2OPVA

Solution nmr structure of the second domain of ksrp
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
85
structure length
85
Chain Sequence
b'GQFHDNANGGQNGTVQEIMIPAGKAGLVIGKGGETIKQLQERAGVKMILIQDGSQNTNVDKPLRIIGDPYKVQQACEMVMDILRE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KHSRP protein
molecule tags Rna binding protein
source organism Homo sapiens
publication title The NMR Structures of the N-terminal Domains of KSRP
rcsb
total genus 23
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2007-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 2opvA00
3L7ZC 2P2RA 4B8TA 3AEVB 2OPVA 1KHMA 2CTMA 2Z0SA 2QNDA 2NN6G 1ZZIA 4JVYA 2CPQA 4AM3A 2CTEA 2AXYA 5K36G 2BL5A 1X4NA 1EC6A 1J4WA 1ZTGA 2CTFA 2DGRA 1WVNA 1K1GA 2CTKA 4BA1I 4LIJA 4IFDG 1DT4A 1WE8A 2JA9A 3V69A 1J5KA 2JE6I 2OPUA 1VIGA 4JVHA 2CTLA 2PQUA 2E3UA 3U1KA 2YQRA 5C0XG 2JVZA 2ANRA 4BA2I 2ANNA 4WANA 4AIMA 2CTJA 2BA0A 1ZZKA 4NBQA 3VKEA 2JZXA 1TUAA 4QMFB 1DTJA 1ZZJA 2JEAI 2FMRA 2MJHA 2HH2A 5JEAG 4OO1G 2JEBI 4WALA 1VIHA 2PY9A 2HH3A 1X4MA
chains in the Genus database with same CATH superfamily
3L7ZC 2ZM6H 4YHHH 3AEVB 4DV2H 4JI7H 4B3TH 4DUYH 2X06A 2NN6G 4AM3A 2D9IA 4G08A 1IBKH 4LFAH 1X4NA 3OETA 1ZTGA 2UUBH 2CTKA 1FKAH 4LF5H 4JYAH 1DT4A 1VBIA 1WE8A 1I6UA 1VIGA 4JI5H 1PQXA 4K0KH 2YQRA 3EZJA 1HR0H 4LF4H 2ANRA 4EC5A 2CPMA 1X0AA 4DR4H 2LTLA 2G8YA 2UXBH 1J5EH 1HNWH 2JEAI 1DTJA 1V8CA 3SB1A 2FMRA 2MJHA 4DUZH 5JEAG 1ODHA 2PY9A 3UOEA 1SEIA 1VIHA 4DV5H 4JI3H 2F4VH 1IBLH 4X65H 1UG8A 3J81W 4X64H 1KHMA 1F0XA 2CTMA 2FPHX 3FAUA 4OCHA 1IBMH 2K1HA 3OSSD 5FLXW 1ZZIA 2CPQA 2VQFH 4JVYA 2CTEA 2AXYA 3J7AK 2BL5A 4NZRM 1EC6A 1K1GA 1FJGH 2JA9A 4JI6H 4OX9H 4DR7H 4KHPH 1XMQH 1N33H 2JE6I 2OPUA 2UXCH 5LMUH 2CTLA 3KDKA 2E3UA 3I0PA 4DR3H 2JVZA 1X4MA 4DV4H 2ANNA 1AN7A 4FJUA 4WANA 4AIMA 2VKCA 2CTJA 3VKEA 4QMFB 3RF2A 2LTMA 4DR5H 4LFBH 4H8AA 4OD6A 2HHHH 4GKJH 4X62H 4JV5H 3T1YH 4NXNH 5IWAH 1NXUA 2P2RA 4DV3H 2PT7G 4B8TA 4JI8H 2Y3MA 1HNXH 4NXMH 2QNDA 2VQEH 3KDGA 2DGRA 1WVNA 3GKUA 4BA1I 3GR5A 2M6QA 2CWFA 2O4CA 2ZQEA 4B8CD 4AQYH 1N34H 1N32H 4JVHA 3JAMW 2PQUA 3U1KA 5C0XG 3QD7X 4GKKH 2LF0A 2CWHA 3NCVA 1WHRA 1XMOH 3J80W 1XRHA 2A1SA 1ZZKA 2BA0A 4LF9H 1V9NA 1X9ZA 2JZXA 4DV1H 2UUCH 4B3SH 4LFCH 2UUAH 2LRRA 3GABA 4FJSA 4DV0H 1S20A 4E9JA 4WALA 4DR6H 2OPVA 1N36H 4YY3H 4DV6H 4NZTM 4LF7H 5A2QW 2Z0SA 5IT9W 2UXDH 1Z2IA 4JI1H 3T1HH 5K36G 4JI4H 1J4WA 2CTFA 3OTOH 4LF8H 4X66H 4LIJA 1WTJA 4IFDG 3V69A 1J5KA 4B3MH 1XNQH 4LF6H 2E5LH 4DV7H 4BA2I 2FFMA 4JI2H 5LL6b 4DR2H 1MSZA 5BR8H 5DT9A 5LMNH 4NBQA 1S03G 1I94H 1XNRH 1TUAA 1ZZJA 4PDBA 1HNZH 4DR1H 4JI0H 2HH2A 4OO1G 2JEBI 2UU9H 4B3RH 2HH3A 2M8WA
chains in the Genus database with same CATH topology
3L7ZC 2P2RA 4B8TA 3AEVB 2OPVA 1KHMA 2CTMA 2Z0SA 2QNDA 2NN6G 1ZZIA 4JVYA 2CPQA 4AM3A 2CTEA 2AXYA 5K36G 2BL5A 1X4NA 1EC6A 1J4WA 1ZTGA 2CTFA 2DGRA 1WVNA 1K1GA 2CTKA 4BA1I 4LIJA 4IFDG 1DT4A 1WE8A 2JA9A 3V69A 1J5KA 2JE6I 2OPUA 1VIGA 4JVHA 2CTLA 2PQUA 2E3UA 3U1KA 2YQRA 5C0XG 2JVZA 2ANRA 4BA2I 2ANNA 4WANA 4AIMA 2CTJA 2BA0A 1ZZKA 4NBQA 3VKEA 2JZXA 1TUAA 4QMFB 1DTJA 1ZZJA 2JEAI 2FMRA 2MJHA 2HH2A 5JEAG 4OO1G 2JEBI 4WALA 1VIHA 2PY9A 2HH3A 1X4MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L7Z C;  2P2R A;  4B8T A;  3AEV B;  2OPV A;  1KHM A;  2CTM A;  2Z0S A;  2QND A;  2NN6 G;  1ZZI A;  4JVY A;  2CPQ A;  4AM3 A;  2CTE A;  2AXY A;  5K36 G;  2BL5 A;  1X4N A;  1EC6 A;  1J4W A;  1ZTG A;  2CTF A;  2DGR A;  1WVN A;  1K1G A;  2CTK A;  4BA1 I;  4LIJ A;  4IFD G;  1DT4 A;  1WE8 A;  2JA9 A;  3V69 A;  1J5K A;  2JE6 I;  2OPU A;  1VIG A;  4JVH A;  2CTL A;  2PQU A;  2E3U A;  3U1K A;  2YQR A;  5C0X G;  2JVZ A;  2ANR A;  4BA2 I;  2ANN A;  4WAN A;  4AIM A;  2CTJ A;  2BA0 A;  1ZZK A;  4NBQ A;  3VKE A;  2JZX A;  1TUA A;  4QMF B;  1DTJ A;  1ZZJ A;  2JEA I;  2FMR A;  2MJH A;  2HH2 A;  5JEA G;  4OO1 G;  2JEB I;  4WAL A;  1VIH A;  2PY9 A;  2HH3 A;  1X4M A; 
#chains in the Genus database with same CATH topology
 3L7Z C;  2ZM6 H;  4YHH H;  3AEV B;  4DV2 H;  4JI7 H;  4B3T H;  4DUY H;  2X06 A;  2NN6 G;  4AM3 A;  2D9I A;  4G08 A;  1IBK H;  4LFA H;  1X4N A;  3OET A;  1ZTG A;  2UUB H;  2CTK A;  1FKA H;  4LF5 H;  4JYA H;  1DT4 A;  1VBI A;  1WE8 A;  1I6U A;  1VIG A;  4JI5 H;  1PQX A;  4K0K H;  2YQR A;  3EZJ A;  1HR0 H;  4LF4 H;  2ANR A;  4EC5 A;  2CPM A;  1X0A A;  4DR4 H;  2LTL A;  2G8Y A;  2UXB H;  1J5E H;  1HNW H;  2JEA I;  1DTJ A;  1V8C A;  3SB1 A;  2FMR A;  2MJH A;  4DUZ H;  5JEA G;  1ODH A;  2PY9 A;  3UOE A;  1SEI A;  1VIH A;  4DV5 H;  4JI3 H;  2F4V H;  1IBL H;  4X65 H;  1UG8 A;  3J81 W;  4X64 H;  1KHM A;  1F0X A;  2CTM A;  2FPH X;  3FAU A;  4OCH A;  1IBM H;  2K1H A;  3OSS D;  5FLX W;  1ZZI A;  2CPQ A;  2VQF H;  4JVY A;  2CTE A;  2AXY A;  3J7A K;  2BL5 A;  4NZR M;  1EC6 A;  1K1G A;  1FJG H;  2JA9 A;  4JI6 H;  4OX9 H;  4DR7 H;  4KHP H;  1XMQ H;  1N33 H;  2JE6 I;  2OPU A;  2UXC H;  5LMU H;  2CTL A;  3KDK A;  2E3U A;  3I0P A;  4DR3 H;  2JVZ A;  1X4M A;  4DV4 H;  2ANN A;  1AN7 A;  4FJU A;  4WAN A;  4AIM A;  2VKC A;  2CTJ A;  3VKE A;  4QMF B;  3RF2 A;  2LTM A;  4DR5 H;  4LFB H;  4H8A A;  4OD6 A;  2HHH H;  4GKJ H;  4X62 H;  4JV5 H;  3T1Y H;  4NXN H;  5IWA H;  1NXU A;  2P2R A;  4DV3 H;  2PT7 G;  4B8T A;  4JI8 H;  2Y3M A;  1HNX H;  4NXM H;  2QND A;  2VQE H;  3KDG A;  2DGR A;  1WVN A;  3GKU A;  4BA1 I;  3GR5 A;  2M6Q A;  2CWF A;  2O4C A;  2ZQE A;  4B8C D;  4AQY H;  1N34 H;  1N32 H;  4JVH A;  3JAM W;  2PQU A;  3U1K A;  5C0X G;  3QD7 X;  4GKK H;  2LF0 A;  2CWH A;  3NCV A;  1WHR A;  1XMO H;  3J80 W;  1XRH A;  2A1S A;  1ZZK A;  2BA0 A;  4LF9 H;  1V9N A;  1X9Z A;  2JZX A;  4DV1 H;  2UUC H;  4B3S H;  4LFC H;  2UUA H;  2LRR A;  3GAB A;  4FJS A;  4DV0 H;  1S20 A;  4E9J A;  4WAL A;  4DR6 H;  2OPV A;  1N36 H;  4YY3 H;  4DV6 H;  4NZT M;  4LF7 H;  5A2Q W;  2Z0S A;  5IT9 W;  2UXD H;  1Z2I A;  4JI1 H;  3T1H H;  5K36 G;  4JI4 H;  1J4W A;  2CTF A;  3OTO H;  4LF8 H;  4X66 H;  4LIJ A;  1WTJ A;  4IFD G;  3V69 A;  1J5K A;  4B3M H;  1XNQ H;  4LF6 H;  2E5L H;  4DV7 H;  4BA2 I;  2FFM A;  4JI2 H;  5LL6 b;  4DR2 H;  1MSZ A;  5BR8 H;  5DT9 A;  5LMN H;  4NBQ A;  1S03 G;  1I94 H;  1XNR H;  1TUA A;  1ZZJ A;  4PDB A;  1HNZ H;  4DR1 H;  4JI0 H;  2HH2 A;  4OO1 G;  2JEB I;  2UU9 H;  4B3R H;  2HH3 A;  2M8W A; 
#chains in the Genus database with same CATH homology
 3L7Z C;  2P2R A;  4B8T A;  3AEV B;  2OPV A;  1KHM A;  2CTM A;  2Z0S A;  2QND A;  2NN6 G;  1ZZI A;  4JVY A;  2CPQ A;  4AM3 A;  2CTE A;  2AXY A;  5K36 G;  2BL5 A;  1X4N A;  1EC6 A;  1J4W A;  1ZTG A;  2CTF A;  2DGR A;  1WVN A;  1K1G A;  2CTK A;  4BA1 I;  4LIJ A;  4IFD G;  1DT4 A;  1WE8 A;  2JA9 A;  3V69 A;  1J5K A;  2JE6 I;  2OPU A;  1VIG A;  4JVH A;  2CTL A;  2PQU A;  2E3U A;  3U1K A;  2YQR A;  5C0X G;  2JVZ A;  2ANR A;  4BA2 I;  2ANN A;  4WAN A;  4AIM A;  2CTJ A;  2BA0 A;  1ZZK A;  4NBQ A;  3VKE A;  2JZX A;  1TUA A;  4QMF B;  1DTJ A;  1ZZJ A;  2JEA I;  2FMR A;  2MJH A;  2HH2 A;  5JEA G;  4OO1 G;  2JEB I;  4WAL A;  1VIH A;  2PY9 A;  2HH3 A;  1X4M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...