2K1HA

Solution nmr structure of ser13 from staphylococcus epidermidis. northeast structural genomics consortium target ser13
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
86
structure length
86
Chain Sequence
MEIIAISETPNHNTMKVSLSEPRQDNSFTTYTAAQEGQPEFINRLFEIEGVKSIFYVLDFISIDKEDNANWNELLPQIENTFAKSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein SeR13
publication title Solution Structure of SeR13.
rcsb
source organism Staphylococcus epidermidis
molecule tags Structural genomics, unknown function
total genus 12
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2008-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08712 Nfu_N Scaffold protein Nfu/NifU N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Scaffold protein Nfu/NifU, N-terminal domain 2k1hA00
2FFMA 2LTLA 1PQXA 2M6QA 2M8WA 2LTMA 2K1HA
chains in the Genus database with same CATH superfamily
4JI6H 3EZJA 4JI4H 1V9NA 2X06A 4AQYH 2M8WA 4LFAH 3JAMW 2A1SA 4YY3H 4WALA 4NZRM 1Z2IA 2JVZA 2AXYA 4LFBH 4NXMH 4LF7H 2VKCA 4H8AA 2LRRA 2ZM6H 1N36H 4JI1H 2OPUA 2CTJA 2OPVA 3AEVB 1WHRA 2JEAI 4B3SH 4B3TH 4DV3H 4JVHA 1XRHA 4DR3H 2D9IA 1N34H 2UU9H 3OSSD 1K1GA 4OD6A 2DGRA 3J80W 4DUYH 1XNRH 2E3UA 4OCHA 2CPMA 3GKUA 4X66H 2UUAH 2BL5A 1HNWH 1FKAH 4DR1H 4B3MH 3GR5A 4WANA 5A2QW 2CWFA 2JA9A 2HHHH 3L7ZC 4JVYA 2CTKA 2HH3A 3V69A 4DV6H 1ZTGA 4X62H 2K1HA 4DV5H 1NXUA 1ZZJA 1IBLH 4LF8H 4NXNH 1VIHA 1TUAA 4JI3H 2CPQA 2JEBI 2M6QA 4DV1H 1HR0H 2Z0SA 4FJSA 4DR2H 4JI7H 4DV7H 4LIJA 2MJHA 2Y3MA 1MSZA 4LFCH 5LMNH 4EC5A 1AN7A 1ZZKA 1WE8A 2VQEH 1S20A 4DV0H 3T1YH 4LF5H 5IT9W 1XNQH 4YHHH 2CTFA 4DR7H 3KDKA 4DR4H 1V8CA 2E5LH 4B8CD 1UG8A 4X65H 4BA1I 4FJUA 4DV4H 1IBMH 2NN6G 1VIGA 4G08A 1X9ZA 4JI2H 2P2RA 4PDBA 2UXCH 2CWHA 2CTEA 4QMFB 3VKEA 4K0KH 1DT4A 5LMUH 4LF9H 2JE6I 2HH2A 2PY9A 5IWAH 1FJGH 4NBQA 1VBIA 3QD7X 1PQXA 2LTLA 3I0PA 5K36G 4X64H 4DR5H 4LF6H 1HNZH 2ANRA 4IFDG 4OO1G 4LF4H 3UOEA 3FAUA 1ODHA 1X4MA 5DT9A 3RF2A 3NCVA 4E9JA 5LL6b 2FFMA 2QNDA 3J7AK 1N33H 3GABA 1X4NA 3OETA 2VQFH 2G8YA 2YQRA 1F0XA 2UUCH 1J5EH 2LF0A 2O4CA 5JEAG 4DR6H 4DUZH 2PT7G 3T1HH 4KHPH 2JZXA 4OX9H 2UUBH 4BA2I 2CTLA 4JYAH 4GKJH 2LTMA 4NZTM 1J4WA 2BA0A 2ANNA 2PQUA 2FMRA 1XMQH 3OTOH 3J81W 1J5KA 1S03G 1I6UA 1EC6A 2UXDH 1N32H 1ZZIA 4AIMA 5BR8H 1XMOH 4B3RH 4AM3A 2UXBH 4JI5H 1HNXH 3U1KA 2ZQEA 3SB1A 4JV5H 5FLXW 1WTJA 2CTMA 1IBKH 4JI0H 4DV2H 1KHMA 4B8TA 1DTJA 4JI8H 5C0XG 3KDGA 2FPHX 1WVNA 4GKKH 1X0AA 1SEIA 1I94H 2F4VH
chains in the Genus database with same CATH topology
2FFMA 2LTLA 1PQXA 2M6QA 2M8WA 2LTMA 2K1HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FFM A;  2LTL A;  1PQX A;  2M6Q A;  2M8W A;  2LTM A;  2K1H A; 
#chains in the Genus database with same CATH topology
 4JI6 H;  3EZJ A;  4JI4 H;  1V9N A;  2X06 A;  4AQY H;  2M8W A;  4LFA H;  3JAM W;  2A1S A;  4YY3 H;  4WAL A;  4NZR M;  1Z2I A;  2JVZ A;  2AXY A;  4LFB H;  4NXM H;  4LF7 H;  2VKC A;  4H8A A;  2LRR A;  2ZM6 H;  1N36 H;  4JI1 H;  2OPU A;  2CTJ A;  2OPV A;  3AEV B;  1WHR A;  2JEA I;  4B3S H;  4B3T H;  4DV3 H;  4JVH A;  1XRH A;  4DR3 H;  2D9I A;  1N34 H;  2UU9 H;  3OSS D;  1K1G A;  4OD6 A;  2DGR A;  3J80 W;  4DUY H;  1XNR H;  2E3U A;  4OCH A;  2CPM A;  3GKU A;  4X66 H;  2UUA H;  2BL5 A;  1HNW H;  1FKA H;  4DR1 H;  4B3M H;  3GR5 A;  4WAN A;  5A2Q W;  2CWF A;  2JA9 A;  2HHH H;  3L7Z C;  4JVY A;  2CTK A;  2HH3 A;  3V69 A;  4DV6 H;  1ZTG A;  4X62 H;  2K1H A;  4DV5 H;  1NXU A;  1ZZJ A;  1IBL H;  4LF8 H;  4NXN H;  1VIH A;  1TUA A;  4JI3 H;  2CPQ A;  2JEB I;  2M6Q A;  4DV1 H;  1HR0 H;  2Z0S A;  4FJS A;  4DR2 H;  4JI7 H;  4DV7 H;  4LIJ A;  2MJH A;  2Y3M A;  1MSZ A;  4LFC H;  5LMN H;  4EC5 A;  1AN7 A;  1ZZK A;  1WE8 A;  2VQE H;  1S20 A;  4DV0 H;  3T1Y H;  4LF5 H;  5IT9 W;  1XNQ H;  4YHH H;  2CTF A;  4DR7 H;  3KDK A;  4DR4 H;  1V8C A;  2E5L H;  4B8C D;  1UG8 A;  4X65 H;  4BA1 I;  4FJU A;  4DV4 H;  1IBM H;  2NN6 G;  1VIG A;  4G08 A;  1X9Z A;  4JI2 H;  2P2R A;  4PDB A;  2UXC H;  2CWH A;  2CTE A;  4QMF B;  3VKE A;  4K0K H;  1DT4 A;  5LMU H;  4LF9 H;  2JE6 I;  2HH2 A;  2PY9 A;  5IWA H;  1FJG H;  4NBQ A;  1VBI A;  3QD7 X;  1PQX A;  2LTL A;  3I0P A;  5K36 G;  4X64 H;  4DR5 H;  4LF6 H;  1HNZ H;  2ANR A;  4IFD G;  4OO1 G;  4LF4 H;  3UOE A;  3FAU A;  1ODH A;  1X4M A;  5DT9 A;  3RF2 A;  3NCV A;  4E9J A;  5LL6 b;  2FFM A;  2QND A;  3J7A K;  1N33 H;  3GAB A;  1X4N A;  3OET A;  2VQF H;  2G8Y A;  2YQR A;  1F0X A;  2UUC H;  1J5E H;  2LF0 A;  2O4C A;  5JEA G;  4DR6 H;  4DUZ H;  2PT7 G;  3T1H H;  4KHP H;  2JZX A;  4OX9 H;  2UUB H;  4BA2 I;  2CTL A;  4JYA H;  4GKJ H;  2LTM A;  4NZT M;  1J4W A;  2BA0 A;  2ANN A;  2PQU A;  2FMR A;  1XMQ H;  3OTO H;  3J81 W;  1J5K A;  1S03 G;  1I6U A;  1EC6 A;  2UXD H;  1N32 H;  1ZZI A;  4AIM A;  5BR8 H;  1XMO H;  4B3R H;  4AM3 A;  2UXB H;  4JI5 H;  1HNX H;  3U1K A;  2ZQE A;  3SB1 A;  4JV5 H;  5FLX W;  1WTJ A;  2CTM A;  1IBK H;  4JI0 H;  4DV2 H;  1KHM A;  4B8T A;  1DTJ A;  4JI8 H;  5C0X G;  3KDG A;  2FPH X;  1WVN A;  4GKK H;  1X0A A;  1SEI A;  1I94 H;  2F4V H; 
#chains in the Genus database with same CATH homology
 2FFM A;  2LTL A;  1PQX A;  2M6Q A;  2M8W A;  2LTM A;  2K1H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...