4FJUA

Crystal structure of ureidoglycolate dehydrogenase in ternary complex with nadh and glyoxylate
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
338
structure length
338
Chain Sequence
b'MKISRETLHQLIENKLCQAGLKREHAATVAEVLVYADARGIHSHGAVRVEYYAERISKGGTNREPEFRLEETGPCSAILHADNAAGQVAAKMGMEHAIKTAQQNGVAVVGISRMGHSGAISYFVQQAARAGFIGISMCQSDPMVVPFGGAEIYYGTNPLAFAAPGEGDEILTFDMATTVQAWGKVLDARSRNMSIPDTWAVDKNGVPTTDPFAVHALLPAAGPKGYGLMMMIDVLSGVLLGLPFGRQVSSMYDDLHAGRNLGQLHIVINPNFFSSSELFRQHLSQTMRELNAITPAPGFNQVYYPGQDQDIKQRKAAVEGIEIVDDIYQYLISDALYN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ureidoglycolate dehydrogenase
molecule tags Oxidoreductase
source organism Escherichia coli
publication title Structural and functional insights into (s)-ureidoglycolate dehydrogenase, a metabolic branch point enzyme in nitrogen utilization.
pubmed doi rcsb
total genus 109
structure length 338
sequence length 338
chains with identical sequence B
ec nomenclature ec 1.1.1.154: Ureidoglycolate dehydrogenase.
pdb deposition date 2012-06-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1530.10 Mainly Alpha Orthogonal Bundle Hypothetical Oxidoreductase Yiak; Chain: A, domain 1 Hypothetical Oxidoreductase Yiak; Chain: A, domain 1 4fjuA01
3.30.1370.60 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Hypothetical oxidoreductase yiak; domain 2 4fjuA02
3I0PA 1X0AA 2CWFA 1VBIA 4FJUA 1NXUA 1V9NA 2CWHA 2X06A 4FJSA 4H8AA 3UOEA 1Z2IA 1S20A 1WTJA 1XRHA 2G8YA
chains in the Genus database with same CATH superfamily
4DV4H 2ZQEA 2UXDH 2D9IA 4DR2H 1MSZA 2HH2A 2JEBI 3GKUA 2FPHX 2PY9A 2F4VH 2A1SA 4B8CD 4OO1G 1XRHA 1SEIA 4X64H 5LMNH 1XNQH 3I0PA 4DV6H 4BA1I 4JI1H 2CTKA 2UUBH 3T1HH 2JEAI 2ANNA 1J5KA 4JYAH 4JI0H 2DGRA 2FFMA 5FLXW 2CWFA 4BA2I 4IFDG 2ZM6H 1V9NA 2Z0SA 3J80W 4H8AA 2O4CA 1AN7A 3T1YH 5DT9A 4E9JA 2UXBH 1X9ZA 2Y3MA 3FAUA 3KDGA 2M6QA 4JI2H 4B8TA 3VKEA 1F0XA 4DR5H 2QNDA 1N36H 2CWHA 1PQXA 3EZJA 2LTLA 2OPUA 4LF8H 4NXMH 1HNWH 5BR8H 2G8YA 1DT4A 2FMRA 2BA0A 4WALA 4LFCH 2E3UA 2NN6G 3NCVA 4DV7H 3V69A 1X4MA 2YQRA 1IBKH 1V8CA 2JVZA 1WTJA 4X66H 4DR4H 4OX9H 1VBIA 4DR6H 5IWAH 4NZTM 4AQYH 5IT9W 4DV0H 1FJGH 5JEAG 4K0KH 2VKCA 4JI6H 1IBMH 4DUYH 3OSSD 1VIGA 4LIJA 2X06A 3GR5A 3U1KA 3UOEA 4JV5H 4NBQA 1N34H 1ZZKA 1FKAH 1I6UA 2CPQA 1VIHA 3JAMW 1UG8A 4EC5A 4JI8H 4OD6A 1ZZIA 1HNXH 2HHHH 2UUAH 3AEVB 4B3MH 4B3SH 2OPVA 1I94H 1ODHA 1WHRA 2VQEH 2BL5A 2JE6I 1TUAA 1WE8A 4DUZH 4DV2H 4JI3H 4FJSA 2JA9A 3OETA 1Z2IA 2CTFA 2JZXA 2PT7G 4OCHA 5A2QW 4JI5H 4LFAH 4JVHA 1IBLH 3RF2A 3J81W 4YHHH 1J5EH 1HNZH 1WVNA 1S20A 4GKJH 1ZTGA 4NZRM 4DV5H 4DV3H 1X0AA 4KHPH 3SB1A 2PQUA 1XNRH 2HH3A 2E5LH 2UU9H 2UUCH 5LMUH 3QD7X 1XMOH 2ANRA 4PDBA 1N33H 1DTJA 4DV1H 2UXCH 1KHMA 1EC6A 2CTMA 4LF4H 4X62H 2K1HA 4LF7H 4X65H 4DR3H 1N32H 4AM3A 3GABA 1XMQH 4YY3H 1J4WA 2P2RA 2CPMA 5K36G 2LTMA 1ZZJA 4GKKH 4JI7H 4LF6H 4JI4H 4LFBH 1HR0H 2CTLA 4LF9H 1S03G 1X4NA 2LF0A 3L7ZC 5LL6b 4FJUA 1K1GA 4B3RH 3J7AK 3KDKA 5C0XG 2LRRA 4DR1H 4B3TH 4WANA 4NXNH 2AXYA 4LF5H 2MJHA 4JVYA 4DR7H 1NXUA 2M8WA 2CTEA 2CTJA 4AIMA 4G08A 3OTOH 2VQFH 4QMFB
chains in the Genus database with same CATH topology
3I0PA 1X0AA 2CWFA 1VBIA 4FJUA 1NXUA 1V9NA 2CWHA 2X06A 4FJSA 4H8AA 3UOEA 1Z2IA 1S20A 1WTJA 1XRHA 2G8YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I0P A;  1X0A A;  2CWF A;  1VBI A;  4FJU A;  1NXU A;  1V9N A;  2CWH A;  2X06 A;  4FJS A;  4H8A A;  3UOE A;  1Z2I A;  1S20 A;  1WTJ A;  1XRH A;  2G8Y A; 
#chains in the Genus database with same CATH topology
 4DV4 H;  2ZQE A;  2UXD H;  2D9I A;  4DR2 H;  1MSZ A;  2HH2 A;  2JEB I;  3GKU A;  2FPH X;  2PY9 A;  2F4V H;  2A1S A;  4B8C D;  4OO1 G;  1XRH A;  1SEI A;  4X64 H;  5LMN H;  1XNQ H;  3I0P A;  4DV6 H;  4BA1 I;  4JI1 H;  2CTK A;  2UUB H;  3T1H H;  2JEA I;  2ANN A;  1J5K A;  4JYA H;  4JI0 H;  2DGR A;  2FFM A;  5FLX W;  2CWF A;  4BA2 I;  4IFD G;  2ZM6 H;  1V9N A;  2Z0S A;  3J80 W;  4H8A A;  2O4C A;  1AN7 A;  3T1Y H;  5DT9 A;  4E9J A;  2UXB H;  1X9Z A;  2Y3M A;  3FAU A;  3KDG A;  2M6Q A;  4JI2 H;  4B8T A;  3VKE A;  1F0X A;  4DR5 H;  2QND A;  1N36 H;  2CWH A;  1PQX A;  3EZJ A;  2LTL A;  2OPU A;  4LF8 H;  4NXM H;  1HNW H;  5BR8 H;  2G8Y A;  1DT4 A;  2FMR A;  2BA0 A;  4WAL A;  4LFC H;  2E3U A;  2NN6 G;  3NCV A;  4DV7 H;  3V69 A;  1X4M A;  2YQR A;  1IBK H;  1V8C A;  2JVZ A;  1WTJ A;  4X66 H;  4DR4 H;  4OX9 H;  1VBI A;  4DR6 H;  5IWA H;  4NZT M;  4AQY H;  5IT9 W;  4DV0 H;  1FJG H;  5JEA G;  4K0K H;  2VKC A;  4JI6 H;  1IBM H;  4DUY H;  3OSS D;  1VIG A;  4LIJ A;  2X06 A;  3GR5 A;  3U1K A;  3UOE A;  4JV5 H;  4NBQ A;  1N34 H;  1ZZK A;  1FKA H;  1I6U A;  2CPQ A;  1VIH A;  3JAM W;  1UG8 A;  4EC5 A;  4JI8 H;  4OD6 A;  1ZZI A;  1HNX H;  2HHH H;  2UUA H;  3AEV B;  4B3M H;  4B3S H;  2OPV A;  1I94 H;  1ODH A;  1WHR A;  2VQE H;  2BL5 A;  2JE6 I;  1TUA A;  1WE8 A;  4DUZ H;  4DV2 H;  4JI3 H;  4FJS A;  2JA9 A;  3OET A;  1Z2I A;  2CTF A;  2JZX A;  2PT7 G;  4OCH A;  5A2Q W;  4JI5 H;  4LFA H;  4JVH A;  1IBL H;  3RF2 A;  3J81 W;  4YHH H;  1J5E H;  1HNZ H;  1WVN A;  1S20 A;  4GKJ H;  1ZTG A;  4NZR M;  4DV5 H;  4DV3 H;  1X0A A;  4KHP H;  3SB1 A;  2PQU A;  1XNR H;  2HH3 A;  2E5L H;  2UU9 H;  2UUC H;  5LMU H;  3QD7 X;  1XMO H;  2ANR A;  4PDB A;  1N33 H;  1DTJ A;  4DV1 H;  2UXC H;  1KHM A;  1EC6 A;  2CTM A;  4LF4 H;  4X62 H;  2K1H A;  4LF7 H;  4X65 H;  4DR3 H;  1N32 H;  4AM3 A;  3GAB A;  1XMQ H;  4YY3 H;  1J4W A;  2P2R A;  2CPM A;  5K36 G;  2LTM A;  1ZZJ A;  4GKK H;  4JI7 H;  4LF6 H;  4JI4 H;  4LFB H;  1HR0 H;  2CTL A;  4LF9 H;  1S03 G;  1X4N A;  2LF0 A;  3L7Z C;  5LL6 b;  4FJU A;  1K1G A;  4B3R H;  3J7A K;  3KDK A;  5C0X G;  2LRR A;  4DR1 H;  4B3T H;  4WAN A;  4NXN H;  2AXY A;  4LF5 H;  2MJH A;  4JVY A;  4DR7 H;  1NXU A;  2M8W A;  2CTE A;  2CTJ A;  4AIM A;  4G08 A;  3OTO H;  2VQF H;  4QMF B; 
#chains in the Genus database with same CATH homology
 3I0P A;  1X0A A;  2CWF A;  1VBI A;  4FJU A;  1NXU A;  1V9N A;  2CWH A;  2X06 A;  4FJS A;  4H8A A;  3UOE A;  1Z2I A;  1S20 A;  1WTJ A;  1XRH A;  2G8Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...