2PY9A

Protein-rna interaction involving kh1 domain from human poly(c)-binding protein-2
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
72
structure length
72
Chain Sequence
KNVTLTIRLLMHGKEVGSIIGKKGESVKKMREESGARINISEGNCPERIITLAGPTNAIFKAFAMIIDKLEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystallographic and NMR studies of protein-protein and protein-nucleic acid interactions involving the KH domains from human poly(C)-binding protein-2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna and dna binding protein/rna
molecule keywords 12-mer C-rich strand of human telomeric RNA
total genus 15
structure length 72
sequence length 72
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 2py9A00
1X4NA 5C0XG 4WALA 1ZZJA 3VKEA 2PQUA 2JEAI 2DGRA 4LIJA 1DT4A 1J4WA 4BA2I 4JVYA 2JVZA 4AIMA 2HH3A 4JVHA 2PY9A 4AM3A 2ANRA 2AXYA 4WANA 2CPQA 2Z0SA 2QNDA 1KHMA 2JE6I 4IFDG 2JA9A 2NN6G 2OPUA 4B8TA 3V69A 1J5KA 4OO1G 1TUAA 2CTLA 2JZXA 2YQRA 3AEVB 2CTJA 2CTEA 2BA0A 1VIGA 4NBQA 1DTJA 1X4MA 2E3UA 2HH2A 2MJHA 5K36G 1VIHA 2OPVA 1ZZIA 2P2RA 2CTFA 3U1KA 2BL5A 2ANNA 1WE8A 1EC6A 2JEBI 1WVNA 3L7ZC 1ZZKA 2FMRA 4QMFB 1ZTGA 4BA1I 1K1GA 5JEAG 2CTMA 2CTKA
chains in the Genus database with same CATH superfamily
4DV2H 4DR4H 4X65H 2JEAI 4DR5H 4BA2I 4LIJA 1DT4A 1J4WA 2UUAH 4X64H 4WANA 1F0XA 4FJSA 4LF7H 1WTJA 2CPQA 2VQEH 2M6QA 4IFDG 3EZJA 4DUYH 4JI4H 3JAMW 4JI0H 3NCVA 4DR2H 1TUAA 2CTLA 3OETA 4DR1H 2HH2A 2MJHA 2E5LH 1VIHA 4KHPH 4YY3H 2OPVA 4B3RH 4PDBA 5LMNH 3J81W 1HNXH 1XRHA 2CWHA 2D9IA 2O4CA 1ZZKA 4X66H 1XNRH 5LL6b 1ZTGA 4BA1I 4OX9H 5JEAG 2CTMA 4EC5A 4FJUA 2LTMA 3KDGA 4JI1H 4JI7H 1NXUA 2CPMA 2UXCH 2UU9H 2DGRA 4B3TH 4LF5H 3SB1A 4NXMH 4K0KH 2HH3A 2X06A 4G08A 4GKKH 1MSZA 2QNDA 2LRRA 1KHMA 2OPUA 4X62H 4B8TA 1J5EH 4OO1G 5BR8H 4LFAH 1S03G 2JZXA 3AEVB 1Z2IA 2F4VH 1V8CA 1UG8A 1VIGA 2BA0A 4NZTM 4YHHH 5K36G 1FJGH 3OTOH 2ZM6H 1I94H 2CTFA 1IBMH 2P2RA 2UUBH 2UUCH 1V9NA 4B3SH 1PQXA 4JI3H 4H8AA 4DR7H 4JYAH 5A2QW 1XMQH 2HHHH 1X0AA 4DV0H 1ODHA 4QMFB 2CWFA 2UXBH 2LF0A 2CTKA 3VKEA 2PQUA 3FAUA 3GABA 4AIMA 4DV7H 4AM3A 4B3MH 2ANRA 1N33H 3OSSD 5IT9W 3J80W 4LF9H 3RF2A 1FKAH 4LF8H 2JE6I 4DR6H 4AQYH 2VQFH 4NZRM 3V69A 4OD6A 1J5KA 3T1HH 2CTEA 1I6UA 1SEIA 1X4MA 2Y3MA 4DUZH 4OCHA 4E9JA 5FLXW 1HNWH 3U1KA 2BL5A 5IWAH 5DT9A 1XNQH 1WE8A 1S20A 3I0PA 2JEBI 1HNZH 4LF6H 2ANNA 1WHRA 2FPHX 3GR5A 3T1YH 2PT7G 1X9ZA 3GKUA 1K1GA 1HR0H 2A1SA 1ZZIA 1X4NA 5C0XG 4WALA 3KDKA 1ZZJA 2VKCA 1EC6A 4JI5H 1N32H 4JVHA 1VBIA 4JVYA 2JVZA 4DV3H 2PY9A 4GKJH 2AXYA 4DV6H 2LTLA 4LFCH 2Z0SA 2JA9A 2NN6G 4JI8H 1IBLH 1N36H 3QD7X 1XMOH 4NXNH 2YQRA 3J7AK 2CTJA 4DV5H 4NBQA 1DTJA 5LMUH 2E3UA 4DV4H 4LF4H 2FFMA 2M8WA 4DV1H 3UOEA 4LFBH 4DR3H 2UXDH 1WVNA 4JI6H 2K1HA 3L7ZC 2FMRA 4JI2H 1AN7A 4B8CD 1IBKH 2G8YA 4JV5H 2ZQEA 1N34H
chains in the Genus database with same CATH topology
1X4NA 5C0XG 4WALA 1ZZJA 3VKEA 2PQUA 2JEAI 2DGRA 4LIJA 1DT4A 1J4WA 4BA2I 4JVYA 2JVZA 4AIMA 2HH3A 4JVHA 2PY9A 4AM3A 2ANRA 2AXYA 4WANA 2CPQA 2Z0SA 2QNDA 1KHMA 2JE6I 4IFDG 2JA9A 2NN6G 2OPUA 4B8TA 3V69A 1J5KA 4OO1G 1TUAA 2CTLA 2JZXA 2YQRA 3AEVB 2CTJA 2CTEA 2BA0A 1VIGA 4NBQA 1DTJA 1X4MA 2E3UA 2HH2A 2MJHA 5K36G 1VIHA 2OPVA 1ZZIA 2P2RA 2CTFA 3U1KA 2BL5A 2ANNA 1WE8A 1EC6A 2JEBI 1WVNA 3L7ZC 1ZZKA 2FMRA 4QMFB 1ZTGA 4BA1I 1K1GA 5JEAG 2CTMA 2CTKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X4N A;  5C0X G;  4WAL A;  1ZZJ A;  3VKE A;  2PQU A;  2JEA I;  2DGR A;  4LIJ A;  1DT4 A;  1J4W A;  4BA2 I;  4JVY A;  2JVZ A;  4AIM A;  2HH3 A;  4JVH A;  2PY9 A;  4AM3 A;  2ANR A;  2AXY A;  4WAN A;  2CPQ A;  2Z0S A;  2QND A;  1KHM A;  2JE6 I;  4IFD G;  2JA9 A;  2NN6 G;  2OPU A;  4B8T A;  3V69 A;  1J5K A;  4OO1 G;  1TUA A;  2CTL A;  2JZX A;  2YQR A;  3AEV B;  2CTJ A;  2CTE A;  2BA0 A;  1VIG A;  4NBQ A;  1DTJ A;  1X4M A;  2E3U A;  2HH2 A;  2MJH A;  5K36 G;  1VIH A;  2OPV A;  1ZZI A;  2P2R A;  2CTF A;  3U1K A;  2BL5 A;  2ANN A;  1WE8 A;  1EC6 A;  2JEB I;  1WVN A;  3L7Z C;  1ZZK A;  2FMR A;  4QMF B;  1ZTG A;  4BA1 I;  1K1G A;  5JEA G;  2CTM A;  2CTK A; 
#chains in the Genus database with same CATH topology
 4DV2 H;  4DR4 H;  4X65 H;  2JEA I;  4DR5 H;  4BA2 I;  4LIJ A;  1DT4 A;  1J4W A;  2UUA H;  4X64 H;  4WAN A;  1F0X A;  4FJS A;  4LF7 H;  1WTJ A;  2CPQ A;  2VQE H;  2M6Q A;  4IFD G;  3EZJ A;  4DUY H;  4JI4 H;  3JAM W;  4JI0 H;  3NCV A;  4DR2 H;  1TUA A;  2CTL A;  3OET A;  4DR1 H;  2HH2 A;  2MJH A;  2E5L H;  1VIH A;  4KHP H;  4YY3 H;  2OPV A;  4B3R H;  4PDB A;  5LMN H;  3J81 W;  1HNX H;  1XRH A;  2CWH A;  2D9I A;  2O4C A;  1ZZK A;  4X66 H;  1XNR H;  5LL6 b;  1ZTG A;  4BA1 I;  4OX9 H;  5JEA G;  2CTM A;  4EC5 A;  4FJU A;  2LTM A;  3KDG A;  4JI1 H;  4JI7 H;  1NXU A;  2CPM A;  2UXC H;  2UU9 H;  2DGR A;  4B3T H;  4LF5 H;  3SB1 A;  4NXM H;  4K0K H;  2HH3 A;  2X06 A;  4G08 A;  4GKK H;  1MSZ A;  2QND A;  2LRR A;  1KHM A;  2OPU A;  4X62 H;  4B8T A;  1J5E H;  4OO1 G;  5BR8 H;  4LFA H;  1S03 G;  2JZX A;  3AEV B;  1Z2I A;  2F4V H;  1V8C A;  1UG8 A;  1VIG A;  2BA0 A;  4NZT M;  4YHH H;  5K36 G;  1FJG H;  3OTO H;  2ZM6 H;  1I94 H;  2CTF A;  1IBM H;  2P2R A;  2UUB H;  2UUC H;  1V9N A;  4B3S H;  1PQX A;  4JI3 H;  4H8A A;  4DR7 H;  4JYA H;  5A2Q W;  1XMQ H;  2HHH H;  1X0A A;  4DV0 H;  1ODH A;  4QMF B;  2CWF A;  2UXB H;  2LF0 A;  2CTK A;  3VKE A;  2PQU A;  3FAU A;  3GAB A;  4AIM A;  4DV7 H;  4AM3 A;  4B3M H;  2ANR A;  1N33 H;  3OSS D;  5IT9 W;  3J80 W;  4LF9 H;  3RF2 A;  1FKA H;  4LF8 H;  2JE6 I;  4DR6 H;  4AQY H;  2VQF H;  4NZR M;  3V69 A;  4OD6 A;  1J5K A;  3T1H H;  2CTE A;  1I6U A;  1SEI A;  1X4M A;  2Y3M A;  4DUZ H;  4OCH A;  4E9J A;  5FLX W;  1HNW H;  3U1K A;  2BL5 A;  5IWA H;  5DT9 A;  1XNQ H;  1WE8 A;  1S20 A;  3I0P A;  2JEB I;  1HNZ H;  4LF6 H;  2ANN A;  1WHR A;  2FPH X;  3GR5 A;  3T1Y H;  2PT7 G;  1X9Z A;  3GKU A;  1K1G A;  1HR0 H;  2A1S A;  1ZZI A;  1X4N A;  5C0X G;  4WAL A;  3KDK A;  1ZZJ A;  2VKC A;  1EC6 A;  4JI5 H;  1N32 H;  4JVH A;  1VBI A;  4JVY A;  2JVZ A;  4DV3 H;  2PY9 A;  4GKJ H;  2AXY A;  4DV6 H;  2LTL A;  4LFC H;  2Z0S A;  2JA9 A;  2NN6 G;  4JI8 H;  1IBL H;  1N36 H;  3QD7 X;  1XMO H;  4NXN H;  2YQR A;  3J7A K;  2CTJ A;  4DV5 H;  4NBQ A;  1DTJ A;  5LMU H;  2E3U A;  4DV4 H;  4LF4 H;  2FFM A;  2M8W A;  4DV1 H;  3UOE A;  4LFB H;  4DR3 H;  2UXD H;  1WVN A;  4JI6 H;  2K1H A;  3L7Z C;  2FMR A;  4JI2 H;  1AN7 A;  4B8C D;  1IBK H;  2G8Y A;  4JV5 H;  2ZQE A;  1N34 H; 
#chains in the Genus database with same CATH homology
 1X4N A;  5C0X G;  4WAL A;  1ZZJ A;  3VKE A;  2PQU A;  2JEA I;  2DGR A;  4LIJ A;  1DT4 A;  1J4W A;  4BA2 I;  4JVY A;  2JVZ A;  4AIM A;  2HH3 A;  4JVH A;  2PY9 A;  4AM3 A;  2ANR A;  2AXY A;  4WAN A;  2CPQ A;  2Z0S A;  2QND A;  1KHM A;  2JE6 I;  4IFD G;  2JA9 A;  2NN6 G;  2OPU A;  4B8T A;  3V69 A;  1J5K A;  4OO1 G;  1TUA A;  2CTL A;  2JZX A;  2YQR A;  3AEV B;  2CTJ A;  2CTE A;  2BA0 A;  1VIG A;  4NBQ A;  1DTJ A;  1X4M A;  2E3U A;  2HH2 A;  2MJH A;  5K36 G;  1VIH A;  2OPV A;  1ZZI A;  2P2R A;  2CTF A;  3U1K A;  2BL5 A;  2ANN A;  1WE8 A;  1EC6 A;  2JEB I;  1WVN A;  3L7Z C;  1ZZK A;  2FMR A;  4QMF B;  1ZTG A;  4BA1 I;  1K1G A;  5JEA G;  2CTM A;  2CTK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...