4FJUA

Crystal structure of ureidoglycolate dehydrogenase in ternary complex with nadh and glyoxylate
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
338
structure length
338
Chain Sequence
MKISRETLHQLIENKLCQAGLKREHAATVAEVLVYADARGIHSHGAVRVEYYAERISKGGTNREPEFRLEETGPCSAILHADNAAGQVAAKMGMEHAIKTAQQNGVAVVGISRMGHSGAISYFVQQAARAGFIGISMCQSDPMVVPFGGAEIYYGTNPLAFAAPGEGDEILTFDMATTVQAWGKVLDARSRNMSIPDTWAVDKNGVPTTDPFAVHALLPAAGPKGYGLMMMIDVLSGVLLGLPFGRQVSSMYDDLHAGRNLGQLHIVINPNFFSSSELFRQHLSQTMRELNAITPAPGFNQVYYPGQDQDIKQRKAAVEGIEIVDDIYQYLISDALYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ureidoglycolate dehydrogenase
publication title Structural and functional insights into (s)-ureidoglycolate dehydrogenase, a metabolic branch point enzyme in nitrogen utilization.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 109
structure length 338
sequence length 338
chains with identical sequence B
ec nomenclature ec 1.1.1.154: Ureidoglycolate dehydrogenase.
pdb deposition date 2012-06-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1530.10 Mainly Alpha Orthogonal Bundle Hypothetical Oxidoreductase Yiak; Chain: A, domain 1 Hypothetical Oxidoreductase Yiak; Chain: A, domain 1 4fjuA01
3.30.1370.60 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Hypothetical oxidoreductase yiak; domain 2 4fjuA02
1X0AA 1VBIA 2X06A 1NXUA 1XRHA 4H8AA 1Z2IA 3I0PA 4FJUA 1V9NA 1S20A 1WTJA 3UOEA 2G8YA 2CWFA 2CWHA 4FJSA
chains in the Genus database with same CATH superfamily
4DUYH 3GR5A 1ODHA 4GKJH 4IFDG 4LF4H 5FLXW 2VKCA 2UXBH 3NCVA 5LMUH 4YHHH 2LRRA 4JI2H 4B3TH 2MJHA 2ZM6H 1K1GA 3L7ZC 2ZQEA 2CWFA 1J4WA 4FJSA 2CTFA 2M8WA 2LTLA 2FMRA 1XNRH 5A2QW 1X4MA 2E5LH 2PT7G 1WTJA 3OETA 4EC5A 1WVNA 2CPQA 2HH2A 3JAMW 4NXMH 4JYAH 2F4VH 5LL6b 4AM3A 1DTJA 2LTMA 1XRHA 4X62H 1XNQH 3KDKA 4FJUA 4JI4H 3OTOH 4OCHA 4JV5H 4X64H 4KHPH 2CTJA 2UUBH 4NZRM 4AQYH 5BR8H 4NZTM 1EC6A 4DR3H 1UG8A 1ZZJA 1SEIA 2QNDA 2CWHA 2OPUA 2YQRA 4DR2H 2PQUA 3GABA 4PDBA 4G08A 4B8CD 4WANA 3J80W 3UOEA 2D9IA 2PY9A 2JEAI 4JI0H 2ANNA 3AEVB 3V69A 1NXUA 1XMQH 2CPMA 4DV3H 5IT9W 1S03G 1IBMH 2UXDH 2G8YA 4AIMA 1KHMA 4LFAH 5JEAG 1J5EH 1MSZA 4DR4H 4JVYA 4DV0H 3GKUA 2BA0A 2UUCH 1VIHA 1X4NA 2JA9A 4E9JA 4B3SH 2JEBI 2LF0A 1ZZIA 2M6QA 2E3UA 1HR0H 4LF7H 1VBIA 4YY3H 4JI6H 4OO1G 4OD6A 3OSSD 2VQFH 4B3MH 4LF5H 2FPHX 4K0KH 4JVHA 1IBLH 3VKEA 1FJGH 4DV2H 4QMFB 3J81W 4NBQA 1FKAH 1Z2IA 1N34H 4LFCH 2BL5A 4B3RH 1N33H 2A1SA 1PQXA 1X0AA 1N32H 4LFBH 4DV6H 1VIGA 1DT4A 2UU9H 2DGRA 1ZZKA 3U1KA 3KDGA 3I0PA 2P2RA 4DV4H 4X66H 1HNZH 2UUAH 1TUAA 1ZTGA 4BA2I 4LIJA 2K1HA 2CTMA 4JI5H 5C0XG 1S20A 2JVZA 1HNWH 3RF2A 2VQEH 4DR5H 1HNXH 3J7AK 2NN6G 4WALA 1AN7A 4LF6H 2ANRA 4DV5H 1J5KA 4OX9H 4LF9H 1X9ZA 2Z0SA 4B8TA 4JI7H 4DV7H 3T1HH 5DT9A 5LMNH 2UXCH 4H8AA 3SB1A 1F0XA 2HHHH 2AXYA 4X65H 2Y3MA 1N36H 4BA1I 1IBKH 2JE6I 2HH3A 2X06A 3QD7X 4GKKH 5K36G 3T1YH 4JI1H 4JI8H 4JI3H 2OPVA 2JZXA 2CTEA 1V9NA 2FFMA 2O4CA 4DUZH 3EZJA 1XMOH 1V8CA 4DR6H 4DV1H 4NXNH 1WE8A 3FAUA 4DR1H 1I94H 2CTLA 4DR7H 5IWAH 2CTKA 1I6UA 1WHRA 4LF8H
chains in the Genus database with same CATH topology
1X0AA 1VBIA 2X06A 1NXUA 1XRHA 4H8AA 1Z2IA 3I0PA 4FJUA 1V9NA 1S20A 1WTJA 3UOEA 2G8YA 2CWFA 2CWHA 4FJSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X0A A;  1VBI A;  2X06 A;  1NXU A;  1XRH A;  4H8A A;  1Z2I A;  3I0P A;  4FJU A;  1V9N A;  1S20 A;  1WTJ A;  3UOE A;  2G8Y A;  2CWF A;  2CWH A;  4FJS A; 
#chains in the Genus database with same CATH topology
 4DUY H;  3GR5 A;  1ODH A;  4GKJ H;  4IFD G;  4LF4 H;  5FLX W;  2VKC A;  2UXB H;  3NCV A;  5LMU H;  4YHH H;  2LRR A;  4JI2 H;  4B3T H;  2MJH A;  2ZM6 H;  1K1G A;  3L7Z C;  2ZQE A;  2CWF A;  1J4W A;  4FJS A;  2CTF A;  2M8W A;  2LTL A;  2FMR A;  1XNR H;  5A2Q W;  1X4M A;  2E5L H;  2PT7 G;  1WTJ A;  3OET A;  4EC5 A;  1WVN A;  2CPQ A;  2HH2 A;  3JAM W;  4NXM H;  4JYA H;  2F4V H;  5LL6 b;  4AM3 A;  1DTJ A;  2LTM A;  1XRH A;  4X62 H;  1XNQ H;  3KDK A;  4FJU A;  4JI4 H;  3OTO H;  4OCH A;  4JV5 H;  4X64 H;  4KHP H;  2CTJ A;  2UUB H;  4NZR M;  4AQY H;  5BR8 H;  4NZT M;  1EC6 A;  4DR3 H;  1UG8 A;  1ZZJ A;  1SEI A;  2QND A;  2CWH A;  2OPU A;  2YQR A;  4DR2 H;  2PQU A;  3GAB A;  4PDB A;  4G08 A;  4B8C D;  4WAN A;  3J80 W;  3UOE A;  2D9I A;  2PY9 A;  2JEA I;  4JI0 H;  2ANN A;  3AEV B;  3V69 A;  1NXU A;  1XMQ H;  2CPM A;  4DV3 H;  5IT9 W;  1S03 G;  1IBM H;  2UXD H;  2G8Y A;  4AIM A;  1KHM A;  4LFA H;  5JEA G;  1J5E H;  1MSZ A;  4DR4 H;  4JVY A;  4DV0 H;  3GKU A;  2BA0 A;  2UUC H;  1VIH A;  1X4N A;  2JA9 A;  4E9J A;  4B3S H;  2JEB I;  2LF0 A;  1ZZI A;  2M6Q A;  2E3U A;  1HR0 H;  4LF7 H;  1VBI A;  4YY3 H;  4JI6 H;  4OO1 G;  4OD6 A;  3OSS D;  2VQF H;  4B3M H;  4LF5 H;  2FPH X;  4K0K H;  4JVH A;  1IBL H;  3VKE A;  1FJG H;  4DV2 H;  4QMF B;  3J81 W;  4NBQ A;  1FKA H;  1Z2I A;  1N34 H;  4LFC H;  2BL5 A;  4B3R H;  1N33 H;  2A1S A;  1PQX A;  1X0A A;  1N32 H;  4LFB H;  4DV6 H;  1VIG A;  1DT4 A;  2UU9 H;  2DGR A;  1ZZK A;  3U1K A;  3KDG A;  3I0P A;  2P2R A;  4DV4 H;  4X66 H;  1HNZ H;  2UUA H;  1TUA A;  1ZTG A;  4BA2 I;  4LIJ A;  2K1H A;  2CTM A;  4JI5 H;  5C0X G;  1S20 A;  2JVZ A;  1HNW H;  3RF2 A;  2VQE H;  4DR5 H;  1HNX H;  3J7A K;  2NN6 G;  4WAL A;  1AN7 A;  4LF6 H;  2ANR A;  4DV5 H;  1J5K A;  4OX9 H;  4LF9 H;  1X9Z A;  2Z0S A;  4B8T A;  4JI7 H;  4DV7 H;  3T1H H;  5DT9 A;  5LMN H;  2UXC H;  4H8A A;  3SB1 A;  1F0X A;  2HHH H;  2AXY A;  4X65 H;  2Y3M A;  1N36 H;  4BA1 I;  1IBK H;  2JE6 I;  2HH3 A;  2X06 A;  3QD7 X;  4GKK H;  5K36 G;  3T1Y H;  4JI1 H;  4JI8 H;  4JI3 H;  2OPV A;  2JZX A;  2CTE A;  1V9N A;  2FFM A;  2O4C A;  4DUZ H;  3EZJ A;  1XMO H;  1V8C A;  4DR6 H;  4DV1 H;  4NXN H;  1WE8 A;  3FAU A;  4DR1 H;  1I94 H;  2CTL A;  4DR7 H;  5IWA H;  2CTK A;  1I6U A;  1WHR A;  4LF8 H; 
#chains in the Genus database with same CATH homology
 1X0A A;  1VBI A;  2X06 A;  1NXU A;  1XRH A;  4H8A A;  1Z2I A;  3I0P A;  4FJU A;  1V9N A;  1S20 A;  1WTJ A;  3UOE A;  2G8Y A;  2CWF A;  2CWH A;  4FJS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...