2PY9A

Protein-rna interaction involving kh1 domain from human poly(c)-binding protein-2
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
72
structure length
72
Chain Sequence
b'KNVTLTIRLLMHGKEVGSIIGKKGESVKKMREESGARINISEGNCPERIITLAGPTNAIFKAFAMIIDKLEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 12-mer C-rich strand of human telomeric RNA
molecule tags Rna and dna binding protein/rna
source organism Homo sapiens
publication title X-ray crystallographic and NMR studies of protein-protein and protein-nucleic acid interactions involving the KH domains from human poly(C)-binding protein-2.
pubmed doi rcsb
total genus 15
structure length 72
sequence length 72
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 2py9A00
2CTEA 2P2RA 4LIJA 1WE8A 2JZXA 2CTMA 1K1GA 1ZZJA 2ANRA 2HH3A 2Z0SA 2QNDA 4NBQA 2FMRA 4B8TA 2AXYA 1VIHA 1J4WA 1X4MA 4WALA 2JEAI 1DTJA 5JEAG 2PY9A 2CTKA 2YQRA 3L7ZC 1J5KA 2JE6I 3U1KA 2PQUA 1TUAA 1X4NA 2BL5A 4OO1G 2JA9A 2MJHA 2DGRA 2CTLA 3V69A 4IFDG 1EC6A 5C0XG 4AM3A 2CTJA 1ZZKA 1WVNA 2JVZA 2BA0A 4QMFB 4WANA 2OPVA 1ZZIA 2E3UA 2HH2A 5K36G 4AIMA 2ANNA 4BA2I 1VIGA 4BA1I 1DT4A 2CPQA 2OPUA 2NN6G 4JVYA 1KHMA 3AEVB 1ZTGA 3VKEA 4JVHA 2CTFA 2JEBI
chains in the Genus database with same CATH superfamily
2UXDH 2PT7G 3KDKA 2LTLA 5A2QW 3JAMW 3GABA 2CTMA 1WTJA 4X66H 4DUYH 4B8CD 4H8AA 1IBLH 4JI8H 4NZRM 4DR2H 2FMRA 4LF5H 1S20A 1VIHA 4LFAH 4GKJH 1XMOH 1X4MA 4WALA 4DV3H 1DTJA 2PY9A 3FAUA 4B3TH 2VQEH 4GKKH 5DT9A 4OO1G 4E9JA 2DGRA 4IFDG 2CWHA 1V8CA 4G08A 1I94H 1WVNA 3T1YH 4NXNH 4KHPH 5LL6b 1IBKH 4FJSA 1PQXA 2E5LH 4JV5H 5LMUH 1V9NA 4DV7H 2CPQA 3AEVB 1FKAH 1ZTGA 2G8YA 1N32H 3UOEA 4DR3H 1VBIA 1XNRH 2JEBI 1SEIA 2FFMA 3OTOH 2P2RA 2UUCH 4B3SH 4LIJA 1WE8A 1MSZA 3T1HH 1K1GA 3EZJA 4B3RH 1IBMH 4JYAH 4DR5H 2HH3A 2Z0SA 1X0AA 4DR7H 1XRHA 1N36H 4OCHA 5JEAG 1HNWH 2Y3MA 2YQRA 1J5KA 3U1KA 4DV1H 3I0PA 2BL5A 4DR4H 2JA9A 4YHHH 3KDGA 3RF2A 1EC6A 5C0XG 4DUZH 2CTJA 2UXBH 4DR1H 1X9ZA 4X65H 2BA0A 2FPHX 5BR8H 4LF9H 1F0XA 2K1HA 2HH2A 5K36G 2ZQEA 2ANNA 1VIGA 4LFBH 3J80W 3NCVA 1FJGH 3J81W 4X62H 4PDBA 4JVHA 1ZZJA 2O4CA 2M6QA 1HR0H 1AN7A 2UUAH 2A1SA 4DV2H 4LF7H 1XNQH 4NBQA 4B8TA 2LRRA 4LFCH 4K0KH 4DV4H 2CTKA 2LTMA 3OETA 4NZTM 4DV5H 2JE6I 4JI5H 1TUAA 3QD7X 1NXUA 2F4VH 1ODHA 2MJHA 3V69A 4DR6H 1J5EH 4LF4H 1N34H 4JI4H 4WANA 5LMNH 4JI2H 4AIMA 4BA2I 4JI1H 3J7AK 3OSSD 4LF8H 1DT4A 4EC5A 1KHMA 1XMQH 2UU9H 1HNZH 1Z2IA 4JI6H 1S03G 2LF0A 2HHHH 4JI7H 2CTEA 4DV0H 4DV6H 2VQFH 5FLXW 2JZXA 2M8WA 4OD6A 5IT9W 1UG8A 4B3MH 2CWFA 2VKCA 5IWAH 2ANRA 2AXYA 4FJUA 2QNDA 4X64H 1N33H 1J4WA 4JI3H 2JEAI 2ZM6H 3L7ZC 2CPMA 4JI0H 2PQUA 4YY3H 1X4NA 3SB1A 1WHRA 2CTLA 4AM3A 1ZZKA 1HNXH 2UXCH 1I6UA 2JVZA 4LF6H 4QMFB 2OPVA 4AQYH 2E3UA 2X06A 3GKUA 1ZZIA 2UUBH 4OX9H 4BA1I 4JVYA 2OPUA 2NN6G 3GR5A 2D9IA 4NXMH 3VKEA 2CTFA
chains in the Genus database with same CATH topology
2CTEA 2P2RA 4LIJA 1WE8A 2JZXA 2CTMA 1K1GA 1ZZJA 2ANRA 2HH3A 2Z0SA 2QNDA 4NBQA 2FMRA 4B8TA 2AXYA 1VIHA 1J4WA 1X4MA 4WALA 2JEAI 1DTJA 5JEAG 2PY9A 2CTKA 2YQRA 3L7ZC 1J5KA 2JE6I 3U1KA 2PQUA 1TUAA 1X4NA 2BL5A 4OO1G 2JA9A 2MJHA 2DGRA 2CTLA 3V69A 4IFDG 1EC6A 5C0XG 4AM3A 2CTJA 1ZZKA 1WVNA 2JVZA 2BA0A 4QMFB 4WANA 2OPVA 1ZZIA 2E3UA 2HH2A 5K36G 4AIMA 2ANNA 4BA2I 1VIGA 4BA1I 1DT4A 2CPQA 2OPUA 2NN6G 4JVYA 1KHMA 3AEVB 1ZTGA 3VKEA 4JVHA 2CTFA 2JEBI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CTE A;  2P2R A;  4LIJ A;  1WE8 A;  2JZX A;  2CTM A;  1K1G A;  1ZZJ A;  2ANR A;  2HH3 A;  2Z0S A;  2QND A;  4NBQ A;  2FMR A;  4B8T A;  2AXY A;  1VIH A;  1J4W A;  1X4M A;  4WAL A;  2JEA I;  1DTJ A;  5JEA G;  2PY9 A;  2CTK A;  2YQR A;  3L7Z C;  1J5K A;  2JE6 I;  3U1K A;  2PQU A;  1TUA A;  1X4N A;  2BL5 A;  4OO1 G;  2JA9 A;  2MJH A;  2DGR A;  2CTL A;  3V69 A;  4IFD G;  1EC6 A;  5C0X G;  4AM3 A;  2CTJ A;  1ZZK A;  1WVN A;  2JVZ A;  2BA0 A;  4QMF B;  4WAN A;  2OPV A;  1ZZI A;  2E3U A;  2HH2 A;  5K36 G;  4AIM A;  2ANN A;  4BA2 I;  1VIG A;  4BA1 I;  1DT4 A;  2CPQ A;  2OPU A;  2NN6 G;  4JVY A;  1KHM A;  3AEV B;  1ZTG A;  3VKE A;  4JVH A;  2CTF A;  2JEB I; 
#chains in the Genus database with same CATH topology
 2UXD H;  2PT7 G;  3KDK A;  2LTL A;  5A2Q W;  3JAM W;  3GAB A;  2CTM A;  1WTJ A;  4X66 H;  4DUY H;  4B8C D;  4H8A A;  1IBL H;  4JI8 H;  4NZR M;  4DR2 H;  2FMR A;  4LF5 H;  1S20 A;  1VIH A;  4LFA H;  4GKJ H;  1XMO H;  1X4M A;  4WAL A;  4DV3 H;  1DTJ A;  2PY9 A;  3FAU A;  4B3T H;  2VQE H;  4GKK H;  5DT9 A;  4OO1 G;  4E9J A;  2DGR A;  4IFD G;  2CWH A;  1V8C A;  4G08 A;  1I94 H;  1WVN A;  3T1Y H;  4NXN H;  4KHP H;  5LL6 b;  1IBK H;  4FJS A;  1PQX A;  2E5L H;  4JV5 H;  5LMU H;  1V9N A;  4DV7 H;  2CPQ A;  3AEV B;  1FKA H;  1ZTG A;  2G8Y A;  1N32 H;  3UOE A;  4DR3 H;  1VBI A;  1XNR H;  2JEB I;  1SEI A;  2FFM A;  3OTO H;  2P2R A;  2UUC H;  4B3S H;  4LIJ A;  1WE8 A;  1MSZ A;  3T1H H;  1K1G A;  3EZJ A;  4B3R H;  1IBM H;  4JYA H;  4DR5 H;  2HH3 A;  2Z0S A;  1X0A A;  4DR7 H;  1XRH A;  1N36 H;  4OCH A;  5JEA G;  1HNW H;  2Y3M A;  2YQR A;  1J5K A;  3U1K A;  4DV1 H;  3I0P A;  2BL5 A;  4DR4 H;  2JA9 A;  4YHH H;  3KDG A;  3RF2 A;  1EC6 A;  5C0X G;  4DUZ H;  2CTJ A;  2UXB H;  4DR1 H;  1X9Z A;  4X65 H;  2BA0 A;  2FPH X;  5BR8 H;  4LF9 H;  1F0X A;  2K1H A;  2HH2 A;  5K36 G;  2ZQE A;  2ANN A;  1VIG A;  4LFB H;  3J80 W;  3NCV A;  1FJG H;  3J81 W;  4X62 H;  4PDB A;  4JVH A;  1ZZJ A;  2O4C A;  2M6Q A;  1HR0 H;  1AN7 A;  2UUA H;  2A1S A;  4DV2 H;  4LF7 H;  1XNQ H;  4NBQ A;  4B8T A;  2LRR A;  4LFC H;  4K0K H;  4DV4 H;  2CTK A;  2LTM A;  3OET A;  4NZT M;  4DV5 H;  2JE6 I;  4JI5 H;  1TUA A;  3QD7 X;  1NXU A;  2F4V H;  1ODH A;  2MJH A;  3V69 A;  4DR6 H;  1J5E H;  4LF4 H;  1N34 H;  4JI4 H;  4WAN A;  5LMN H;  4JI2 H;  4AIM A;  4BA2 I;  4JI1 H;  3J7A K;  3OSS D;  4LF8 H;  1DT4 A;  4EC5 A;  1KHM A;  1XMQ H;  2UU9 H;  1HNZ H;  1Z2I A;  4JI6 H;  1S03 G;  2LF0 A;  2HHH H;  4JI7 H;  2CTE A;  4DV0 H;  4DV6 H;  2VQF H;  5FLX W;  2JZX A;  2M8W A;  4OD6 A;  5IT9 W;  1UG8 A;  4B3M H;  2CWF A;  2VKC A;  5IWA H;  2ANR A;  2AXY A;  4FJU A;  2QND A;  4X64 H;  1N33 H;  1J4W A;  4JI3 H;  2JEA I;  2ZM6 H;  3L7Z C;  2CPM A;  4JI0 H;  2PQU A;  4YY3 H;  1X4N A;  3SB1 A;  1WHR A;  2CTL A;  4AM3 A;  1ZZK A;  1HNX H;  2UXC H;  1I6U A;  2JVZ A;  4LF6 H;  4QMF B;  2OPV A;  4AQY H;  2E3U A;  2X06 A;  3GKU A;  1ZZI A;  2UUB H;  4OX9 H;  4BA1 I;  4JVY A;  2OPU A;  2NN6 G;  3GR5 A;  2D9I A;  4NXM H;  3VKE A;  2CTF A; 
#chains in the Genus database with same CATH homology
 2CTE A;  2P2R A;  4LIJ A;  1WE8 A;  2JZX A;  2CTM A;  1K1G A;  1ZZJ A;  2ANR A;  2HH3 A;  2Z0S A;  2QND A;  4NBQ A;  2FMR A;  4B8T A;  2AXY A;  1VIH A;  1J4W A;  1X4M A;  4WAL A;  2JEA I;  1DTJ A;  5JEA G;  2PY9 A;  2CTK A;  2YQR A;  3L7Z C;  1J5K A;  2JE6 I;  3U1K A;  2PQU A;  1TUA A;  1X4N A;  2BL5 A;  4OO1 G;  2JA9 A;  2MJH A;  2DGR A;  2CTL A;  3V69 A;  4IFD G;  1EC6 A;  5C0X G;  4AM3 A;  2CTJ A;  1ZZK A;  1WVN A;  2JVZ A;  2BA0 A;  4QMF B;  4WAN A;  2OPV A;  1ZZI A;  2E3U A;  2HH2 A;  5K36 G;  4AIM A;  2ANN A;  4BA2 I;  1VIG A;  4BA1 I;  1DT4 A;  2CPQ A;  2OPU A;  2NN6 G;  4JVY A;  1KHM A;  3AEV B;  1ZTG A;  3VKE A;  4JVH A;  2CTF A;  2JEB I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...