2PY9A

Protein-rna interaction involving kh1 domain from human poly(c)-binding protein-2
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
72
structure length
72
Chain Sequence
KNVTLTIRLLMHGKEVGSIIGKKGESVKKMREESGARINISEGNCPERIITLAGPTNAIFKAFAMIIDKLEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 12-mer C-rich strand of human telomeric RNA
publication title X-ray crystallographic and NMR studies of protein-protein and protein-nucleic acid interactions involving the KH domains from human poly(C)-binding protein-2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna and dna binding protein/rna
total genus 15
structure length 72
sequence length 72
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 2py9A00
2HH2A 2BL5A 4AM3A 2CTEA 1WVNA 2OPVA 4IFDG 2CTFA 4AIMA 4QMFB 1X4MA 5K36G 2OPUA 1EC6A 3U1KA 4JVYA 2CTJA 2CTMA 2QNDA 2YQRA 2ANRA 2PQUA 2DGRA 2CPQA 2BA0A 2JZXA 2MJHA 1ZZKA 2AXYA 1KHMA 4BA2I 1ZZIA 2CTKA 2JA9A 2ANNA 3L7ZC 1DT4A 2FMRA 4LIJA 4NBQA 1X4NA 5JEAG 4WANA 4BA1I 3VKEA 1VIGA 1DTJA 1VIHA 4OO1G 2JEBI 1WE8A 1J5KA 3AEVB 2NN6G 2JE6I 3V69A 2E3UA 2JEAI 4B8TA 1J4WA 2JVZA 1ZTGA 2HH3A 1TUAA 2CTLA 4JVHA 2PY9A 1K1GA 1ZZJA 2Z0SA 2P2RA 4WALA 5C0XG
chains in the Genus database with same CATH superfamily
3UOEA 2UUBH 4AM3A 2FPHX 1WVNA 3EZJA 4YHHH 4AIMA 4LF5H 5DT9A 1EC6A 2LF0A 3J81W 2UU9H 4JVYA 2E5LH 2QNDA 1N34H 2ANRA 1MSZA 2DGRA 5A2QW 5BR8H 4JI1H 2BA0A 1WHRA 3GABA 2AXYA 4K0KH 1Z2IA 4BA2I 2CTKA 5FLXW 5LMNH 2UUAH 1DT4A 2LTMA 1N32H 3RF2A 5JEAG 2ZQEA 4WANA 4LF4H 1DTJA 1WE8A 1J5KA 5LMUH 2JE6I 3V69A 4JI4H 4LF8H 1N33H 2Z0SA 4LFCH 4DV6H 2HH2A 2BL5A 3T1HH 4DR7H 4DV3H 1ODHA 1NXUA 4LF7H 3KDGA 4NXNH 1UG8A 2CPMA 4PDBA 4DUYH 2CTJA 4DV7H 1AN7A 2CPQA 1ZZIA 2JA9A 5IWAH 1SEIA 3NCVA 4X66H 4B3SH 4DR3H 4EC5A 1XMQH 4BA1I 3VKEA 1VIGA 1FJGH 1XNQH 4OO1G 1X9ZA 4DR6H 2NN6G 4JI2H 4DR4H 2Y3MA 2CTLA 2LRRA 4GKJH 5LL6b 2UUCH 2UXBH 2D9IA 1HR0H 5IT9W 4H8AA 1VBIA 4WALA 5C0XG 2M6QA 1X0AA 2CTEA 4DV0H 2HHHH 2OPVA 4IFDG 2CTFA 4LFAH 4OX9H 1I6UA 5K36G 2OPUA 4OCHA 1N36H 1J5EH 4JI0H 3J7AK 2CTMA 2PQUA 2YQRA 3QD7X 4FJUA 4LF6H 1XNRH 2MJHA 1ZZKA 1KHMA 4JI3H 3OTOH 4LF9H 4B8CD 1V8CA 2PT7G 2A1SA 4YY3H 3I0PA 3L7ZC 4NBQA 4LIJA 4JI5H 2F4VH 4B3RH 1X4NA 4NZRM 1HNXH 3KDKA 1PQXA 2CWHA 1VIHA 4JI6H 2JEBI 4JI8H 4LFBH 2VKCA 1IBLH 1V9NA 4JYAH 2JEAI 4B8TA 4DR2H 4X62H 1J4WA 3T1YH 4B3MH 4JI7H 2HH3A 3OSSD 2PY9A 4FJSA 1ZZJA 3J80W 2P2RA 4B3TH 2X06A 4DV2H 4AQYH 3FAUA 2G8YA 4OD6A 3JAMW 4QMFB 1X4MA 3GKUA 3GR5A 3U1KA 2ZM6H 2FFMA 2LTLA 4DUZH 1I94H 4X64H 4DR5H 4GKKH 1S20A 2JZXA 4NXMH 1XMOH 4DV1H 2UXDH 1FKAH 4DV5H 2ANNA 2FMRA 1IBKH 3SB1A 1S03G 1IBMH 4JV5H 2M8WA 2VQEH 4KHPH 4G08A 2VQFH 3AEVB 2O4CA 3OETA 2E3UA 2K1HA 1XRHA 1F0XA 4NZTM 4E9JA 2JVZA 2CWFA 4DV4H 1TUAA 1ZTGA 4JVHA 1HNZH 2UXCH 1K1GA 1HNWH 4X65H 4DR1H 1WTJA
chains in the Genus database with same CATH topology
2HH2A 2BL5A 4AM3A 2CTEA 1WVNA 2OPVA 4IFDG 2CTFA 4AIMA 4QMFB 1X4MA 5K36G 2OPUA 1EC6A 3U1KA 4JVYA 2CTJA 2CTMA 2QNDA 2YQRA 2ANRA 2PQUA 2DGRA 2CPQA 2BA0A 2JZXA 2MJHA 1ZZKA 2AXYA 1KHMA 4BA2I 1ZZIA 2CTKA 2JA9A 2ANNA 3L7ZC 1DT4A 2FMRA 4LIJA 4NBQA 1X4NA 5JEAG 4WANA 4BA1I 3VKEA 1VIGA 1DTJA 1VIHA 4OO1G 2JEBI 1WE8A 1J5KA 3AEVB 2NN6G 2JE6I 3V69A 2E3UA 2JEAI 4B8TA 1J4WA 2JVZA 1ZTGA 2HH3A 1TUAA 2CTLA 4JVHA 2PY9A 1K1GA 1ZZJA 2Z0SA 2P2RA 4WALA 5C0XG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HH2 A;  2BL5 A;  4AM3 A;  2CTE A;  1WVN A;  2OPV A;  4IFD G;  2CTF A;  4AIM A;  4QMF B;  1X4M A;  5K36 G;  2OPU A;  1EC6 A;  3U1K A;  4JVY A;  2CTJ A;  2CTM A;  2QND A;  2YQR A;  2ANR A;  2PQU A;  2DGR A;  2CPQ A;  2BA0 A;  2JZX A;  2MJH A;  1ZZK A;  2AXY A;  1KHM A;  4BA2 I;  1ZZI A;  2CTK A;  2JA9 A;  2ANN A;  3L7Z C;  1DT4 A;  2FMR A;  4LIJ A;  4NBQ A;  1X4N A;  5JEA G;  4WAN A;  4BA1 I;  3VKE A;  1VIG A;  1DTJ A;  1VIH A;  4OO1 G;  2JEB I;  1WE8 A;  1J5K A;  3AEV B;  2NN6 G;  2JE6 I;  3V69 A;  2E3U A;  2JEA I;  4B8T A;  1J4W A;  2JVZ A;  1ZTG A;  2HH3 A;  1TUA A;  2CTL A;  4JVH A;  2PY9 A;  1K1G A;  1ZZJ A;  2Z0S A;  2P2R A;  4WAL A;  5C0X G; 
#chains in the Genus database with same CATH topology
 3UOE A;  2UUB H;  4AM3 A;  2FPH X;  1WVN A;  3EZJ A;  4YHH H;  4AIM A;  4LF5 H;  5DT9 A;  1EC6 A;  2LF0 A;  3J81 W;  2UU9 H;  4JVY A;  2E5L H;  2QND A;  1N34 H;  2ANR A;  1MSZ A;  2DGR A;  5A2Q W;  5BR8 H;  4JI1 H;  2BA0 A;  1WHR A;  3GAB A;  2AXY A;  4K0K H;  1Z2I A;  4BA2 I;  2CTK A;  5FLX W;  5LMN H;  2UUA H;  1DT4 A;  2LTM A;  1N32 H;  3RF2 A;  5JEA G;  2ZQE A;  4WAN A;  4LF4 H;  1DTJ A;  1WE8 A;  1J5K A;  5LMU H;  2JE6 I;  3V69 A;  4JI4 H;  4LF8 H;  1N33 H;  2Z0S A;  4LFC H;  4DV6 H;  2HH2 A;  2BL5 A;  3T1H H;  4DR7 H;  4DV3 H;  1ODH A;  1NXU A;  4LF7 H;  3KDG A;  4NXN H;  1UG8 A;  2CPM A;  4PDB A;  4DUY H;  2CTJ A;  4DV7 H;  1AN7 A;  2CPQ A;  1ZZI A;  2JA9 A;  5IWA H;  1SEI A;  3NCV A;  4X66 H;  4B3S H;  4DR3 H;  4EC5 A;  1XMQ H;  4BA1 I;  3VKE A;  1VIG A;  1FJG H;  1XNQ H;  4OO1 G;  1X9Z A;  4DR6 H;  2NN6 G;  4JI2 H;  4DR4 H;  2Y3M A;  2CTL A;  2LRR A;  4GKJ H;  5LL6 b;  2UUC H;  2UXB H;  2D9I A;  1HR0 H;  5IT9 W;  4H8A A;  1VBI A;  4WAL A;  5C0X G;  2M6Q A;  1X0A A;  2CTE A;  4DV0 H;  2HHH H;  2OPV A;  4IFD G;  2CTF A;  4LFA H;  4OX9 H;  1I6U A;  5K36 G;  2OPU A;  4OCH A;  1N36 H;  1J5E H;  4JI0 H;  3J7A K;  2CTM A;  2PQU A;  2YQR A;  3QD7 X;  4FJU A;  4LF6 H;  1XNR H;  2MJH A;  1ZZK A;  1KHM A;  4JI3 H;  3OTO H;  4LF9 H;  4B8C D;  1V8C A;  2PT7 G;  2A1S A;  4YY3 H;  3I0P A;  3L7Z C;  4NBQ A;  4LIJ A;  4JI5 H;  2F4V H;  4B3R H;  1X4N A;  4NZR M;  1HNX H;  3KDK A;  1PQX A;  2CWH A;  1VIH A;  4JI6 H;  2JEB I;  4JI8 H;  4LFB H;  2VKC A;  1IBL H;  1V9N A;  4JYA H;  2JEA I;  4B8T A;  4DR2 H;  4X62 H;  1J4W A;  3T1Y H;  4B3M H;  4JI7 H;  2HH3 A;  3OSS D;  2PY9 A;  4FJS A;  1ZZJ A;  3J80 W;  2P2R A;  4B3T H;  2X06 A;  4DV2 H;  4AQY H;  3FAU A;  2G8Y A;  4OD6 A;  3JAM W;  4QMF B;  1X4M A;  3GKU A;  3GR5 A;  3U1K A;  2ZM6 H;  2FFM A;  2LTL A;  4DUZ H;  1I94 H;  4X64 H;  4DR5 H;  4GKK H;  1S20 A;  2JZX A;  4NXM H;  1XMO H;  4DV1 H;  2UXD H;  1FKA H;  4DV5 H;  2ANN A;  2FMR A;  1IBK H;  3SB1 A;  1S03 G;  1IBM H;  4JV5 H;  2M8W A;  2VQE H;  4KHP H;  4G08 A;  2VQF H;  3AEV B;  2O4C A;  3OET A;  2E3U A;  2K1H A;  1XRH A;  1F0X A;  4NZT M;  4E9J A;  2JVZ A;  2CWF A;  4DV4 H;  1TUA A;  1ZTG A;  4JVH A;  1HNZ H;  2UXC H;  1K1G A;  1HNW H;  4X65 H;  4DR1 H;  1WTJ A; 
#chains in the Genus database with same CATH homology
 2HH2 A;  2BL5 A;  4AM3 A;  2CTE A;  1WVN A;  2OPV A;  4IFD G;  2CTF A;  4AIM A;  4QMF B;  1X4M A;  5K36 G;  2OPU A;  1EC6 A;  3U1K A;  4JVY A;  2CTJ A;  2CTM A;  2QND A;  2YQR A;  2ANR A;  2PQU A;  2DGR A;  2CPQ A;  2BA0 A;  2JZX A;  2MJH A;  1ZZK A;  2AXY A;  1KHM A;  4BA2 I;  1ZZI A;  2CTK A;  2JA9 A;  2ANN A;  3L7Z C;  1DT4 A;  2FMR A;  4LIJ A;  4NBQ A;  1X4N A;  5JEA G;  4WAN A;  4BA1 I;  3VKE A;  1VIG A;  1DTJ A;  1VIH A;  4OO1 G;  2JEB I;  1WE8 A;  1J5K A;  3AEV B;  2NN6 G;  2JE6 I;  3V69 A;  2E3U A;  2JEA I;  4B8T A;  1J4W A;  2JVZ A;  1ZTG A;  2HH3 A;  1TUA A;  2CTL A;  4JVH A;  2PY9 A;  1K1G A;  1ZZJ A;  2Z0S A;  2P2R A;  4WAL A;  5C0X G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...