2OPVA

Solution nmr structure of the second domain of ksrp
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
85
structure length
85
Chain Sequence
GQFHDNANGGQNGTVQEIMIPAGKAGLVIGKGGETIKQLQERAGVKMILIQDGSQNTNVDKPLRIIGDPYKVQQACEMVMDILRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KHSRP protein
publication title The NMR Structures of the N-terminal Domains of KSRP
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 23
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2007-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 2opvA00
1VIHA 2E3UA 5JEAG 2ANNA 2PY9A 1DT4A 2JZXA 1K1GA 1WE8A 2QNDA 4BA1I 4JVHA 1J5KA 1EC6A 4LIJA 5C0XG 4WALA 2CTJA 2JEBI 3VKEA 1ZZIA 2OPVA 2DGRA 2OPUA 2CTEA 2AXYA 2ANRA 4OO1G 2CTLA 1KHMA 4QMFB 4AIMA 2JEAI 3U1KA 2CPQA 2BL5A 1ZZKA 2P2RA 1X4NA 2CTMA 2JVZA 2HH3A 2JA9A 2CTFA 2YQRA 1ZTGA 4WANA 4AM3A 2HH2A 1WVNA 1TUAA 4NBQA 2PQUA 4BA2I 1X4MA 2FMRA 4JVYA 5K36G 3L7ZC 1J4WA 2BA0A 3V69A 2MJHA 3AEVB 2Z0SA 4IFDG 2NN6G 1ZZJA 1DTJA 2CTKA 4B8TA 1VIGA 2JE6I
chains in the Genus database with same CATH superfamily
4JI4H 2PY9A 2UU9H 2JZXA 4LFAH 1EC6A 1V8CA 4NZTM 2HHHH 4JI0H 4LIJA 2UXDH 1IBLH 1NXUA 4FJUA 3RF2A 2DGRA 2AXYA 2ANRA 4OO1G 4KHPH 2UXBH 3FAUA 2G8YA 1HNXH 4JI1H 1KHMA 2D9IA 4K0KH 1IBKH 4LFCH 1IBMH 2LRRA 2LF0A 2VQFH 4DV6H 2JA9A 2CTFA 4LF8H 1WVNA 3J7AK 3I0PA 4E9JA 4DV4H 2FMRA 3L7ZC 1J4WA 3V69A 2MJHA 3AEVB 4JI2H 4NXMH 1I6UA 3T1YH 2NN6G 5BR8H 4DR1H 3GR5A 4OCHA 4B3SH 3NCVA 1XNQH 2CWFA 2PT7G 3GABA 1AN7A 1DT4A 2LTMA 3EZJA 4BA1I 4DV3H 1K1GA 3OTOH 1J5KA 4YHHH 4B3MH 4JVHA 4DR4H 5C0XG 4JV5H 2CTJA 2JEBI 4X62H 4OX9H 1ZZIA 2OPVA 3T1HH 4H8AA 1XMOH 1N34H 3J81W 4JI6H 1XRHA 4LF5H 3U1KA 2E5LH 2BL5A 2CPQA 1ZZKA 3J80W 1SEIA 2CPMA 5IWAH 1FKAH 2FPHX 4OD6A 1ODHA 4EC5A 2UXCH 1N36H 3OETA 4AM3A 2HH2A 1TUAA 1UG8A 4LF4H 1X4MA 3JAMW 2M8WA 4DR5H 4JVYA 5K36G 4FJSA 3UOEA 4DR2H 1HNWH 4JI3H 2Z0SA 4GKKH 1WHRA 4IFDG 1DTJA 2CTKA 4NXNH 4JI7H 2VKCA 1MSZA 4B8CD 2JE6I 4G08A 3GKUA 1WTJA 2O4CA 2F4VH 2UUCH 3KDKA 1WE8A 4DR7H 2ZQEA 4WALA 5A2QW 3VKEA 4LF7H 4DR6H 2Y3MA 2OPUA 2CTEA 4X65H 1XNRH 4LF6H 2LTLA 4QMFB 3SB1A 2JEAI 2P2RA 2K1HA 4B3RH 3QD7X 2JVZA 4DR3H 2HH3A 1VBIA 1ZTGA 2UUBH 4WANA 5IT9W 4NBQA 2PQUA 2X06A 4BA2I 2UUAH 2FFMA 2BA0A 2A1SA 4DUYH 4DV7H 4GKJH 2ZM6H 4X64H 4X66H 2VQEH 1VIHA 2E3UA 5JEAG 2ANNA 2M6QA 2QNDA 1X0AA 4JI8H 1HR0H 4JYAH 1PQXA 1S20A 2CWHA 5FLXW 5LMNH 1I94H 1N32H 5DT9A 2CTLA 4AIMA 1X9ZA 1HNZH 5LL6b 1J5EH 4DV0H 1X4NA 4DV2H 2CTMA 2YQRA 3OSSD 4PDBA 4YY3H 4LF9H 4NZRM 4DV5H 1FJGH 4DV1H 1XMQH 1S03G 4JI5H 4AQYH 1V9NA 3KDGA 1N33H 1ZZJA 4B3TH 4B8TA 4LFBH 1F0XA 1Z2IA 4DUZH 5LMUH 1VIGA
chains in the Genus database with same CATH topology
1VIHA 2E3UA 5JEAG 2ANNA 2PY9A 1DT4A 2JZXA 1K1GA 1WE8A 2QNDA 4BA1I 4JVHA 1J5KA 1EC6A 4LIJA 5C0XG 4WALA 2CTJA 2JEBI 3VKEA 1ZZIA 2OPVA 2DGRA 2OPUA 2CTEA 2AXYA 2ANRA 4OO1G 2CTLA 1KHMA 4QMFB 4AIMA 2JEAI 3U1KA 2CPQA 2BL5A 1ZZKA 2P2RA 1X4NA 2CTMA 2JVZA 2HH3A 2JA9A 2CTFA 2YQRA 1ZTGA 4WANA 4AM3A 2HH2A 1WVNA 1TUAA 4NBQA 2PQUA 4BA2I 1X4MA 2FMRA 4JVYA 5K36G 3L7ZC 1J4WA 2BA0A 3V69A 2MJHA 3AEVB 2Z0SA 4IFDG 2NN6G 1ZZJA 1DTJA 2CTKA 4B8TA 1VIGA 2JE6I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VIH A;  2E3U A;  5JEA G;  2ANN A;  2PY9 A;  1DT4 A;  2JZX A;  1K1G A;  1WE8 A;  2QND A;  4BA1 I;  4JVH A;  1J5K A;  1EC6 A;  4LIJ A;  5C0X G;  4WAL A;  2CTJ A;  2JEB I;  3VKE A;  1ZZI A;  2OPV A;  2DGR A;  2OPU A;  2CTE A;  2AXY A;  2ANR A;  4OO1 G;  2CTL A;  1KHM A;  4QMF B;  4AIM A;  2JEA I;  3U1K A;  2CPQ A;  2BL5 A;  1ZZK A;  2P2R A;  1X4N A;  2CTM A;  2JVZ A;  2HH3 A;  2JA9 A;  2CTF A;  2YQR A;  1ZTG A;  4WAN A;  4AM3 A;  2HH2 A;  1WVN A;  1TUA A;  4NBQ A;  2PQU A;  4BA2 I;  1X4M A;  2FMR A;  4JVY A;  5K36 G;  3L7Z C;  1J4W A;  2BA0 A;  3V69 A;  2MJH A;  3AEV B;  2Z0S A;  4IFD G;  2NN6 G;  1ZZJ A;  1DTJ A;  2CTK A;  4B8T A;  1VIG A;  2JE6 I; 
#chains in the Genus database with same CATH topology
 4JI4 H;  2PY9 A;  2UU9 H;  2JZX A;  4LFA H;  1EC6 A;  1V8C A;  4NZT M;  2HHH H;  4JI0 H;  4LIJ A;  2UXD H;  1IBL H;  1NXU A;  4FJU A;  3RF2 A;  2DGR A;  2AXY A;  2ANR A;  4OO1 G;  4KHP H;  2UXB H;  3FAU A;  2G8Y A;  1HNX H;  4JI1 H;  1KHM A;  2D9I A;  4K0K H;  1IBK H;  4LFC H;  1IBM H;  2LRR A;  2LF0 A;  2VQF H;  4DV6 H;  2JA9 A;  2CTF A;  4LF8 H;  1WVN A;  3J7A K;  3I0P A;  4E9J A;  4DV4 H;  2FMR A;  3L7Z C;  1J4W A;  3V69 A;  2MJH A;  3AEV B;  4JI2 H;  4NXM H;  1I6U A;  3T1Y H;  2NN6 G;  5BR8 H;  4DR1 H;  3GR5 A;  4OCH A;  4B3S H;  3NCV A;  1XNQ H;  2CWF A;  2PT7 G;  3GAB A;  1AN7 A;  1DT4 A;  2LTM A;  3EZJ A;  4BA1 I;  4DV3 H;  1K1G A;  3OTO H;  1J5K A;  4YHH H;  4B3M H;  4JVH A;  4DR4 H;  5C0X G;  4JV5 H;  2CTJ A;  2JEB I;  4X62 H;  4OX9 H;  1ZZI A;  2OPV A;  3T1H H;  4H8A A;  1XMO H;  1N34 H;  3J81 W;  4JI6 H;  1XRH A;  4LF5 H;  3U1K A;  2E5L H;  2BL5 A;  2CPQ A;  1ZZK A;  3J80 W;  1SEI A;  2CPM A;  5IWA H;  1FKA H;  2FPH X;  4OD6 A;  1ODH A;  4EC5 A;  2UXC H;  1N36 H;  3OET A;  4AM3 A;  2HH2 A;  1TUA A;  1UG8 A;  4LF4 H;  1X4M A;  3JAM W;  2M8W A;  4DR5 H;  4JVY A;  5K36 G;  4FJS A;  3UOE A;  4DR2 H;  1HNW H;  4JI3 H;  2Z0S A;  4GKK H;  1WHR A;  4IFD G;  1DTJ A;  2CTK A;  4NXN H;  4JI7 H;  2VKC A;  1MSZ A;  4B8C D;  2JE6 I;  4G08 A;  3GKU A;  1WTJ A;  2O4C A;  2F4V H;  2UUC H;  3KDK A;  1WE8 A;  4DR7 H;  2ZQE A;  4WAL A;  5A2Q W;  3VKE A;  4LF7 H;  4DR6 H;  2Y3M A;  2OPU A;  2CTE A;  4X65 H;  1XNR H;  4LF6 H;  2LTL A;  4QMF B;  3SB1 A;  2JEA I;  2P2R A;  2K1H A;  4B3R H;  3QD7 X;  2JVZ A;  4DR3 H;  2HH3 A;  1VBI A;  1ZTG A;  2UUB H;  4WAN A;  5IT9 W;  4NBQ A;  2PQU A;  2X06 A;  4BA2 I;  2UUA H;  2FFM A;  2BA0 A;  2A1S A;  4DUY H;  4DV7 H;  4GKJ H;  2ZM6 H;  4X64 H;  4X66 H;  2VQE H;  1VIH A;  2E3U A;  5JEA G;  2ANN A;  2M6Q A;  2QND A;  1X0A A;  4JI8 H;  1HR0 H;  4JYA H;  1PQX A;  1S20 A;  2CWH A;  5FLX W;  5LMN H;  1I94 H;  1N32 H;  5DT9 A;  2CTL A;  4AIM A;  1X9Z A;  1HNZ H;  5LL6 b;  1J5E H;  4DV0 H;  1X4N A;  4DV2 H;  2CTM A;  2YQR A;  3OSS D;  4PDB A;  4YY3 H;  4LF9 H;  4NZR M;  4DV5 H;  1FJG H;  4DV1 H;  1XMQ H;  1S03 G;  4JI5 H;  4AQY H;  1V9N A;  3KDG A;  1N33 H;  1ZZJ A;  4B3T H;  4B8T A;  4LFB H;  1F0X A;  1Z2I A;  4DUZ H;  5LMU H;  1VIG A; 
#chains in the Genus database with same CATH homology
 1VIH A;  2E3U A;  5JEA G;  2ANN A;  2PY9 A;  1DT4 A;  2JZX A;  1K1G A;  1WE8 A;  2QND A;  4BA1 I;  4JVH A;  1J5K A;  1EC6 A;  4LIJ A;  5C0X G;  4WAL A;  2CTJ A;  2JEB I;  3VKE A;  1ZZI A;  2OPV A;  2DGR A;  2OPU A;  2CTE A;  2AXY A;  2ANR A;  4OO1 G;  2CTL A;  1KHM A;  4QMF B;  4AIM A;  2JEA I;  3U1K A;  2CPQ A;  2BL5 A;  1ZZK A;  2P2R A;  1X4N A;  2CTM A;  2JVZ A;  2HH3 A;  2JA9 A;  2CTF A;  2YQR A;  1ZTG A;  4WAN A;  4AM3 A;  2HH2 A;  1WVN A;  1TUA A;  4NBQ A;  2PQU A;  4BA2 I;  1X4M A;  2FMR A;  4JVY A;  5K36 G;  3L7Z C;  1J4W A;  2BA0 A;  3V69 A;  2MJH A;  3AEV B;  2Z0S A;  4IFD G;  2NN6 G;  1ZZJ A;  1DTJ A;  2CTK A;  4B8T A;  1VIG A;  2JE6 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...