2M8WA

Restrained cs-rosetta solution nmr structure of staphylococcus aureus protein sav1430. northeast structural genomics target zr18. structure determination
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
91
structure length
91
Chain Sequence
MKIISISETPNHNTMKITLSESREGMTSDTYTKVDDSQPAFINDILKVEGVKSIFHVMDFISVDKENDANWETVLPKVEAVFELEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Uncharacterized protein
publication title PDBStat: a universal restraint converter and restraint analysis software package for protein NMR.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
total genus 18
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2013-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08712 Nfu_N Scaffold protein Nfu/NifU N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Scaffold protein Nfu/NifU, N-terminal domain 2m8wA00
2LTMA 1PQXA 2LTLA 2FFMA 2K1HA 2M8WA 2M6QA
chains in the Genus database with same CATH superfamily
2ANNA 1MSZA 4OX9H 4AM3A 2JE6I 4FJSA 4G08A 4LFBH 4LFCH 1HNZH 3GR5A 3L7ZC 4JVHA 1I94H 2CPMA 1DTJA 3SB1A 1J5EH 2OPUA 3NCVA 2PQUA 2UUBH 1ZZKA 2M6QA 4WALA 5C0XG 5IWAH 2HH2A 1WE8A 1FKAH 1N34H 1EC6A 4LF4H 1TUAA 4LIJA 2VQFH 2VQEH 2A1SA 4B8TA 1VIGA 4B3TH 1I6UA 4E9JA 2CTEA 4JV5H 2PT7G 4DR5H 2UXDH 2ZQEA 4DV7H 4JI7H 4LF8H 4JI4H 1PQXA 3J81W 4QMFB 4DV5H 3UOEA 2JA9A 2JEBI 3QD7X 4DR1H 2CPQA 4DV3H 1HNWH 2LTMA 1DT4A 4JI8H 4DV0H 1Z2IA 1WVNA 2LRRA 3KDGA 1XRHA 1F0XA 2UU9H 4DR6H 3AEVB 2D9IA 2E5LH 4BA1I 3GKUA 4DV1H 1J4WA 2O4CA 1K1GA 2QNDA 2ANRA 3EZJA 2UXBH 2K1HA 1WTJA 1NXUA 4JI3H 1SEIA 4DV2H 1ZZIA 4B3MH 5IT9W 4NBQA 4WANA 2CTJA 4NXNH 4NZRM 2MJHA 2UXCH 4AIMA 2VKCA 4X62H 1S03G 4JI1H 2UUCH 2JEAI 2HH3A 5LMNH 4LF6H 4AQYH 4JI0H 4YY3H 1V8CA 1ODHA 4X65H 2F4VH 2DGRA 1X0AA 3T1HH 1XMOH 4LF5H 4YHHH 4EC5A 3JAMW 2JVZA 4GKKH 2BL5A 3U1KA 3KDKA 3VKEA 4LFAH 2Y3MA 5LMUH 1VBIA 4GKJH 2UUAH 2FFMA 2LTLA 2CTMA 4KHPH 5A2QW 2FPHX 4DR7H 1KHMA 2NN6G 2OPVA 4B8CD 1HR0H 4K0KH 4OD6A 1XMQH 5K36G 1AN7A 5BR8H 2Z0SA 2AXYA 3OSSD 2CTLA 3GABA 4H8AA 3I0PA 1XNQH 1UG8A 5JEAG 2JZXA 4DR2H 2FMRA 4IFDG 2CTKA 4NXMH 4NZTM 2CWFA 4JI5H 3J7AK 1N36H 4DV4H 4JYAH 3T1YH 4DR4H 1N32H 2LF0A 1ZZJA 1J5KA 2ZM6H 3OTOH 1ZTGA 4OCHA 4DUZH 4LF7H 2HHHH 5LL6b 2YQRA 1IBMH 2CWHA 3RF2A 5FLXW 4DUYH 4DV6H 1HNXH 1X4NA 2BA0A 2E3UA 3OETA 2P2RA 2G8YA 2M8WA 2PY9A 1N33H 4BA2I 2X06A 4B3SH 1WHRA 4X66H 1XNRH 1X9ZA 2CTFA 1IBKH 4JVYA 1FJGH 4B3RH 4OO1G 3J80W 3V69A 1IBLH 1X4MA 5DT9A 4PDBA 4X64H 1S20A 4JI6H 1V9NA 4FJUA 4LF9H 4DR3H 3FAUA 1VIHA 4JI2H
chains in the Genus database with same CATH topology
2LTMA 1PQXA 2LTLA 2FFMA 2K1HA 2M8WA 2M6QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LTM A;  1PQX A;  2LTL A;  2FFM A;  2K1H A;  2M8W A;  2M6Q A; 
#chains in the Genus database with same CATH topology
 2ANN A;  1MSZ A;  4OX9 H;  4AM3 A;  2JE6 I;  4FJS A;  4G08 A;  4LFB H;  4LFC H;  1HNZ H;  3GR5 A;  3L7Z C;  4JVH A;  1I94 H;  2CPM A;  1DTJ A;  3SB1 A;  1J5E H;  2OPU A;  3NCV A;  2PQU A;  2UUB H;  1ZZK A;  2M6Q A;  4WAL A;  5C0X G;  5IWA H;  2HH2 A;  1WE8 A;  1FKA H;  1N34 H;  1EC6 A;  4LF4 H;  1TUA A;  4LIJ A;  2VQF H;  2VQE H;  2A1S A;  4B8T A;  1VIG A;  4B3T H;  1I6U A;  4E9J A;  2CTE A;  4JV5 H;  2PT7 G;  4DR5 H;  2UXD H;  2ZQE A;  4DV7 H;  4JI7 H;  4LF8 H;  4JI4 H;  1PQX A;  3J81 W;  4QMF B;  4DV5 H;  3UOE A;  2JA9 A;  2JEB I;  3QD7 X;  4DR1 H;  2CPQ A;  4DV3 H;  1HNW H;  2LTM A;  1DT4 A;  4JI8 H;  4DV0 H;  1Z2I A;  1WVN A;  2LRR A;  3KDG A;  1XRH A;  1F0X A;  2UU9 H;  4DR6 H;  3AEV B;  2D9I A;  2E5L H;  4BA1 I;  3GKU A;  4DV1 H;  1J4W A;  2O4C A;  1K1G A;  2QND A;  2ANR A;  3EZJ A;  2UXB H;  2K1H A;  1WTJ A;  1NXU A;  4JI3 H;  1SEI A;  4DV2 H;  1ZZI A;  4B3M H;  5IT9 W;  4NBQ A;  4WAN A;  2CTJ A;  4NXN H;  4NZR M;  2MJH A;  2UXC H;  4AIM A;  2VKC A;  4X62 H;  1S03 G;  4JI1 H;  2UUC H;  2JEA I;  2HH3 A;  5LMN H;  4LF6 H;  4AQY H;  4JI0 H;  4YY3 H;  1V8C A;  1ODH A;  4X65 H;  2F4V H;  2DGR A;  1X0A A;  3T1H H;  1XMO H;  4LF5 H;  4YHH H;  4EC5 A;  3JAM W;  2JVZ A;  4GKK H;  2BL5 A;  3U1K A;  3KDK A;  3VKE A;  4LFA H;  2Y3M A;  5LMU H;  1VBI A;  4GKJ H;  2UUA H;  2FFM A;  2LTL A;  2CTM A;  4KHP H;  5A2Q W;  2FPH X;  4DR7 H;  1KHM A;  2NN6 G;  2OPV A;  4B8C D;  1HR0 H;  4K0K H;  4OD6 A;  1XMQ H;  5K36 G;  1AN7 A;  5BR8 H;  2Z0S A;  2AXY A;  3OSS D;  2CTL A;  3GAB A;  4H8A A;  3I0P A;  1XNQ H;  1UG8 A;  5JEA G;  2JZX A;  4DR2 H;  2FMR A;  4IFD G;  2CTK A;  4NXM H;  4NZT M;  2CWF A;  4JI5 H;  3J7A K;  1N36 H;  4DV4 H;  4JYA H;  3T1Y H;  4DR4 H;  1N32 H;  2LF0 A;  1ZZJ A;  1J5K A;  2ZM6 H;  3OTO H;  1ZTG A;  4OCH A;  4DUZ H;  4LF7 H;  2HHH H;  5LL6 b;  2YQR A;  1IBM H;  2CWH A;  3RF2 A;  5FLX W;  4DUY H;  4DV6 H;  1HNX H;  1X4N A;  2BA0 A;  2E3U A;  3OET A;  2P2R A;  2G8Y A;  2M8W A;  2PY9 A;  1N33 H;  4BA2 I;  2X06 A;  4B3S H;  1WHR A;  4X66 H;  1XNR H;  1X9Z A;  2CTF A;  1IBK H;  4JVY A;  1FJG H;  4B3R H;  4OO1 G;  3J80 W;  3V69 A;  1IBL H;  1X4M A;  5DT9 A;  4PDB A;  4X64 H;  1S20 A;  4JI6 H;  1V9N A;  4FJU A;  4LF9 H;  4DR3 H;  3FAU A;  1VIH A;  4JI2 H; 
#chains in the Genus database with same CATH homology
 2LTM A;  1PQX A;  2LTL A;  2FFM A;  2K1H A;  2M8W A;  2M6Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...