4FJUA

Crystal structure of ureidoglycolate dehydrogenase in ternary complex with nadh and glyoxylate
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
338
structure length
338
Chain Sequence
b'MKISRETLHQLIENKLCQAGLKREHAATVAEVLVYADARGIHSHGAVRVEYYAERISKGGTNREPEFRLEETGPCSAILHADNAAGQVAAKMGMEHAIKTAQQNGVAVVGISRMGHSGAISYFVQQAARAGFIGISMCQSDPMVVPFGGAEIYYGTNPLAFAAPGEGDEILTFDMATTVQAWGKVLDARSRNMSIPDTWAVDKNGVPTTDPFAVHALLPAAGPKGYGLMMMIDVLSGVLLGLPFGRQVSSMYDDLHAGRNLGQLHIVINPNFFSSSELFRQHLSQTMRELNAITPAPGFNQVYYPGQDQDIKQRKAAVEGIEIVDDIYQYLISDALYN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ureidoglycolate dehydrogenase
publication title Structural and functional insights into (s)-ureidoglycolate dehydrogenase, a metabolic branch point enzyme in nitrogen utilization.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 109
structure length 338
sequence length 338
chains with identical sequence B
ec nomenclature ec 1.1.1.154: Ureidoglycolate dehydrogenase.
pdb deposition date 2012-06-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1530.10 Mainly Alpha Orthogonal Bundle Hypothetical Oxidoreductase Yiak; Chain: A, domain 1 Hypothetical Oxidoreductase Yiak; Chain: A, domain 1 4fjuA01
3.30.1370.60 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Hypothetical oxidoreductase yiak; domain 2 4fjuA02
1XRHA 2G8YA 1Z2IA 1X0AA 3I0PA 4H8AA 1S20A 1V9NA 1VBIA 2CWFA 2CWHA 4FJUA 1WTJA 1NXUA 4FJSA 3UOEA 2X06A
chains in the Genus database with same CATH superfamily
2UXCH 4NBQA 2HHHH 2JE6I 2CTMA 1S03G 1FKAH 4DR2H 2OPUA 2CTEA 1IBLH 4B3SH 4WANA 4JI0H 4DV0H 1X9ZA 2PQUA 3V69A 4OD6A 3KDKA 2CTFA 1XNRH 2LTMA 4LF9H 1VIGA 4AIMA 1X0AA 4JVHA 4DR7H 2JA9A 1IBKH 4B8CD 4NXMH 2A1SA 5DT9A 4OCHA 4DV3H 4DV1H 4LFCH 1J4WA 2UUAH 4LF4H 1HNZH 2LF0A 2G8YA 1WVNA 4OO1G 2JEBI 4NXNH 2NN6G 4DUZH 2P2RA 2VQEH 1J5KA 5A2QW 2QNDA 1J5EH 3KDGA 2UU9H 2Z0SA 3GKUA 2CWFA 2CPMA 3J80W 4JI7H 1X4NA 4IFDG 4NZRM 4X64H 1ZZJA 2X06A 1ZZIA 5FLXW 2UXDH 3J81W 4JVYA 1S20A 2MJHA 4DR6H 4X65H 4LF7H 2CTKA 4EC5A 2E5LH 2CTJA 2E3UA 5K36G 1HR0H 2AXYA 1F0XA 2FMRA 1EC6A 4DV4H 1Z2IA 3OTOH 1V8CA 4KHPH 1MSZA 1K1GA 1TUAA 2ZQEA 2JEAI 1FJGH 1SEIA 5C0XG 3NCVA 4LF8H 4AQYH 3I0PA 1UG8A 2M8WA 4X66H 2JVZA 1NXUA 1WE8A 2O4CA 4GKJH 4X62H 2LRRA 4H8AA 2PY9A 1N36H 1VBIA 4YHHH 4DV5H 1IBMH 1KHMA 2UUCH 3VKEA 1I94H 4OX9H 3UOEA 3QD7X 2HH2A 2F4VH 5BR8H 3EZJA 5JEAG 4DUYH 4LFBH 3OETA 2K1HA 4LF5H 5LMNH 1WHRA 4GKKH 4DV7H 3SB1A 3GR5A 3FAUA 2VKCA 2DGRA 5IT9W 1X4MA 1ZZKA 2PT7G 1N34H 2UUBH 4DR4H 3L7ZC 2YQRA 1PQXA 2VQFH 4B8TA 2BA0A 2CWHA 1ODHA 1DT4A 3AEVB 1N33H 4JI4H 4JI6H 3GABA 2CTLA 1AN7A 4B3TH 4JYAH 4G08A 4LFAH 1XMQH 4JV5H 2FFMA 4DR1H 3JAMW 5IWAH 1HNXH 4BA1I 2ANNA 4DR5H 4B3RH 2BL5A 1ZTGA 1VIHA 2HH3A 4K0KH 1XRHA 1XNQH 4JI1H 1N32H 4QMFB 4JI2H 4FJUA 2JZXA 4NZTM 4JI5H 1WTJA 1I6UA 4LIJA 3T1YH 1DTJA 3RF2A 4B3MH 2ANRA 4JI8H 1HNWH 2UXBH 2CPQA 2M6QA 4DV2H 2OPVA 2LTLA 3OSSD 1V9NA 4PDBA 2Y3MA 4E9JA 3T1HH 4FJSA 1XMOH 4DV6H 2FPHX 3J7AK 4YY3H 4AM3A 5LMUH 4JI3H 4LF6H 2D9IA 3U1KA 4DR3H 4BA2I 2ZM6H 5LL6b 4WALA
chains in the Genus database with same CATH topology
1XRHA 2G8YA 1Z2IA 1X0AA 3I0PA 4H8AA 1S20A 1V9NA 1VBIA 2CWFA 2CWHA 4FJUA 1WTJA 1NXUA 4FJSA 3UOEA 2X06A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XRH A;  2G8Y A;  1Z2I A;  1X0A A;  3I0P A;  4H8A A;  1S20 A;  1V9N A;  1VBI A;  2CWF A;  2CWH A;  4FJU A;  1WTJ A;  1NXU A;  4FJS A;  3UOE A;  2X06 A; 
#chains in the Genus database with same CATH topology
 2UXC H;  4NBQ A;  2HHH H;  2JE6 I;  2CTM A;  1S03 G;  1FKA H;  4DR2 H;  2OPU A;  2CTE A;  1IBL H;  4B3S H;  4WAN A;  4JI0 H;  4DV0 H;  1X9Z A;  2PQU A;  3V69 A;  4OD6 A;  3KDK A;  2CTF A;  1XNR H;  2LTM A;  4LF9 H;  1VIG A;  4AIM A;  1X0A A;  4JVH A;  4DR7 H;  2JA9 A;  1IBK H;  4B8C D;  4NXM H;  2A1S A;  5DT9 A;  4OCH A;  4DV3 H;  4DV1 H;  4LFC H;  1J4W A;  2UUA H;  4LF4 H;  1HNZ H;  2LF0 A;  2G8Y A;  1WVN A;  4OO1 G;  2JEB I;  4NXN H;  2NN6 G;  4DUZ H;  2P2R A;  2VQE H;  1J5K A;  5A2Q W;  2QND A;  1J5E H;  3KDG A;  2UU9 H;  2Z0S A;  3GKU A;  2CWF A;  2CPM A;  3J80 W;  4JI7 H;  1X4N A;  4IFD G;  4NZR M;  4X64 H;  1ZZJ A;  2X06 A;  1ZZI A;  5FLX W;  2UXD H;  3J81 W;  4JVY A;  1S20 A;  2MJH A;  4DR6 H;  4X65 H;  4LF7 H;  2CTK A;  4EC5 A;  2E5L H;  2CTJ A;  2E3U A;  5K36 G;  1HR0 H;  2AXY A;  1F0X A;  2FMR A;  1EC6 A;  4DV4 H;  1Z2I A;  3OTO H;  1V8C A;  4KHP H;  1MSZ A;  1K1G A;  1TUA A;  2ZQE A;  2JEA I;  1FJG H;  1SEI A;  5C0X G;  3NCV A;  4LF8 H;  4AQY H;  3I0P A;  1UG8 A;  2M8W A;  4X66 H;  2JVZ A;  1NXU A;  1WE8 A;  2O4C A;  4GKJ H;  4X62 H;  2LRR A;  4H8A A;  2PY9 A;  1N36 H;  1VBI A;  4YHH H;  4DV5 H;  1IBM H;  1KHM A;  2UUC H;  3VKE A;  1I94 H;  4OX9 H;  3UOE A;  3QD7 X;  2HH2 A;  2F4V H;  5BR8 H;  3EZJ A;  5JEA G;  4DUY H;  4LFB H;  3OET A;  2K1H A;  4LF5 H;  5LMN H;  1WHR A;  4GKK H;  4DV7 H;  3SB1 A;  3GR5 A;  3FAU A;  2VKC A;  2DGR A;  5IT9 W;  1X4M A;  1ZZK A;  2PT7 G;  1N34 H;  2UUB H;  4DR4 H;  3L7Z C;  2YQR A;  1PQX A;  2VQF H;  4B8T A;  2BA0 A;  2CWH A;  1ODH A;  1DT4 A;  3AEV B;  1N33 H;  4JI4 H;  4JI6 H;  3GAB A;  2CTL A;  1AN7 A;  4B3T H;  4JYA H;  4G08 A;  4LFA H;  1XMQ H;  4JV5 H;  2FFM A;  4DR1 H;  3JAM W;  5IWA H;  1HNX H;  4BA1 I;  2ANN A;  4DR5 H;  4B3R H;  2BL5 A;  1ZTG A;  1VIH A;  2HH3 A;  4K0K H;  1XRH A;  1XNQ H;  4JI1 H;  1N32 H;  4QMF B;  4JI2 H;  4FJU A;  2JZX A;  4NZT M;  4JI5 H;  1WTJ A;  1I6U A;  4LIJ A;  3T1Y H;  1DTJ A;  3RF2 A;  4B3M H;  2ANR A;  4JI8 H;  1HNW H;  2UXB H;  2CPQ A;  2M6Q A;  4DV2 H;  2OPV A;  2LTL A;  3OSS D;  1V9N A;  4PDB A;  2Y3M A;  4E9J A;  3T1H H;  4FJS A;  1XMO H;  4DV6 H;  2FPH X;  3J7A K;  4YY3 H;  4AM3 A;  5LMU H;  4JI3 H;  4LF6 H;  2D9I A;  3U1K A;  4DR3 H;  4BA2 I;  2ZM6 H;  5LL6 b;  4WAL A; 
#chains in the Genus database with same CATH homology
 1XRH A;  2G8Y A;  1Z2I A;  1X0A A;  3I0P A;  4H8A A;  1S20 A;  1V9N A;  1VBI A;  2CWF A;  2CWH A;  4FJU A;  1WTJ A;  1NXU A;  4FJS A;  3UOE A;  2X06 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...