2PY9A

Protein-rna interaction involving kh1 domain from human poly(c)-binding protein-2
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
72
structure length
72
Chain Sequence
KNVTLTIRLLMHGKEVGSIIGKKGESVKKMREESGARINISEGNCPERIITLAGPTNAIFKAFAMIIDKLEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna and dna binding protein/rna
molecule keywords 12-mer C-rich strand of human telomeric RNA
publication title X-ray crystallographic and NMR studies of protein-protein and protein-nucleic acid interactions involving the KH domains from human poly(C)-binding protein-2.
pubmed doi rcsb
source organism Homo sapiens
total genus 15
structure length 72
sequence length 72
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 2py9A00
2JVZA 1VIHA 1X4MA 2CTJA 2HH3A 2Z0SA 5JEAG 4NBQA 3L7ZC 4WALA 2JA9A 4OO1G 3AEVB 1K1GA 4LIJA 1VIGA 1KHMA 2JZXA 1ZTGA 1DTJA 2AXYA 2CPQA 2OPVA 2PQUA 4IFDG 4JVHA 4QMFB 2QNDA 2CTFA 2BA0A 1X4NA 4B8TA 2JEBI 1J4WA 5C0XG 4JVYA 4AM3A 1J5KA 2CTEA 1EC6A 5K36G 1ZZKA 3V69A 2MJHA 4AIMA 1WVNA 2OPUA 2NN6G 2YQRA 1WE8A 2JE6I 3U1KA 1TUAA 2BL5A 2DGRA 1ZZJA 2FMRA 2P2RA 2CTLA 2PY9A 3VKEA 4WANA 4BA1I 1DT4A 4BA2I 2HH2A 2CTKA 2E3UA 2ANRA 1ZZIA 2CTMA 2JEAI 2ANNA
chains in the Genus database with same CATH superfamily
1Z2IA 2LRRA 4NZRM 1MSZA 1X4MA 2Z0SA 2CPMA 1IBMH 3OSSD 5BR8H 4LFCH 5DT9A 1VIGA 4E9JA 4JVHA 2PQUA 2OPVA 3FAUA 4X66H 4IFDG 4OX9H 1J5EH 4B8TA 5LMUH 4DV6H 3QD7X 4JVYA 1HNXH 3J7AK 5K36G 4JI2H 2UUCH 3GKUA 2MJHA 4DV2H 4JI4H 3KDGA 4OCHA 2YQRA 4JYAH 2CWFA 1WTJA 2DGRA 2FMRA 2PY9A 4GKKH 4LFBH 4BA1I 4BA2I 4JI5H 3J81W 1WHRA 2HH2A 5IT9W 5LL6b 2ZQEA 2CTMA 1ZZIA 4JI0H 2ANNA 2JEAI 2JVZA 4GKJH 2CTJA 5JEAG 1XMQH 4B3RH 1IBLH 4DR6H 4OO1G 1XRHA 2JA9A 3AEVB 1K1GA 4B3SH 4EC5A 3J80W 4DV5H 1NXUA 2JZXA 1IBKH 1ODHA 1V9NA 4DR4H 1N33H 2CTFA 2Y3MA 1S20A 4YY3H 1X0AA 1EC6A 2FPHX 4LF4H 4NXMH 1VBIA 3V69A 4DR2H 1S03G 4AIMA 5FLXW 4DR1H 4LF8H 2JE6I 4DV1H 1TUAA 2LTMA 4JI6H 1UG8A 2VQEH 4LF7H 2CTLA 4JI7H 4KHPH 3NCVA 4H8AA 3SB1A 4DUYH 2CTKA 1XNQH 2ANRA 2FFMA 2A1SA 4LFAH 4X64H 3T1YH 1VIHA 1FKAH 2E5LH 1I6UA 5A2QW 1AN7A 1KHMA 3GR5A 1ZTGA 2AXYA 2LF0A 4JI1H 4JI8H 4G08A 2QNDA 5LMNH 2VKCA 2UXCH 3EZJA 2LTLA 1J4WA 2G8YA 2M6QA 4LF9H 2CTEA 2X06A 4AM3A 4FJSA 1ZZKA 2CWHA 3RF2A 4YHHH 1N34H 2K1HA 4DV3H 4LF5H 1WVNA 2OPUA 2PT7G 2NN6G 1WE8A 3U1KA 1XMOH 4LF6H 2P2RA 2UXBH 3VKEA 4WANA 4DV0H 1DT4A 2UUBH 1N36H 2E3UA 4DR5H 4AQYH 1F0XA 3OETA 4NZTM 1PQXA 4X65H 1I94H 2HH3A 4DR7H 4NBQA 3L7ZC 4WALA 4X62H 4B3MH 4OD6A 4LIJA 3GABA 2UUAH 4FJUA 1SEIA 1DTJA 2CPQA 2ZM6H 2VQFH 3UOEA 4K0KH 4QMFB 3JAMW 2BA0A 1X4NA 2JEBI 4B8CD 5C0XG 1J5KA 1HR0H 1HNZH 4JV5H 3OTOH 2F4VH 2O4CA 3T1HH 2UXDH 2M8WA 3KDKA 4B3TH 4PDBA 4DUZH 2BL5A 2UU9H 5IWAH 1N32H 1ZZJA 4DR3H 4DV7H 4NXNH 1FJGH 4JI3H 1HNWH 4DV4H 2D9IA 1X9ZA 2HHHH 1V8CA 3I0PA 1XNRH
chains in the Genus database with same CATH topology
2JVZA 1VIHA 1X4MA 2CTJA 2HH3A 2Z0SA 5JEAG 4NBQA 3L7ZC 4WALA 2JA9A 4OO1G 3AEVB 1K1GA 4LIJA 1VIGA 1KHMA 2JZXA 1ZTGA 1DTJA 2AXYA 2CPQA 2OPVA 2PQUA 4IFDG 4JVHA 4QMFB 2QNDA 2CTFA 2BA0A 1X4NA 4B8TA 2JEBI 1J4WA 5C0XG 4JVYA 4AM3A 1J5KA 2CTEA 1EC6A 5K36G 1ZZKA 3V69A 2MJHA 4AIMA 1WVNA 2OPUA 2NN6G 2YQRA 1WE8A 2JE6I 3U1KA 1TUAA 2BL5A 2DGRA 1ZZJA 2FMRA 2P2RA 2CTLA 2PY9A 3VKEA 4WANA 4BA1I 1DT4A 4BA2I 2HH2A 2CTKA 2E3UA 2ANRA 1ZZIA 2CTMA 2JEAI 2ANNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JVZ A;  1VIH A;  1X4M A;  2CTJ A;  2HH3 A;  2Z0S A;  5JEA G;  4NBQ A;  3L7Z C;  4WAL A;  2JA9 A;  4OO1 G;  3AEV B;  1K1G A;  4LIJ A;  1VIG A;  1KHM A;  2JZX A;  1ZTG A;  1DTJ A;  2AXY A;  2CPQ A;  2OPV A;  2PQU A;  4IFD G;  4JVH A;  4QMF B;  2QND A;  2CTF A;  2BA0 A;  1X4N A;  4B8T A;  2JEB I;  1J4W A;  5C0X G;  4JVY A;  4AM3 A;  1J5K A;  2CTE A;  1EC6 A;  5K36 G;  1ZZK A;  3V69 A;  2MJH A;  4AIM A;  1WVN A;  2OPU A;  2NN6 G;  2YQR A;  1WE8 A;  2JE6 I;  3U1K A;  1TUA A;  2BL5 A;  2DGR A;  1ZZJ A;  2FMR A;  2P2R A;  2CTL A;  2PY9 A;  3VKE A;  4WAN A;  4BA1 I;  1DT4 A;  4BA2 I;  2HH2 A;  2CTK A;  2E3U A;  2ANR A;  1ZZI A;  2CTM A;  2JEA I;  2ANN A; 
#chains in the Genus database with same CATH topology
 1Z2I A;  2LRR A;  4NZR M;  1MSZ A;  1X4M A;  2Z0S A;  2CPM A;  1IBM H;  3OSS D;  5BR8 H;  4LFC H;  5DT9 A;  1VIG A;  4E9J A;  4JVH A;  2PQU A;  2OPV A;  3FAU A;  4X66 H;  4IFD G;  4OX9 H;  1J5E H;  4B8T A;  5LMU H;  4DV6 H;  3QD7 X;  4JVY A;  1HNX H;  3J7A K;  5K36 G;  4JI2 H;  2UUC H;  3GKU A;  2MJH A;  4DV2 H;  4JI4 H;  3KDG A;  4OCH A;  2YQR A;  4JYA H;  2CWF A;  1WTJ A;  2DGR A;  2FMR A;  2PY9 A;  4GKK H;  4LFB H;  4BA1 I;  4BA2 I;  4JI5 H;  3J81 W;  1WHR A;  2HH2 A;  5IT9 W;  5LL6 b;  2ZQE A;  2CTM A;  1ZZI A;  4JI0 H;  2ANN A;  2JEA I;  2JVZ A;  4GKJ H;  2CTJ A;  5JEA G;  1XMQ H;  4B3R H;  1IBL H;  4DR6 H;  4OO1 G;  1XRH A;  2JA9 A;  3AEV B;  1K1G A;  4B3S H;  4EC5 A;  3J80 W;  4DV5 H;  1NXU A;  2JZX A;  1IBK H;  1ODH A;  1V9N A;  4DR4 H;  1N33 H;  2CTF A;  2Y3M A;  1S20 A;  4YY3 H;  1X0A A;  1EC6 A;  2FPH X;  4LF4 H;  4NXM H;  1VBI A;  3V69 A;  4DR2 H;  1S03 G;  4AIM A;  5FLX W;  4DR1 H;  4LF8 H;  2JE6 I;  4DV1 H;  1TUA A;  2LTM A;  4JI6 H;  1UG8 A;  2VQE H;  4LF7 H;  2CTL A;  4JI7 H;  4KHP H;  3NCV A;  4H8A A;  3SB1 A;  4DUY H;  2CTK A;  1XNQ H;  2ANR A;  2FFM A;  2A1S A;  4LFA H;  4X64 H;  3T1Y H;  1VIH A;  1FKA H;  2E5L H;  1I6U A;  5A2Q W;  1AN7 A;  1KHM A;  3GR5 A;  1ZTG A;  2AXY A;  2LF0 A;  4JI1 H;  4JI8 H;  4G08 A;  2QND A;  5LMN H;  2VKC A;  2UXC H;  3EZJ A;  2LTL A;  1J4W A;  2G8Y A;  2M6Q A;  4LF9 H;  2CTE A;  2X06 A;  4AM3 A;  4FJS A;  1ZZK A;  2CWH A;  3RF2 A;  4YHH H;  1N34 H;  2K1H A;  4DV3 H;  4LF5 H;  1WVN A;  2OPU A;  2PT7 G;  2NN6 G;  1WE8 A;  3U1K A;  1XMO H;  4LF6 H;  2P2R A;  2UXB H;  3VKE A;  4WAN A;  4DV0 H;  1DT4 A;  2UUB H;  1N36 H;  2E3U A;  4DR5 H;  4AQY H;  1F0X A;  3OET A;  4NZT M;  1PQX A;  4X65 H;  1I94 H;  2HH3 A;  4DR7 H;  4NBQ A;  3L7Z C;  4WAL A;  4X62 H;  4B3M H;  4OD6 A;  4LIJ A;  3GAB A;  2UUA H;  4FJU A;  1SEI A;  1DTJ A;  2CPQ A;  2ZM6 H;  2VQF H;  3UOE A;  4K0K H;  4QMF B;  3JAM W;  2BA0 A;  1X4N A;  2JEB I;  4B8C D;  5C0X G;  1J5K A;  1HR0 H;  1HNZ H;  4JV5 H;  3OTO H;  2F4V H;  2O4C A;  3T1H H;  2UXD H;  2M8W A;  3KDK A;  4B3T H;  4PDB A;  4DUZ H;  2BL5 A;  2UU9 H;  5IWA H;  1N32 H;  1ZZJ A;  4DR3 H;  4DV7 H;  4NXN H;  1FJG H;  4JI3 H;  1HNW H;  4DV4 H;  2D9I A;  1X9Z A;  2HHH H;  1V8C A;  3I0P A;  1XNR H; 
#chains in the Genus database with same CATH homology
 2JVZ A;  1VIH A;  1X4M A;  2CTJ A;  2HH3 A;  2Z0S A;  5JEA G;  4NBQ A;  3L7Z C;  4WAL A;  2JA9 A;  4OO1 G;  3AEV B;  1K1G A;  4LIJ A;  1VIG A;  1KHM A;  2JZX A;  1ZTG A;  1DTJ A;  2AXY A;  2CPQ A;  2OPV A;  2PQU A;  4IFD G;  4JVH A;  4QMF B;  2QND A;  2CTF A;  2BA0 A;  1X4N A;  4B8T A;  2JEB I;  1J4W A;  5C0X G;  4JVY A;  4AM3 A;  1J5K A;  2CTE A;  1EC6 A;  5K36 G;  1ZZK A;  3V69 A;  2MJH A;  4AIM A;  1WVN A;  2OPU A;  2NN6 G;  2YQR A;  1WE8 A;  2JE6 I;  3U1K A;  1TUA A;  2BL5 A;  2DGR A;  1ZZJ A;  2FMR A;  2P2R A;  2CTL A;  2PY9 A;  3VKE A;  4WAN A;  4BA1 I;  1DT4 A;  4BA2 I;  2HH2 A;  2CTK A;  2E3U A;  2ANR A;  1ZZI A;  2CTM A;  2JEA I;  2ANN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...