2K1HA

Solution nmr structure of ser13 from staphylococcus epidermidis. northeast structural genomics consortium target ser13
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
86
structure length
86
Chain Sequence
MEIIAISETPNHNTMKVSLSEPRQDNSFTTYTAAQEGQPEFINRLFEIEGVKSIFYVLDFISIDKEDNANWNELLPQIENTFAKSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein SeR13
publication title Solution Structure of SeR13.
rcsb
source organism Staphylococcus epidermidis
total genus 12
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2008-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08712 Nfu_N Scaffold protein Nfu/NifU N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Scaffold protein Nfu/NifU, N-terminal domain 2k1hA00
2K1HA 2FFMA 1PQXA 2M8WA 2LTLA 2LTMA 2M6QA
chains in the Genus database with same CATH superfamily
2VQEH 3GR5A 4DR4H 1N32H 4B3TH 2CTJA 4QMFB 4B3SH 4H8AA 3OETA 3RF2A 2G8YA 4LF6H 1V9NA 2UXBH 1N34H 4JI2H 4YHHH 2HHHH 2UUCH 1NXUA 1X9ZA 2LRRA 3EZJA 2CTEA 4NXMH 4LF5H 2A1SA 2F4VH 1VIHA 2CPQA 1J4WA 2E5LH 1MSZA 3J80W 4DV1H 4B8TA 4DUZH 2UXDH 2LF0A 4NBQA 2JEBI 4JYAH 1WVNA 2FMRA 4DR5H 3KDGA 4AQYH 3UOEA 2JVZA 4DV2H 2BL5A 2ZQEA 2NN6G 4GKJH 1S03G 2Z0SA 1IBLH 4WANA 4OCHA 4JVHA 4YY3H 4LF9H 1FJGH 4JI8H 1DT4A 4AIMA 4K0KH 2E3UA 1VBIA 1VIGA 3JAMW 1XMQH 1FKAH 2CTLA 4X65H 4NZTM 2LTLA 1ZZIA 1I94H 2X06A 2YQRA 4DV6H 2M6QA 1ZTGA 1EC6A 1J5EH 1X4MA 2BA0A 2DGRA 4B8CD 1XNRH 2MJHA 4B3RH 2JE6I 1K1GA 1N36H 4NZRM 2Y3MA 4JI1H 2UU9H 2K1HA 4LFAH 1IBKH 4X66H 4JI5H 3VKEA 2PY9A 4LIJA 2UUBH 1ZZKA 5K36G 3NCVA 1XMOH 1XRHA 4FJUA 4DR7H 2CTKA 2OPUA 4KHPH 2CTFA 1HNZH 4DR6H 4JI3H 3KDKA 2O4CA 2LTMA 4DUYH 4E9JA 2JEAI 3L7ZC 2CWFA 2UUAH 2ZM6H 4PDBA 4FJSA 3GKUA 2VQFH 3QD7X 4IFDG 2CTMA 1HNXH 3J7AK 4X62H 3SB1A 3AEVB 4AM3A 2CWHA 4DV5H 1S20A 4JI0H 1PQXA 1N33H 3V69A 3T1YH 4NXNH 4OX9H 1DTJA 2JA9A 3OSSD 5BR8H 3T1HH 2P2RA 4LFCH 1I6UA 4JV5H 2UXCH 2AXYA 5C0XG 1WHRA 4BA2I 4DV3H 1AN7A 4LF4H 1SEIA 1Z2IA 3FAUA 2QNDA 4LF7H 2ANNA 2D9IA 1J5KA 4JVYA 3GABA 4OD6A 1IBMH 4DV4H 4JI7H 5IT9W 1X0AA 5IWAH 2FPHX 2M8WA 4GKKH 1V8CA 5LMNH 4WALA 5LL6b 4JI6H 1X4NA 1HNWH 5FLXW 2HH2A 5DT9A 3J81W 1TUAA 4DR2H 4DR1H 1ODHA 2OPVA 4LF8H 2VKCA 1ZZJA 4LFBH 4OO1G 2PT7G 4X64H 2FFMA 4G08A 2JZXA 1WE8A 3OTOH 4JI4H 5JEAG 4BA1I 4DV0H 4DR3H 1KHMA 5A2QW 1UG8A 5LMUH 3I0PA 1XNQH 2HH3A 1HR0H 2ANRA 1WTJA 1F0XA 2CPMA 3U1KA 4DV7H 4B3MH 4EC5A 2PQUA
chains in the Genus database with same CATH topology
2K1HA 2FFMA 1PQXA 2M8WA 2LTLA 2LTMA 2M6QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K1H A;  2FFM A;  1PQX A;  2M8W A;  2LTL A;  2LTM A;  2M6Q A; 
#chains in the Genus database with same CATH topology
 2VQE H;  3GR5 A;  4DR4 H;  1N32 H;  4B3T H;  2CTJ A;  4QMF B;  4B3S H;  4H8A A;  3OET A;  3RF2 A;  2G8Y A;  4LF6 H;  1V9N A;  2UXB H;  1N34 H;  4JI2 H;  4YHH H;  2HHH H;  2UUC H;  1NXU A;  1X9Z A;  2LRR A;  3EZJ A;  2CTE A;  4NXM H;  4LF5 H;  2A1S A;  2F4V H;  1VIH A;  2CPQ A;  1J4W A;  2E5L H;  1MSZ A;  3J80 W;  4DV1 H;  4B8T A;  4DUZ H;  2UXD H;  2LF0 A;  4NBQ A;  2JEB I;  4JYA H;  1WVN A;  2FMR A;  4DR5 H;  3KDG A;  4AQY H;  3UOE A;  2JVZ A;  4DV2 H;  2BL5 A;  2ZQE A;  2NN6 G;  4GKJ H;  1S03 G;  2Z0S A;  1IBL H;  4WAN A;  4OCH A;  4JVH A;  4YY3 H;  4LF9 H;  1FJG H;  4JI8 H;  1DT4 A;  4AIM A;  4K0K H;  2E3U A;  1VBI A;  1VIG A;  3JAM W;  1XMQ H;  1FKA H;  2CTL A;  4X65 H;  4NZT M;  2LTL A;  1ZZI A;  1I94 H;  2X06 A;  2YQR A;  4DV6 H;  2M6Q A;  1ZTG A;  1EC6 A;  1J5E H;  1X4M A;  2BA0 A;  2DGR A;  4B8C D;  1XNR H;  2MJH A;  4B3R H;  2JE6 I;  1K1G A;  1N36 H;  4NZR M;  2Y3M A;  4JI1 H;  2UU9 H;  2K1H A;  4LFA H;  1IBK H;  4X66 H;  4JI5 H;  3VKE A;  2PY9 A;  4LIJ A;  2UUB H;  1ZZK A;  5K36 G;  3NCV A;  1XMO H;  1XRH A;  4FJU A;  4DR7 H;  2CTK A;  2OPU A;  4KHP H;  2CTF A;  1HNZ H;  4DR6 H;  4JI3 H;  3KDK A;  2O4C A;  2LTM A;  4DUY H;  4E9J A;  2JEA I;  3L7Z C;  2CWF A;  2UUA H;  2ZM6 H;  4PDB A;  4FJS A;  3GKU A;  2VQF H;  3QD7 X;  4IFD G;  2CTM A;  1HNX H;  3J7A K;  4X62 H;  3SB1 A;  3AEV B;  4AM3 A;  2CWH A;  4DV5 H;  1S20 A;  4JI0 H;  1PQX A;  1N33 H;  3V69 A;  3T1Y H;  4NXN H;  4OX9 H;  1DTJ A;  2JA9 A;  3OSS D;  5BR8 H;  3T1H H;  2P2R A;  4LFC H;  1I6U A;  4JV5 H;  2UXC H;  2AXY A;  5C0X G;  1WHR A;  4BA2 I;  4DV3 H;  1AN7 A;  4LF4 H;  1SEI A;  1Z2I A;  3FAU A;  2QND A;  4LF7 H;  2ANN A;  2D9I A;  1J5K A;  4JVY A;  3GAB A;  4OD6 A;  1IBM H;  4DV4 H;  4JI7 H;  5IT9 W;  1X0A A;  5IWA H;  2FPH X;  2M8W A;  4GKK H;  1V8C A;  5LMN H;  4WAL A;  5LL6 b;  4JI6 H;  1X4N A;  1HNW H;  5FLX W;  2HH2 A;  5DT9 A;  3J81 W;  1TUA A;  4DR2 H;  4DR1 H;  1ODH A;  2OPV A;  4LF8 H;  2VKC A;  1ZZJ A;  4LFB H;  4OO1 G;  2PT7 G;  4X64 H;  2FFM A;  4G08 A;  2JZX A;  1WE8 A;  3OTO H;  4JI4 H;  5JEA G;  4BA1 I;  4DV0 H;  4DR3 H;  1KHM A;  5A2Q W;  1UG8 A;  5LMU H;  3I0P A;  1XNQ H;  2HH3 A;  1HR0 H;  2ANR A;  1WTJ A;  1F0X A;  2CPM A;  3U1K A;  4DV7 H;  4B3M H;  4EC5 A;  2PQU A; 
#chains in the Genus database with same CATH homology
 2K1H A;  2FFM A;  1PQX A;  2M8W A;  2LTL A;  2LTM A;  2M6Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...