2OPVA

Solution nmr structure of the second domain of ksrp
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
85
structure length
85
Chain Sequence
b'GQFHDNANGGQNGTVQEIMIPAGKAGLVIGKGGETIKQLQERAGVKMILIQDGSQNTNVDKPLRIIGDPYKVQQACEMVMDILRE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KHSRP protein
publication title The NMR Structures of the N-terminal Domains of KSRP
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 23
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2007-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 2opvA00
2CPQA 3AEVB 1X4NA 4AM3A 1DTJA 2JZXA 2DGRA 2CTKA 1X4MA 2PY9A 2MJHA 1K1GA 2CTLA 4JVHA 2E3UA 2JE6I 1ZZIA 1VIGA 3L7ZC 1J5KA 2ANRA 1EC6A 4NBQA 4OO1G 2P2RA 1DT4A 1VIHA 2CTEA 4AIMA 3VKEA 2FMRA 2CTFA 2CTJA 2JEBI 1J4WA 1ZZKA 2OPVA 2Z0SA 5JEAG 1ZTGA 5K36G 1WVNA 4JVYA 4WANA 4WALA 2JEAI 2CTMA 1WE8A 2AXYA 1TUAA 2HH3A 2PQUA 2HH2A 3V69A 4BA1I 3U1KA 4BA2I 4IFDG 2JA9A 2YQRA 2QNDA 2NN6G 2JVZA 4QMFB 1ZZJA 2BL5A 2BA0A 4B8TA 5C0XG 1KHMA 2ANNA 2OPUA 4LIJA
chains in the Genus database with same CATH superfamily
2CPQA 3AEVB 2K1HA 4JI3H 4NXMH 1F0XA 4H8AA 3OSSD 1J5KA 1IBMH 4DUYH 2P2RA 2E5LH 5FLXW 2UXDH 4AIMA 4DV0H 4B3RH 4OD6A 4DV4H 1WTJA 1FKAH 5IT9W 4FJSA 2JEBI 3GKUA 4NZTM 1XMQH 4DR3H 2CWFA 2Z0SA 4GKKH 1I6UA 4LF4H 1ZTGA 2CPMA 1N34H 1X9ZA 4JVYA 1XRHA 2D9IA 1NXUA 4E9JA 4JI5H 4JV5H 4LFBH 1V8CA 1N33H 3J81W 3U1KA 4JI8H 2YQRA 1WHRA 3I0PA 1MSZA 4B8TA 1KHMA 4EC5A 1HNZH 2OPUA 4LIJA 2UXCH 1X4NA 2M6QA 1DTJA 5LMNH 2M8WA 4LF7H 4AM3A 2CTKA 1HR0H 1XNQH 1X4MA 2MJHA 2VKCA 2CTLA 2LTLA 3OTOH 2UUAH 2E3UA 1S03G 1N36H 4NBQA 1EC6A 2LRRA 2LF0A 2PT7G 1Z2IA 4FJUA 3JAMW 5LMUH 1AN7A 4GKJH 3SB1A 5DT9A 4DUZH 3VKEA 2CTFA 1HNWH 4LF6H 1X0AA 4X62H 4X66H 4JI2H 4JI0H 1WVNA 3FAUA 4WANA 1XNRH 1SEIA 2CTMA 2PQUA 4JI1H 2ZM6H 2LTMA 2HHHH 3V69A 4BA1I 2G8YA 1S20A 2QNDA 2JVZA 4OCHA 2ANNA 1VBIA 4LF8H 2VQEH 4DV5H 2JZXA 4DV7H 4DR1H 4LF5H 4B3MH 2PY9A 4K0KH 1K1GA 4JVHA 1VIGA 3L7ZC 3OETA 2ANRA 4YHHH 4JI6H 1DT4A 4DV3H 3T1YH 1FJGH 4DR2H 5IWAH 2CTJA 5A2QW 4AQYH 3KDKA 1V9NA 4OX9H 2OPVA 5K36G 3GR5A 5JEAG 1I94H 4B8CD 4WALA 2JEAI 2UXBH 3NCVA 5LL6b 1WE8A 2AXYA 4JYAH 1N32H 4NZRM 4BA2I 2UUBH 2JA9A 1ZZJA 4LF9H 2VQFH 2FPHX 2BL5A 2BA0A 1J5EH 4DV6H 4G08A 4DV1H 4LFCH 4DV2H 4JI4H 4YY3H 1HNXH 3GABA 2A1SA 3QD7X 4JI7H 4LFAH 2ZQEA 4NXNH 2DGRA 2FFMA 3KDGA 2JE6I 1ZZIA 1IBKH 1UG8A 3UOEA 2O4CA 4PDBA 1IBLH 5BR8H 4OO1G 1VIHA 2CTEA 2X06A 2UUCH 2FMRA 4X64H 4DR7H 1PQXA 1J4WA 1ODHA 3EZJA 1ZZKA 3J80W 2CWHA 3RF2A 3J7AK 1TUAA 2HH3A 2Y3MA 2HH2A 2F4VH 4DR4H 4B3TH 4IFDG 4QMFB 2NN6G 4X65H 4KHPH 5C0XG 3T1HH 4B3SH 2UU9H 4DR5H 4DR6H 1XMOH
chains in the Genus database with same CATH topology
2CPQA 3AEVB 1X4NA 4AM3A 1DTJA 2JZXA 2DGRA 2CTKA 1X4MA 2PY9A 2MJHA 1K1GA 2CTLA 4JVHA 2E3UA 2JE6I 1ZZIA 1VIGA 3L7ZC 1J5KA 2ANRA 1EC6A 4NBQA 4OO1G 2P2RA 1DT4A 1VIHA 2CTEA 4AIMA 3VKEA 2FMRA 2CTFA 2CTJA 2JEBI 1J4WA 1ZZKA 2OPVA 2Z0SA 5JEAG 1ZTGA 5K36G 1WVNA 4JVYA 4WANA 4WALA 2JEAI 2CTMA 1WE8A 2AXYA 1TUAA 2HH3A 2PQUA 2HH2A 3V69A 4BA1I 3U1KA 4BA2I 4IFDG 2JA9A 2YQRA 2QNDA 2NN6G 2JVZA 4QMFB 1ZZJA 2BL5A 2BA0A 4B8TA 5C0XG 1KHMA 2ANNA 2OPUA 4LIJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CPQ A;  3AEV B;  1X4N A;  4AM3 A;  1DTJ A;  2JZX A;  2DGR A;  2CTK A;  1X4M A;  2PY9 A;  2MJH A;  1K1G A;  2CTL A;  4JVH A;  2E3U A;  2JE6 I;  1ZZI A;  1VIG A;  3L7Z C;  1J5K A;  2ANR A;  1EC6 A;  4NBQ A;  4OO1 G;  2P2R A;  1DT4 A;  1VIH A;  2CTE A;  4AIM A;  3VKE A;  2FMR A;  2CTF A;  2CTJ A;  2JEB I;  1J4W A;  1ZZK A;  2OPV A;  2Z0S A;  5JEA G;  1ZTG A;  5K36 G;  1WVN A;  4JVY A;  4WAN A;  4WAL A;  2JEA I;  2CTM A;  1WE8 A;  2AXY A;  1TUA A;  2HH3 A;  2PQU A;  2HH2 A;  3V69 A;  4BA1 I;  3U1K A;  4BA2 I;  4IFD G;  2JA9 A;  2YQR A;  2QND A;  2NN6 G;  2JVZ A;  4QMF B;  1ZZJ A;  2BL5 A;  2BA0 A;  4B8T A;  5C0X G;  1KHM A;  2ANN A;  2OPU A;  4LIJ A; 
#chains in the Genus database with same CATH topology
 2CPQ A;  3AEV B;  2K1H A;  4JI3 H;  4NXM H;  1F0X A;  4H8A A;  3OSS D;  1J5K A;  1IBM H;  4DUY H;  2P2R A;  2E5L H;  5FLX W;  2UXD H;  4AIM A;  4DV0 H;  4B3R H;  4OD6 A;  4DV4 H;  1WTJ A;  1FKA H;  5IT9 W;  4FJS A;  2JEB I;  3GKU A;  4NZT M;  1XMQ H;  4DR3 H;  2CWF A;  2Z0S A;  4GKK H;  1I6U A;  4LF4 H;  1ZTG A;  2CPM A;  1N34 H;  1X9Z A;  4JVY A;  1XRH A;  2D9I A;  1NXU A;  4E9J A;  4JI5 H;  4JV5 H;  4LFB H;  1V8C A;  1N33 H;  3J81 W;  3U1K A;  4JI8 H;  2YQR A;  1WHR A;  3I0P A;  1MSZ A;  4B8T A;  1KHM A;  4EC5 A;  1HNZ H;  2OPU A;  4LIJ A;  2UXC H;  1X4N A;  2M6Q A;  1DTJ A;  5LMN H;  2M8W A;  4LF7 H;  4AM3 A;  2CTK A;  1HR0 H;  1XNQ H;  1X4M A;  2MJH A;  2VKC A;  2CTL A;  2LTL A;  3OTO H;  2UUA H;  2E3U A;  1S03 G;  1N36 H;  4NBQ A;  1EC6 A;  2LRR A;  2LF0 A;  2PT7 G;  1Z2I A;  4FJU A;  3JAM W;  5LMU H;  1AN7 A;  4GKJ H;  3SB1 A;  5DT9 A;  4DUZ H;  3VKE A;  2CTF A;  1HNW H;  4LF6 H;  1X0A A;  4X62 H;  4X66 H;  4JI2 H;  4JI0 H;  1WVN A;  3FAU A;  4WAN A;  1XNR H;  1SEI A;  2CTM A;  2PQU A;  4JI1 H;  2ZM6 H;  2LTM A;  2HHH H;  3V69 A;  4BA1 I;  2G8Y A;  1S20 A;  2QND A;  2JVZ A;  4OCH A;  2ANN A;  1VBI A;  4LF8 H;  2VQE H;  4DV5 H;  2JZX A;  4DV7 H;  4DR1 H;  4LF5 H;  4B3M H;  2PY9 A;  4K0K H;  1K1G A;  4JVH A;  1VIG A;  3L7Z C;  3OET A;  2ANR A;  4YHH H;  4JI6 H;  1DT4 A;  4DV3 H;  3T1Y H;  1FJG H;  4DR2 H;  5IWA H;  2CTJ A;  5A2Q W;  4AQY H;  3KDK A;  1V9N A;  4OX9 H;  2OPV A;  5K36 G;  3GR5 A;  5JEA G;  1I94 H;  4B8C D;  4WAL A;  2JEA I;  2UXB H;  3NCV A;  5LL6 b;  1WE8 A;  2AXY A;  4JYA H;  1N32 H;  4NZR M;  4BA2 I;  2UUB H;  2JA9 A;  1ZZJ A;  4LF9 H;  2VQF H;  2FPH X;  2BL5 A;  2BA0 A;  1J5E H;  4DV6 H;  4G08 A;  4DV1 H;  4LFC H;  4DV2 H;  4JI4 H;  4YY3 H;  1HNX H;  3GAB A;  2A1S A;  3QD7 X;  4JI7 H;  4LFA H;  2ZQE A;  4NXN H;  2DGR A;  2FFM A;  3KDG A;  2JE6 I;  1ZZI A;  1IBK H;  1UG8 A;  3UOE A;  2O4C A;  4PDB A;  1IBL H;  5BR8 H;  4OO1 G;  1VIH A;  2CTE A;  2X06 A;  2UUC H;  2FMR A;  4X64 H;  4DR7 H;  1PQX A;  1J4W A;  1ODH A;  3EZJ A;  1ZZK A;  3J80 W;  2CWH A;  3RF2 A;  3J7A K;  1TUA A;  2HH3 A;  2Y3M A;  2HH2 A;  2F4V H;  4DR4 H;  4B3T H;  4IFD G;  4QMF B;  2NN6 G;  4X65 H;  4KHP H;  5C0X G;  3T1H H;  4B3S H;  2UU9 H;  4DR5 H;  4DR6 H;  1XMO H; 
#chains in the Genus database with same CATH homology
 2CPQ A;  3AEV B;  1X4N A;  4AM3 A;  1DTJ A;  2JZX A;  2DGR A;  2CTK A;  1X4M A;  2PY9 A;  2MJH A;  1K1G A;  2CTL A;  4JVH A;  2E3U A;  2JE6 I;  1ZZI A;  1VIG A;  3L7Z C;  1J5K A;  2ANR A;  1EC6 A;  4NBQ A;  4OO1 G;  2P2R A;  1DT4 A;  1VIH A;  2CTE A;  4AIM A;  3VKE A;  2FMR A;  2CTF A;  2CTJ A;  2JEB I;  1J4W A;  1ZZK A;  2OPV A;  2Z0S A;  5JEA G;  1ZTG A;  5K36 G;  1WVN A;  4JVY A;  4WAN A;  4WAL A;  2JEA I;  2CTM A;  1WE8 A;  2AXY A;  1TUA A;  2HH3 A;  2PQU A;  2HH2 A;  3V69 A;  4BA1 I;  3U1K A;  4BA2 I;  4IFD G;  2JA9 A;  2YQR A;  2QND A;  2NN6 G;  2JVZ A;  4QMF B;  1ZZJ A;  2BL5 A;  2BA0 A;  4B8T A;  5C0X G;  1KHM A;  2ANN A;  2OPU A;  4LIJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...