2M8WA

Restrained cs-rosetta solution nmr structure of staphylococcus aureus protein sav1430. northeast structural genomics target zr18. structure determination
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
91
structure length
91
Chain Sequence
MKIISISETPNHNTMKITLSESREGMTSDTYTKVDDSQPAFINDILKVEGVKSIFHVMDFISVDKENDANWETVLPKVEAVFELEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title PDBStat: a universal restraint converter and restraint analysis software package for protein NMR.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Unknown function
total genus 18
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2013-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08712 Nfu_N Scaffold protein Nfu/NifU N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Scaffold protein Nfu/NifU, N-terminal domain 2m8wA00
2M6QA 2M8WA 1PQXA 2LTMA 2K1HA 2FFMA 2LTLA
chains in the Genus database with same CATH superfamily
2CWFA 4AQYH 4DV2H 1WE8A 3EZJA 1HNWH 4H8AA 2UU9H 1WHRA 4GKKH 3GABA 2E3UA 2HH3A 4JI5H 4DV5H 5BR8H 4JYAH 4G08A 1X4MA 2CWHA 2QNDA 1ZTGA 4JI8H 4DV0H 4JI4H 2VQEH 1UG8A 2FMRA 4DV4H 5IT9W 4B3SH 2VQFH 1SEIA 1S20A 2ZM6H 5IWAH 4DR3H 2AXYA 2E5LH 3FAUA 2UXCH 4FJSA 2BL5A 1HNXH 3OSSD 4QMFB 4IFDG 4YHHH 1J5KA 4DUYH 2OPVA 1EC6A 1N36H 1VIGA 4AM3A 4B3MH 2OPUA 1TUAA 1IBKH 3UOEA 4BA1I 2FFMA 3I0PA 2LF0A 4EC5A 2JEBI 2LRRA 3RF2A 4LF6H 1N33H 1S03G 1V9NA 4BA2I 3OETA 1IBLH 2ANRA 2DGRA 1X0AA 2G8YA 4DR1H 2JVZA 5DT9A 2M6QA 1MSZA 1WVNA 1V8CA 2M8WA 1I6UA 1FJGH 4JI6H 4JV5H 2LTMA 2JEAI 2CTFA 1X9ZA 4JI0H 2BA0A 2Y3MA 3KDKA 2D9IA 4OCHA 4JI1H 4OO1G 4K0KH 2ANNA 5K36G 4GKJH 1XMOH 4KHPH 4LFBH 3J7AK 3GR5A 3T1HH 4NZRM 1I94H 4E9JA 3JAMW 4X62H 4DV3H 3L7ZC 4X66H 2UXBH 3J81W 4JI7H 2CTMA 4B3RH 4LFCH 2PT7G 2MJHA 4DR2H 2LTLA 4DV1H 1N34H 2ZQEA 4X65H 3QD7X 4DUZH 2CPQA 1ODHA 1Z2IA 4LF7H 1N32H 4WANA 2YQRA 1NXUA 5FLXW 2PY9A 2F4VH 3GKUA 4JI2H 4LF9H 2CPMA 4DR6H 1AN7A 3VKEA 1VBIA 1ZZKA 1K1GA 5A2QW 2VKCA 4PDBA 4X64H 4LFAH 2JZXA 4B3TH 4LIJA 4OX9H 3AEVB 2UUCH 1IBMH 2JE6I 4B8TA 1FKAH 1WTJA 4NXNH 1XNQH 1J5EH 3NCVA 1VIHA 4DR5H 2HHHH 4LF4H 1ZZJA 4DV7H 4NBQA 4NZTM 2UXDH 5JEAG 2NN6G 4AIMA 4YY3H 1HNZH 3OTOH 5LMUH 1J4WA 2CTKA 2UUAH 4LF8H 5LMNH 4JVHA 4LF5H 4DR4H 4OD6A 2UUBH 3SB1A 3T1YH 2P2RA 3U1KA 4B8CD 1DT4A 1F0XA 1XMQH 4JI3H 5LL6b 3V69A 2CTEA 4JVYA 4DR7H 1PQXA 4NXMH 2HH2A 2X06A 4FJUA 2A1SA 1XNRH 2Z0SA 1DTJA 2CTJA 3KDGA 2CTLA 2JA9A 5C0XG 1HR0H 2PQUA 1XRHA 1ZZIA 2FPHX 2O4CA 4DV6H 1KHMA 1X4NA 2K1HA 4WALA 3J80W
chains in the Genus database with same CATH topology
2M6QA 2M8WA 1PQXA 2LTMA 2K1HA 2FFMA 2LTLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M6Q A;  2M8W A;  1PQX A;  2LTM A;  2K1H A;  2FFM A;  2LTL A; 
#chains in the Genus database with same CATH topology
 2CWF A;  4AQY H;  4DV2 H;  1WE8 A;  3EZJ A;  1HNW H;  4H8A A;  2UU9 H;  1WHR A;  4GKK H;  3GAB A;  2E3U A;  2HH3 A;  4JI5 H;  4DV5 H;  5BR8 H;  4JYA H;  4G08 A;  1X4M A;  2CWH A;  2QND A;  1ZTG A;  4JI8 H;  4DV0 H;  4JI4 H;  2VQE H;  1UG8 A;  2FMR A;  4DV4 H;  5IT9 W;  4B3S H;  2VQF H;  1SEI A;  1S20 A;  2ZM6 H;  5IWA H;  4DR3 H;  2AXY A;  2E5L H;  3FAU A;  2UXC H;  4FJS A;  2BL5 A;  1HNX H;  3OSS D;  4QMF B;  4IFD G;  4YHH H;  1J5K A;  4DUY H;  2OPV A;  1EC6 A;  1N36 H;  1VIG A;  4AM3 A;  4B3M H;  2OPU A;  1TUA A;  1IBK H;  3UOE A;  4BA1 I;  2FFM A;  3I0P A;  2LF0 A;  4EC5 A;  2JEB I;  2LRR A;  3RF2 A;  4LF6 H;  1N33 H;  1S03 G;  1V9N A;  4BA2 I;  3OET A;  1IBL H;  2ANR A;  2DGR A;  1X0A A;  2G8Y A;  4DR1 H;  2JVZ A;  5DT9 A;  2M6Q A;  1MSZ A;  1WVN A;  1V8C A;  2M8W A;  1I6U A;  1FJG H;  4JI6 H;  4JV5 H;  2LTM A;  2JEA I;  2CTF A;  1X9Z A;  4JI0 H;  2BA0 A;  2Y3M A;  3KDK A;  2D9I A;  4OCH A;  4JI1 H;  4OO1 G;  4K0K H;  2ANN A;  5K36 G;  4GKJ H;  1XMO H;  4KHP H;  4LFB H;  3J7A K;  3GR5 A;  3T1H H;  4NZR M;  1I94 H;  4E9J A;  3JAM W;  4X62 H;  4DV3 H;  3L7Z C;  4X66 H;  2UXB H;  3J81 W;  4JI7 H;  2CTM A;  4B3R H;  4LFC H;  2PT7 G;  2MJH A;  4DR2 H;  2LTL A;  4DV1 H;  1N34 H;  2ZQE A;  4X65 H;  3QD7 X;  4DUZ H;  2CPQ A;  1ODH A;  1Z2I A;  4LF7 H;  1N32 H;  4WAN A;  2YQR A;  1NXU A;  5FLX W;  2PY9 A;  2F4V H;  3GKU A;  4JI2 H;  4LF9 H;  2CPM A;  4DR6 H;  1AN7 A;  3VKE A;  1VBI A;  1ZZK A;  1K1G A;  5A2Q W;  2VKC A;  4PDB A;  4X64 H;  4LFA H;  2JZX A;  4B3T H;  4LIJ A;  4OX9 H;  3AEV B;  2UUC H;  1IBM H;  2JE6 I;  4B8T A;  1FKA H;  1WTJ A;  4NXN H;  1XNQ H;  1J5E H;  3NCV A;  1VIH A;  4DR5 H;  2HHH H;  4LF4 H;  1ZZJ A;  4DV7 H;  4NBQ A;  4NZT M;  2UXD H;  5JEA G;  2NN6 G;  4AIM A;  4YY3 H;  1HNZ H;  3OTO H;  5LMU H;  1J4W A;  2CTK A;  2UUA H;  4LF8 H;  5LMN H;  4JVH A;  4LF5 H;  4DR4 H;  4OD6 A;  2UUB H;  3SB1 A;  3T1Y H;  2P2R A;  3U1K A;  4B8C D;  1DT4 A;  1F0X A;  1XMQ H;  4JI3 H;  5LL6 b;  3V69 A;  2CTE A;  4JVY A;  4DR7 H;  1PQX A;  4NXM H;  2HH2 A;  2X06 A;  4FJU A;  2A1S A;  1XNR H;  2Z0S A;  1DTJ A;  2CTJ A;  3KDG A;  2CTL A;  2JA9 A;  5C0X G;  1HR0 H;  2PQU A;  1XRH A;  1ZZI A;  2FPH X;  2O4C A;  4DV6 H;  1KHM A;  1X4N A;  2K1H A;  4WAL A;  3J80 W; 
#chains in the Genus database with same CATH homology
 2M6Q A;  2M8W A;  1PQX A;  2LTM A;  2K1H A;  2FFM A;  2LTL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...