HJ 1DD3A 1JY2O 5AW0B 4B86A 2MJHA 3H1JD 4DV0H 2V4HA 3FXEA 1FZCA 5APYA 2M5AB 1J5KA 2UU9H 1Q81Q 1S72P 4WB4A 1RE4C 2P67A 1ZRTE 5KJ7D 1BGYD 1MZ9A 1ODHA 1HTLC 1N7LA 1X8YA 2KSEA 1N7SC 1FZBA 1BE3J 2E75D 1KQSO 4KHXA 4DV2H 2IFMA 1OVUA 1S03G 3H1KJ 1M7LA 3FX0A 3M9HA 2M5AA 3RBXA 5CCHA 1TUAA 2N1TC 2PP6A 4H44B 1MFZA 1QVFO 2KSJA 3KZIH 4Z1MH 4H13D 2OPVA 1QL1A 2WT7A 3RL0C 1RF0C 2CTMA 5K5GB 3BRTB 1T2KC 4BA2I 1NOHA 3R4YA 3RL0g 2JJLA 1KYOD 1OZHA 3I0PA 5APUA 4IFDG 2QM8A 2QM7A 1BDCA 1NU1G 2V7QJ 2FYNB 1LTSC 2O4CA 3PRJA 3CXHH 2FYUE 3U59A 1JEKA 2M0BA 3H32A 3P8MC 2ZM6H 3CD6P 2W6JH 5CCHD 3L71D 5KTBA 2KS1B 2POHA 1FZFA 3AE2C 3AEBC 2JEAI 1LTJB 2VQEH 1GL2B 2OYHA 2Y3MA 1I6UA 1Y9BA 4FJSA 2UUAH 1DTJA 1IFPA 2FXPA 3FXDA 1VQ8P 3B71A 1WMKA 4OWFA 3OA7A 1USEA 2P7JA 2WPQA 1PP9D 3U1KA 3B4SA 3WU2E 1ZLLA 3E1RA 4H44D 2W6BA 1PZQA 1JCCA 4JVHA 1LTJA 1ZR2A 1V8CA 5AW1B 3H1HE 3M0AA 5TJHA 3CCMP 3L75D 5APQA 4JYAH 2H88C 1KYOH 2FYZA 1XTCC 1VF5C 1NTZG 2OTKE 2ZJSE 2D2CC 2C0XA 1AQ5A 1P84I 1M1JB 2GUVA 3IFMA 3AE1C 2ZT9B 4DR3H 4NPEA 3U1AA 2G8YA 2ZVNB 1IBMH 1BE3E 3IN6A 1G1JA 4IFFA 2JA9A 3E1IA 1ZOYC 3L74G 1BSHA 3H1KE 1OW7A 2E76B 1EXIA 2C0WA 5CMZA 2XV5A 2QSIA 5B66E 1M1JA 1WRGA 4U3FG 2BEZF 1L0NE 1KILC 3HD7A 4EOTA 2OPUA 3RK2C 2FYUK 1IFJA 3WMM0 2KZJA 1L0LG 1U7JA 2I1KA 4DZOA 4PJ0E 3P32A 1FC2C 1HWTC 2K9JB 1YYCA 1WE8A 4DUYH 1SQVE 3M9QA 2BCCD 5CJ0A 5K36G 2XU6A 3HUSB 2IDBA 1KC8Q 3H1LG 2M3BA 3C1LA 2HH3A 2A06G 1LJ2A 3HD7D 5KJ7C 4LC1A 3RK3E 3P8CE 4JBZA 2ZYDA 2UXDH 3SFDC 2R3CA 2M6QA 2K9JA 4TLFA 5AW7B 3I55P 5GTHE 1SQXD 4C46A 3HUSA 4U7JA 3USSA 1NTKE 1VQ5P 2Q7CA 3G3ZA 4OD6A 3TGUJ 1XNQH 1LP1B 5E79E 1FU1A 1HR0H 2W90A 1AQTA 1IFNA 4H13C 3WUVA 1PFIA 5KKZB 2Y0DA 3CPWO 4UB6E 1VQNP 3FWNA 2GUSA 2E5YA 3RGUA 4K0KH 2P58A 3NFQA 3RK3B 4WY4C 4GDOA 2C9LY 2XNXA 1GU4A 4EI2A 3HRNA 1JM0A 1H89A 3LW5J 1RE4A 3ABVC 5KLVD 1BGYJ 2GA1A 2QJPB 1LP1A 3RL0B 5H2FE 5AVYB 1KHMA 4NPFX 1OMIA 3CCEP 2Y0EA 1N7SA 4I2LC 1L0ND 2CTFA 3AEVB 1L0NK 1RH5B 1MUUA 3O6QB 1PGOA 1RQVA 3E7KA 2AEFA 1KQGB 2IBZE 3BRVB 1ZN5A 2N1TA 1LTAC 3CLQA 2JE6I 1RF0A 2NPSC 3P7KA 3B5NC 1ZW0A 3F5HA 1N73C 3MGNA 1BCCG 3FWLA 1URQA 2MJZA 3GF3A 5AVXB 1SQVK 1N7SD 2IZ1A 3IR9A 1AFOA 1NTME 3L72G 2ZQEA 2ZFCA 1HJ0A 2OYOA 1YJWP 1A02J 2N1TD 5BVZA 1FZAA 3L71J 1K1GA 1X9VA 3CC7P 3GHGC 3RL0D 2KIKA 1P84D 1T2KD 1SQBD 1URQD 3V2RA 1HNWH 1HF9A 4DR1H 4GOFA 1NTKK 4OH8B 5TISE 1KV4A 1KILE 2P10A 1S4XA 2H43A 3OTOH 1PGJA 1AVOA 3TDKA 1ZZIA 3TGUE 1AN7A 4YXDC 3A3YB 2QIWA 5CJ4A 4JI2H 3VP9A 2IYPA 3M06A 3IAOA 2CWFA 2YKQA 3GW6A 3CCVP 2A1SA 3HE5B 4YPCA 3L75J 3L73G 2Q3IA 2LF0A 2P2UA 4RJTA 3AE6C 3H1JE 1N36H 2JDIH 1FJGH 2IPPA 1LNQA 3PHLA 4RESB 1ZTGA 4BA1I 1PPJD 3AE3C 1YIJP 1K05A 2WSCJ 1FDOA 1KILB 1UIXA 2PY9A 2PGDA 3OSSD 4JI7H 2SPZA 4LFCH 1W5CE 3RK2B 1P84H 2JEBI 2WPRA 2KLVA 1JY3O 1DX7A 1K9MQ 4KT0J 2LXCB 2Z4EA 2P2RA 1VF5D 2K1AA 1MKMA 1U57A 2D2CD 2HLOA 1S1CX 2F4VH 1NTMD 1DIPA 3L70G 2FYUJ 1KYOE 1A02F 4GKGA 4ZNCA 1NTMK 5AW5B 3OETA 4NBQA 3VMXA 2M8WA 1HNXH 4GOEA 3VN0A 4JI5H 4N6JA 4R4LA 1VQ4P 1IO4A 1KTMA 2QEXP 3TSIA 1SQQD 3A5TA 3H1ID 5CCGC 1H8AA 2E75B 5EFWB 3L71E 3MD0A 1JOCA 2YO3A 1PGPA 3V2NA 2K3RA 2BCCJ 1VBIA 2IX7C 1U7MA 2QE7H 5KJ7A 4B3MH 4RO0A 2FFMA 1JY2P 4H13B 2UUBH 1LTIC 1S5LH 1G2CA 1DH3A 1N33H 2O01H 1PP9E 1UG8A 1WTJA 2WPSA 4H8AA 5APXA 4WY4B 5AW6B 1SQXJ 1NVOA 3OJAB 1EC6A 1MFTA 1X4MA 2WQYC 3CXHD 2R32A 1T8ZA 4W7ZA 5AW2B 2CPQA 3AEFC 2X06A 3L75E 1IFDA 2WT7B 1T3UA 1GU5A 3CWBG 4JPZB 2LKMA 3AE8C 3SB1A 3BCCD 2R3SA 2YIUC 1JNMA 1E5WA 4WY4A 2E5TA 2BEQD 1HUCA 2R5DA 1KQLA 2NN6G 3CC2P 2PRRA 2QJKC 1VIGA 3EQ2A 5M1BA 3H32B 3B5NB 1JTHA 1EZVI 2FYUG 5AVQB 3C9IA 2JZXA 1Y47A 4B3SH 1L0NJ 3JCUH 2OYHB 1AA0A 4WBAA 1URQC 1KB9I 1M8OB 1M90Q 4FJUA 2AEJA 4WY4D 2RH0A 1OVVA 3HE4B 3VYIA 3V5BA 1OVRA 1CW5A 3SFEC 1SQPD 3V2PA 3II6A 2NPSA 3B5NA 3CCUP 3MHVA 3GHGB 4WWIA 2FFDC 1N73A 2JWDA 1SQVJ 2YO2A 2ZYGA 4LLHA 4LIJA 5GTIH 3VOPA 3AE7C 1KN7A 1I94H 5C0XG 4DV6H 4ASVA 4D6TD 3QD7X 3L4FA 2YNYA 2NRGA 3GLMA 2BCCE 2A45I 3HE4A 3L35A 1M1KQ 1JO5A 3H1HG 5KAIH 1J4WA 1T3JA 3CCLP 3D6ZA 1DEEG 1EZVG 1W2EA 1ZZKA 4B3RH 3GHGA 4JVYA 3JAMW 2NPSD 4HYTB 3B5ND 2BL5A 2JWAA 4M3LA 4AUWA 2E42A 5AW9B 3V6IA 1NTKJ 1SQBJ 3PH0A 1J2JB 2KNCA 4G08A 1SQXE 4NPDA 2WSEH 3OAKA 5APSA 3V2QA 1NKNA 3V4WA 3O8ZA 3BATA 3Q5SA 5KLIC 4AIMA 1FZEA 4GKJH 2OYIC 4PD4I 1BE3G 3CCSP 1PV3A 1RHZB 3H1KG 2LRRA 2K1HA 2VRSA 3HD7B 3J7AK 3T1YH 2A45G 2YXRB 1M57D 3CX5D 1NHLA 2ZXXA 4WVZA 1R5LA 2N9YB 1QLED 2WSFJ 3PTZA 5KLVE 4X66H 2HH2A 4C7NB 3H6PA 2KK7A 1LT9C 2LTLA 3R2PA 1X0TA 2KLUA 1L4AC 1SQVG 4HB1A 1IBKH 2FBWC 1IFIA 5KAFE 2OARA 3A7OA 1EDLA 4DR5H 3CL3D 4DR4H 2KXPB 1OWAA 4C7NA 1NTMJ 3MUDC 3G4SP 1WVNA 5IT9W 4N3YB 3AEEC 4U3FE 4JI1H 2QVAA 2RMZA 1NU1D 1X22A 3CCRP 4IFDK 3V69A 1TU3F 4JV5H 5AVSB 2VQFH 1SQQJ 2IBZI 1SVFA 3S1KA 5L8RJ 1NTKG 5CCGA 3H1IJ 5AVVB 3CX5H 2E5LH 1XNRH 5BU5A 4NXNH 4WANA 1P84E 4EC5A 4C7RA 5APVA 1VQLP 1OW8A 5LMUH 2AXCA 1ZXGA 1SQXK 2UXBH 1SQBE 2Z5HA 2C9NY 2CK3H 1LTBC 1NO4A 3CMEP 2HFED 4DV3H 3VMAA 4OGQD 2HG5D 1V9NA 3AEDC 2YIUB 3EFGA 1N7SB 4CPGA 1HJBA 3KHUA 1KD1Q 2CPSA 5CCGD 3KQGA 3GG2A 2HHHH 1YTZI 5AVWB 1NGMB 2CTLA 3PJSK 2L91A 3H1JJ 5B5EE 4IL6E 2QJKB 1KB9D 1JCDA 2Q9IA 2N1TB 3GKUA 2JVZA 2PT7G 3WUTA 4H0LC 5KLVK 2IFNA 1NTZD 4I7ZC 3ITKA 1URQB 1PPJE 3BCCJ 3F89A 3EFFK 2QG4A 1HH0A 5AW4B 2Y0CA 4DV7H 1JB0J 1YQ4C 1RQUA 2LR2A 2FFDB 2XDJA 3VMZA 3WU2H 2AXTH 2CTEA 2K37A 3KXDA 4JI4H 1GW3A 1VQOP 1YI2P 3L74D 1OX3A 1VIHA 3G9RA 3G71P 4KJMA 3RF2A 4EDFA 4NZRM 1NAFA 2N9BA 4HJGH 1N32H 2Z5IA 1N8RQ 2WSEJ 4U3FD 1GTWA 1JY2N 1AV1A 4X65H 1ZV8A 1F0XA 2ZXEB 4YTPC 4DV4H 4L73A 1XMOH 2H89C 5AVUB 2QA4P 1QGKB 2FFDA 1KB9H 5IWAH 3M91A 1L2PA 1L0LD 4JI0H 1FKAH 1SQQE 4PD4D 5A2QW 2ITAA 3H1IE 1FJKA 4YXWH 3TGUG 1FJPA 5AW3B 4D6TJ 3A2AA 1ZMEC 3SSUA 1SQBK 3VKEA 3H1LD 1VF5B 2A06D 2CWHA 1LWUC 3KZIE 2D2CB 1RF1C 1PP9J 1KYOI 2Q5UA 1KFMA 2HODB 2KYVA 4O9BA 2D9IA 3JCUE 1GL2C 1MSZA 2HYNA 3EZJA 3D6YA 1VPCA 1VQKP 1YHQP 2E3UA 1BGYG 1VQ6P 2V7QH 3CXHE 1PQXA 1AVYA 2KB7P 2PAJA 2AXYA 4PJ0H 2ZYAA 2OYIA 1DEBA 3V4QA 2HODA 2BA0A 3FAUA 5CBNA 1DD4A 5GTIE 1JY3P 4PV1C 2IZ0A 4IL6X 1IC2A 1LT9B 1NWQA 1HNZH 1FBMA 3Q5RA 2J58A 3OW2O 2ANNA 3BCCE 4PD4H 1GZLA 4LF9H 1S9KD 4LF4H 5KAIE 5APTA 1HGZA 1GDTA 3LIDA 1K73Q 1QX8A 1ZP0C 3PLNA 1KZUB 2WTYA 3M0DC 1NJIQ 1R8EA 1LT9A 3A0HH 3IF4A 1ZZJA 2UUCH 2O1JA 1NH4A 1WT6A 3L71G 1L4AA 2M3EA 3AEGC 3L36A 3HTKB 4DT0A 3M9BA 1NKZB 4OGQC 4DV1H 1T6AA 3QH9A 1J1DC 1G2CB 1SQPE 1LGHB 4X64H 4JF7A 4DR6H 1SQQK 3U1CA 3MUDA 4I6MC 1SFCC 1BCCD 4OVNF 2FXMA 4Y99C 3Q1MA 3BASA 4W7YA 2M8RA 5CHXA 2LXBA 1EDKA 4D6TE 3HTKA 3L72D 1L4AD 5CBOA 1Q7YQ 3JC22 3L75G 4BXLA 1GD2E 4PDBA 2J5UA 3AE9C 2H7HA 2OTLP 4JI6H 1D7MA 3T97A 3KDPB 4WALA 4KHPH 1RE3C 3MP7B 4H0LB 1H0TA 2E74C 1IBLH 1JTHB 3AEAC 4I7ZB 2P1JA 1IK9A 4HH2A 1CI6A 3KYQA 4EIJA 5DT9A 1JMBA 3Q3DA 1SEIA 2CPBA 5LL6b 4NZTM 3H25A 1YJ9P 3J80W 3I56P 3L73D 1OFCX 4X62H 2GM4A 5KLVJ 1KQFB 3AE4C 1S2EA 2NPSB 2ZVOB 2UWJE 3EWKA 5KKZC 3BVHA 1NTZJ 3CX5E 1N73B 2XKMA 5BR8H 1WHRA 1BSNA 1JMMA 3S9OA 2O1KA 4Y28J 3RK3C 3B8EB 2W27A 3CWBE 4DUZH 2CTKA 1KFNA 5TISH 2QRXA 3D70A 3D71A 5FLXW 5AW8B 2QJPC 1Q90D 1CZQA 1GW4A 1HVVA 1NYHA 1FDMA 3L74J 4H0LD 2BCCG 1SQPK 3QWOC 2CTJA 4LGDE 1Q82Q 4U3FJ 4BRYB 3CMAP 2KNCB 3UIAA 1YBKA 3L70D 1LWUB 2FXOA 4QMAA 4UB8H 1RF1B 1GK4A 3LW5H 2OGUA 5JEAG 1FAVA 1NU1E 1L0LJ 1SQXG 2RN0A 4DR2H 5AVTB 1W2BO 1FOSF 2J59M 3CCQP 1EC5A 2NZ2A 4OO1G 2WITA 3C8VA 1G1IA 4XE5B 1SP4A 4XA4A 2JP3A 3S4RA 4BRYA 4AQRD 1K04A 1YQ3C 1SS1A 1HBWA 1R5SA 3H1LJ 1LWUA 1FOSE 3L37A 1RF1A 2AXTE 2KS1A 4A7PA 2R44A 1GL2A 4PV1B 4ZMDA 1EZVE 2YXQB 1OW6A 1YTZT 1J1EC 5KLVG 3FGAD 1ZRTD 2JKVA 1XRHA 4LF5H 3AECC 4ZKUA 3GABA 1VDFA 3A0BH 3AE5C 1KB9E 1L0NG
chains in the Genus database with same CATH topology
1WTJA 2E75C 2IDBA 1S5LX 4H8AA 3AE3C 2FBWC 2YMKA 2QJPC 3Q1MA 3GLMA 4I7ZC 3D6YA 1X0AA 1PIXA 2FYNC 1K05A 1Q90D 2WQYC 2WSCJ 2E76C 1FDOA 1NYHA 2H88C 4H0LD 1PL5A 1UIXA 3RK3E 1S20A 2E75D 3D6ZA 3AEFC 2X06A 3SFDC 3GF3A 1VF5C 2D2CC 4XFJA 2QJYC 1JB0J 3UOEA 4H44B 4OGQB 1YQ4C 3AEEC 4Z1MH 1RQUA 4KT0J 2O01J 3AE8C 4H13D 2J5UA 2MKVA 3AE1C 3T97B 2ZT9B 1DD4A 3AE9C 1VF5D 1HJ0A 2YIUC 1MKMA 4PV1C 1U57A 4U7JA 4IL6X 1AJYA 1IK7A 2D2CD 1TU3F 3G9RA 1S1CX 3R4YA 3Q5RA 2BEQD 3RL0g 2OQQA 2G3AA 5L8RJ 4H0LB 2G8YA 1GMJA 2E74C 3I0PA 4H13C 4R4MA 3IN6A 1DIPA 4PV1D 2WSEJ 2QJKC 2V7QJ 3AEAC 4I7ZB 5KLIC 1Z2IA 5M1BA 3Q5SA 3GF7A 1ZOYC 1KORA 2NZ2A 1OW7A 2E76B 3C8VA 2K9YA 1KMIZ 2E74D 4YTPC 1PV3A 1EXIA 1HF9A 2JP3A 1OW8A 3Q3DA 1K04A 1YQ3C 2QSIA 2H89C 4R4LA 1KTMA 1ZP0C 4GDOA 4RKUJ 1VL2A 1KILE 2P10A 3AE2C 3AEBC 1FDIA 2BEZF 3Q2YA 3Q5PA 1R8EA 1EXJA 3H25A 3LW5J 2E75B 3ABVC 1Y9BA 4FJSA 4OGQD 4YXDC 4FJUA 2FXPA 2QIWA 1V9NA 3AEDC 1KQFB 1DD3A 2ZT9D 4PV1B 3AE4C 1NXUA 3B71A 2WSFJ 1VBIA 3AEGC 3EWKA 3IAOA 2CWFA 5KKZC 3SFEC 1WMKA 2JO1A 1OMIA 1ZMEC 1NGMB 4H44C 1OW6A 2E74B 4OGQC 4TT3H 3FGAD 4H13B 1VF5B 2WPVB 2ZT9C 2CWHA 3S9OA 3AE6C 4Y28J 2D2CB 1XRHA 1RQVA 1KQGB 3AECC 1ZRTE 3AE7C 2E76D 3GMAA 4H44D 3O6QA 3AE5C 4H0LC 3D70A 3D71A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WTJ A;  3UOE A;  4H8A A;  1NXU A;  1VBI A;  3EWK A;  2CWF A;  1X0A A;  1WMK A;  1OMI A;  1ZME C;  1FDO A;  1AJY A;  1S20 A;  2P10 A;  2CWH A;  2X06 A;  1FDI A;  2G8Y A;  1XRH A;  3I0P A;  3H25 A;  3IN6 A;  4FJS A;  4FJU A;  3O6Q A;  1Z2I A;  1V9N A; 
#chains in the Genus database with same CATH topology
 1Q86 Q;  4YY3 H;  3KDK A;  1YIT P;  2FY8 A;  3MIW A;  1GL2 D;  3CWB D;  1NTZ E;  3WUU A;  3SWK A;  1Z56 A;  1USD A;  4OGQ B;  3ZDM A;  2ZAE B;  1J1D B;  2O01 J;  4AM3 A;  3SWF A;  3G6E P;  3TYY A;  2Z0S A;  2H8P D;  4LFB H;  1IK7 A;  1IFM A;  3I5C A;  4DJG A;  1HGV A;  3KPE A;  3MTU E;  3M0D A;  1SFC B;  3L74 E;  3GR5 A;  2FYU D;  2WWW A;  1RY3 A;  4Y99 B;  4PV1 D;  3VTP C;  2DGR A;  2K9Y A;  1FE6 A;  1XTG B;  1NU1 K;  1FDI A;  1QVG O;  1SQB G;  1DT4 A;  1Y8A A;  3TK1 A;  2B9B A;  2KI7 B;  1L0L E;  1SFC A;  2ZT9 D;  1BCC J;  3PP5 A;  2WSC H;  4PD4 E;  2E74 B;  3L72 J;  3TNU B;  3H1H D;  3H1L E;  2WZ7 A;  2E76 D;  3GMA A;  2B88 A;  2A06 E;  1JY3 N;  3MZW B;  1EZV D;  2E75 C;  5DJU B;  4B8T A;  2HR3 A;  1X0A A;  2QND A;  3RBZ A;  3A0H E;  1BDD A;  1M56 D;  2B89 A;  4IOI H;  1VQP P;  1PL5 A;  1SFC D;  1LTT C;  1FZC C;  1RE3 A;  1PPJ G;  2R5B A;  1N34 H;  2CPM A;  1E79 H;  4JYC A;  2QJY C;  3J81 W;  3TNU A;  3LIE A;  2IBZ G;  1XMQ H;  2MKV A;  2AEM A;  1AJY A;  1BE3 D;  4OX9 H;  2FKW B;  1NTZ K;  4L74 A;  1N86 A;  1X79 B;  3CC4 P;  4LF8 H;  3SWY A;  2Q3E A;  1NAY A;  1GMJ A;  3H1K D;  2KOG A;  4R4M A;  5CCH C;  3L73 J;  1KOR A;  2OTJ P;  4NXM H;  1LT1 A;  1KMI Z;  2E74 D;  1S9K E;  1S5L E;  4GT1 A;  1ZR4 A;  1NTM G;  1CSB A;  3CXH I;  4W80 A;  4ZKP A;  4ASW A;  2VKC A;  2WVR A;  1VQM P;  2KUB A;  1H88 A;  3Q2Y A;  3Q5P A;  1EXJ A;  1N2D C;  4QMF B;  1LTG C;  3VMY A;  4GKK H;  3CI9 A;  2BAS A;  5DJT B;  4JI3 H;  1SQQ G;  4YHH H;  1NXU A;  5C39 A;  1QEX A;  2YKO A;  1UII A;  3H1I G;  2JO1 A;  4JI8 H;  2JEE A;  4H44 C;  1SQP J;  4TT3 H;  1SQV D;  2WPV B;  2KZI A;  2I1J A;  2OYH C;  2JR8 A;  4B8C D;  4LFA H;  3O6Q A;  1L0L K;  1OXZ A;  1PGQ A;  1EQ7 A;  3RK3 D;  3P8C D;  4I1L A;  1PIX A;  2FYN C;  2WMM A;  1BCC E;  3L70 J;  4AYC A;  4N78 E;  1S20 A;  2DW3 A;  5KLI B;  2OYI B;  3L72 E;  5B66 H;  4LF7 H;  5BU8 B;  1LTJ C;  3H1J G;  1VQ7 P;  2A45 H;  3UOE A;  1NTK D;  1J1E B;  1S3J A;  2L5G B;  2LTM A;  2FPH X;  3NCV A;  1SLQ A;  1EDJ A;  3K5B A;  2OQQ A;  4JQ0 D;  2G3A A;  2O3J A;  1X9Z A;  5KAF H;  1IJD B;  2Q1K A;  3JSV C;  2W8Z A;  3BCC G;  1Z2I A;  2PQU A;  3GF7 A;  4DV5 H;  4IFM A;  4DCK A;  4K35 A;  2YQR A;  1GK6 A;  5APW A;  2WSS H;  3L7Z C;  4RKU J;  4K3A A;  4DR7 H;  1QL2 A;  4EYY Q;  2E43 A;  1OIP A;  2IYO A;  1L4A B;  4UB8 E;  4HKZ H;  1BGY E;  3T1H H;  2YKP A;  3L73 E;  2PFX A;  1IZN B;  4L75 A;  1FS0 E;  2Y9Y A;  3CCJ P;  1M1J C;  2IBZ D;  3KDG A;  2KP8 A;  2ANR A;  2B87 B;  2ZT9 C;  3CWB J;  3HE5 A;  5GTH H;  2HPC B;  3HD7 C;  1SQP G;  3W67 A;  4AQY H;  1S5L X;  1MV8 A;  1J5E H;  2YMK A;  5E79 H;  1FZG A;  3NTN A;  1EDI A;  5LMN H;  2E76 C;  2RKL A;  4GOD A;  4JYB A;  4MN4 C;  3NMD A;  3N7N A;  4UB6 H;  2Y9Z A;  2K88 A;  1KIL A;  4D6T G;  2B87 A;  3W68 A;  4XFJ A;  5B5E H;  4IL6 H;  1Q2N A;  2HPC A;  3CX5 I;  5AVZ B;  1YJN P;  2YMY A;  4N78 D;  3T97 B;  1PP9 G;  3TF5 A;  2O01 N;  3A0B E;  4GIF A;  4L76 A;  1H0T B;  1NU1 J;  1K8A Q;  5H2F H;  2I8D A;  3VP8 A;  3L70 E;  2FMR A;  4LF6 H;  2Q6Q A;  1CI6 B;  2W83 C;  2WSF H;  2W6A A;  1JUN A;  1X4N A;  5AVR B;  1FZC B;  1KIL D;  4DOJ A;  4BWN A;  3HUS C;  3NXS A;  2XZR A;  4E9J A;  4B3T H;  3RK2 D;  3TGU D;  1VL2 A;  2QJY B;  4OCH A;  3N4X A;  2UXC H;  2XND H;  1VQ9 P;  3H1H J;  1DD3 A;  1JY2 O;  5AW0 B;  4B86 A;  2MJH A;  3H1J D;  4DV0 H;  2V4H A;  3FXE A;  1FZC A;  5APY A;  2M5A B;  1J5K A;  2UU9 H;  1Q81 Q;  1S72 P;  4WB4 A;  1RE4 C;  2P67 A;  1ZRT E;  5KJ7 D;  1BGY D;  1MZ9 A;  1ODH A;  1HTL C;  1N7L A;  1X8Y A;  2KSE A;  1N7S C;  1FZB A;  1BE3 J;  2E75 D;  1KQS O;  4KHX A;  4DV2 H;  2IFM A;  1OVU A;  1S03 G;  3H1K J;  1M7L A;  3FX0 A;  3M9H A;  2M5A A;  3RBX A;  5CCH A;  1TUA A;  2N1T C;  2PP6 A;  4H44 B;  1MFZ A;  1QVF O;  2KSJ A;  3KZI H;  4Z1M H;  4H13 D;  2OPV A;  1QL1 A;  2WT7 A;  3RL0 C;  1RF0 C;  2CTM A;  5K5G B;  3BRT B;  1T2K C;  4BA2 I;  1NOH A;  3R4Y A;  3RL0 g;  2JJL A;  1KYO D;  1OZH A;  3I0P A;  5APU A;  4IFD G;  2QM8 A;  2QM7 A;  1BDC A;  1NU1 G;  2V7Q J;  2FYN B;  1LTS C;  2O4C A;  3PRJ A;  3CXH H;  2FYU E;  3U59 A;  1JEK A;  2M0B A;  3H32 A;  3P8M C;  2ZM6 H;  3CD6 P;  2W6J H;  5CCH D;  3L71 D;  5KTB A;  2KS1 B;  2POH A;  1FZF A;  3AE2 C;  3AEB C;  2JEA I;  1LTJ B;  2VQE H;  1GL2 B;  2OYH A;  2Y3M A;  1I6U A;  1Y9B A;  4FJS A;  2UUA H;  1DTJ A;  1IFP A;  2FXP A;  3FXD A;  1VQ8 P;  3B71 A;  1WMK A;  4OWF A;  3OA7 A;  1USE A;  2P7J A;  2WPQ A;  1PP9 D;  3U1K A;  3B4S A;  3WU2 E;  1ZLL A;  3E1R A;  4H44 D;  2W6B A;  1PZQ A;  1JCC A;  4JVH A;  1LTJ A;  1ZR2 A;  1V8C A;  5AW1 B;  3H1H E;  3M0A A;  5TJH A;  3CCM P;  3L75 D;  5APQ A;  4JYA H;  2H88 C;  1KYO H;  2FYZ A;  1XTC C;  1VF5 C;  1NTZ G;  2OTK E;  2ZJS E;  2D2C C;  2C0X A;  1AQ5 A;  1P84 I;  1M1J B;  2GUV A;  3IFM A;  3AE1 C;  2ZT9 B;  4DR3 H;  4NPE A;  3U1A A;  2G8Y A;  2ZVN B;  1IBM H;  1BE3 E;  3IN6 A;  1G1J A;  4IFF A;  2JA9 A;  3E1I A;  1ZOY C;  3L74 G;  1BSH A;  3H1K E;  1OW7 A;  2E76 B;  1EXI A;  2C0W A;  5CMZ A;  2XV5 A;  2QSI A;  5B66 E;  1M1J A;  1WRG A;  4U3F G;  2BEZ F;  1L0N E;  1KIL C;  3HD7 A;  4EOT A;  2OPU A;  3RK2 C;  2FYU K;  1IFJ A;  3WMM 0;  2KZJ A;  1L0L G;  1U7J A;  2I1K A;  4DZO A;  4PJ0 E;  3P32 A;  1FC2 C;  1HWT C;  2K9J B;  1YYC A;  1WE8 A;  4DUY H;  1SQV E;  3M9Q A;  2BCC D;  5CJ0 A;  5K36 G;  2XU6 A;  3HUS B;  2IDB A;  1KC8 Q;  3H1L G;  2M3B A;  3C1L A;  2HH3 A;  2A06 G;  1LJ2 A;  3HD7 D;  5KJ7 C;  4LC1 A;  3RK3 E;  3P8C E;  4JBZ A;  2ZYD A;  2UXD H;  3SFD C;  2R3C A;  2M6Q A;  2K9J A;  4TLF A;  5AW7 B;  3I55 P;  5GTH E;  1SQX D;  4C46 A;  3HUS A;  4U7J A;  3USS A;  1NTK E;  1VQ5 P;  2Q7C A;  3G3Z A;  4OD6 A;  3TGU J;  1XNQ H;  1LP1 B;  5E79 E;  1FU1 A;  1HR0 H;  2W90 A;  1AQT A;  1IFN A;  4H13 C;  3WUV A;  1PFI A;  5KKZ B;  2Y0D A;  3CPW O;  4UB6 E;  1VQN P;  3FWN A;  2GUS A;  2E5Y A;  3RGU A;  4K0K H;  2P58 A;  3NFQ A;  3RK3 B;  4WY4 C;  4GDO A;  2C9L Y;  2XNX A;  1GU4 A;  4EI2 A;  3HRN A;  1JM0 A;  1H89 A;  3LW5 J;  1RE4 A;  3ABV C;  5KLV D;  1BGY J;  2GA1 A;  2QJP B;  1LP1 A;  3RL0 B;  5H2F E;  5AVY B;  1KHM A;  4NPF X;  1OMI A;  3CCE P;  2Y0E A;  1N7S A;  4I2L C;  1L0N D;  2CTF A;  3AEV B;  1L0N K;  1RH5 B;  1MUU A;  3O6Q B;  1PGO A;  1RQV A;  3E7K A;  2AEF A;  1KQG B;  2IBZ E;  3BRV B;  1ZN5 A;  2N1T A;  1LTA C;  3CLQ A;  2JE6 I;  1RF0 A;  2NPS C;  3P7K A;  3B5N C;  1ZW0 A;  3F5H A;  1N73 C;  3MGN A;  1BCC G;  3FWL A;  1URQ A;  2MJZ A;  3GF3 A;  5AVX B;  1SQV K;  1N7S D;  2IZ1 A;  3IR9 A;  1AFO A;  1NTM E;  3L72 G;  2ZQE A;  2ZFC A;  1HJ0 A;  2OYO A;  1YJW P;  1A02 J;  2N1T D;  5BVZ A;  1FZA A;  3L71 J;  1K1G A;  1X9V A;  3CC7 P;  3GHG C;  3RL0 D;  2KIK A;  1P84 D;  1T2K D;  1SQB D;  1URQ D;  3V2R A;  1HNW H;  1HF9 A;  4DR1 H;  4GOF A;  1NTK K;  4OH8 B;  5TIS E;  1KV4 A;  1KIL E;  2P10 A;  1S4X A;  2H43 A;  3OTO H;  1PGJ A;  1AVO A;  3TDK A;  1ZZI A;  3TGU E;  1AN7 A;  4YXD C;  3A3Y B;  2QIW A;  5CJ4 A;  4JI2 H;  3VP9 A;  2IYP A;  3M06 A;  3IAO A;  2CWF A;  2YKQ A;  3GW6 A;  3CCV P;  2A1S A;  3HE5 B;  4YPC A;  3L75 J;  3L73 G;  2Q3I A;  2LF0 A;  2P2U A;  4RJT A;  3AE6 C;  3H1J E;  1N36 H;  2JDI H;  1FJG H;  2IPP A;  1LNQ A;  3PHL A;  4RES B;  1ZTG A;  4BA1 I;  1PPJ D;  3AE3 C;  1YIJ P;  1K05 A;  2WSC J;  1FDO A;  1KIL B;  1UIX A;  2PY9 A;  2PGD A;  3OSS D;  4JI7 H;  2SPZ A;  4LFC H;  1W5C E;  3RK2 B;  1P84 H;  2JEB I;  2WPR A;  2KLV A;  1JY3 O;  1DX7 A;  1K9M Q;  4KT0 J;  2LXC B;  2Z4E A;  2P2R A;  1VF5 D;  2K1A A;  1MKM A;  1U57 A;  2D2C D;  2HLO A;  1S1C X;  2F4V H;  1NTM D;  1DIP A;  3L70 G;  2FYU J;  1KYO E;  1A02 F;  4GKG A;  4ZNC A;  1NTM K;  5AW5 B;  3OET A;  4NBQ A;  3VMX A;  2M8W A;  1HNX H;  4GOE A;  3VN0 A;  4JI5 H;  4N6J A;  4R4L A;  1VQ4 P;  1IO4 A;  1KTM A;  2QEX P;  3TSI A;  1SQQ D;  3A5T A;  3H1I D;  5CCG C;  1H8A A;  2E75 B;  5EFW B;  3L71 E;  3MD0 A;  1JOC A;  2YO3 A;  1PGP A;  3V2N A;  2K3R A;  2BCC J;  1VBI A;  2IX7 C;  1U7M A;  2QE7 H;  5KJ7 A;  4B3M H;  4RO0 A;  2FFM A;  1JY2 P;  4H13 B;  2UUB H;  1LTI C;  1S5L H;  1G2C A;  1DH3 A;  1N33 H;  2O01 H;  1PP9 E;  1UG8 A;  1WTJ A;  2WPS A;  4H8A A;  5APX A;  4WY4 B;  5AW6 B;  1SQX J;  1NVO A;  3OJA B;  1EC6 A;  1MFT A;  1X4M A;  2WQY C;  3CXH D;  2R32 A;  1T8Z A;  4W7Z A;  5AW2 B;  2CPQ A;  3AEF C;  2X06 A;  3L75 E;  1IFD A;  2WT7 B;  1T3U A;  1GU5 A;  3CWB G;  4JPZ B;  2LKM A;  3AE8 C;  3SB1 A;  3BCC D;  2R3S A;  2YIU C;  1JNM A;  1E5W A;  4WY4 A;  2E5T A;  2BEQ D;  1HUC A;  2R5D A;  1KQL A;  2NN6 G;  3CC2 P;  2PRR A;  2QJK C;  1VIG A;  3EQ2 A;  5M1B A;  3H32 B;  3B5N B;  1JTH A;  1EZV I;  2FYU G;  5AVQ B;  3C9I A;  2JZX A;  1Y47 A;  4B3S H;  1L0N J;  3JCU H;  2OYH B;  1AA0 A;  4WBA A;  1URQ C;  1KB9 I;  1M8O B;  1M90 Q;  4FJU A;  2AEJ A;  4WY4 D;  2RH0 A;  1OVV A;  3HE4 B;  3VYI A;  3V5B A;  1OVR A;  1CW5 A;  3SFE C;  1SQP D;  3V2P A;  3II6 A;  2NPS A;  3B5N A;  3CCU P;  3MHV A;  3GHG B;  4WWI A;  2FFD C;  1N73 A;  2JWD A;  1SQV J;  2YO2 A;  2ZYG A;  4LLH A;  4LIJ A;  5GTI H;  3VOP A;  3AE7 C;  1KN7 A;  1I94 H;  5C0X G;  4DV6 H;  4ASV A;  4D6T D;  3QD7 X;  3L4F A;  2YNY A;  2NRG A;  3GLM A;  2BCC E;  2A45 I;  3HE4 A;  3L35 A;  1M1K Q;  1JO5 A;  3H1H G;  5KAI H;  1J4W A;  1T3J A;  3CCL P;  3D6Z A;  1DEE G;  1EZV G;  1W2E A;  1ZZK A;  4B3R H;  3GHG A;  4JVY A;  3JAM W;  2NPS D;  4HYT B;  3B5N D;  2BL5 A;  2JWA A;  4M3L A;  4AUW A;  2E42 A;  5AW9 B;  3V6I A;  1NTK J;  1SQB J;  3PH0 A;  1J2J B;  2KNC A;  4G08 A;  1SQX E;  4NPD A;  2WSE H;  3OAK A;  5APS A;  3V2Q A;  1NKN A;  3V4W A;  3O8Z A;  3BAT A;  3Q5S A;  5KLI C;  4AIM A;  1FZE A;  4GKJ H;  2OYI C;  4PD4 I;  1BE3 G;  3CCS P;  1PV3 A;  1RHZ B;  3H1K G;  2LRR A;  2K1H A;  2VRS A;  3HD7 B;  3J7A K;  3T1Y H;  2A45 G;  2YXR B;  1M57 D;  3CX5 D;  1NHL A;  2ZXX A;  4WVZ A;  1R5L A;  2N9Y B;  1QLE D;  2WSF J;  3PTZ A;  5KLV E;  4X66 H;  2HH2 A;  4C7N B;  3H6P A;  2KK7 A;  1LT9 C;  2LTL A;  3R2P A;  1X0T A;  2KLU A;  1L4A C;  1SQV G;  4HB1 A;  1IBK H;  2FBW C;  1IFI A;  5KAF E;  2OAR A;  3A7O A;  1EDL A;  4DR5 H;  3CL3 D;  4DR4 H;  2KXP B;  1OWA A;  4C7N A;  1NTM J;  3MUD C;  3G4S P;  1WVN A;  5IT9 W;  4N3Y B;  3AEE C;  4U3F E;  4JI1 H;  2QVA A;  2RMZ A;  1NU1 D;  1X22 A;  3CCR P;  4IFD K;  3V69 A;  1TU3 F;  4JV5 H;  5AVS B;  2VQF H;  1SQQ J;  2IBZ I;  1SVF A;  3S1K A;  5L8R J;  1NTK G;  5CCG A;  3H1I J;  5AVV B;  3CX5 H;  2E5L H;  1XNR H;  5BU5 A;  4NXN H;  4WAN A;  1P84 E;  4EC5 A;  4C7R A;  5APV A;  1VQL P;  1OW8 A;  5LMU H;  2AXC A;  1ZXG A;  1SQX K;  2UXB H;  1SQB E;  2Z5H A;  2C9N Y;  2CK3 H;  1LTB C;  1NO4 A;  3CME P;  2HFE D;  4DV3 H;  3VMA A;  4OGQ D;  2HG5 D;  1V9N A;  3AED C;  2YIU B;  3EFG A;  1N7S B;  4CPG A;  1HJB A;  3KHU A;  1KD1 Q;  2CPS A;  5CCG D;  3KQG A;  3GG2 A;  2HHH H;  1YTZ I;  5AVW B;  1NGM B;  2CTL A;  3PJS K;  2L91 A;  3H1J J;  5B5E E;  4IL6 E;  2QJK B;  1KB9 D;  1JCD A;  2Q9I A;  2N1T B;  3GKU A;  2JVZ A;  2PT7 G;  3WUT A;  4H0L C;  5KLV K;  2IFN A;  1NTZ D;  4I7Z C;  3ITK A;  1URQ B;  1PPJ E;  3BCC J;  3F89 A;  3EFF K;  2QG4 A;  1HH0 A;  5AW4 B;  2Y0C A;  4DV7 H;  1JB0 J;  1YQ4 C;  1RQU A;  2LR2 A;  2FFD B;  2XDJ A;  3VMZ A;  3WU2 H;  2AXT H;  2CTE A;  2K37 A;  3KXD A;  4JI4 H;  1GW3 A;  1VQO P;  1YI2 P;  3L74 D;  1OX3 A;  1VIH A;  3G9R A;  3G71 P;  4KJM A;  3RF2 A;  4EDF A;  4NZR M;  1NAF A;  2N9B A;  4HJG H;  1N32 H;  2Z5I A;  1N8R Q;  2WSE J;  4U3F D;  1GTW A;  1JY2 N;  1AV1 A;  4X65 H;  1ZV8 A;  1F0X A;  2ZXE B;  4YTP C;  4DV4 H;  4L73 A;  1XMO H;  2H89 C;  5AVU B;  2QA4 P;  1QGK B;  2FFD A;  1KB9 H;  5IWA H;  3M91 A;  1L2P A;  1L0L D;  4JI0 H;  1FKA H;  1SQQ E;  4PD4 D;  5A2Q W;  2ITA A;  3H1I E;  1FJK A;  4YXW H;  3TGU G;  1FJP A;  5AW3 B;  4D6T J;  3A2A A;  1ZME C;  3SSU A;  1SQB K;  3VKE A;  3H1L D;  1VF5 B;  2A06 D;  2CWH A;  1LWU C;  3KZI E;  2D2C B;  1RF1 C;  1PP9 J;  1KYO I;  2Q5U A;  1KFM A;  2HOD B;  2KYV A;  4O9B A;  2D9I A;  3JCU E;  1GL2 C;  1MSZ A;  2HYN A;  3EZJ A;  3D6Y A;  1VPC A;  1VQK P;  1YHQ P;  2E3U A;  1BGY G;  1VQ6 P;  2V7Q H;  3CXH E;  1PQX A;  1AVY A;  2KB7 P;  2PAJ A;  2AXY A;  4PJ0 H;  2ZYA A;  2OYI A;  1DEB A;  3V4Q A;  2HOD A;  2BA0 A;  3FAU A;  5CBN A;  1DD4 A;  5GTI E;  1JY3 P;  4PV1 C;  2IZ0 A;  4IL6 X;  1IC2 A;  1LT9 B;  1NWQ A;  1HNZ H;  1FBM A;  3Q5R A;  2J58 A;  3OW2 O;  2ANN A;  3BCC E;  4PD4 H;  1GZL A;  4LF9 H;  1S9K D;  4LF4 H;  5KAI E;  5APT A;  1HGZ A;  1GDT A;  3LID A;  1K73 Q;  1QX8 A;  1ZP0 C;  3PLN A;  1KZU B;  2WTY A;  3M0D C;  1NJI Q;  1R8E A;  1LT9 A;  3A0H H;  3IF4 A;  1ZZJ A;  2UUC H;  2O1J A;  1NH4 A;  1WT6 A;  3L71 G;  1L4A A;  2M3E A;  3AEG C;  3L36 A;  3HTK B;  4DT0 A;  3M9B A;  1NKZ B;  4OGQ C;  4DV1 H;  1T6A A;  3QH9 A;  1J1D C;  1G2C B;  1SQP E;  1LGH B;  4X64 H;  4JF7 A;  4DR6 H;  1SQQ K;  3U1C A;  3MUD A;  4I6M C;  1SFC C;  1BCC D;  4OVN F;  2FXM A;  4Y99 C;  3Q1M A;  3BAS A;  4W7Y A;  2M8R A;  5CHX A;  2LXB A;  1EDK A;  4D6T E;  3HTK A;  3L72 D;  1L4A D;  5CBO A;  1Q7Y Q;  3JC2 2;  3L75 G;  4BXL A;  1GD2 E;  4PDB A;  2J5U A;  3AE9 C;  2H7H A;  2OTL P;  4JI6 H;  1D7M A;  3T97 A;  3KDP B;  4WAL A;  4KHP H;  1RE3 C;  3MP7 B;  4H0L B;  1H0T A;  2E74 C;  1IBL H;  1JTH B;  3AEA C;  4I7Z B;  2P1J A;  1IK9 A;  4HH2 A;  1CI6 A;  3KYQ A;  4EIJ A;  5DT9 A;  1JMB A;  3Q3D A;  1SEI A;  2CPB A;  5LL6 b;  4NZT M;  3H25 A;  1YJ9 P;  3J80 W;  3I56 P;  3L73 D;  1OFC X;  4X62 H;  2GM4 A;  5KLV J;  1KQF B;  3AE4 C;  1S2E A;  2NPS B;  2ZVO B;  2UWJ E;  3EWK A;  5KKZ C;  3BVH A;  1NTZ J;  3CX5 E;  1N73 B;  2XKM A;  5BR8 H;  1WHR A;  1BSN A;  1JMM A;  3S9O A;  2O1K A;  4Y28 J;  3RK3 C;  3B8E B;  2W27 A;  3CWB E;  4DUZ H;  2CTK A;  1KFN A;  5TIS H;  2QRX A;  3D70 A;  3D71 A;  5FLX W;  5AW8 B;  2QJP C;  1Q90 D;  1CZQ A;  1GW4 A;  1HVV A;  1NYH A;  1FDM A;  3L74 J;  4H0L D;  2BCC G;  1SQP K;  3QWO C;  2CTJ A;  4LGD E;  1Q82 Q;  4U3F J;  4BRY B;  3CMA P;  2KNC B;  3UIA A;  1YBK A;  3L70 D;  1LWU B;  2FXO A;  4QMA A;  4UB8 H;  1RF1 B;  1GK4 A;  3LW5 H;  2OGU A;  5JEA G;  1FAV A;  1NU1 E;  1L0L J;  1SQX G;  2RN0 A;  4DR2 H;  5AVT B;  1W2B O;  1FOS F;  2J59 M;  3CCQ P;  1EC5 A;  2NZ2 A;  4OO1 G;  2WIT A;  3C8V A;  1G1I A;  4XE5 B;  1SP4 A;  4XA4 A;  2JP3 A;  3S4R A;  4BRY A;  4AQR D;  1K04 A;  1YQ3 C;  1SS1 A;  1HBW A;  1R5S A;  3H1L J;  1LWU A;  1FOS E;  3L37 A;  1RF1 A;  2AXT E;  2KS1 A;  4A7P A;  2R44 A;  1GL2 A;  4PV1 B;  4ZMD A;  1EZV E;  2YXQ B;  1OW6 A;  1YTZ T;  1J1E C;  5KLV G;  3FGA D;  1ZRT D;  2JKV A;  1XRH A;  4LF5 H;  3AEC C;  4ZKU A;  3GAB A;  1VDF A;  3A0B H;  3AE5 C;  1KB9 E;  1L0N G; 
#chains in the Genus database with same CATH homology
 1WTJ A;  2E75 C;  2IDB A;  1S5L X;  4H8A A;  3AE3 C;  2FBW C;  2YMK A;  2QJP C;  3Q1M A;  3GLM A;  4I7Z C;  3D6Y A;  1X0A A;  1PIX A;  2FYN C;  1K05 A;  1Q90 D;  2WQY C;  2WSC J;  2E76 C;  1FDO A;  1NYH A;  2H88 C;  4H0L D;  1PL5 A;  1UIX A;  3RK3 E;  1S20 A;  2E75 D;  3D6Z A;  3AEF C;  2X06 A;  3SFD C;  3GF3 A;  1VF5 C;  2D2C C;  4XFJ A;  2QJY C;  1JB0 J;  3UOE A;  4H44 B;  4OGQ B;  1YQ4 C;  3AEE C;  4Z1M H;  1RQU A;  4KT0 J;  2O01 J;  3AE8 C;  4H13 D;  2J5U A;  2MKV A;  3AE1 C;  3T97 B;  2ZT9 B;  1DD4 A;  3AE9 C;  1VF5 D;  1HJ0 A;  2YIU C;  1MKM A;  4PV1 C;  1U57 A;  4U7J A;  4IL6 X;  1AJY A;  1IK7 A;  2D2C D;  1TU3 F;  3G9R A;  1S1C X;  3R4Y A;  3Q5R A;  2BEQ D;  3RL0 g;  2OQQ A;  2G3A A;  5L8R J;  4H0L B;  2G8Y A;  1GMJ A;  2E74 C;  3I0P A;  4H13 C;  4R4M A;  3IN6 A;  1DIP A;  4PV1 D;  2WSE J;  2QJK C;  2V7Q J;  3AEA C;  4I7Z B;  5KLI C;  1Z2I A;  5M1B A;  3Q5S A;  3GF7 A;  1ZOY C;  1KOR A;  2NZ2 A;  1OW7 A;  2E76 B;  3C8V A;  2K9Y A;  1KMI Z;  2E74 D;  4YTP C;  1PV3 A;  1EXI A;  1HF9 A;  2JP3 A;  1OW8 A;  3Q3D A;  1K04 A;  1YQ3 C;  2QSI A;  2H89 C;  4R4L A;  1KTM A;  1ZP0 C;  4GDO A;  4RKU J;  1VL2 A;  1KIL E;  2P10 A;  3AE2 C;  3AEB C;  1FDI A;  2BEZ F;  3Q2Y A;  3Q5P A;  1R8E A;  1EXJ A;  3H25 A;  3LW5 J;  2E75 B;  3ABV C;  1Y9B A;  4FJS A;  4OGQ D;  4YXD C;  4FJU A;  2FXP A;  2QIW A;  1V9N A;  3AED C;  1KQF B;  1DD3 A;  2ZT9 D;  4PV1 B;  3AE4 C;  1NXU A;  3B71 A;  2WSF J;  1VBI A;  3AEG C;  3EWK A;  3IAO A;  2CWF A;  5KKZ C;  3SFE C;  1WMK A;  2JO1 A;  1OMI A;  1ZME C;  1NGM B;  4H44 C;  1OW6 A;  2E74 B;  4OGQ C;  4TT3 H;  3FGA D;  4H13 B;  1VF5 B;  2WPV B;  2ZT9 C;  2CWH A;  3S9O A;  3AE6 C;  4Y28 J;  2D2C B;  1XRH A;  1RQV A;  1KQG B;  3AEC C;  1ZRT E;  3AE7 C;  2E76 D;  3GMA A;  4H44 D;  3O6Q A;  3AE5 C;  4H0L C;  3D70 A;  3D71 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...