4FJUA

Crystal structure of ureidoglycolate dehydrogenase in ternary complex with nadh and glyoxylate
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
338
structure length
338
Chain Sequence
MKISRETLHQLIENKLCQAGLKREHAATVAEVLVYADARGIHSHGAVRVEYYAERISKGGTNREPEFRLEETGPCSAILHADNAAGQVAAKMGMEHAIKTAQQNGVAVVGISRMGHSGAISYFVQQAARAGFIGISMCQSDPMVVPFGGAEIYYGTNPLAFAAPGEGDEILTFDMATTVQAWGKVLDARSRNMSIPDTWAVDKNGVPTTDPFAVHALLPAAGPKGYGLMMMIDVLSGVLLGLPFGRQVSSMYDDLHAGRNLGQLHIVINPNFFSSSELFRQHLSQTMRELNAITPAPGFNQVYYPGQDQDIKQRKAAVEGIEIVDDIYQYLISDALYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Ureidoglycolate dehydrogenase
publication title Structural and functional insights into (s)-ureidoglycolate dehydrogenase, a metabolic branch point enzyme in nitrogen utilization.
pubmed doi rcsb
source organism Escherichia coli
total genus 109
structure length 338
sequence length 338
chains with identical sequence B
ec nomenclature ec 1.1.1.154: Ureidoglycolate dehydrogenase.
pdb deposition date 2012-06-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1530.10 Mainly Alpha Orthogonal Bundle Hypothetical Oxidoreductase Yiak; Chain: A, domain 1 Hypothetical Oxidoreductase Yiak; Chain: A, domain 1 4fjuA01
3.30.1370.60 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Hypothetical oxidoreductase yiak; domain 2 4fjuA02
2CWFA 2G8YA 1XRHA 2CWHA 4FJUA 3I0PA 4H8AA 1NXUA 1S20A 1WTJA 1VBIA 1V9NA 1X0AA 4FJSA 3UOEA 2X06A 1Z2IA
chains in the Genus database with same CATH superfamily
4LF6H 1IBLH 2CWFA 5BR8H 4AM3A 4X62H 1WTJA 3QD7X 1XMQH 4B3SH 4JI7H 4DR6H 4DR7H 4FJSA 1X4NA 1ZZIA 3T1HH 1FJGH 4DV2H 1HR0H 4DR5H 5C0XG 4FJUA 2FPHX 2CPQA 1FKAH 4JI5H 5JEAG 2LRRA 1X9ZA 4DV1H 4OCHA 1TUAA 4DR3H 2F4VH 4JI6H 4LF8H 2FFMA 4DV4H 4LF5H 2CTMA 1S20A 2CTLA 4NBQA 4LIJA 2D9IA 1ZTGA 4PDBA 2ANRA 4JVHA 5LMUH 2UXBH 3T1YH 2P2RA 4BA1I 2OPUA 3J7AK 2HH3A 2MJHA 1EC6A 1N36H 4DV0H 4LF9H 1VBIA 2Y3MA 2PQUA 4NXNH 4JYAH 4DV6H 3NCVA 1ZZJA 4AIMA 3KDKA 4GKJH 2CTKA 2NN6G 3I0PA 1DTJA 1ZZKA 3FAUA 2ANNA 2FMRA 5DT9A 2VQFH 1IBKH 4B3TH 2ZM6H 2X06A 1F0XA 2YQRA 4LF7H 4DR2H 2LF0A 4B3MH 4AQYH 4LFBH 4JI2H 1I6UA 5IWAH 2HHHH 3GKUA 1WVNA 2PY9A 1J5KA 4JI4H 1KHMA 5A2QW 2JE6I 3SB1A 2E5LH 3JAMW 4X66H 1ODHA 3OTOH 2CTJA 1XMOH 4NZRM 1AN7A 1XRHA 4IFDG 2CTEA 1WE8A 4X65H 3EZJA 1J5EH 4OD6A 2BA0A 1HNXH 2OPVA 2CTFA 4YHHH 4JVYA 1Z2IA 3L7ZC 2JZXA 3J80W 2QNDA 1X4MA 5IT9W 5LMNH 3VKEA 1DT4A 2PT7G 2Z0SA 1X0AA 3V69A 5K36G 2ZQEA 2M8WA 1UG8A 4NZTM 4JI1H 3J81W 1HNWH 4WALA 4LFCH 4B3RH 1I94H 4G08A 4E9JA 4LF4H 1N32H 4H8AA 2AXYA 2BL5A 2DGRA 4EC5A 2UXDH 2UUBH 4GKKH 4DR1H 4DR4H 4BA2I 2VKCA 4JI3H 4JV5H 4KHPH 4JI8H 4B8CD 1HNZH 1MSZA 1VIGA 1VIHA 2E3UA 1XNRH 2K1HA 4LFAH 1V8CA 3GABA 2JEAI 3KDGA 2CPMA 1K1GA 2CWHA 3U1KA 2UUAH 4B8TA 3OETA 2JVZA 3GR5A 1S03G 3AEVB 1SEIA 4DV7H 1N33H 1N34H 4WANA 4YY3H 4K0KH 1V9NA 5FLXW 2A1SA 2JEBI 1XNQH 2M6QA 2G8YA 2HH2A 3OSSD 4X64H 2LTMA 1NXUA 2VQEH 4OO1G 2UXCH 1J4WA 4DV3H 1IBMH 1WHRA 5LL6b 2UU9H 2UUCH 2JA9A 4DUYH 1PQXA 2LTLA 4JI0H 4DUZH 4QMFB 3RF2A 4OX9H 4NXMH 4DV5H 2O4CA 3UOEA
chains in the Genus database with same CATH topology
2CWFA 2G8YA 1XRHA 2CWHA 4FJUA 3I0PA 4H8AA 1NXUA 1S20A 1WTJA 1VBIA 1V9NA 1X0AA 4FJSA 3UOEA 2X06A 1Z2IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CWF A;  2G8Y A;  1XRH A;  2CWH A;  4FJU A;  3I0P A;  4H8A A;  1NXU A;  1S20 A;  1WTJ A;  1VBI A;  1V9N A;  1X0A A;  4FJS A;  3UOE A;  2X06 A;  1Z2I A; 
#chains in the Genus database with same CATH topology
 4LF6 H;  1IBL H;  2CWF A;  5BR8 H;  4AM3 A;  4X62 H;  1WTJ A;  3QD7 X;  1XMQ H;  4B3S H;  4JI7 H;  4DR6 H;  4DR7 H;  4FJS A;  1X4N A;  1ZZI A;  3T1H H;  1FJG H;  4DV2 H;  1HR0 H;  4DR5 H;  5C0X G;  4FJU A;  2FPH X;  2CPQ A;  1FKA H;  4JI5 H;  5JEA G;  2LRR A;  1X9Z A;  4DV1 H;  4OCH A;  1TUA A;  4DR3 H;  2F4V H;  4JI6 H;  4LF8 H;  2FFM A;  4DV4 H;  4LF5 H;  2CTM A;  1S20 A;  2CTL A;  4NBQ A;  4LIJ A;  2D9I A;  1ZTG A;  4PDB A;  2ANR A;  4JVH A;  5LMU H;  2UXB H;  3T1Y H;  2P2R A;  4BA1 I;  2OPU A;  3J7A K;  2HH3 A;  2MJH A;  1EC6 A;  1N36 H;  4DV0 H;  4LF9 H;  1VBI A;  2Y3M A;  2PQU A;  4NXN H;  4JYA H;  4DV6 H;  3NCV A;  1ZZJ A;  4AIM A;  3KDK A;  4GKJ H;  2CTK A;  2NN6 G;  3I0P A;  1DTJ A;  1ZZK A;  3FAU A;  2ANN A;  2FMR A;  5DT9 A;  2VQF H;  1IBK H;  4B3T H;  2ZM6 H;  2X06 A;  1F0X A;  2YQR A;  4LF7 H;  4DR2 H;  2LF0 A;  4B3M H;  4AQY H;  4LFB H;  4JI2 H;  1I6U A;  5IWA H;  2HHH H;  3GKU A;  1WVN A;  2PY9 A;  1J5K A;  4JI4 H;  1KHM A;  5A2Q W;  2JE6 I;  3SB1 A;  2E5L H;  3JAM W;  4X66 H;  1ODH A;  3OTO H;  2CTJ A;  1XMO H;  4NZR M;  1AN7 A;  1XRH A;  4IFD G;  2CTE A;  1WE8 A;  4X65 H;  3EZJ A;  1J5E H;  4OD6 A;  2BA0 A;  1HNX H;  2OPV A;  2CTF A;  4YHH H;  4JVY A;  1Z2I A;  3L7Z C;  2JZX A;  3J80 W;  2QND A;  1X4M A;  5IT9 W;  5LMN H;  3VKE A;  1DT4 A;  2PT7 G;  2Z0S A;  1X0A A;  3V69 A;  5K36 G;  2ZQE A;  2M8W A;  1UG8 A;  4NZT M;  4JI1 H;  3J81 W;  1HNW H;  4WAL A;  4LFC H;  4B3R H;  1I94 H;  4G08 A;  4E9J A;  4LF4 H;  1N32 H;  4H8A A;  2AXY A;  2BL5 A;  2DGR A;  4EC5 A;  2UXD H;  2UUB H;  4GKK H;  4DR1 H;  4DR4 H;  4BA2 I;  2VKC A;  4JI3 H;  4JV5 H;  4KHP H;  4JI8 H;  4B8C D;  1HNZ H;  1MSZ A;  1VIG A;  1VIH A;  2E3U A;  1XNR H;  2K1H A;  4LFA H;  1V8C A;  3GAB A;  2JEA I;  3KDG A;  2CPM A;  1K1G A;  2CWH A;  3U1K A;  2UUA H;  4B8T A;  3OET A;  2JVZ A;  3GR5 A;  1S03 G;  3AEV B;  1SEI A;  4DV7 H;  1N33 H;  1N34 H;  4WAN A;  4YY3 H;  4K0K H;  1V9N A;  5FLX W;  2A1S A;  2JEB I;  1XNQ H;  2M6Q A;  2G8Y A;  2HH2 A;  3OSS D;  4X64 H;  2LTM A;  1NXU A;  2VQE H;  4OO1 G;  2UXC H;  1J4W A;  4DV3 H;  1IBM H;  1WHR A;  5LL6 b;  2UU9 H;  2UUC H;  2JA9 A;  4DUY H;  1PQX A;  2LTL A;  4JI0 H;  4DUZ H;  4QMF B;  3RF2 A;  4OX9 H;  4NXM H;  4DV5 H;  2O4C A;  3UOE A; 
#chains in the Genus database with same CATH homology
 2CWF A;  2G8Y A;  1XRH A;  2CWH A;  4FJU A;  3I0P A;  4H8A A;  1NXU A;  1S20 A;  1WTJ A;  1VBI A;  1V9N A;  1X0A A;  4FJS A;  3UOE A;  2X06 A;  1Z2I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...