2OPVA

Solution nmr structure of the second domain of ksrp
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
85
structure length
85
Chain Sequence
GQFHDNANGGQNGTVQEIMIPAGKAGLVIGKGGETIKQLQERAGVKMILIQDGSQNTNVDKPLRIIGDPYKVQQACEMVMDILRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The NMR Structures of the N-terminal Domains of KSRP
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords KHSRP protein
total genus 23
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2007-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 2opvA00
1DTJA 5C0XG 4JVYA 1ZZKA 2MJHA 4OO1G 1ZZJA 2BL5A 2HH2A 4IFDG 1ZTGA 4QMFB 5K36G 3V69A 2PY9A 2OPVA 4AIMA 2DGRA 1K1GA 1VIGA 2CTKA 1WE8A 4LIJA 1TUAA 4WALA 1KHMA 2P2RA 2JA9A 2ANRA 2JEAI 2JE6I 2HH3A 1VIHA 2JZXA 1EC6A 2JVZA 1J4WA 2QNDA 1DT4A 1X4NA 4BA1I 2NN6G 3VKEA 4NBQA 3AEVB 4BA2I 2CTEA 4B8TA 4AM3A 4WANA 3L7ZC 3U1KA 1X4MA 2CTLA 2CPQA 2FMRA 2Z0SA 1WVNA 2CTFA 2E3UA 2OPUA 1ZZIA 2YQRA 2PQUA 4JVHA 2CTJA 2BA0A 2AXYA 1J5KA 2CTMA 5JEAG 2JEBI 2ANNA
chains in the Genus database with same CATH superfamily
2UUBH 2D9IA 2VQFH 2HHHH 1ODHA 4QMFB 4JV5H 2M8WA 3SB1A 2Y3MA 1VIGA 2CTKA 4LIJA 1KHMA 4JI0H 2CWHA 5IT9W 2LF0A 1XMOH 1Z2IA 3GKUA 4LF6H 2VKCA 1N33H 1IBLH 1J4WA 4DR2H 1X4NA 1J5EH 5LL6b 4DV5H 2NN6G 4AM3A 3AEVB 4AQYH 3U1KA 2CTLA 2FMRA 4LF8H 4X62H 4KHPH 4H8AA 1ZZIA 2PQUA 2CTJA 4OD6A 2AXYA 4DR5H 2A1SA 1N32H 2JEBI 4EC5A 3KDGA 5BR8H 4G08A 1ZZKA 2UU9H 4FJSA 4JI6H 2HH2A 1IBMH 2PY9A 2G8YA 1K1GA 4JI5H 1V9NA 2DGRA 2UUAH 1XNRH 2UUCH 4JYAH 4WALA 1WE8A 1FJGH 1F0XA 2P2RA 2JA9A 3JAMW 1V8CA 4JI7H 2JEAI 1NXUA 2VQEH 4DV3H 2HH3A 4FJUA 3J7AK 2K1HA 5FLXW 4LFCH 4NXNH 4OX9H 4B8CD 2F4VH 1PQXA 2UXBH 3J81W 3VKEA 3J80W 4BA2I 3OETA 2UXCH 3GR5A 4WANA 3UOEA 1I94H 2O4CA 2Z0SA 4DUZH 4LF7H 2OPUA 4DV2H 4GKKH 4DV1H 4JVHA 1SEIA 2BA0A 1S03G 4K0KH 2LRRA 2LTLA 2CWFA 2X06A 1DTJA 1X9ZA 5C0XG 4B3MH 4DR7H 1S20A 2FPHX 4IFDG 4DR3H 4LFBH 4DV4H 1ZTGA 3I0PA 3V69A 2FFMA 2E5LH 4LF4H 1AN7A 1IBKH 3FAUA 5DT9A 1HNXH 4X66H 5LMNH 4X65H 1MSZA 2ANRA 1UG8A 1VIHA 2JZXA 1N36H 1EC6A 2JVZA 2M6QA 1HNZH 2QNDA 1DT4A 4PDBA 2ZM6H 4NBQA 2CTEA 4B8TA 4JI3H 3L7ZC 4JI8H 1X4MA 2LTMA 5A2QW 2CPQA 4NZTM 1HR0H 1WVNA 2CTFA 2ZQEA 4NZRM 3EZJA 2YQRA 4DUYH 4GKJH 3T1YH 2CTMA 5JEAG 4YHHH 1XRHA 4DR1H 4JI4H 2ANNA 4JVYA 2PT7G 4DV6H 4OCHA 4YY3H 2MJHA 1FKAH 1ZZJA 4LFAH 2BL5A 1HNWH 4OO1G 2CPMA 3NCVA 5LMUH 5K36G 2OPVA 4AIMA 3OTOH 4DV0H 4LF9H 2UXDH 1TUAA 5IWAH 4NXMH 4LF5H 2JE6I 4X64H 1XNQH 3QD7X 1N34H 1I6UA 3T1HH 3RF2A 1X0AA 1WTJA 3OSSD 4BA1I 4B3SH 4DV7H 4JI1H 4DR6H 1VBIA 3GABA 2E3UA 4E9JA 4JI2H 1J5KA 1WHRA 1XMQH 4B3RH 4DR4H 4B3TH 3KDKA
chains in the Genus database with same CATH topology
1DTJA 5C0XG 4JVYA 1ZZKA 2MJHA 4OO1G 1ZZJA 2BL5A 2HH2A 4IFDG 1ZTGA 4QMFB 5K36G 3V69A 2PY9A 2OPVA 4AIMA 2DGRA 1K1GA 1VIGA 2CTKA 1WE8A 4LIJA 1TUAA 4WALA 1KHMA 2P2RA 2JA9A 2ANRA 2JEAI 2JE6I 2HH3A 1VIHA 2JZXA 1EC6A 2JVZA 1J4WA 2QNDA 1DT4A 1X4NA 4BA1I 2NN6G 3VKEA 4NBQA 3AEVB 4BA2I 2CTEA 4B8TA 4AM3A 4WANA 3L7ZC 3U1KA 1X4MA 2CTLA 2CPQA 2FMRA 2Z0SA 1WVNA 2CTFA 2E3UA 2OPUA 1ZZIA 2YQRA 2PQUA 4JVHA 2CTJA 2BA0A 2AXYA 1J5KA 2CTMA 5JEAG 2JEBI 2ANNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DTJ A;  5C0X G;  4JVY A;  1ZZK A;  2MJH A;  4OO1 G;  1ZZJ A;  2BL5 A;  2HH2 A;  4IFD G;  1ZTG A;  4QMF B;  5K36 G;  3V69 A;  2PY9 A;  2OPV A;  4AIM A;  2DGR A;  1K1G A;  1VIG A;  2CTK A;  1WE8 A;  4LIJ A;  1TUA A;  4WAL A;  1KHM A;  2P2R A;  2JA9 A;  2ANR A;  2JEA I;  2JE6 I;  2HH3 A;  1VIH A;  2JZX A;  1EC6 A;  2JVZ A;  1J4W A;  2QND A;  1DT4 A;  1X4N A;  4BA1 I;  2NN6 G;  3VKE A;  4NBQ A;  3AEV B;  4BA2 I;  2CTE A;  4B8T A;  4AM3 A;  4WAN A;  3L7Z C;  3U1K A;  1X4M A;  2CTL A;  2CPQ A;  2FMR A;  2Z0S A;  1WVN A;  2CTF A;  2E3U A;  2OPU A;  1ZZI A;  2YQR A;  2PQU A;  4JVH A;  2CTJ A;  2BA0 A;  2AXY A;  1J5K A;  2CTM A;  5JEA G;  2JEB I;  2ANN A; 
#chains in the Genus database with same CATH topology
 2UUB H;  2D9I A;  2VQF H;  2HHH H;  1ODH A;  4QMF B;  4JV5 H;  2M8W A;  3SB1 A;  2Y3M A;  1VIG A;  2CTK A;  4LIJ A;  1KHM A;  4JI0 H;  2CWH A;  5IT9 W;  2LF0 A;  1XMO H;  1Z2I A;  3GKU A;  4LF6 H;  2VKC A;  1N33 H;  1IBL H;  1J4W A;  4DR2 H;  1X4N A;  1J5E H;  5LL6 b;  4DV5 H;  2NN6 G;  4AM3 A;  3AEV B;  4AQY H;  3U1K A;  2CTL A;  2FMR A;  4LF8 H;  4X62 H;  4KHP H;  4H8A A;  1ZZI A;  2PQU A;  2CTJ A;  4OD6 A;  2AXY A;  4DR5 H;  2A1S A;  1N32 H;  2JEB I;  4EC5 A;  3KDG A;  5BR8 H;  4G08 A;  1ZZK A;  2UU9 H;  4FJS A;  4JI6 H;  2HH2 A;  1IBM H;  2PY9 A;  2G8Y A;  1K1G A;  4JI5 H;  1V9N A;  2DGR A;  2UUA H;  1XNR H;  2UUC H;  4JYA H;  4WAL A;  1WE8 A;  1FJG H;  1F0X A;  2P2R A;  2JA9 A;  3JAM W;  1V8C A;  4JI7 H;  2JEA I;  1NXU A;  2VQE H;  4DV3 H;  2HH3 A;  4FJU A;  3J7A K;  2K1H A;  5FLX W;  4LFC H;  4NXN H;  4OX9 H;  4B8C D;  2F4V H;  1PQX A;  2UXB H;  3J81 W;  3VKE A;  3J80 W;  4BA2 I;  3OET A;  2UXC H;  3GR5 A;  4WAN A;  3UOE A;  1I94 H;  2O4C A;  2Z0S A;  4DUZ H;  4LF7 H;  2OPU A;  4DV2 H;  4GKK H;  4DV1 H;  4JVH A;  1SEI A;  2BA0 A;  1S03 G;  4K0K H;  2LRR A;  2LTL A;  2CWF A;  2X06 A;  1DTJ A;  1X9Z A;  5C0X G;  4B3M H;  4DR7 H;  1S20 A;  2FPH X;  4IFD G;  4DR3 H;  4LFB H;  4DV4 H;  1ZTG A;  3I0P A;  3V69 A;  2FFM A;  2E5L H;  4LF4 H;  1AN7 A;  1IBK H;  3FAU A;  5DT9 A;  1HNX H;  4X66 H;  5LMN H;  4X65 H;  1MSZ A;  2ANR A;  1UG8 A;  1VIH A;  2JZX A;  1N36 H;  1EC6 A;  2JVZ A;  2M6Q A;  1HNZ H;  2QND A;  1DT4 A;  4PDB A;  2ZM6 H;  4NBQ A;  2CTE A;  4B8T A;  4JI3 H;  3L7Z C;  4JI8 H;  1X4M A;  2LTM A;  5A2Q W;  2CPQ A;  4NZT M;  1HR0 H;  1WVN A;  2CTF A;  2ZQE A;  4NZR M;  3EZJ A;  2YQR A;  4DUY H;  4GKJ H;  3T1Y H;  2CTM A;  5JEA G;  4YHH H;  1XRH A;  4DR1 H;  4JI4 H;  2ANN A;  4JVY A;  2PT7 G;  4DV6 H;  4OCH A;  4YY3 H;  2MJH A;  1FKA H;  1ZZJ A;  4LFA H;  2BL5 A;  1HNW H;  4OO1 G;  2CPM A;  3NCV A;  5LMU H;  5K36 G;  2OPV A;  4AIM A;  3OTO H;  4DV0 H;  4LF9 H;  2UXD H;  1TUA A;  5IWA H;  4NXM H;  4LF5 H;  2JE6 I;  4X64 H;  1XNQ H;  3QD7 X;  1N34 H;  1I6U A;  3T1H H;  3RF2 A;  1X0A A;  1WTJ A;  3OSS D;  4BA1 I;  4B3S H;  4DV7 H;  4JI1 H;  4DR6 H;  1VBI A;  3GAB A;  2E3U A;  4E9J A;  4JI2 H;  1J5K A;  1WHR A;  1XMQ H;  4B3R H;  4DR4 H;  4B3T H;  3KDK A; 
#chains in the Genus database with same CATH homology
 1DTJ A;  5C0X G;  4JVY A;  1ZZK A;  2MJH A;  4OO1 G;  1ZZJ A;  2BL5 A;  2HH2 A;  4IFD G;  1ZTG A;  4QMF B;  5K36 G;  3V69 A;  2PY9 A;  2OPV A;  4AIM A;  2DGR A;  1K1G A;  1VIG A;  2CTK A;  1WE8 A;  4LIJ A;  1TUA A;  4WAL A;  1KHM A;  2P2R A;  2JA9 A;  2ANR A;  2JEA I;  2JE6 I;  2HH3 A;  1VIH A;  2JZX A;  1EC6 A;  2JVZ A;  1J4W A;  2QND A;  1DT4 A;  1X4N A;  4BA1 I;  2NN6 G;  3VKE A;  4NBQ A;  3AEV B;  4BA2 I;  2CTE A;  4B8T A;  4AM3 A;  4WAN A;  3L7Z C;  3U1K A;  1X4M A;  2CTL A;  2CPQ A;  2FMR A;  2Z0S A;  1WVN A;  2CTF A;  2E3U A;  2OPU A;  1ZZI A;  2YQR A;  2PQU A;  4JVH A;  2CTJ A;  2BA0 A;  2AXY A;  1J5K A;  2CTM A;  5JEA G;  2JEB I;  2ANN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...