2K1HA

Solution nmr structure of ser13 from staphylococcus epidermidis. northeast structural genomics consortium target ser13
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
86
structure length
86
Chain Sequence
MEIIAISETPNHNTMKVSLSEPRQDNSFTTYTAAQEGQPEFINRLFEIEGVKSIFYVLDFISIDKEDNANWNELLPQIENTFAKSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein SeR13
publication title Solution Structure of SeR13.
rcsb
source organism Staphylococcus epidermidis
molecule tags Structural genomics, unknown function
total genus 12
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2008-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08712 Nfu_N Scaffold protein Nfu/NifU N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Scaffold protein Nfu/NifU, N-terminal domain 2k1hA00
2M6QA 2M8WA 2LTMA 2LTLA 1PQXA 2K1HA 2FFMA
chains in the Genus database with same CATH superfamily
4FJUA 1UG8A 4JI2H 4IFDG 2Y3MA 4JVYA 4BA1I 1HNWH 5LMNH 4DV2H 2O4CA 4LFAH 1XNQH 4LIJA 2X06A 1IBMH 4LF4H 1N33H 4DUYH 1ZTGA 4LF6H 1J4WA 1PQXA 4YHHH 1HNXH 2ANRA 1VBIA 2CPMA 1IBLH 3EZJA 5A2QW 2CPQA 4DV6H 4X66H 4DR3H 1I6UA 4DR5H 2CTJA 1J5EH 4JYAH 1FJGH 4YY3H 3T1HH 2UXBH 4AM3A 4B3SH 2HH3A 2FFMA 1N34H 5DT9A 3JAMW 2UXCH 2LTMA 1XNRH 3NCVA 1J5KA 1WVNA 1K1GA 1NXUA 3QD7X 2DGRA 4DR7H 2E3UA 4X62H 4AQYH 4B3TH 1MSZA 1I94H 3OTOH 4EC5A 1VIGA 2FMRA 3OETA 4LFBH 3KDKA 2LRRA 1ZZJA 4DV3H 1N32H 3U1KA 4LFCH 4H8AA 2OPVA 4LF9H 4NXMH 4LF5H 5BR8H 3T1YH 1XMOH 2CTFA 1HNZH 1X0AA 2E5LH 4OO1G 4DV7H 1S03G 2UUBH 1TUAA 4OX9H 5LMUH 2YQRA 2CTLA 2UU9H 1ZZIA 4JI8H 2ZM6H 1X4MA 1V8CA 2HHHH 4JI3H 4K0KH 4X65H 2QNDA 2MJHA 4DR6H 4NZRM 4AIMA 1F0XA 2UXDH 2A1SA 2JEBI 3KDGA 4DUZH 4GKKH 3SB1A 1ZZKA 4OD6A 4GKJH 4BA2I 2P2RA 1DT4A 4JV5H 4JVHA 4B8CD 4QMFB 1Z2IA 2VQFH 4DR1H 1XMQH 4JI1H 4LF7H 4LF8H 4JI7H 4NXNH 2JE6I 2JZXA 2VKCA 4JI4H 5IWAH 2G8YA 4G08A 3GABA 3I0PA 2VQEH 4B8TA 4DR2H 5JEAG 2NN6G 4JI0H 2CWHA 4OCHA 4PDBA 4DV5H 2M6QA 4B3MH 3AEVB 2CTEA 3L7ZC 3UOEA 1VIHA 4WALA 2UUCH 4B3RH 2K1HA 1X9ZA 4NZTM 1X4NA 2Z0SA 2JVZA 3GR5A 2M8WA 2UUAH 2BA0A 2JEAI 3J7AK 1DTJA 3VKEA 5IT9W 2OPUA 1S20A 2ANNA 3J81W 2FPHX 1WTJA 3GKUA 4DR4H 4DV4H 2LF0A 4KHPH 4WANA 1WHRA 2D9IA 4X64H 2JA9A 3J80W 2PQUA 1HR0H 1WE8A 2LTLA 1IBKH 3OSSD 1AN7A 5FLXW 4DV1H 1N36H 4NBQA 1ODHA 2AXYA 1XRHA 2ZQEA 3V69A 2HH2A 5C0XG 4JI5H 1SEIA 2CWFA 3FAUA 2PY9A 2CTKA 5K36G 2PT7G 2BL5A 4DV0H 1V9NA 5LL6b 2CTMA 1FKAH 3RF2A 4JI6H 2F4VH 4E9JA 1EC6A 1KHMA 4FJSA
chains in the Genus database with same CATH topology
2M6QA 2M8WA 2LTMA 2LTLA 1PQXA 2K1HA 2FFMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M6Q A;  2M8W A;  2LTM A;  2LTL A;  1PQX A;  2K1H A;  2FFM A; 
#chains in the Genus database with same CATH topology
 4FJU A;  1UG8 A;  4JI2 H;  4IFD G;  2Y3M A;  4JVY A;  4BA1 I;  1HNW H;  5LMN H;  4DV2 H;  2O4C A;  4LFA H;  1XNQ H;  4LIJ A;  2X06 A;  1IBM H;  4LF4 H;  1N33 H;  4DUY H;  1ZTG A;  4LF6 H;  1J4W A;  1PQX A;  4YHH H;  1HNX H;  2ANR A;  1VBI A;  2CPM A;  1IBL H;  3EZJ A;  5A2Q W;  2CPQ A;  4DV6 H;  4X66 H;  4DR3 H;  1I6U A;  4DR5 H;  2CTJ A;  1J5E H;  4JYA H;  1FJG H;  4YY3 H;  3T1H H;  2UXB H;  4AM3 A;  4B3S H;  2HH3 A;  2FFM A;  1N34 H;  5DT9 A;  3JAM W;  2UXC H;  2LTM A;  1XNR H;  3NCV A;  1J5K A;  1WVN A;  1K1G A;  1NXU A;  3QD7 X;  2DGR A;  4DR7 H;  2E3U A;  4X62 H;  4AQY H;  4B3T H;  1MSZ A;  1I94 H;  3OTO H;  4EC5 A;  1VIG A;  2FMR A;  3OET A;  4LFB H;  3KDK A;  2LRR A;  1ZZJ A;  4DV3 H;  1N32 H;  3U1K A;  4LFC H;  4H8A A;  2OPV A;  4LF9 H;  4NXM H;  4LF5 H;  5BR8 H;  3T1Y H;  1XMO H;  2CTF A;  1HNZ H;  1X0A A;  2E5L H;  4OO1 G;  4DV7 H;  1S03 G;  2UUB H;  1TUA A;  4OX9 H;  5LMU H;  2YQR A;  2CTL A;  2UU9 H;  1ZZI A;  4JI8 H;  2ZM6 H;  1X4M A;  1V8C A;  2HHH H;  4JI3 H;  4K0K H;  4X65 H;  2QND A;  2MJH A;  4DR6 H;  4NZR M;  4AIM A;  1F0X A;  2UXD H;  2A1S A;  2JEB I;  3KDG A;  4DUZ H;  4GKK H;  3SB1 A;  1ZZK A;  4OD6 A;  4GKJ H;  4BA2 I;  2P2R A;  1DT4 A;  4JV5 H;  4JVH A;  4B8C D;  4QMF B;  1Z2I A;  2VQF H;  4DR1 H;  1XMQ H;  4JI1 H;  4LF7 H;  4LF8 H;  4JI7 H;  4NXN H;  2JE6 I;  2JZX A;  2VKC A;  4JI4 H;  5IWA H;  2G8Y A;  4G08 A;  3GAB A;  3I0P A;  2VQE H;  4B8T A;  4DR2 H;  5JEA G;  2NN6 G;  4JI0 H;  2CWH A;  4OCH A;  4PDB A;  4DV5 H;  2M6Q A;  4B3M H;  3AEV B;  2CTE A;  3L7Z C;  3UOE A;  1VIH A;  4WAL A;  2UUC H;  4B3R H;  2K1H A;  1X9Z A;  4NZT M;  1X4N A;  2Z0S A;  2JVZ A;  3GR5 A;  2M8W A;  2UUA H;  2BA0 A;  2JEA I;  3J7A K;  1DTJ A;  3VKE A;  5IT9 W;  2OPU A;  1S20 A;  2ANN A;  3J81 W;  2FPH X;  1WTJ A;  3GKU A;  4DR4 H;  4DV4 H;  2LF0 A;  4KHP H;  4WAN A;  1WHR A;  2D9I A;  4X64 H;  2JA9 A;  3J80 W;  2PQU A;  1HR0 H;  1WE8 A;  2LTL A;  1IBK H;  3OSS D;  1AN7 A;  5FLX W;  4DV1 H;  1N36 H;  4NBQ A;  1ODH A;  2AXY A;  1XRH A;  2ZQE A;  3V69 A;  2HH2 A;  5C0X G;  4JI5 H;  1SEI A;  2CWF A;  3FAU A;  2PY9 A;  2CTK A;  5K36 G;  2PT7 G;  2BL5 A;  4DV0 H;  1V9N A;  5LL6 b;  2CTM A;  1FKA H;  3RF2 A;  4JI6 H;  2F4V H;  4E9J A;  1EC6 A;  1KHM A;  4FJS A; 
#chains in the Genus database with same CATH homology
 2M6Q A;  2M8W A;  2LTM A;  2LTL A;  1PQX A;  2K1H A;  2FFM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...