2OPVA

Solution nmr structure of the second domain of ksrp
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
85
structure length
85
Chain Sequence
GQFHDNANGGQNGTVQEIMIPAGKAGLVIGKGGETIKQLQERAGVKMILIQDGSQNTNVDKPLRIIGDPYKVQQACEMVMDILRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords KHSRP protein
publication title The NMR Structures of the N-terminal Domains of KSRP
rcsb
source organism Homo sapiens
total genus 23
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2007-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 2opvA00
2OPVA 2AXYA 2ANRA 2CTKA 1X4NA 4WALA 1J5KA 4AM3A 2PQUA 2CTEA 2OPUA 2JEBI 1DTJA 1ZZIA 2MJHA 3V69A 2CPQA 1TUAA 2HH3A 2FMRA 3VKEA 4AIMA 4B8TA 1VIGA 4BA2I 2BA0A 2CTJA 2QNDA 2YQRA 2CTMA 2CTFA 1X4MA 2E3UA 1ZZJA 2ANNA 1WE8A 2JEAI 5C0XG 4BA1I 3AEVB 2HH2A 2BL5A 4IFDG 4OO1G 1VIHA 5JEAG 5K36G 1KHMA 2Z0SA 1WVNA 2P2RA 4WANA 1J4WA 1ZTGA 2CTLA 2JVZA 3U1KA 1DT4A 4LIJA 4JVHA 1K1GA 2DGRA 1EC6A 2JA9A 2JE6I 4QMFB 2PY9A 4JVYA 2JZXA 2NN6G 1ZZKA 3L7ZC 4NBQA
chains in the Genus database with same CATH superfamily
4DUZH 5FLXW 4AM3A 2D9IA 1DTJA 2ZQEA 1HNZH 5BR8H 2CPQA 1IBLH 3OTOH 4G08A 3FAUA 1HR0H 2UUAH 4H8AA 3OSSD 1HNWH 3UOEA 4DV1H 1Z2IA 3VKEA 1VIGA 4BA2I 2UUCH 2BA0A 4LFBH 2M8WA 2CWFA 5A2QW 4DV6H 1ZZJA 1XNRH 3AEVB 4YHHH 1F0XA 4DR6H 4NXNH 4DV0H 4X65H 3RF2A 4JI8H 4AQYH 5DT9A 3I0PA 2DGRA 2K1HA 2LF0A 1HNXH 4LF8H 4JVYA 1EC6A 1N33H 4JI7H 4JI5H 1I6UA 2JZXA 2NN6G 1XNQH 2G8YA 2Y3MA 4JV5H 2FFMA 4B3SH 1I94H 2ANRA 4GKJH 1AN7A 4FJSA 1ODHA 1MSZA 2PQUA 2OPUA 2JEBI 1V9NA 3T1YH 2PT7G 2VKCA 4DV7H 1IBKH 1FJGH 4JI3H 1VBIA 4X62H 2LRRA 3EZJA 2ANNA 1X4MA 2E3UA 4B3TH 4DV2H 4OO1G 4PDBA 5K36G 1SEIA 2BL5A 4YY3H 4LF9H 2Z0SA 2P2RA 4OD6A 4X64H 4LF4H 2JVZA 4LFCH 4LIJA 5LMUH 1XMQH 2A1SA 2CWHA 4X66H 4DR5H 4QMFB 4NZTM 1ZZKA 2UXBH 5JEAG 4DV5H 2AXYA 4OCHA 3J81W 4B3MH 4DR4H 4DR7H 2ZM6H 4WALA 1NXUA 2LTMA 2MJHA 1TUAA 2HH3A 3JAMW 4LF7H 1S20A 2FMRA 2X06A 3GR5A 4AIMA 4B8TA 1UG8A 4JI4H 2VQFH 2QNDA 4GKKH 1N36H 2CTFA 3GKUA 1WE8A 4LFAH 5C0XG 2JEAI 2HH2A 1WTJA 3OETA 1WVNA 4DR2H 1S03G 4DV4H 1ZTGA 4JI6H 5IWAH 3T1HH 2JA9A 2JE6I 4LF5H 2UU9H 3GABA 2HHHH 4B8CD 3J7AK 1N32H 2FPHX 3L7ZC 5LMNH 3QD7X 2E5LH 1PQXA 2OPVA 3NCVA 3SB1A 2CTKA 2O4CA 4DUYH 1X4NA 3KDKA 1J5KA 1X0AA 2F4VH 2CTEA 4JI1H 1ZZIA 3V69A 1IBMH 2VQEH 2UXDH 4NZRM 4EC5A 2UUBH 4FJUA 5LL6b 2CTJA 2YQRA 2CTMA 2M6QA 4JYAH 1XMOH 4DV3H 4IFDG 4BA1I 4OX9H 4K0KH 1KHMA 1VIHA 4KHPH 5IT9W 2LTLA 4DR1H 3J80W 4JI0H 1FKAH 1J4WA 4NXMH 4WANA 2CTLA 3U1KA 4LF6H 1DT4A 3KDGA 4JVHA 1K1GA 4JI2H 1V8CA 4E9JA 2PY9A 4B3RH 2CPMA 1N34H 1X9ZA 1XRHA 2UXCH 1J5EH 1WHRA 4DR3H 4NBQA
chains in the Genus database with same CATH topology
2OPVA 2AXYA 2ANRA 2CTKA 1X4NA 4WALA 1J5KA 4AM3A 2PQUA 2CTEA 2OPUA 2JEBI 1DTJA 1ZZIA 2MJHA 3V69A 2CPQA 1TUAA 2HH3A 2FMRA 3VKEA 4AIMA 4B8TA 1VIGA 4BA2I 2BA0A 2CTJA 2QNDA 2YQRA 2CTMA 2CTFA 1X4MA 2E3UA 1ZZJA 2ANNA 1WE8A 2JEAI 5C0XG 4BA1I 3AEVB 2HH2A 2BL5A 4IFDG 4OO1G 1VIHA 5JEAG 5K36G 1KHMA 2Z0SA 1WVNA 2P2RA 4WANA 1J4WA 1ZTGA 2CTLA 2JVZA 3U1KA 1DT4A 4LIJA 4JVHA 1K1GA 2DGRA 1EC6A 2JA9A 2JE6I 4QMFB 2PY9A 4JVYA 2JZXA 2NN6G 1ZZKA 3L7ZC 4NBQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OPV A;  2AXY A;  2ANR A;  2CTK A;  1X4N A;  4WAL A;  1J5K A;  4AM3 A;  2PQU A;  2CTE A;  2OPU A;  2JEB I;  1DTJ A;  1ZZI A;  2MJH A;  3V69 A;  2CPQ A;  1TUA A;  2HH3 A;  2FMR A;  3VKE A;  4AIM A;  4B8T A;  1VIG A;  4BA2 I;  2BA0 A;  2CTJ A;  2QND A;  2YQR A;  2CTM A;  2CTF A;  1X4M A;  2E3U A;  1ZZJ A;  2ANN A;  1WE8 A;  2JEA I;  5C0X G;  4BA1 I;  3AEV B;  2HH2 A;  2BL5 A;  4IFD G;  4OO1 G;  1VIH A;  5JEA G;  5K36 G;  1KHM A;  2Z0S A;  1WVN A;  2P2R A;  4WAN A;  1J4W A;  1ZTG A;  2CTL A;  2JVZ A;  3U1K A;  1DT4 A;  4LIJ A;  4JVH A;  1K1G A;  2DGR A;  1EC6 A;  2JA9 A;  2JE6 I;  4QMF B;  2PY9 A;  4JVY A;  2JZX A;  2NN6 G;  1ZZK A;  3L7Z C;  4NBQ A; 
#chains in the Genus database with same CATH topology
 4DUZ H;  5FLX W;  4AM3 A;  2D9I A;  1DTJ A;  2ZQE A;  1HNZ H;  5BR8 H;  2CPQ A;  1IBL H;  3OTO H;  4G08 A;  3FAU A;  1HR0 H;  2UUA H;  4H8A A;  3OSS D;  1HNW H;  3UOE A;  4DV1 H;  1Z2I A;  3VKE A;  1VIG A;  4BA2 I;  2UUC H;  2BA0 A;  4LFB H;  2M8W A;  2CWF A;  5A2Q W;  4DV6 H;  1ZZJ A;  1XNR H;  3AEV B;  4YHH H;  1F0X A;  4DR6 H;  4NXN H;  4DV0 H;  4X65 H;  3RF2 A;  4JI8 H;  4AQY H;  5DT9 A;  3I0P A;  2DGR A;  2K1H A;  2LF0 A;  1HNX H;  4LF8 H;  4JVY A;  1EC6 A;  1N33 H;  4JI7 H;  4JI5 H;  1I6U A;  2JZX A;  2NN6 G;  1XNQ H;  2G8Y A;  2Y3M A;  4JV5 H;  2FFM A;  4B3S H;  1I94 H;  2ANR A;  4GKJ H;  1AN7 A;  4FJS A;  1ODH A;  1MSZ A;  2PQU A;  2OPU A;  2JEB I;  1V9N A;  3T1Y H;  2PT7 G;  2VKC A;  4DV7 H;  1IBK H;  1FJG H;  4JI3 H;  1VBI A;  4X62 H;  2LRR A;  3EZJ A;  2ANN A;  1X4M A;  2E3U A;  4B3T H;  4DV2 H;  4OO1 G;  4PDB A;  5K36 G;  1SEI A;  2BL5 A;  4YY3 H;  4LF9 H;  2Z0S A;  2P2R A;  4OD6 A;  4X64 H;  4LF4 H;  2JVZ A;  4LFC H;  4LIJ A;  5LMU H;  1XMQ H;  2A1S A;  2CWH A;  4X66 H;  4DR5 H;  4QMF B;  4NZT M;  1ZZK A;  2UXB H;  5JEA G;  4DV5 H;  2AXY A;  4OCH A;  3J81 W;  4B3M H;  4DR4 H;  4DR7 H;  2ZM6 H;  4WAL A;  1NXU A;  2LTM A;  2MJH A;  1TUA A;  2HH3 A;  3JAM W;  4LF7 H;  1S20 A;  2FMR A;  2X06 A;  3GR5 A;  4AIM A;  4B8T A;  1UG8 A;  4JI4 H;  2VQF H;  2QND A;  4GKK H;  1N36 H;  2CTF A;  3GKU A;  1WE8 A;  4LFA H;  5C0X G;  2JEA I;  2HH2 A;  1WTJ A;  3OET A;  1WVN A;  4DR2 H;  1S03 G;  4DV4 H;  1ZTG A;  4JI6 H;  5IWA H;  3T1H H;  2JA9 A;  2JE6 I;  4LF5 H;  2UU9 H;  3GAB A;  2HHH H;  4B8C D;  3J7A K;  1N32 H;  2FPH X;  3L7Z C;  5LMN H;  3QD7 X;  2E5L H;  1PQX A;  2OPV A;  3NCV A;  3SB1 A;  2CTK A;  2O4C A;  4DUY H;  1X4N A;  3KDK A;  1J5K A;  1X0A A;  2F4V H;  2CTE A;  4JI1 H;  1ZZI A;  3V69 A;  1IBM H;  2VQE H;  2UXD H;  4NZR M;  4EC5 A;  2UUB H;  4FJU A;  5LL6 b;  2CTJ A;  2YQR A;  2CTM A;  2M6Q A;  4JYA H;  1XMO H;  4DV3 H;  4IFD G;  4BA1 I;  4OX9 H;  4K0K H;  1KHM A;  1VIH A;  4KHP H;  5IT9 W;  2LTL A;  4DR1 H;  3J80 W;  4JI0 H;  1FKA H;  1J4W A;  4NXM H;  4WAN A;  2CTL A;  3U1K A;  4LF6 H;  1DT4 A;  3KDG A;  4JVH A;  1K1G A;  4JI2 H;  1V8C A;  4E9J A;  2PY9 A;  4B3R H;  2CPM A;  1N34 H;  1X9Z A;  1XRH A;  2UXC H;  1J5E H;  1WHR A;  4DR3 H;  4NBQ A; 
#chains in the Genus database with same CATH homology
 2OPV A;  2AXY A;  2ANR A;  2CTK A;  1X4N A;  4WAL A;  1J5K A;  4AM3 A;  2PQU A;  2CTE A;  2OPU A;  2JEB I;  1DTJ A;  1ZZI A;  2MJH A;  3V69 A;  2CPQ A;  1TUA A;  2HH3 A;  2FMR A;  3VKE A;  4AIM A;  4B8T A;  1VIG A;  4BA2 I;  2BA0 A;  2CTJ A;  2QND A;  2YQR A;  2CTM A;  2CTF A;  1X4M A;  2E3U A;  1ZZJ A;  2ANN A;  1WE8 A;  2JEA I;  5C0X G;  4BA1 I;  3AEV B;  2HH2 A;  2BL5 A;  4IFD G;  4OO1 G;  1VIH A;  5JEA G;  5K36 G;  1KHM A;  2Z0S A;  1WVN A;  2P2R A;  4WAN A;  1J4W A;  1ZTG A;  2CTL A;  2JVZ A;  3U1K A;  1DT4 A;  4LIJ A;  4JVH A;  1K1G A;  2DGR A;  1EC6 A;  2JA9 A;  2JE6 I;  4QMF B;  2PY9 A;  4JVY A;  2JZX A;  2NN6 G;  1ZZK A;  3L7Z C;  4NBQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...