4FJUA

Crystal structure of ureidoglycolate dehydrogenase in ternary complex with nadh and glyoxylate
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
338
structure length
338
Chain Sequence
MKISRETLHQLIENKLCQAGLKREHAATVAEVLVYADARGIHSHGAVRVEYYAERISKGGTNREPEFRLEETGPCSAILHADNAAGQVAAKMGMEHAIKTAQQNGVAVVGISRMGHSGAISYFVQQAARAGFIGISMCQSDPMVVPFGGAEIYYGTNPLAFAAPGEGDEILTFDMATTVQAWGKVLDARSRNMSIPDTWAVDKNGVPTTDPFAVHALLPAAGPKGYGLMMMIDVLSGVLLGLPFGRQVSSMYDDLHAGRNLGQLHIVINPNFFSSSELFRQHLSQTMRELNAITPAPGFNQVYYPGQDQDIKQRKAAVEGIEIVDDIYQYLISDALYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional insights into (s)-ureidoglycolate dehydrogenase, a metabolic branch point enzyme in nitrogen utilization.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords Ureidoglycolate dehydrogenase
total genus 109
structure length 338
sequence length 338
chains with identical sequence B
ec nomenclature ec 1.1.1.154: Ureidoglycolate dehydrogenase.
pdb deposition date 2012-06-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1530.10 Mainly Alpha Orthogonal Bundle Hypothetical Oxidoreductase Yiak; Chain: A, domain 1 Hypothetical Oxidoreductase Yiak; Chain: A, domain 1 4fjuA01
3.30.1370.60 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Hypothetical oxidoreductase yiak; domain 2 4fjuA02
1XRHA 2CWFA 1S20A 4FJSA 3UOEA 4H8AA 2CWHA 1V9NA 1WTJA 1Z2IA 2X06A 1X0AA 2G8YA 3I0PA 4FJUA 1VBIA 1NXUA
chains in the Genus database with same CATH superfamily
2Z0SA 3VKEA 1N33H 2PT7G 1J4WA 1AN7A 1X4MA 3KDGA 3OTOH 1I94H 2HHHH 4DR6H 2P2RA 3GKUA 2G8YA 2JVZA 1N36H 2LRRA 1IBLH 5A2QW 5LMUH 2E3UA 1TUAA 1DT4A 1HNXH 5BR8H 1PQXA 4OD6A 4K0KH 4WALA 1XMOH 4LF9H 3AEVB 1ODHA 2M8WA 2PQUA 3V69A 4AIMA 1SEIA 5C0XG 3GR5A 1XNRH 5K36G 1V9NA 4B3SH 1XMQH 4DR3H 2FPHX 4JI2H 4LIJA 3I0PA 1VBIA 4NXMH 4GKKH 4AQYH 1EC6A 4LF4H 4LF8H 5DT9A 2OPUA 1IBMH 4JVHA 1V8CA 4GKJH 4NBQA 2JEBI 4FJUA 4FJSA 1NXUA 4WANA 1FJGH 4E9JA 2JEAI 1Z2IA 4LFCH 4DV2H 2D9IA 2BA0A 3T1YH 4B3RH 4DV5H 4JI4H 2UUCH 3J80W 4H8AA 4BA1I 2VQFH 5IT9W 2A1SA 4DR5H 1VIGA 2MJHA 4NZTM 2JE6I 4X65H 1J5EH 1FKAH 2LTLA 4LFBH 2CTMA 1MSZA 1WVNA 2CPQA 2JZXA 2K1HA 2E5LH 2FFMA 1WHRA 2F4VH 4DR7H 4B3MH 2NN6G 2UXCH 2JA9A 4LF6H 3L7ZC 2UU9H 4DR4H 4DV6H 4OO1G 2OPVA 1HNZH 1S03G 2UUAH 3T1HH 4YY3H 1ZTGA 1X4NA 5JEAG 2CTEA 2UUBH 4JI7H 3RF2A 3SB1A 4B8CD 4DUYH 1IBKH 4JI0H 4JI3H 4JI5H 5IWAH 1N32H 4PDBA 4NZRM 2Y3MA 2CTKA 4DV0H 2UXBH 1KHMA 3OSSD 4JV5H 3NCVA 1X9ZA 4DR2H 2M6QA 3JAMW 4OX9H 1ZZJA 3QD7X 3GABA 2VQEH 4JI6H 4DV3H 4B3TH 2ANRA 2CTJA 4LFAH 4OCHA 1HNWH 1ZZKA 2LF0A 2QNDA 1DTJA 3J81W 2AXYA 4KHPH 2HH2A 4B8TA 4DV1H 1N34H 2CTLA 1ZZIA 2LTMA 3UOEA 3EZJA 4LF7H 4IFDG 2DGRA 5LL6b 2ANNA 4JI8H 5LMNH 4JI1H 1HR0H 2CPMA 4G08A 2CWHA 2HH3A 4BA2I 1S20A 1UG8A 4YHHH 4LF5H 4X62H 4X64H 1WE8A 3FAUA 2ZM6H 1XNQH 4JVYA 1J5KA 2BL5A 4DV4H 2FMRA 4NXNH 1XRHA 2CWFA 4DUZH 2UXDH 1F0XA 2CTFA 1WTJA 4X66H 2X06A 1VIHA 2PY9A 2O4CA 3KDKA 1K1GA 3J7AK 4DV7H 4DR1H 2ZQEA 4QMFB 4AM3A 4JYAH 5FLXW 2VKCA 3OETA 3U1KA 1X0AA 2YQRA 4EC5A 1I6UA
chains in the Genus database with same CATH topology
1XRHA 2CWFA 1S20A 4FJSA 3UOEA 4H8AA 2CWHA 1V9NA 1WTJA 1Z2IA 2X06A 1X0AA 2G8YA 3I0PA 4FJUA 1VBIA 1NXUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XRH A;  2CWF A;  1S20 A;  4FJS A;  3UOE A;  4H8A A;  2CWH A;  1V9N A;  1WTJ A;  1Z2I A;  2X06 A;  1X0A A;  2G8Y A;  3I0P A;  4FJU A;  1VBI A;  1NXU A; 
#chains in the Genus database with same CATH topology
 2Z0S A;  3VKE A;  1N33 H;  2PT7 G;  1J4W A;  1AN7 A;  1X4M A;  3KDG A;  3OTO H;  1I94 H;  2HHH H;  4DR6 H;  2P2R A;  3GKU A;  2G8Y A;  2JVZ A;  1N36 H;  2LRR A;  1IBL H;  5A2Q W;  5LMU H;  2E3U A;  1TUA A;  1DT4 A;  1HNX H;  5BR8 H;  1PQX A;  4OD6 A;  4K0K H;  4WAL A;  1XMO H;  4LF9 H;  3AEV B;  1ODH A;  2M8W A;  2PQU A;  3V69 A;  4AIM A;  1SEI A;  5C0X G;  3GR5 A;  1XNR H;  5K36 G;  1V9N A;  4B3S H;  1XMQ H;  4DR3 H;  2FPH X;  4JI2 H;  4LIJ A;  3I0P A;  1VBI A;  4NXM H;  4GKK H;  4AQY H;  1EC6 A;  4LF4 H;  4LF8 H;  5DT9 A;  2OPU A;  1IBM H;  4JVH A;  1V8C A;  4GKJ H;  4NBQ A;  2JEB I;  4FJU A;  4FJS A;  1NXU A;  4WAN A;  1FJG H;  4E9J A;  2JEA I;  1Z2I A;  4LFC H;  4DV2 H;  2D9I A;  2BA0 A;  3T1Y H;  4B3R H;  4DV5 H;  4JI4 H;  2UUC H;  3J80 W;  4H8A A;  4BA1 I;  2VQF H;  5IT9 W;  2A1S A;  4DR5 H;  1VIG A;  2MJH A;  4NZT M;  2JE6 I;  4X65 H;  1J5E H;  1FKA H;  2LTL A;  4LFB H;  2CTM A;  1MSZ A;  1WVN A;  2CPQ A;  2JZX A;  2K1H A;  2E5L H;  2FFM A;  1WHR A;  2F4V H;  4DR7 H;  4B3M H;  2NN6 G;  2UXC H;  2JA9 A;  4LF6 H;  3L7Z C;  2UU9 H;  4DR4 H;  4DV6 H;  4OO1 G;  2OPV A;  1HNZ H;  1S03 G;  2UUA H;  3T1H H;  4YY3 H;  1ZTG A;  1X4N A;  5JEA G;  2CTE A;  2UUB H;  4JI7 H;  3RF2 A;  3SB1 A;  4B8C D;  4DUY H;  1IBK H;  4JI0 H;  4JI3 H;  4JI5 H;  5IWA H;  1N32 H;  4PDB A;  4NZR M;  2Y3M A;  2CTK A;  4DV0 H;  2UXB H;  1KHM A;  3OSS D;  4JV5 H;  3NCV A;  1X9Z A;  4DR2 H;  2M6Q A;  3JAM W;  4OX9 H;  1ZZJ A;  3QD7 X;  3GAB A;  2VQE H;  4JI6 H;  4DV3 H;  4B3T H;  2ANR A;  2CTJ A;  4LFA H;  4OCH A;  1HNW H;  1ZZK A;  2LF0 A;  2QND A;  1DTJ A;  3J81 W;  2AXY A;  4KHP H;  2HH2 A;  4B8T A;  4DV1 H;  1N34 H;  2CTL A;  1ZZI A;  2LTM A;  3UOE A;  3EZJ A;  4LF7 H;  4IFD G;  2DGR A;  5LL6 b;  2ANN A;  4JI8 H;  5LMN H;  4JI1 H;  1HR0 H;  2CPM A;  4G08 A;  2CWH A;  2HH3 A;  4BA2 I;  1S20 A;  1UG8 A;  4YHH H;  4LF5 H;  4X62 H;  4X64 H;  1WE8 A;  3FAU A;  2ZM6 H;  1XNQ H;  4JVY A;  1J5K A;  2BL5 A;  4DV4 H;  2FMR A;  4NXN H;  1XRH A;  2CWF A;  4DUZ H;  2UXD H;  1F0X A;  2CTF A;  1WTJ A;  4X66 H;  2X06 A;  1VIH A;  2PY9 A;  2O4C A;  3KDK A;  1K1G A;  3J7A K;  4DV7 H;  4DR1 H;  2ZQE A;  4QMF B;  4AM3 A;  4JYA H;  5FLX W;  2VKC A;  3OET A;  3U1K A;  1X0A A;  2YQR A;  4EC5 A;  1I6U A; 
#chains in the Genus database with same CATH homology
 1XRH A;  2CWF A;  1S20 A;  4FJS A;  3UOE A;  4H8A A;  2CWH A;  1V9N A;  1WTJ A;  1Z2I A;  2X06 A;  1X0A A;  2G8Y A;  3I0P A;  4FJU A;  1VBI A;  1NXU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...