1VIHA

Nmr study of vigilin, repeat 6, minimized average structure
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
71
structure length
71
Chain Sequence
INRMDYVEINIDHKFHRHLIGKSGANINRIKDQYKVSVRIPPDSEKSNLIRIEGDPQGVQQAKRELLELAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribonucleoprotein
molecule keywords VIGILIN
publication title Three-dimensional structure and stability of the KH domain: molecular insights into the fragile X syndrome.
pubmed doi rcsb
source organism Homo sapiens
total genus 12
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 1995-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 1vihA00
1ZZIA 2JVZA 4LIJA 2AXYA 2HH2A 2CTEA 3VKEA 1J4WA 1WVNA 1K1GA 2JEAI 3L7ZC 2Z0SA 2PQUA 2PY9A 1EC6A 1DTJA 1TUAA 2QNDA 1ZZJA 4AIMA 4AM3A 1X4MA 2CPQA 2CTJA 4JVHA 2MJHA 2JEBI 2HH3A 4JVYA 2JE6I 2BL5A 2CTKA 2YQRA 2DGRA 1VIGA 2CTFA 1WE8A 2OPUA 4NBQA 2CTMA 2JZXA 3U1KA 2ANRA 1DT4A 2P2RA 4WALA 1ZTGA 4IFDG 5C0XG 2FMRA 5K36G 3AEVB 2BA0A 2E3UA 4BA1I 2JA9A 1KHMA 4WANA 1J5KA 2ANNA 1VIHA 2OPVA 3V69A 4B8TA 4OO1G 4BA2I 1X4NA 5JEAG 2CTLA 4QMFB 1ZZKA 2NN6G
chains in the Genus database with same CATH superfamily
4FJUA 1ZZIA 4G08A 1K1GA 1J4WA 1I6UA 2UXBH 1FJGH 1XNQH 2Z0SA 4JI2H 3KDGA 1ZZJA 4DR7H 1J5EH 2CPQA 4DV1H 2UU9H 4JVHA 4DV0H 1X9ZA 1S20A 4LF5H 1SEIA 2BL5A 2YQRA 4DV4H 1VIGA 2LF0A 2ANRA 2UXCH 4OCHA 1PQXA 4JI0H 2O4CA 4DR2H 5C0XG 1N36H 3GKUA 1X0AA 4FJSA 2E3UA 2JA9A 1Z2IA 4B3SH 1N34H 4JI7H 4BA2I 5LMUH 2M6QA 4AQYH 2VQFH 1HNZH 1S03G 4LIJA 4NZTM 2CTEA 1WVNA 1XRHA 3RF2A 1WTJA 3OTOH 4LF8H 2M8WA 2K1HA 4LF9H 1EC6A 4DV5H 4JV5H 4AIMA 4AM3A 1MSZA 2ZQEA 4NXMH 4JI5H 2MJHA 4B3TH 4LFBH 2HH3A 4JVYA 2VQEH 4YHHH 1I94H 2DGRA 2OPUA 4NBQA 2JZXA 3KDKA 2G8YA 1IBKH 1DT4A 2P2RA 4NXNH 4DR4H 1N32H 4B3MH 1V9NA 2CPMA 2FMRA 4DR3H 3GR5A 3GABA 4GKKH 2CWHA 5BR8H 3T1YH 2UUAH 2ANNA 2OPVA 3I0PA 3V69A 4LFAH 4OO1G 5IWAH 4DR5H 4JI8H 4JI3H 1X4NA 2LRRA 2CTLA 2PQUA 4QMFB 4EC5A 5IT9W 5K36G 4H8AA 4JI4H 2AXYA 2F4VH 3EZJA 2D9IA 2JEAI 4DR1H 2FPHX 3OETA 4LF4H 4DUYH 1VBIA 1X4MA 4LF6H 1HR0H 4DV3H 2JEBI 2X06A 2LTMA 2PT7G 4YY3H 3J7AK 1NXUA 4X62H 4JI6H 1WE8A 4DV7H 2CTMA 4X66H 4WALA 1ZTGA 4LF7H 4IFDG 4DV6H 1V8CA 2Y3MA 4KHPH 1WHRA 3QD7X 4B8CD 3FAUA 1KHMA 4WANA 1J5KA 2A1SA 4E9JA 1HNXH 1IBLH 4DR6H 5FLXW 4B8TA 5LMNH 5JEAG 4DV2H 1N33H 1ZZKA 1DTJA 2HHHH 3J80W 2JVZA 1XMOH 1HNWH 4K0KH 2HH2A 4B3RH 1F0XA 1ODHA 2PY9A 3L7ZC 4JYAH 1FKAH 1XMQH 1TUAA 2CWFA 2QNDA 4X65H 4OX9H 2CTJA 4X64H 3OSSD 2JE6I 1IBMH 3NCVA 2CTKA 3J81W 4JI1H 2CTFA 3U1KA 1UG8A 2UUBH 4GKJH 2UXDH 3SB1A 4NZRM 4OD6A 5DT9A 3AEVB 4LFCH 2BA0A 5LL6b 4BA1I 2E5LH 2ZM6H 2FFMA 3JAMW 4DUZH 3UOEA 3T1HH 2VKCA 1VIHA 5A2QW 2LTLA 2UUCH 4PDBA 3VKEA 1AN7A 1XNRH 2NN6G
chains in the Genus database with same CATH topology
1ZZIA 2JVZA 4LIJA 2AXYA 2HH2A 2CTEA 3VKEA 1J4WA 1WVNA 1K1GA 2JEAI 3L7ZC 2Z0SA 2PQUA 2PY9A 1EC6A 1DTJA 1TUAA 2QNDA 1ZZJA 4AIMA 4AM3A 1X4MA 2CPQA 2CTJA 4JVHA 2MJHA 2JEBI 2HH3A 4JVYA 2JE6I 2BL5A 2CTKA 2YQRA 2DGRA 1VIGA 2CTFA 1WE8A 2OPUA 4NBQA 2CTMA 2JZXA 3U1KA 2ANRA 1DT4A 2P2RA 4WALA 1ZTGA 4IFDG 5C0XG 2FMRA 5K36G 3AEVB 2BA0A 2E3UA 4BA1I 2JA9A 1KHMA 4WANA 1J5KA 2ANNA 1VIHA 2OPVA 3V69A 4B8TA 4OO1G 4BA2I 1X4NA 5JEAG 2CTLA 4QMFB 1ZZKA 2NN6G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZZI A;  2JVZ A;  4LIJ A;  2AXY A;  2HH2 A;  2CTE A;  3VKE A;  1J4W A;  1WVN A;  1K1G A;  2JEA I;  3L7Z C;  2Z0S A;  2PQU A;  2PY9 A;  1EC6 A;  1DTJ A;  1TUA A;  2QND A;  1ZZJ A;  4AIM A;  4AM3 A;  1X4M A;  2CPQ A;  2CTJ A;  4JVH A;  2MJH A;  2JEB I;  2HH3 A;  4JVY A;  2JE6 I;  2BL5 A;  2CTK A;  2YQR A;  2DGR A;  1VIG A;  2CTF A;  1WE8 A;  2OPU A;  4NBQ A;  2CTM A;  2JZX A;  3U1K A;  2ANR A;  1DT4 A;  2P2R A;  4WAL A;  1ZTG A;  4IFD G;  5C0X G;  2FMR A;  5K36 G;  3AEV B;  2BA0 A;  2E3U A;  4BA1 I;  2JA9 A;  1KHM A;  4WAN A;  1J5K A;  2ANN A;  1VIH A;  2OPV A;  3V69 A;  4B8T A;  4OO1 G;  4BA2 I;  1X4N A;  5JEA G;  2CTL A;  4QMF B;  1ZZK A;  2NN6 G; 
#chains in the Genus database with same CATH topology
 4FJU A;  1ZZI A;  4G08 A;  1K1G A;  1J4W A;  1I6U A;  2UXB H;  1FJG H;  1XNQ H;  2Z0S A;  4JI2 H;  3KDG A;  1ZZJ A;  4DR7 H;  1J5E H;  2CPQ A;  4DV1 H;  2UU9 H;  4JVH A;  4DV0 H;  1X9Z A;  1S20 A;  4LF5 H;  1SEI A;  2BL5 A;  2YQR A;  4DV4 H;  1VIG A;  2LF0 A;  2ANR A;  2UXC H;  4OCH A;  1PQX A;  4JI0 H;  2O4C A;  4DR2 H;  5C0X G;  1N36 H;  3GKU A;  1X0A A;  4FJS A;  2E3U A;  2JA9 A;  1Z2I A;  4B3S H;  1N34 H;  4JI7 H;  4BA2 I;  5LMU H;  2M6Q A;  4AQY H;  2VQF H;  1HNZ H;  1S03 G;  4LIJ A;  4NZT M;  2CTE A;  1WVN A;  1XRH A;  3RF2 A;  1WTJ A;  3OTO H;  4LF8 H;  2M8W A;  2K1H A;  4LF9 H;  1EC6 A;  4DV5 H;  4JV5 H;  4AIM A;  4AM3 A;  1MSZ A;  2ZQE A;  4NXM H;  4JI5 H;  2MJH A;  4B3T H;  4LFB H;  2HH3 A;  4JVY A;  2VQE H;  4YHH H;  1I94 H;  2DGR A;  2OPU A;  4NBQ A;  2JZX A;  3KDK A;  2G8Y A;  1IBK H;  1DT4 A;  2P2R A;  4NXN H;  4DR4 H;  1N32 H;  4B3M H;  1V9N A;  2CPM A;  2FMR A;  4DR3 H;  3GR5 A;  3GAB A;  4GKK H;  2CWH A;  5BR8 H;  3T1Y H;  2UUA H;  2ANN A;  2OPV A;  3I0P A;  3V69 A;  4LFA H;  4OO1 G;  5IWA H;  4DR5 H;  4JI8 H;  4JI3 H;  1X4N A;  2LRR A;  2CTL A;  2PQU A;  4QMF B;  4EC5 A;  5IT9 W;  5K36 G;  4H8A A;  4JI4 H;  2AXY A;  2F4V H;  3EZJ A;  2D9I A;  2JEA I;  4DR1 H;  2FPH X;  3OET A;  4LF4 H;  4DUY H;  1VBI A;  1X4M A;  4LF6 H;  1HR0 H;  4DV3 H;  2JEB I;  2X06 A;  2LTM A;  2PT7 G;  4YY3 H;  3J7A K;  1NXU A;  4X62 H;  4JI6 H;  1WE8 A;  4DV7 H;  2CTM A;  4X66 H;  4WAL A;  1ZTG A;  4LF7 H;  4IFD G;  4DV6 H;  1V8C A;  2Y3M A;  4KHP H;  1WHR A;  3QD7 X;  4B8C D;  3FAU A;  1KHM A;  4WAN A;  1J5K A;  2A1S A;  4E9J A;  1HNX H;  1IBL H;  4DR6 H;  5FLX W;  4B8T A;  5LMN H;  5JEA G;  4DV2 H;  1N33 H;  1ZZK A;  1DTJ A;  2HHH H;  3J80 W;  2JVZ A;  1XMO H;  1HNW H;  4K0K H;  2HH2 A;  4B3R H;  1F0X A;  1ODH A;  2PY9 A;  3L7Z C;  4JYA H;  1FKA H;  1XMQ H;  1TUA A;  2CWF A;  2QND A;  4X65 H;  4OX9 H;  2CTJ A;  4X64 H;  3OSS D;  2JE6 I;  1IBM H;  3NCV A;  2CTK A;  3J81 W;  4JI1 H;  2CTF A;  3U1K A;  1UG8 A;  2UUB H;  4GKJ H;  2UXD H;  3SB1 A;  4NZR M;  4OD6 A;  5DT9 A;  3AEV B;  4LFC H;  2BA0 A;  5LL6 b;  4BA1 I;  2E5L H;  2ZM6 H;  2FFM A;  3JAM W;  4DUZ H;  3UOE A;  3T1H H;  2VKC A;  1VIH A;  5A2Q W;  2LTL A;  2UUC H;  4PDB A;  3VKE A;  1AN7 A;  1XNR H;  2NN6 G; 
#chains in the Genus database with same CATH homology
 1ZZI A;  2JVZ A;  4LIJ A;  2AXY A;  2HH2 A;  2CTE A;  3VKE A;  1J4W A;  1WVN A;  1K1G A;  2JEA I;  3L7Z C;  2Z0S A;  2PQU A;  2PY9 A;  1EC6 A;  1DTJ A;  1TUA A;  2QND A;  1ZZJ A;  4AIM A;  4AM3 A;  1X4M A;  2CPQ A;  2CTJ A;  4JVH A;  2MJH A;  2JEB I;  2HH3 A;  4JVY A;  2JE6 I;  2BL5 A;  2CTK A;  2YQR A;  2DGR A;  1VIG A;  2CTF A;  1WE8 A;  2OPU A;  4NBQ A;  2CTM A;  2JZX A;  3U1K A;  2ANR A;  1DT4 A;  2P2R A;  4WAL A;  1ZTG A;  4IFD G;  5C0X G;  2FMR A;  5K36 G;  3AEV B;  2BA0 A;  2E3U A;  4BA1 I;  2JA9 A;  1KHM A;  4WAN A;  1J5K A;  2ANN A;  1VIH A;  2OPV A;  3V69 A;  4B8T A;  4OO1 G;  4BA2 I;  1X4N A;  5JEA G;  2CTL A;  4QMF B;  1ZZK A;  2NN6 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...