2G8YA

The structure of a putative malate/lactate dehydrogenase from e. coli.
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
359
structure length
359
Chain Sequence
b'SGHRFDAQTLHSFIQAVFRQMGSEEQEAKLVADHLIAANLAGHDSHGIGMFPSYVRSWSQGHLQINHHAKTVKEAGAAVTLDGDRAFGQVAAHEAMALGIEKAHQHGIAAVALHNSHHIGRIGYWAEQCAAAGFVSIHFVSVVGIPMVAPFHGRDSRFGTNPFCVVFPRKDNFPLLLDYATSAIAFGKTRVAWHKGVPVPPGCLIDVNGVPTTNPAVMQESPLGSLLTFAEHKGYALAAMCEILGGALSGGKTTHQETLQTSPDAILNCMTTIIINPELFGAPDCNAQTEAFAEWVKASPHDDDKPILLPGEWEVNTRRERQKQGIPLDAGSWQAICDAARQIGMPEETLQAFCQQLAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Malate/L-lactate dehydrogenases
molecule tags Oxidoreductase
source organism Escherichia coli
publication title The structure of a putative malate/lactate dehydrogenase from E. coli.
rcsb
total genus 113
structure length 359
sequence length 359
chains with identical sequence B
ec nomenclature ec 1.1.1.237: Hydroxyphenylpyruvate reductase.
pdb deposition date 2006-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02615 Ldh_2 Malate/L-lactate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1530.10 Mainly Alpha Orthogonal Bundle Hypothetical Oxidoreductase Yiak; Chain: A, domain 1 Hypothetical Oxidoreductase Yiak; Chain: A, domain 1 2g8yA01
1.20.5.460 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2g8yA03
3.30.1370.60 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Hypothetical oxidoreductase yiak; domain 2 2g8yA02
1NXUA 1S20A 1WMKA 2CWFA 3O6QA 4H8AA 2G8YA 1V9NA 1FDIA 1WTJA 4FJSA 1FDOA 3H25A 1ZMEC 1OMIA 1AJYA 1Z2IA 3UOEA 3EWKA 1XRHA 2P10A 4FJUA 2X06A 1VBIA 3I0PA 1X0AA 3IN6A 2CWHA
chains in the Genus database with same CATH superfamily
1EDIA 2FXMA 1NYHA 1FJGH 1URQC 3NFQA 2NN6G 3SB1A 1ZRTD 1NJIQ 3L73G 1W2EA 1Y9BA 1J4WA 2KXPB 1GL2A 3H1IJ 1AV1A 2Y3MA 5AVQB 1U57A 3P8MC 3CCEP 5KLVD 4PJ0H 5EFWB 2FYUD 4L76A 1YJWP 2JEAI 2K9YA 1GU4A 2A06G 1T2KC 1SQQK 3C8VA 3H1IG 3L75E 4GKKH 3NTNA 3VOPA 3VN0A 4RESB 1BGYE 1KQSO 3U1KA 3N4XA 1FDIA 4WB4A 3A3YB 2O01N 1IBLH 1S4XA 1S1CX 1L0LJ 1Q86Q 2FYUJ 5KAIE 5IT9W 5CBOA 5AVRB 3EZJA 4DJGA 1SLQA 2K37A 2D2CB 4TT3H 1RHZB 2WITA 1H89A 1PP9D 3AE9C 1M1JC 2E3UA 1SQXK 2WSCJ 2YMYA 3H1HE 3KZIH 3H1HG 3B5NC 1NTZE 2WSFH 5GTIH 4JVYA 2FYUG 2HH2A 2JKVA 3L36A 4BXLA 2JDIH 3AE1C 3CPWO 5KJ7C 1NH4A 2JP3A 2F4VH 2YKPA 1NTMD 4H13B 5CJ4A 1RH5B 4JI3H 1FJKA 2KLUA 2KP8A 1SQPK 5APYA 3JC22 4DUZH 1LWUA 1XTGB 1VL2A 3W68A 1NOHA 1MZ9A 1XTCC 1VQLP 1GMJA 3BATA 3T1HH 2HPCB 1HTLC 3M0AA 5AW3B 1SQXG 3HE5B 4LF7H 4HKZH 2HR3A 2IYPA 2N1TD 3HD7A 2ITAA 2O3JA 4DV4H 3QH9A 3KZIE 2ZYGA 4O9BA 4B8TA 2ZYAA 5GTIE 2KS1B 3V4WA 1LTBC 1GK4A 1SQPE 3N7NA 1BCCJ 4I6MC 1KB9E 3W67A 1PGQA 1X9VA 2XU6A 2UUCH 2JZXA 1QL2A 3L72G 1M1KQ 5BU8B 2A06D 1Q90D 1NTZG 2C0XA 2ZVNB 2PGDA 3KHUA 3VMYA 5B5EH 1BCCE 3OAKA 4JI2H 4X65H 3CXHI 4DV3H 4DR1H 1N2DC 4KT0J 4N78E 2KNCB 3HUSA 4LF6H 2OTKE 2CWFA 3BASA 2VQEH 3VP8A 3JAMW 1QVGO 2UXDH 2W83C 4R4MA 1GL2B 3T97B 1PP9E 3OTOH 3Q5SA 3A0HH 1IK7A 1HJ0A 1N7SC 4OVNF 3A2AA 3AE2C 1H88A 2N1TA 1URQB 1OFCX 4C7RA 1X4NA 3AE7C 4LC1A 3MP7B 1HH0A 1NU1J 3D6ZA 1BDCA 1L0NE 1SQPJ 2AEFA 1KYOE 3WUVA 2KUBA 1HJBA 2YO2A 1NO4A 5JEAG 3O6QB 5AVWB 4LFAH 1NU1E 5TJHA 1EQ7A 3RL0g 3AEVB 2N9BA 3FAUA 1FZCB 1VBIA 2A06E 3U1CA 1G1JA 4KHPH 2FXOA 2IDBA 3RF2A 1H0TB 4GOFA 1KQLA 1QX8A 1FDMA 2WT7A 1NTKK 1PPJD 5KJ7A 1KTMA 2B9BA 2IBZD 2WMMA 2ANNA 2Y0CA 1K73Q 1T3JA 3H1ID 1SQBG 3SFEC 3FXDA 1NHLA 3CL3D 3G6EP 2OTJP 2QG4A 3PRJA 2E75C 1SQQJ 5AW1B 1E79H 1SFCC 4IL6X 2FXPA 4I2LC 2JWAA 2WSEH 3H1LG 2P10A 1G1IA 4CPGA 2Q1KA 4Y28J 3L71E 3WU2H 2MKVA 2IBZI 1HBWA 2OARA 4JQ0D 2PP6A 2V7QJ 2XV5A 1Q2NA 2BCCG 2B89A 2WQYC 1L4AB 3BCCG 2R44A 2KK7A 4AUWA 2L5GB 2LKMA 2R32A 2FBWC 4XFJA 2WSEJ 3OA7A 3JSVC 2BCCJ 2OYOA 3HE4A 4LF8H 2C9NY 4D6TG 1QEXA 4I1LA 3IAOA 2ZT9B 1SQVG 3TGUJ 4HYTB 2JWDA 1LT9B 1OWAA 3L74E 5LMUH 1NTKD 5E79E 3KYQA 4R4LA 2V4HA 3JCUH 3BCCE 2R5BA 2CTEA 1M57D 4WANA 4U3FJ 2BCCE 3USSA 1HF9A 4ZKUA 2KSJA 1IZNB 1SQQE 1R5LA 1SVFA 3Q5RA 1XNQH 2QSIA 1NKZB 2FYZA 3HE4B 1SQVK 3CCQP 3RK3C 1IJDB 2RH0A 3CC7P 5K36G 2WPRA 3I5CA 3UOEA 5AW5B 2XDJA 4DV0H 3WU2E 2O01J 2FKWB 5KAFE 1N73C 1LTTC 1SQBE 2Q3EA 3CC2P 3A5TA 3A0BE 3AE5C 2IPPA 1SQXE 1KYOI 3TK1A 3L74J 3CMEP 2KZIA 2ZT9D 4JYCA 3D6YA 2W27A 5CCGC 3TGUE 2KB7P 2FYUE 3WUTA 1RE3A 4C46A 2FFDB 4JI4H 3G3ZA 3GHGA 1VQ4P 1PGPA 1IFMA 4PD4H 1SQPD 1VF5B 3CWBD 4ASVA 2E5YA 1EZVE 3HTKA 3RK3D 2JJLA 3RGUA 2I1KA 1K8AQ 2JEEA 1YBKA 5DT9A 2MJZA 4JI5H 5KTBA 1KB9H 1KILD 2QE7H 4U3FD 1DD3A 2E76C 4A7PA 1NKNA 4LF9H 4DR2H 4H8AA 2AXTE 3FWLA 1FZAA 1OW6A 4B3RH 3OW2O 4X66H 1J1EB 3HD7C 2C9LY 3GF7A 1N73B 4HB1A 3LW5J 4ZNCA 1KMIZ 1RF1B 1KILC 1LGHB 2KYVA 1FE6A 2Y9YA 4OGQD 4N6JA 1PV3A 3ZDMA 1ZLLA 4B3SH 3M9BA 4JI0H 3F89A 3EFGA 1BE3D 1K1GA 2OYHB 4IFDG 2WSCH 3R2PA 2QM7A 1GL2C 2M3EA 1SEIA 1J5KA 1M1JB 4YHHH 4FJUA 1J1DB 3LW5H 4XE5B 5AVSB 1DEBA 2Y0EA 4EOTA 3CI9A 2FPHX 1MUUA 1BCCD 4U7JA 3CXHH 1FOSF 1V8CA 2GUSA 1PQXA 1BSHA 1J5EH 1PFIA 1N36H 2E5TA 2OYHC 4D6TD 1P84I 3IN6A 1KD1Q 3E7KA 1WRGA 4IFFA 2LXBA 2O4CA 4I7ZC 3MD0A 4PV1D 4PJ0E 1YQ4C 1DEEG 1N32H 1NAFA 4JVHA 5KKZB 1VQ8P 1M7LA 2UXBH 1N7SA 2Z5HA 2UWJE 5B66H 4EYYQ 2OPVA 4L73A 1JY3N 3GLMA 1OVRA 2JO1A 3AEEC 1FJPA 1OXZA 5APXA 2N9YB 1S2EA 1X79B 3TGUG 1OX3A 2YNYA 3CWBG 3KQGA 3V6IA 4L74A 3L37A 4RO0A 4JV5H 3CCRP 5KLIC 1SFCB 4UB8E 4AYCA 1OZHA 3J81W 2E75B 1NTMG 1VQ7P 2KS1A 2DW3A 2R3CA 3RK3E 4K35A 1GTWA 1G2CA 1NAYA 3R4YA 3CD6P 3HTKB 1N73A 3I56P 1FBMA 2E42A 3AEAC 1X9ZA 1KYOH 4LIJA 1CW5A 5CJ0A 3GW6A 1Q81Q 1MKMA 1NU1K 1SQXD 3M0DA 1IFIA 5AVVB 4DV5H 1GW4A 4E9JA 2FFDA 3G4SP 3Q5PA 3L75G 2VQFH 2UUAH 2FMRA 5AW8B 1JEKA 1AJYA 3V4QA 2ZJSE 1BE3G 2PFXA 3IR9A 4DCKA 4DV2H 4JYBA 1AQTA 2ZM6H 4YTPC 1SQBD 2CPSA 3KDGA 2H89C 3ABVC 1DT4A 3L75J 2NPSB 2AXCA 3H1HJ 1HGZA 2BEZF 1DX7A 1HR0H 1HGVA 1CSBA 2A1SA 2BCCD 2HLOA 3EWKA 1A02F 2H7HA 3GR5A 4JI7H 1K9MQ 1X0TA 3H1KE 2KOGA 1EDLA 4Y99B 3CX5E 2CTJA 2QJPB 5LMNH 2BEQD 1RF0C 4H44B 1KN7A 1KILA 3JCUE 1M8OB 3IF4A 2N1TB 4PV1B 5BU5A 3D70A 2OPUA 1T6AA 2JVZA 1LP1A 3L74D 2I1JA 1W2BO 1PP9G 5CCHA 3L70J 3CXHD 2LR2A 2WVRA 4DR3H 3BRVB 1IO4A 1S72P 2RKLA 2OYHA 3E1RA 1HNZH 3AECC 4OD6A 2FY8A 3GKUA 2E74D 1FAVA 1HVVA 2OYIB 1WMKA 1ZP0C 2XNXA 2N1TC 1HUCA 2Q3IA 4NZTM 4GIFA 1JTHB 1GU5A 3L70D 3L71G 1YQ3C 4QMFB 1K05A 1KQGB 3QWOC 2WPQA 3ITKA 4NPDA 1J2JB 3MUDA 1SFCD 2ZFCA 3AE6C 3L72J 4UB8H 4TLFA 3SSUA 2LF0A 1S5LE 2FFMA 1P84D 2WWWA 1FZBA 1VIGA 1VPCA 1JMBA 1USEA 2NPSD 3FXEA 3H1JJ 3B5NB 2BL5A 1EDKA 3CX5H 2AXYA 4W7ZA 2PQUA 2O01H 4GOEA 1QLED 1RE4A 1YYCA 2WPVB 1SQBK 2IBZG 2A45I 2R3SA 1KV4A 1FOSE 3H1JG 1MSZA 3H1HD 4DUYH 1IC2A 2AXTH 1VQ9P 1L0NJ 5APTA 1KZUB 3L73J 2CPMA 2B88A 1L4AD 3M0DC 4DR5H 5H2FH 1UIXA 4JI8H 4NXNH 4JI1H 1L0NG 4DR4H 2QA4P 1OIPA 2R5DA 2FYUK 2ZQEA 4W80A 5IWAH 1QGKB 3CX5D 2A45G 3EFFK 1SQQD 1SP4A 2W6JH 1ZTGA 1LNQA 1ZR2A 1S9KD 4C7NA 4I7ZB 1P84H 2CK3H 1GZLA 1NXUA 1SQVE 3AE3C 4GKGA 5CHXA 5KLVE 3B71A 3J7AK 3CCSP 2V7QH 2ANRA 4LLHA 1W5CE 1LT9A 2K3RA 1N33H 4GDOA 1MFZA 1GK6A 2M8RA 2ZT9C 2WSSH 2X06A 3NCVA 4B3MH 1S03G 1WTJA 1RF1A 4EIJA 2QRXA 2QVAA 5B66E 2KLVA 1AVYA 3B8EB 3H1LJ 2KIKA 1KC8Q 3P8CE 2OGUA 3CCUP 2XNDH 3CXHE 2NPSA 1JY2O 3K5BA 1JOCA 3H1KG 5APVA 2JEBI 2HPCA 3MHVA 3AEGC 5AW9B 3FWNA 5AW4B 4UB6H 2C0WA 2G3AA 1LTGC 2BA0A 3L70E 3GHGB 3L70G 1KHMA 5AVXB 2AEJA 2VRSA 2AEMA 1PGJA 3H1JE 2XZRA 3Q1MA 3L73E 3KPEA 1XMOH 3I0PA 3B5NA 3PHLA 4KJMA 1U7MA 1OW7A 1VQOP 4BRYB 4X64H 5DJUB 2P58A 3H25A 2POHA 1VF5C 4U3FG 1VF5D 5AVTB 1XMQH 1CZQA 1NTZD 1SFCA 2HH3A 5C39A 2Z4EA 1PL5A 4NPEA 1NTME 2Q6QA 3TF5A 1L0LK 3MIWA 1EC6A 1JO5A 1E5WA 1VQKP 1N7SB 2M5AB 1LWUB 4AQYH 3VMXA 1IFNA 4PDBA 4GT1A 3M9QA 3V2PA 5AW7B 2P67A 2QJKC 1XRHA 1R5SA 3QD7X 5GTHH 2JE6I 1LTSC 1SQVD 1N34H 5LL6b 3V2NA 2M6QA 2CPBA 4AIMA 2NZ2A 3L71D 1QL1A 1N8RQ 1BGYG 3G9RA 4PD4D 5M1BA 3KDKA 3P7KA 1LP1B 5KKZC 2P2UA 2B87B 4OGQC 4BA1I 1QVFO 3M06A 4WY4A 3C9IA 1K04A 4DOJA 2P7JA 3GMAA 1LTJC 2XKMA 1VQPP 2WTYA 1KYOD 2QJYC 3TDKA 1RY3A 1GW3A 5L8RJ 4B8CD 1JY3P 2KNCA 2Q9IA 2GA1A 3B5ND 2E74B 3BRTB 3T97A 3LIDA 4FJSA 2P1JA 1DD4A 3RK2C 2CTFA 2IFMA 1Z2IA 1S3JA 2E76D 4EI2A 3H1LE 1YIJP 3PH0A 2Z5IA 4QMAA 3II6A 5E79H 3HUSB 1LT9C 1PZQA 4H13D 4C7NB 4U3FE 1EDJA 1RE4C 2CTKA 3RK2B 3OJAB 1ZMEC 1NU1G 1N86A 4PD4E 1ZV8A 1JCDA 4GKJH 1HNWH 5AVYB 1LJ2A 3GF3A 1JB0J 1YJ9P 1LTIC 2RN0A 1FZFA 4EDFA 1GD2E 1AQ5A 3RBXA 4NZRM 1DH3A 1M90Q 4NPFX 1WVNA 1SQQG 1NGMB 3HD7D 2KZJA 3RBZA 1YJNP 2HFED 5APWA 2WT7B 5BR8H 3A0BH 2E43A 1FZGA 1KFNA 1JY2P 2YKOA 4K3AA 3RL0D 4RJTA 5FLXW 1GDTA 3RK3B 2YXRB 1EC5A 3HRNA 2WPSA 2IYOA 2W6AA 2QNDA 4IOIH 3CCJP 1TU3F 3U59A 2O1JA 5H2FE 4WVZA 3KXDA 4DZOA 2J58A 1FU1A 5AW0B 1ZW0A 3H1KJ 1H0TA 2OTLP 2PAJA 2UXCH 4W7YA 3H1JD 1AA0A 4D6TJ 4PV1C 1UG8A 2D2CC 1X8YA 2IZ0A 2CTLA 2IZ1A 1RE3C 2W6BA 3BCCD 5AW6B 1YITP 2L91A 2E75D 3VMZA 3FX0A 2Y9ZA 4LFCH 1ZR4A 1MV8A 2VKCA 1LWUC 2W90A 2BASA 2ZXXA 5BVZA 1MFTA 3CWBJ 2B87A 1NU1D 3G71P 2E76B 2FYNB 4UB6E 2J5UA 3V5BA 4EC5A 1BCCG 4YPCA 4YXDC 4JI6H 3V2RA 1BE3E 1IFPA 4XA4A 3J80W 1OVVA 1SQVJ 2MJHA 1JY2N 3H32A 3Q2YA 2YIUB 3AE4C 4WALA 2H88C 3PLNA 1Y8AA 2HG5D 3WUUA 2PY9A 2ZYDA 1LTJB 4OWFA 2LRRA 1ZOYC 4LGDE 3IFMA 5CCHC 1NTKJ 1J1DC 2HODB 2K1AA 1S5LX 3WMM0 4N3YB 1H8AA 1M56D 4OGQB 4Y99C 3BVHA 1L2PA 1Q82Q 2KI7B 4WY4C 4PD4I 1IBMH 3MZWB 2UU9H 1BE3J 3CC4P 1NWQA 4JF7A 4BRYA 4HJGH 4OH8B 4JYAH 1VQNP 1X4MA 2I8DA 5KJ7D 4LF4H 1HNXH 3CWBE 5APSA 3HD7B 2IFNA 1J1EC 5KAFH 2D9IA 1USDA 2WSFJ 1IBKH 2LTLA 2QIWA 2P2RA 3TNUB 3P32A 1TUAA 2J59M 1DIPA 4LFBH 1I6UA 3H6PA 1SQPG 3LIEA 1KB9D 2OQQA 1ZZIA 4RKUJ 3D71A 1KQFB 4G08A 2LTMA 1NVOA 3NMDA 4BA2I 1BGYD 2PT7G 3GG2A 1IFJA 1S5LH 4B86A 1ZZKA 3Q3DA 1JTHA 4LF5H 3SWFA 4X62H 3OETA 3U1AA 2CTMA 4H0LD 2M8WA 2A45H 1A02J 1URQD 1NTZK 3M91A 5APUA 1YI2P 1X0AA 3H32B 3O6QA 1RQUA 1FKAH 5KLVK 3CMAP 2QJYB 4NBQA 1FDOA 1FS0E 5K5GB 2M0BA 3C1LA 1VQ6P 3MGNA 4NXMH 2E74C 4JPZB 3L71J 2HODA 1SQBJ 2YIUC 5C0XG 1UIIA 1NTMK 3TYYA 1LTAC 2QJKB 1X22A 1URQA 1L0NK 2O1KA 4DV1H 4H44D 3CCVP 1ODHA 1L0LE 3L72D 1JCCA 4H0LB 1KORA 2W8ZA 3RK2D 3RL0B 1L0LD 1JY3O 4WBAA 3VYIA 1T2KD 4DV7H 3BCCJ 5CCGD 2K9JB 2YO3A 2WZ7A 4YXWH 3V69A 3L75D 4L75A 3S9OA 4H0LC 5GTHE 3SFDC 2GM4A 3VP9A 4IL6H 4K0KH 3V2QA 3L7ZC 2M5AA 2JR8A 3SWYA 1P84E 1BSNA 3AEFC 3TNUA 2K1HA 5AVZB 1OVUA 1L4AC 4DR6H 1VDFA 1KILE 5TISE 5CCGA 2Z0SA 3AE8C 3H1KD 4DR7H 4OX9H 1HWTC 1F0XA 1V9NA 3S1KA 3MTUE 1ZN5A 5B5EE 2JA9A 4BWNA 2ZVOB 1CI6A 3H1IE 5A2QW 4H13C 3NXSA 5AVUB 1ZRTE 4DT0A 1Y47A 1JNMA 5KLVG 1N7LA 1FZEA 2YKQA 1NTKG 1WE8A 1VQ5P 3H1LD 5CCHD 1Q7YQ 1NTMJ 1JMMA 3P8CD 3T1YH 3I55P 1EZVD 3TSIA 5KLIB 3EQ2A 1G2CB 1L0LG 1VIHA 1T8ZA 2E5LH 1LTJA 5KLVJ 3UIAA 5CBNA 3A0HE 1AN7A 1ZZJA 2OYIA 3VMAA 1FZCA 4IFDK 3L74G 1S20A 1ZXGA 5KAIH 5APQA 1YTZT 4KHXA 2YQRA 1YTZI 3S4RA 4IL6E 2Q7CA 3GHGC 3CCMP 4DV6H 1GL2D 2K88A 1L0ND 3RL0C 1EZVI 2K9JA 4OCHA 4YY3H 2FYNC 1RF0A 3HUSC 2UUBH 1T3UA 2NRGA 2ZAEB 1OW8A 1PP9J 3CLQA 1BDDA 5TISH 1FC2C 1D7MA 4OO1G 1YHQP 4Z1MH 2H43A 2OYIC 1EXIA 4ASWA 3PP5A 4WY4B 4HH2A 4AQRD 2DGRA 2ZXEB 1NTKE 4D6TE 1PPJG 1R8EA 3OSSD 4GODA 3F5HA 2GUVA 2G8YA 1DTJA 2M3BA 1M1JA 3M9HA 4JBZA 2QM8A 2FFDC 1SQXJ 4N78D 4ZMDA 2LXCB 2QJPC 1EZVG 1KILB 3PTZA 1EXJA 2H8PD 1AVOA 1I94H 2IX7C 1LT1A 3SWKA 1N7SD 3L35A 3B4SA 4H44C 3AEBC 5CMZA 3VTPC 4MN4C 1JM0A 1JUNA 5DJTB 1KB9I 4WWIA 1SS1A 1AFOA 1Z56A 2CWHA 1XNRH 2YXQB 2HHHH 2Q5UA 1NTZJ 2Y0DA 3AEDC 3GABA 1PPJE 3VKEA 3PJSK 2NPSC 1OMIA 1IFDA 3MUDC 1S9KE 1L4AA 1CI6B 2RMZA 3L73D 3KDPB 5AW2B 2PRRA 1VQMP 1WHRA 4AM3A 2CPQA 3E1IA 1IK9A 2D2CD 4IFMA 3L4FA 1WT6A 1FZCC 2SPZA 3FGAD 1RQVA 3HE5A 2KSEA 1BGYJ 4M3LA 4B3TH 1KFMA 3L72E 1RF1C 3A7OA 4ZKPA 1PGOA 2QEXP 3TGUD 1PIXA 3CCLP 2IBZE 3CX5I 3O8ZA 4WY4D 1U7JA 2HYNA 2YMKA
chains in the Genus database with same CATH topology
4H13B 4OGQD 3O6QA 1S5LX 2CWFA 1RQUA 2E75C 1PV3A 2E75B 1NYHA 1R8EA 2NZ2A 2G8YA 1V9NA 4OGQB 3RK3E 3G9RA 1FDOA 3R4YA 5M1BA 3AEGC 5KKZC 4IL6X 1UIXA 2E74C 3UOEA 2FXPA 3AEAC 4OGQC 4R4MA 4H13C 2O01J 2QJPC 1VL2A 3T97B 1K04A 1ZRTE 3Q5SA 2P10A 2YIUC 1TU3F 1Y9BA 3GMAA 4FJUA 3AECC 1MKMA 4Y28J 1EXJA 1IK7A 1HJ0A 3AE5C 3AE2C 2QJYC 2MKVA 2E74D 2G3AA 1GMJA 1WMKA 1ZP0C 2V7QJ 4U7JA 5L8RJ 3Q5PA 2ZT9D 2E74B 1U57A 2WQYC 3AE7C 4FJSA 3D6YA 1DD4A 4H44D 4H44C 1AJYA 1Z2IA 4PV1C 2D2CC 2E76D 1YQ3C 3Q1MA 1K05A 1KQGB 2K9YA 3AEBC 3D6ZA 4H0LB 1KORA 2FBWC 4XFJA 3C8VA 4YTPC 4I7ZB 3I0PA 3AE6C 2WSFJ 3IN6A 2CWHA 2WSEJ 1NXUA 2H89C 4H13D 2QIWA 3ABVC 1S20A 3AE3C 1OW7A 2E75D 1VF5B 3B71A 3AEDC 1FDIA 2BEZF 3H25A 1DIPA 4I7ZC 1VF5C 1ZMEC 1OMIA 1VF5D 4PV1D 3RL0g 1S1CX 3IAOA 2ZT9B 4GDOA 1YQ4C 3S9OA 4H0LC 3SFDC 3EWKA 2ZT9C 2OQQA 2D2CB 1PL5A 4RKUJ 2E76B 4TT3H 1KQFB 2X06A 1VBIA 3D71A 2FYNC 3GF3A 1JB0J 3AE9C 1DD3A 2E76C 2D2CD 2J5UA 1Q90D 2IDBA 2WSCJ 2WPVB 4R4LA 2BEQD 3FGAD 4H8AA 3GLMA 1OW6A 3Q3DA 4YXDC 1RQVA 1OW8A 3AEFC 1WTJA 2JO1A 3AEEC 1NGMB 4H44B 1HF9A 4Z1MH 3Q2YA 3GF7A 3AE4C 2H88C 3LW5J 1KTMA 3AE1C 1EXIA 4H0LD 4KT0J 2QJKC 1KMIZ 1XRHA 4PV1B 1PIXA 1KILE 2JP3A 5KLIC 3Q5RA 3AE8C 3SFEC 1ZOYC 2QSIA 3D70A 1X0AA 2YMKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NXU A;  1S20 A;  1WMK A;  2CWF A;  3O6Q A;  4H8A A;  2G8Y A;  1V9N A;  1FDI A;  1WTJ A;  4FJS A;  1FDO A;  3H25 A;  1ZME C;  1OMI A;  1AJY A;  1Z2I A;  3UOE A;  3EWK A;  1XRH A;  2P10 A;  4FJU A;  2X06 A;  1VBI A;  3I0P A;  1X0A A;  3IN6 A;  2CWH A; 
#chains in the Genus database with same CATH topology
 1EDI A;  2FXM A;  1NYH A;  1FJG H;  1URQ C;  3NFQ A;  2NN6 G;  3SB1 A;  1ZRT D;  1NJI Q;  3L73 G;  1W2E A;  1Y9B A;  1J4W A;  2KXP B;  1GL2 A;  3H1I J;  1AV1 A;  2Y3M A;  5AVQ B;  1U57 A;  3P8M C;  3CCE P;  5KLV D;  4PJ0 H;  5EFW B;  2FYU D;  4L76 A;  1YJW P;  2JEA I;  2K9Y A;  1GU4 A;  2A06 G;  1T2K C;  1SQQ K;  3C8V A;  3H1I G;  3L75 E;  4GKK H;  3NTN A;  3VOP A;  3VN0 A;  4RES B;  1BGY E;  1KQS O;  3U1K A;  3N4X A;  1FDI A;  4WB4 A;  3A3Y B;  2O01 N;  1IBL H;  1S4X A;  1S1C X;  1L0L J;  1Q86 Q;  2FYU J;  5KAI E;  5IT9 W;  5CBO A;  5AVR B;  3EZJ A;  4DJG A;  1SLQ A;  2K37 A;  2D2C B;  4TT3 H;  1RHZ B;  2WIT A;  1H89 A;  1PP9 D;  3AE9 C;  1M1J C;  2E3U A;  1SQX K;  2WSC J;  2YMY A;  3H1H E;  3KZI H;  3H1H G;  3B5N C;  1NTZ E;  2WSF H;  5GTI H;  4JVY A;  2FYU G;  2HH2 A;  2JKV A;  3L36 A;  4BXL A;  2JDI H;  3AE1 C;  3CPW O;  5KJ7 C;  1NH4 A;  2JP3 A;  2F4V H;  2YKP A;  1NTM D;  4H13 B;  5CJ4 A;  1RH5 B;  4JI3 H;  1FJK A;  2KLU A;  2KP8 A;  1SQP K;  5APY A;  3JC2 2;  4DUZ H;  1LWU A;  1XTG B;  1VL2 A;  3W68 A;  1NOH A;  1MZ9 A;  1XTC C;  1VQL P;  1GMJ A;  3BAT A;  3T1H H;  2HPC B;  1HTL C;  3M0A A;  5AW3 B;  1SQX G;  3HE5 B;  4LF7 H;  4HKZ H;  2HR3 A;  2IYP A;  2N1T D;  3HD7 A;  2ITA A;  2O3J A;  4DV4 H;  3QH9 A;  3KZI E;  2ZYG A;  4O9B A;  4B8T A;  2ZYA A;  5GTI E;  2KS1 B;  3V4W A;  1LTB C;  1GK4 A;  1SQP E;  3N7N A;  1BCC J;  4I6M C;  1KB9 E;  3W67 A;  1PGQ A;  1X9V A;  2XU6 A;  2UUC H;  2JZX A;  1QL2 A;  3L72 G;  1M1K Q;  5BU8 B;  2A06 D;  1Q90 D;  1NTZ G;  2C0X A;  2ZVN B;  2PGD A;  3KHU A;  3VMY A;  5B5E H;  1BCC E;  3OAK A;  4JI2 H;  4X65 H;  3CXH I;  4DV3 H;  4DR1 H;  1N2D C;  4KT0 J;  4N78 E;  2KNC B;  3HUS A;  4LF6 H;  2OTK E;  2CWF A;  3BAS A;  2VQE H;  3VP8 A;  3JAM W;  1QVG O;  2UXD H;  2W83 C;  4R4M A;  1GL2 B;  3T97 B;  1PP9 E;  3OTO H;  3Q5S A;  3A0H H;  1IK7 A;  1HJ0 A;  1N7S C;  4OVN F;  3A2A A;  3AE2 C;  1H88 A;  2N1T A;  1URQ B;  1OFC X;  4C7R A;  1X4N A;  3AE7 C;  4LC1 A;  3MP7 B;  1HH0 A;  1NU1 J;  3D6Z A;  1BDC A;  1L0N E;  1SQP J;  2AEF A;  1KYO E;  3WUV A;  2KUB A;  1HJB A;  2YO2 A;  1NO4 A;  5JEA G;  3O6Q B;  5AVW B;  4LFA H;  1NU1 E;  5TJH A;  1EQ7 A;  3RL0 g;  3AEV B;  2N9B A;  3FAU A;  1FZC B;  1VBI A;  2A06 E;  3U1C A;  1G1J A;  4KHP H;  2FXO A;  2IDB A;  3RF2 A;  1H0T B;  4GOF A;  1KQL A;  1QX8 A;  1FDM A;  2WT7 A;  1NTK K;  1PPJ D;  5KJ7 A;  1KTM A;  2B9B A;  2IBZ D;  2WMM A;  2ANN A;  2Y0C A;  1K73 Q;  1T3J A;  3H1I D;  1SQB G;  3SFE C;  3FXD A;  1NHL A;  3CL3 D;  3G6E P;  2OTJ P;  2QG4 A;  3PRJ A;  2E75 C;  1SQQ J;  5AW1 B;  1E79 H;  1SFC C;  4IL6 X;  2FXP A;  4I2L C;  2JWA A;  2WSE H;  3H1L G;  2P10 A;  1G1I A;  4CPG A;  2Q1K A;  4Y28 J;  3L71 E;  3WU2 H;  2MKV A;  2IBZ I;  1HBW A;  2OAR A;  4JQ0 D;  2PP6 A;  2V7Q J;  2XV5 A;  1Q2N A;  2BCC G;  2B89 A;  2WQY C;  1L4A B;  3BCC G;  2R44 A;  2KK7 A;  4AUW A;  2L5G B;  2LKM A;  2R32 A;  2FBW C;  4XFJ A;  2WSE J;  3OA7 A;  3JSV C;  2BCC J;  2OYO A;  3HE4 A;  4LF8 H;  2C9N Y;  4D6T G;  1QEX A;  4I1L A;  3IAO A;  2ZT9 B;  1SQV G;  3TGU J;  4HYT B;  2JWD A;  1LT9 B;  1OWA A;  3L74 E;  5LMU H;  1NTK D;  5E79 E;  3KYQ A;  4R4L A;  2V4H A;  3JCU H;  3BCC E;  2R5B A;  2CTE A;  1M57 D;  4WAN A;  4U3F J;  2BCC E;  3USS A;  1HF9 A;  4ZKU A;  2KSJ A;  1IZN B;  1SQQ E;  1R5L A;  1SVF A;  3Q5R A;  1XNQ H;  2QSI A;  1NKZ B;  2FYZ A;  3HE4 B;  1SQV K;  3CCQ P;  3RK3 C;  1IJD B;  2RH0 A;  3CC7 P;  5K36 G;  2WPR A;  3I5C A;  3UOE A;  5AW5 B;  2XDJ A;  4DV0 H;  3WU2 E;  2O01 J;  2FKW B;  5KAF E;  1N73 C;  1LTT C;  1SQB E;  2Q3E A;  3CC2 P;  3A5T A;  3A0B E;  3AE5 C;  2IPP A;  1SQX E;  1KYO I;  3TK1 A;  3L74 J;  3CME P;  2KZI A;  2ZT9 D;  4JYC A;  3D6Y A;  2W27 A;  5CCG C;  3TGU E;  2KB7 P;  2FYU E;  3WUT A;  1RE3 A;  4C46 A;  2FFD B;  4JI4 H;  3G3Z A;  3GHG A;  1VQ4 P;  1PGP A;  1IFM A;  4PD4 H;  1SQP D;  1VF5 B;  3CWB D;  4ASV A;  2E5Y A;  1EZV E;  3HTK A;  3RK3 D;  2JJL A;  3RGU A;  2I1K A;  1K8A Q;  2JEE A;  1YBK A;  5DT9 A;  2MJZ A;  4JI5 H;  5KTB A;  1KB9 H;  1KIL D;  2QE7 H;  4U3F D;  1DD3 A;  2E76 C;  4A7P A;  1NKN A;  4LF9 H;  4DR2 H;  4H8A A;  2AXT E;  3FWL A;  1FZA A;  1OW6 A;  4B3R H;  3OW2 O;  4X66 H;  1J1E B;  3HD7 C;  2C9L Y;  3GF7 A;  1N73 B;  4HB1 A;  3LW5 J;  4ZNC A;  1KMI Z;  1RF1 B;  1KIL C;  1LGH B;  2KYV A;  1FE6 A;  2Y9Y A;  4OGQ D;  4N6J A;  1PV3 A;  3ZDM A;  1ZLL A;  4B3S H;  3M9B A;  4JI0 H;  3F89 A;  3EFG A;  1BE3 D;  1K1G A;  2OYH B;  4IFD G;  2WSC H;  3R2P A;  2QM7 A;  1GL2 C;  2M3E A;  1SEI A;  1J5K A;  1M1J B;  4YHH H;  4FJU A;  1J1D B;  3LW5 H;  4XE5 B;  5AVS B;  1DEB A;  2Y0E A;  4EOT A;  3CI9 A;  2FPH X;  1MUU A;  1BCC D;  4U7J A;  3CXH H;  1FOS F;  1V8C A;  2GUS A;  1PQX A;  1BSH A;  1J5E H;  1PFI A;  1N36 H;  2E5T A;  2OYH C;  4D6T D;  1P84 I;  3IN6 A;  1KD1 Q;  3E7K A;  1WRG A;  4IFF A;  2LXB A;  2O4C A;  4I7Z C;  3MD0 A;  4PV1 D;  4PJ0 E;  1YQ4 C;  1DEE G;  1N32 H;  1NAF A;  4JVH A;  5KKZ B;  1VQ8 P;  1M7L A;  2UXB H;  1N7S A;  2Z5H A;  2UWJ E;  5B66 H;  4EYY Q;  2OPV A;  4L73 A;  1JY3 N;  3GLM A;  1OVR A;  2JO1 A;  3AEE C;  1FJP A;  1OXZ A;  5APX A;  2N9Y B;  1S2E A;  1X79 B;  3TGU G;  1OX3 A;  2YNY A;  3CWB G;  3KQG A;  3V6I A;  4L74 A;  3L37 A;  4RO0 A;  4JV5 H;  3CCR P;  5KLI C;  1SFC B;  4UB8 E;  4AYC A;  1OZH A;  3J81 W;  2E75 B;  1NTM G;  1VQ7 P;  2KS1 A;  2DW3 A;  2R3C A;  3RK3 E;  4K35 A;  1GTW A;  1G2C A;  1NAY A;  3R4Y A;  3CD6 P;  3HTK B;  1N73 A;  3I56 P;  1FBM A;  2E42 A;  3AEA C;  1X9Z A;  1KYO H;  4LIJ A;  1CW5 A;  5CJ0 A;  3GW6 A;  1Q81 Q;  1MKM A;  1NU1 K;  1SQX D;  3M0D A;  1IFI A;  5AVV B;  4DV5 H;  1GW4 A;  4E9J A;  2FFD A;  3G4S P;  3Q5P A;  3L75 G;  2VQF H;  2UUA H;  2FMR A;  5AW8 B;  1JEK A;  1AJY A;  3V4Q A;  2ZJS E;  1BE3 G;  2PFX A;  3IR9 A;  4DCK A;  4DV2 H;  4JYB A;  1AQT A;  2ZM6 H;  4YTP C;  1SQB D;  2CPS A;  3KDG A;  2H89 C;  3ABV C;  1DT4 A;  3L75 J;  2NPS B;  2AXC A;  3H1H J;  1HGZ A;  2BEZ F;  1DX7 A;  1HR0 H;  1HGV A;  1CSB A;  2A1S A;  2BCC D;  2HLO A;  3EWK A;  1A02 F;  2H7H A;  3GR5 A;  4JI7 H;  1K9M Q;  1X0T A;  3H1K E;  2KOG A;  1EDL A;  4Y99 B;  3CX5 E;  2CTJ A;  2QJP B;  5LMN H;  2BEQ D;  1RF0 C;  4H44 B;  1KN7 A;  1KIL A;  3JCU E;  1M8O B;  3IF4 A;  2N1T B;  4PV1 B;  5BU5 A;  3D70 A;  2OPU A;  1T6A A;  2JVZ A;  1LP1 A;  3L74 D;  2I1J A;  1W2B O;  1PP9 G;  5CCH A;  3L70 J;  3CXH D;  2LR2 A;  2WVR A;  4DR3 H;  3BRV B;  1IO4 A;  1S72 P;  2RKL A;  2OYH A;  3E1R A;  1HNZ H;  3AEC C;  4OD6 A;  2FY8 A;  3GKU A;  2E74 D;  1FAV A;  1HVV A;  2OYI B;  1WMK A;  1ZP0 C;  2XNX A;  2N1T C;  1HUC A;  2Q3I A;  4NZT M;  4GIF A;  1JTH B;  1GU5 A;  3L70 D;  3L71 G;  1YQ3 C;  4QMF B;  1K05 A;  1KQG B;  3QWO C;  2WPQ A;  3ITK A;  4NPD A;  1J2J B;  3MUD A;  1SFC D;  2ZFC A;  3AE6 C;  3L72 J;  4UB8 H;  4TLF A;  3SSU A;  2LF0 A;  1S5L E;  2FFM A;  1P84 D;  2WWW A;  1FZB A;  1VIG A;  1VPC A;  1JMB A;  1USE A;  2NPS D;  3FXE A;  3H1J J;  3B5N B;  2BL5 A;  1EDK A;  3CX5 H;  2AXY A;  4W7Z A;  2PQU A;  2O01 H;  4GOE A;  1QLE D;  1RE4 A;  1YYC A;  2WPV B;  1SQB K;  2IBZ G;  2A45 I;  2R3S A;  1KV4 A;  1FOS E;  3H1J G;  1MSZ A;  3H1H D;  4DUY H;  1IC2 A;  2AXT H;  1VQ9 P;  1L0N J;  5APT A;  1KZU B;  3L73 J;  2CPM A;  2B88 A;  1L4A D;  3M0D C;  4DR5 H;  5H2F H;  1UIX A;  4JI8 H;  4NXN H;  4JI1 H;  1L0N G;  4DR4 H;  2QA4 P;  1OIP A;  2R5D A;  2FYU K;  2ZQE A;  4W80 A;  5IWA H;  1QGK B;  3CX5 D;  2A45 G;  3EFF K;  1SQQ D;  1SP4 A;  2W6J H;  1ZTG A;  1LNQ A;  1ZR2 A;  1S9K D;  4C7N A;  4I7Z B;  1P84 H;  2CK3 H;  1GZL A;  1NXU A;  1SQV E;  3AE3 C;  4GKG A;  5CHX A;  5KLV E;  3B71 A;  3J7A K;  3CCS P;  2V7Q H;  2ANR A;  4LLH A;  1W5C E;  1LT9 A;  2K3R A;  1N33 H;  4GDO A;  1MFZ A;  1GK6 A;  2M8R A;  2ZT9 C;  2WSS H;  2X06 A;  3NCV A;  4B3M H;  1S03 G;  1WTJ A;  1RF1 A;  4EIJ A;  2QRX A;  2QVA A;  5B66 E;  2KLV A;  1AVY A;  3B8E B;  3H1L J;  2KIK A;  1KC8 Q;  3P8C E;  2OGU A;  3CCU P;  2XND H;  3CXH E;  2NPS A;  1JY2 O;  3K5B A;  1JOC A;  3H1K G;  5APV A;  2JEB I;  2HPC A;  3MHV A;  3AEG C;  5AW9 B;  3FWN A;  5AW4 B;  4UB6 H;  2C0W A;  2G3A A;  1LTG C;  2BA0 A;  3L70 E;  3GHG B;  3L70 G;  1KHM A;  5AVX B;  2AEJ A;  2VRS A;  2AEM A;  1PGJ A;  3H1J E;  2XZR A;  3Q1M A;  3L73 E;  3KPE A;  1XMO H;  3I0P A;  3B5N A;  3PHL A;  4KJM A;  1U7M A;  1OW7 A;  1VQO P;  4BRY B;  4X64 H;  5DJU B;  2P58 A;  3H25 A;  2POH A;  1VF5 C;  4U3F G;  1VF5 D;  5AVT B;  1XMQ H;  1CZQ A;  1NTZ D;  1SFC A;  2HH3 A;  5C39 A;  2Z4E A;  1PL5 A;  4NPE A;  1NTM E;  2Q6Q A;  3TF5 A;  1L0L K;  3MIW A;  1EC6 A;  1JO5 A;  1E5W A;  1VQK P;  1N7S B;  2M5A B;  1LWU B;  4AQY H;  3VMX A;  1IFN A;  4PDB A;  4GT1 A;  3M9Q A;  3V2P A;  5AW7 B;  2P67 A;  2QJK C;  1XRH A;  1R5S A;  3QD7 X;  5GTH H;  2JE6 I;  1LTS C;  1SQV D;  1N34 H;  5LL6 b;  3V2N A;  2M6Q A;  2CPB A;  4AIM A;  2NZ2 A;  3L71 D;  1QL1 A;  1N8R Q;  1BGY G;  3G9R A;  4PD4 D;  5M1B A;  3KDK A;  3P7K A;  1LP1 B;  5KKZ C;  2P2U A;  2B87 B;  4OGQ C;  4BA1 I;  1QVF O;  3M06 A;  4WY4 A;  3C9I A;  1K04 A;  4DOJ A;  2P7J A;  3GMA A;  1LTJ C;  2XKM A;  1VQP P;  2WTY A;  1KYO D;  2QJY C;  3TDK A;  1RY3 A;  1GW3 A;  5L8R J;  4B8C D;  1JY3 P;  2KNC A;  2Q9I A;  2GA1 A;  3B5N D;  2E74 B;  3BRT B;  3T97 A;  3LID A;  4FJS A;  2P1J A;  1DD4 A;  3RK2 C;  2CTF A;  2IFM A;  1Z2I A;  1S3J A;  2E76 D;  4EI2 A;  3H1L E;  1YIJ P;  3PH0 A;  2Z5I A;  4QMA A;  3II6 A;  5E79 H;  3HUS B;  1LT9 C;  1PZQ A;  4H13 D;  4C7N B;  4U3F E;  1EDJ A;  1RE4 C;  2CTK A;  3RK2 B;  3OJA B;  1ZME C;  1NU1 G;  1N86 A;  4PD4 E;  1ZV8 A;  1JCD A;  4GKJ H;  1HNW H;  5AVY B;  1LJ2 A;  3GF3 A;  1JB0 J;  1YJ9 P;  1LTI C;  2RN0 A;  1FZF A;  4EDF A;  1GD2 E;  1AQ5 A;  3RBX A;  4NZR M;  1DH3 A;  1M90 Q;  4NPF X;  1WVN A;  1SQQ G;  1NGM B;  3HD7 D;  2KZJ A;  3RBZ A;  1YJN P;  2HFE D;  5APW A;  2WT7 B;  5BR8 H;  3A0B H;  2E43 A;  1FZG A;  1KFN A;  1JY2 P;  2YKO A;  4K3A A;  3RL0 D;  4RJT A;  5FLX W;  1GDT A;  3RK3 B;  2YXR B;  1EC5 A;  3HRN A;  2WPS A;  2IYO A;  2W6A A;  2QND A;  4IOI H;  3CCJ P;  1TU3 F;  3U59 A;  2O1J A;  5H2F E;  4WVZ A;  3KXD A;  4DZO A;  2J58 A;  1FU1 A;  5AW0 B;  1ZW0 A;  3H1K J;  1H0T A;  2OTL P;  2PAJ A;  2UXC H;  4W7Y A;  3H1J D;  1AA0 A;  4D6T J;  4PV1 C;  1UG8 A;  2D2C C;  1X8Y A;  2IZ0 A;  2CTL A;  2IZ1 A;  1RE3 C;  2W6B A;  3BCC D;  5AW6 B;  1YIT P;  2L91 A;  2E75 D;  3VMZ A;  3FX0 A;  2Y9Z A;  4LFC H;  1ZR4 A;  1MV8 A;  2VKC A;  1LWU C;  2W90 A;  2BAS A;  2ZXX A;  5BVZ A;  1MFT A;  3CWB J;  2B87 A;  1NU1 D;  3G71 P;  2E76 B;  2FYN B;  4UB6 E;  2J5U A;  3V5B A;  4EC5 A;  1BCC G;  4YPC A;  4YXD C;  4JI6 H;  3V2R A;  1BE3 E;  1IFP A;  4XA4 A;  3J80 W;  1OVV A;  1SQV J;  2MJH A;  1JY2 N;  3H32 A;  3Q2Y A;  2YIU B;  3AE4 C;  4WAL A;  2H88 C;  3PLN A;  1Y8A A;  2HG5 D;  3WUU A;  2PY9 A;  2ZYD A;  1LTJ B;  4OWF A;  2LRR A;  1ZOY C;  4LGD E;  3IFM A;  5CCH C;  1NTK J;  1J1D C;  2HOD B;  2K1A A;  1S5L X;  3WMM 0;  4N3Y B;  1H8A A;  1M56 D;  4OGQ B;  4Y99 C;  3BVH A;  1L2P A;  1Q82 Q;  2KI7 B;  4WY4 C;  4PD4 I;  1IBM H;  3MZW B;  2UU9 H;  1BE3 J;  3CC4 P;  1NWQ A;  4JF7 A;  4BRY A;  4HJG H;  4OH8 B;  4JYA H;  1VQN P;  1X4M A;  2I8D A;  5KJ7 D;  4LF4 H;  1HNX H;  3CWB E;  5APS A;  3HD7 B;  2IFN A;  1J1E C;  5KAF H;  2D9I A;  1USD A;  2WSF J;  1IBK H;  2LTL A;  2QIW A;  2P2R A;  3TNU B;  3P32 A;  1TUA A;  2J59 M;  1DIP A;  4LFB H;  1I6U A;  3H6P A;  1SQP G;  3LIE A;  1KB9 D;  2OQQ A;  1ZZI A;  4RKU J;  3D71 A;  1KQF B;  4G08 A;  2LTM A;  1NVO A;  3NMD A;  4BA2 I;  1BGY D;  2PT7 G;  3GG2 A;  1IFJ A;  1S5L H;  4B86 A;  1ZZK A;  3Q3D A;  1JTH A;  4LF5 H;  3SWF A;  4X62 H;  3OET A;  3U1A A;  2CTM A;  4H0L D;  2M8W A;  2A45 H;  1A02 J;  1URQ D;  1NTZ K;  3M91 A;  5APU A;  1YI2 P;  1X0A A;  3H32 B;  3O6Q A;  1RQU A;  1FKA H;  5KLV K;  3CMA P;  2QJY B;  4NBQ A;  1FDO A;  1FS0 E;  5K5G B;  2M0B A;  3C1L A;  1VQ6 P;  3MGN A;  4NXM H;  2E74 C;  4JPZ B;  3L71 J;  2HOD A;  1SQB J;  2YIU C;  5C0X G;  1UII A;  1NTM K;  3TYY A;  1LTA C;  2QJK B;  1X22 A;  1URQ A;  1L0N K;  2O1K A;  4DV1 H;  4H44 D;  3CCV P;  1ODH A;  1L0L E;  3L72 D;  1JCC A;  4H0L B;  1KOR A;  2W8Z A;  3RK2 D;  3RL0 B;  1L0L D;  1JY3 O;  4WBA A;  3VYI A;  1T2K D;  4DV7 H;  3BCC J;  5CCG D;  2K9J B;  2YO3 A;  2WZ7 A;  4YXW H;  3V69 A;  3L75 D;  4L75 A;  3S9O A;  4H0L C;  5GTH E;  3SFD C;  2GM4 A;  3VP9 A;  4IL6 H;  4K0K H;  3V2Q A;  3L7Z C;  2M5A A;  2JR8 A;  3SWY A;  1P84 E;  1BSN A;  3AEF C;  3TNU A;  2K1H A;  5AVZ B;  1OVU A;  1L4A C;  4DR6 H;  1VDF A;  1KIL E;  5TIS E;  5CCG A;  2Z0S A;  3AE8 C;  3H1K D;  4DR7 H;  4OX9 H;  1HWT C;  1F0X A;  1V9N A;  3S1K A;  3MTU E;  1ZN5 A;  5B5E E;  2JA9 A;  4BWN A;  2ZVO B;  1CI6 A;  3H1I E;  5A2Q W;  4H13 C;  3NXS A;  5AVU B;  1ZRT E;  4DT0 A;  1Y47 A;  1JNM A;  5KLV G;  1N7L A;  1FZE A;  2YKQ A;  1NTK G;  1WE8 A;  1VQ5 P;  3H1L D;  5CCH D;  1Q7Y Q;  1NTM J;  1JMM A;  3P8C D;  3T1Y H;  3I55 P;  1EZV D;  3TSI A;  5KLI B;  3EQ2 A;  1G2C B;  1L0L G;  1VIH A;  1T8Z A;  2E5L H;  1LTJ A;  5KLV J;  3UIA A;  5CBN A;  3A0H E;  1AN7 A;  1ZZJ A;  2OYI A;  3VMA A;  1FZC A;  4IFD K;  3L74 G;  1S20 A;  1ZXG A;  5KAI H;  5APQ A;  1YTZ T;  4KHX A;  2YQR A;  1YTZ I;  3S4R A;  4IL6 E;  2Q7C A;  3GHG C;  3CCM P;  4DV6 H;  1GL2 D;  2K88 A;  1L0N D;  3RL0 C;  1EZV I;  2K9J A;  4OCH A;  4YY3 H;  2FYN C;  1RF0 A;  3HUS C;  2UUB H;  1T3U A;  2NRG A;  2ZAE B;  1OW8 A;  1PP9 J;  3CLQ A;  1BDD A;  5TIS H;  1FC2 C;  1D7M A;  4OO1 G;  1YHQ P;  4Z1M H;  2H43 A;  2OYI C;  1EXI A;  4ASW A;  3PP5 A;  4WY4 B;  4HH2 A;  4AQR D;  2DGR A;  2ZXE B;  1NTK E;  4D6T E;  1PPJ G;  1R8E A;  3OSS D;  4GOD A;  3F5H A;  2GUV A;  2G8Y A;  1DTJ A;  2M3B A;  1M1J A;  3M9H A;  4JBZ A;  2QM8 A;  2FFD C;  1SQX J;  4N78 D;  4ZMD A;  2LXC B;  2QJP C;  1EZV G;  1KIL B;  3PTZ A;  1EXJ A;  2H8P D;  1AVO A;  1I94 H;  2IX7 C;  1LT1 A;  3SWK A;  1N7S D;  3L35 A;  3B4S A;  4H44 C;  3AEB C;  5CMZ A;  3VTP C;  4MN4 C;  1JM0 A;  1JUN A;  5DJT B;  1KB9 I;  4WWI A;  1SS1 A;  1AFO A;  1Z56 A;  2CWH A;  1XNR H;  2YXQ B;  2HHH H;  2Q5U A;  1NTZ J;  2Y0D A;  3AED C;  3GAB A;  1PPJ E;  3VKE A;  3PJS K;  2NPS C;  1OMI A;  1IFD A;  3MUD C;  1S9K E;  1L4A A;  1CI6 B;  2RMZ A;  3L73 D;  3KDP B;  5AW2 B;  2PRR A;  1VQM P;  1WHR A;  4AM3 A;  2CPQ A;  3E1I A;  1IK9 A;  2D2C D;  4IFM A;  3L4F A;  1WT6 A;  1FZC C;  2SPZ A;  3FGA D;  1RQV A;  3HE5 A;  2KSE A;  1BGY J;  4M3L A;  4B3T H;  1KFM A;  3L72 E;  1RF1 C;  3A7O A;  4ZKP A;  1PGO A;  2QEX P;  3TGU D;  1PIX A;  3CCL P;  2IBZ E;  3CX5 I;  3O8Z A;  4WY4 D;  1U7J A;  2HYN A;  2YMK A; 
#chains in the Genus database with same CATH homology
 4H13 B;  4OGQ D;  3O6Q A;  1S5L X;  2CWF A;  1RQU A;  2E75 C;  1PV3 A;  2E75 B;  1NYH A;  1R8E A;  2NZ2 A;  2G8Y A;  1V9N A;  4OGQ B;  3RK3 E;  3G9R A;  1FDO A;  3R4Y A;  5M1B A;  3AEG C;  5KKZ C;  4IL6 X;  1UIX A;  2E74 C;  3UOE A;  2FXP A;  3AEA C;  4OGQ C;  4R4M A;  4H13 C;  2O01 J;  2QJP C;  1VL2 A;  3T97 B;  1K04 A;  1ZRT E;  3Q5S A;  2P10 A;  2YIU C;  1TU3 F;  1Y9B A;  3GMA A;  4FJU A;  3AEC C;  1MKM A;  4Y28 J;  1EXJ A;  1IK7 A;  1HJ0 A;  3AE5 C;  3AE2 C;  2QJY C;  2MKV A;  2E74 D;  2G3A A;  1GMJ A;  1WMK A;  1ZP0 C;  2V7Q J;  4U7J A;  5L8R J;  3Q5P A;  2ZT9 D;  2E74 B;  1U57 A;  2WQY C;  3AE7 C;  4FJS A;  3D6Y A;  1DD4 A;  4H44 D;  4H44 C;  1AJY A;  1Z2I A;  4PV1 C;  2D2C C;  2E76 D;  1YQ3 C;  3Q1M A;  1K05 A;  1KQG B;  2K9Y A;  3AEB C;  3D6Z A;  4H0L B;  1KOR A;  2FBW C;  4XFJ A;  3C8V A;  4YTP C;  4I7Z B;  3I0P A;  3AE6 C;  2WSF J;  3IN6 A;  2CWH A;  2WSE J;  1NXU A;  2H89 C;  4H13 D;  2QIW A;  3ABV C;  1S20 A;  3AE3 C;  1OW7 A;  2E75 D;  1VF5 B;  3B71 A;  3AED C;  1FDI A;  2BEZ F;  3H25 A;  1DIP A;  4I7Z C;  1VF5 C;  1ZME C;  1OMI A;  1VF5 D;  4PV1 D;  3RL0 g;  1S1C X;  3IAO A;  2ZT9 B;  4GDO A;  1YQ4 C;  3S9O A;  4H0L C;  3SFD C;  3EWK A;  2ZT9 C;  2OQQ A;  2D2C B;  1PL5 A;  4RKU J;  2E76 B;  4TT3 H;  1KQF B;  2X06 A;  1VBI A;  3D71 A;  2FYN C;  3GF3 A;  1JB0 J;  3AE9 C;  1DD3 A;  2E76 C;  2D2C D;  2J5U A;  1Q90 D;  2IDB A;  2WSC J;  2WPV B;  4R4L A;  2BEQ D;  3FGA D;  4H8A A;  3GLM A;  1OW6 A;  3Q3D A;  4YXD C;  1RQV A;  1OW8 A;  3AEF C;  1WTJ A;  2JO1 A;  3AEE C;  1NGM B;  4H44 B;  1HF9 A;  4Z1M H;  3Q2Y A;  3GF7 A;  3AE4 C;  2H88 C;  3LW5 J;  1KTM A;  3AE1 C;  1EXI A;  4H0L D;  4KT0 J;  2QJK C;  1KMI Z;  1XRH A;  4PV1 B;  1PIX A;  1KIL E;  2JP3 A;  5KLI C;  3Q5R A;  3AE8 C;  3SFE C;  1ZOY C;  2QSI A;  3D70 A;  1X0A A;  2YMK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...