2M8WA

Restrained cs-rosetta solution nmr structure of staphylococcus aureus protein sav1430. northeast structural genomics target zr18. structure determination
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
91
structure length
91
Chain Sequence
MKIISISETPNHNTMKITLSESREGMTSDTYTKVDDSQPAFINDILKVEGVKSIFHVMDFISVDKENDANWETVLPKVEAVFELEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title PDBStat: a universal restraint converter and restraint analysis software package for protein NMR.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Unknown function
total genus 18
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2013-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08712 Nfu_N Scaffold protein Nfu/NifU N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Scaffold protein Nfu/NifU, N-terminal domain 2m8wA00
2K1HA 2M6QA 2LTLA 2FFMA 2LTMA 2M8WA 1PQXA
chains in the Genus database with same CATH superfamily
1N36H 1X4NA 1V9NA 1WE8A 1WVNA 4G08A 5DT9A 4LF4H 2ANRA 2OPUA 2NN6G 1K1GA 2PQUA 3QD7X 1N32H 2F4VH 4EC5A 2ANNA 3T1YH 1Z2IA 2FMRA 2ZM6H 3T1HH 3VKEA 2UU9H 4E9JA 4DV5H 2PT7G 4JI4H 3AEVB 1WHRA 2O4CA 2CTLA 2AXYA 1PQXA 2E3UA 4JI5H 1HNWH 3GR5A 5LL6b 5A2QW 4BA2I 1EC6A 2JA9A 3SB1A 1ODHA 1V8CA 4DR6H 3U1KA 2YQRA 2VKCA 2MJHA 1MSZA 4X65H 2HHHH 3L7ZC 2K1HA 3UOEA 4B8CD 4DV1H 4DV6H 2CTFA 4DR3H 4LIJA 4NBQA 4B8TA 4DR2H 4B3RH 2UUAH 4LF7H 1FJGH 1ZZIA 1XNRH 4FJUA 4OD6A 4JYAH 4X66H 1DT4A 1VIHA 2M6QA 4AIMA 5BR8H 4DV2H 4LF8H 1SEIA 4AQYH 5IWAH 4LFCH 2UUBH 5K36G 4FJSA 3NCVA 1N33H 4AM3A 4DR5H 2CTEA 2Y3MA 4GKJH 4DR4H 2CTMA 3RF2A 2LF0A 4LFAH 4DV0H 4B3SH 4JV5H 2LRRA 2X06A 4DR1H 1KHMA 5FLXW 1J5EH 4OX9H 2QNDA 1X0AA 2VQFH 4DR7H 4KHPH 2BA0A 2CWHA 4JI7H 2CTKA 2UXBH 4B3MH 4JI3H 2LTLA 2ZQEA 4NZTM 1XMOH 2JVZA 1N34H 4LF6H 3OETA 2DGRA 1FKAH 3J7AK 2A1SA 3GABA 1HNXH 3J80W 3OSSD 3KDGA 2UXCH 4DV3H 5LMUH 2JEBI 1WTJA 4JI2H 3I0PA 2UXDH 2Z0SA 3GKUA 1F0XA 4OCHA 4BA1I 4K0KH 4DV7H 1DTJA 3V69A 1ZZKA 2CPQA 1XMQH 1UG8A 4B3TH 1IBLH 4JI0H 1XNQH 1IBKH 2CWFA 4LF5H 1VBIA 4H8AA 4YHHH 4LFBH 4QMFB 2JE6I 4NZRM 1TUAA 2E5LH 3KDKA 4JI6H 2OPVA 4NXNH 4OO1G 2HH2A 2G8YA 1X4MA 3EZJA 4DUYH 4PDBA 2LTMA 1S20A 2FPHX 1IBMH 1S03G 3FAUA 4DV4H 1I94H 4LF9H 2HH3A 1J4WA 5C0XG 1HNZH 4NXMH 2UUCH 2JZXA 3J81W 2BL5A 1NXUA 4YY3H 4JI8H 3OTOH 1I6UA 1XRHA 5JEAG 1ZZJA 5LMNH 4JI1H 2CTJA 1X9ZA 4IFDG 1HR0H 5IT9W 2PY9A 1AN7A 2VQEH 2JEAI 2P2RA 4X62H 1J5KA 1ZTGA 4JVYA 4GKKH 4X64H 4WANA 4JVHA 3JAMW 4DUZH 2D9IA 4WALA 1VIGA 2FFMA 2CPMA 2M8WA
chains in the Genus database with same CATH topology
2K1HA 2M6QA 2LTLA 2FFMA 2LTMA 2M8WA 1PQXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K1H A;  2M6Q A;  2LTL A;  2FFM A;  2LTM A;  2M8W A;  1PQX A; 
#chains in the Genus database with same CATH topology
 1N36 H;  1X4N A;  1V9N A;  1WE8 A;  1WVN A;  4G08 A;  5DT9 A;  4LF4 H;  2ANR A;  2OPU A;  2NN6 G;  1K1G A;  2PQU A;  3QD7 X;  1N32 H;  2F4V H;  4EC5 A;  2ANN A;  3T1Y H;  1Z2I A;  2FMR A;  2ZM6 H;  3T1H H;  3VKE A;  2UU9 H;  4E9J A;  4DV5 H;  2PT7 G;  4JI4 H;  3AEV B;  1WHR A;  2O4C A;  2CTL A;  2AXY A;  1PQX A;  2E3U A;  4JI5 H;  1HNW H;  3GR5 A;  5LL6 b;  5A2Q W;  4BA2 I;  1EC6 A;  2JA9 A;  3SB1 A;  1ODH A;  1V8C A;  4DR6 H;  3U1K A;  2YQR A;  2VKC A;  2MJH A;  1MSZ A;  4X65 H;  2HHH H;  3L7Z C;  2K1H A;  3UOE A;  4B8C D;  4DV1 H;  4DV6 H;  2CTF A;  4DR3 H;  4LIJ A;  4NBQ A;  4B8T A;  4DR2 H;  4B3R H;  2UUA H;  4LF7 H;  1FJG H;  1ZZI A;  1XNR H;  4FJU A;  4OD6 A;  4JYA H;  4X66 H;  1DT4 A;  1VIH A;  2M6Q A;  4AIM A;  5BR8 H;  4DV2 H;  4LF8 H;  1SEI A;  4AQY H;  5IWA H;  4LFC H;  2UUB H;  5K36 G;  4FJS A;  3NCV A;  1N33 H;  4AM3 A;  4DR5 H;  2CTE A;  2Y3M A;  4GKJ H;  4DR4 H;  2CTM A;  3RF2 A;  2LF0 A;  4LFA H;  4DV0 H;  4B3S H;  4JV5 H;  2LRR A;  2X06 A;  4DR1 H;  1KHM A;  5FLX W;  1J5E H;  4OX9 H;  2QND A;  1X0A A;  2VQF H;  4DR7 H;  4KHP H;  2BA0 A;  2CWH A;  4JI7 H;  2CTK A;  2UXB H;  4B3M H;  4JI3 H;  2LTL A;  2ZQE A;  4NZT M;  1XMO H;  2JVZ A;  1N34 H;  4LF6 H;  3OET A;  2DGR A;  1FKA H;  3J7A K;  2A1S A;  3GAB A;  1HNX H;  3J80 W;  3OSS D;  3KDG A;  2UXC H;  4DV3 H;  5LMU H;  2JEB I;  1WTJ A;  4JI2 H;  3I0P A;  2UXD H;  2Z0S A;  3GKU A;  1F0X A;  4OCH A;  4BA1 I;  4K0K H;  4DV7 H;  1DTJ A;  3V69 A;  1ZZK A;  2CPQ A;  1XMQ H;  1UG8 A;  4B3T H;  1IBL H;  4JI0 H;  1XNQ H;  1IBK H;  2CWF A;  4LF5 H;  1VBI A;  4H8A A;  4YHH H;  4LFB H;  4QMF B;  2JE6 I;  4NZR M;  1TUA A;  2E5L H;  3KDK A;  4JI6 H;  2OPV A;  4NXN H;  4OO1 G;  2HH2 A;  2G8Y A;  1X4M A;  3EZJ A;  4DUY H;  4PDB A;  2LTM A;  1S20 A;  2FPH X;  1IBM H;  1S03 G;  3FAU A;  4DV4 H;  1I94 H;  4LF9 H;  2HH3 A;  1J4W A;  5C0X G;  1HNZ H;  4NXM H;  2UUC H;  2JZX A;  3J81 W;  2BL5 A;  1NXU A;  4YY3 H;  4JI8 H;  3OTO H;  1I6U A;  1XRH A;  5JEA G;  1ZZJ A;  5LMN H;  4JI1 H;  2CTJ A;  1X9Z A;  4IFD G;  1HR0 H;  5IT9 W;  2PY9 A;  1AN7 A;  2VQE H;  2JEA I;  2P2R A;  4X62 H;  1J5K A;  1ZTG A;  4JVY A;  4GKK H;  4X64 H;  4WAN A;  4JVH A;  3JAM W;  4DUZ H;  2D9I A;  4WAL A;  1VIG A;  2FFM A;  2CPM A;  2M8W A; 
#chains in the Genus database with same CATH homology
 2K1H A;  2M6Q A;  2LTL A;  2FFM A;  2LTM A;  2M8W A;  1PQX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...