1VIHA

Nmr study of vigilin, repeat 6, minimized average structure
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
71
structure length
71
Chain Sequence
b'INRMDYVEINIDHKFHRHLIGKSGANINRIKDQYKVSVRIPPDSEKSNLIRIEGDPQGVQQAKRELLELAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VIGILIN
molecule tags Ribonucleoprotein
source organism Homo sapiens
publication title Three-dimensional structure and stability of the KH domain: molecular insights into the fragile X syndrome.
pubmed doi rcsb
total genus 12
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 1995-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 1vihA00
4WANA 2JVZA 2DGRA 4B8TA 1ZZIA 2CTLA 2CTKA 2JEBI 1X4NA 2BA0A 2OPUA 2ANRA 2NN6G 2OPVA 3AEVB 1TUAA 2PY9A 1X4MA 3VKEA 3U1KA 1ZZKA 2CPQA 1DT4A 1K1GA 4OO1G 4JVYA 2PQUA 2HH3A 3L7ZC 1ZZJA 2P2RA 4AIMA 5C0XG 1J5KA 2ANNA 4BA1I 2JE6I 1J4WA 2BL5A 2YQRA 1WVNA 2E3UA 1VIGA 2JZXA 2Z0SA 5JEAG 4AM3A 4IFDG 1KHMA 5K36G 2QNDA 4BA2I 2HH2A 2CTMA 2FMRA 2CTFA 2JA9A 3V69A 4NBQA 1DTJA 1EC6A 2CTJA 4WALA 1VIHA 4QMFB 2CTEA 2JEAI 4LIJA 4JVHA 1ZTGA 2AXYA 2MJHA 1WE8A
chains in the Genus database with same CATH superfamily
1IBKH 3RF2A 4GKKH 3T1YH 4B3MH 4B8CD 5IT9W 2G8YA 4KHPH 5A2QW 1XMOH 2UU9H 2FFMA 1WTJA 3VKEA 4JV5H 4JI2H 4JVYA 1DT4A 5IWAH 1FJGH 1HNWH 4JYAH 4LFBH 1N32H 3GABA 4B3SH 2CWFA 4GKJH 2UXBH 1ODHA 3KDGA 3KDKA 3T1HH 3GKUA 1VIGA 4X62H 1N33H 3FAUA 2CPMA 1X9ZA 4NZRM 4DUYH 1KHMA 2F4VH 3QD7X 2HH2A 2CTMA 4K0KH 1AN7A 2LTMA 3J81W 4E9JA 2JA9A 1XMQH 4NBQA 1N36H 4JI3H 4WALA 2E5LH 1N34H 4LF9H 2AXYA 4BA2I 4WANA 1XNQH 2LRRA 2CTLA 2CTKA 1X4NA 2CWHA 3GR5A 2OPUA 4OD6A 4JI8H 4LFCH 2PY9A 4X64H 2FPHX 1ZZKA 2CPQA 4B3TH 2PQUA 1WHRA 1Z2IA 2M6QA 4LFAH 1ZZJA 4AIMA 2LTLA 4FJUA 5C0XG 4AM3A 5JEAG 4IFDG 4DR2H 4DR7H 2UXCH 4DV7H 5DT9A 4PDBA 1S20A 2VKCA 2CTFA 5FLXW 3V69A 4DV4H 1MSZA 1DTJA 4JI4H 1F0XA 1VIHA 2UUAH 3EZJA 1J5EH 4JVHA 4OCHA 2VQEH 1WE8A 4JI7H 4NZTM 4DR3H 2JVZA 2DGRA 3NCVA 4NXNH 5LMUH 2JEBI 2BA0A 2OPVA 3AEVB 1TUAA 3OSSD 1X4MA 4DV2H 4DR5H 3U1KA 4X65H 4DUZH 1I94H 1XRHA 2Y3MA 2HHHH 4OX9H 4JI0H 4JI6H 4X66H 2ANNA 4G08A 4AQYH 2P2RA 2A1SA 4EC5A 2UUBH 3J7AK 4BA1I 1J4WA 1V9NA 2YQRA 1WVNA 2E3UA 2JZXA 2Z0SA 4YY3H 5BR8H 1FKAH 1HR0H 4JI5H 5K36G 4LF5H 1HNXH 4LF4H 2FMRA 1EC6A 2CTJA 2PT7G 1PQXA 4QMFB 2CTEA 4B3RH 2VQFH 4DV5H 2X06A 3SB1A 2M8WA 2MJHA 4FJSA 4YHHH 4NXMH 2D9IA 3UOEA 5LMNH 2O4CA 4B8TA 1ZZIA 4JI1H 4LF8H 1I6UA 2UUCH 4DR4H 2ANRA 2NN6G 4LF7H 3I0PA 4DR1H 4DV0H 2LF0A 4LF6H 4OO1G 4DV6H 1K1GA 1IBLH 1XNRH 2HH3A 4DV3H 3L7ZC 2ZM6H 1J5KA 5LL6b 2JE6I 2BL5A 3OETA 3OTOH 1X0AA 1UG8A 3J80W 1SEIA 2QNDA 1S03G 2ZQEA 2K1HA 4H8AA 4DR6H 4DV1H 3JAMW 1V8CA 1HNZH 2JEAI 1IBMH 4LIJA 2UXDH 1VBIA 1ZTGA 1NXUA
chains in the Genus database with same CATH topology
4WANA 2JVZA 2DGRA 4B8TA 1ZZIA 2CTLA 2CTKA 2JEBI 1X4NA 2BA0A 2OPUA 2ANRA 2NN6G 2OPVA 3AEVB 1TUAA 2PY9A 1X4MA 3VKEA 3U1KA 1ZZKA 2CPQA 1DT4A 1K1GA 4OO1G 4JVYA 2PQUA 2HH3A 3L7ZC 1ZZJA 2P2RA 4AIMA 5C0XG 1J5KA 2ANNA 4BA1I 2JE6I 1J4WA 2BL5A 2YQRA 1WVNA 2E3UA 1VIGA 2JZXA 2Z0SA 5JEAG 4AM3A 4IFDG 1KHMA 5K36G 2QNDA 4BA2I 2HH2A 2CTMA 2FMRA 2CTFA 2JA9A 3V69A 4NBQA 1DTJA 1EC6A 2CTJA 4WALA 1VIHA 4QMFB 2CTEA 2JEAI 4LIJA 4JVHA 1ZTGA 2AXYA 2MJHA 1WE8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WAN A;  2JVZ A;  2DGR A;  4B8T A;  1ZZI A;  2CTL A;  2CTK A;  2JEB I;  1X4N A;  2BA0 A;  2OPU A;  2ANR A;  2NN6 G;  2OPV A;  3AEV B;  1TUA A;  2PY9 A;  1X4M A;  3VKE A;  3U1K A;  1ZZK A;  2CPQ A;  1DT4 A;  1K1G A;  4OO1 G;  4JVY A;  2PQU A;  2HH3 A;  3L7Z C;  1ZZJ A;  2P2R A;  4AIM A;  5C0X G;  1J5K A;  2ANN A;  4BA1 I;  2JE6 I;  1J4W A;  2BL5 A;  2YQR A;  1WVN A;  2E3U A;  1VIG A;  2JZX A;  2Z0S A;  5JEA G;  4AM3 A;  4IFD G;  1KHM A;  5K36 G;  2QND A;  4BA2 I;  2HH2 A;  2CTM A;  2FMR A;  2CTF A;  2JA9 A;  3V69 A;  4NBQ A;  1DTJ A;  1EC6 A;  2CTJ A;  4WAL A;  1VIH A;  4QMF B;  2CTE A;  2JEA I;  4LIJ A;  4JVH A;  1ZTG A;  2AXY A;  2MJH A;  1WE8 A; 
#chains in the Genus database with same CATH topology
 1IBK H;  3RF2 A;  4GKK H;  3T1Y H;  4B3M H;  4B8C D;  5IT9 W;  2G8Y A;  4KHP H;  5A2Q W;  1XMO H;  2UU9 H;  2FFM A;  1WTJ A;  3VKE A;  4JV5 H;  4JI2 H;  4JVY A;  1DT4 A;  5IWA H;  1FJG H;  1HNW H;  4JYA H;  4LFB H;  1N32 H;  3GAB A;  4B3S H;  2CWF A;  4GKJ H;  2UXB H;  1ODH A;  3KDG A;  3KDK A;  3T1H H;  3GKU A;  1VIG A;  4X62 H;  1N33 H;  3FAU A;  2CPM A;  1X9Z A;  4NZR M;  4DUY H;  1KHM A;  2F4V H;  3QD7 X;  2HH2 A;  2CTM A;  4K0K H;  1AN7 A;  2LTM A;  3J81 W;  4E9J A;  2JA9 A;  1XMQ H;  4NBQ A;  1N36 H;  4JI3 H;  4WAL A;  2E5L H;  1N34 H;  4LF9 H;  2AXY A;  4BA2 I;  4WAN A;  1XNQ H;  2LRR A;  2CTL A;  2CTK A;  1X4N A;  2CWH A;  3GR5 A;  2OPU A;  4OD6 A;  4JI8 H;  4LFC H;  2PY9 A;  4X64 H;  2FPH X;  1ZZK A;  2CPQ A;  4B3T H;  2PQU A;  1WHR A;  1Z2I A;  2M6Q A;  4LFA H;  1ZZJ A;  4AIM A;  2LTL A;  4FJU A;  5C0X G;  4AM3 A;  5JEA G;  4IFD G;  4DR2 H;  4DR7 H;  2UXC H;  4DV7 H;  5DT9 A;  4PDB A;  1S20 A;  2VKC A;  2CTF A;  5FLX W;  3V69 A;  4DV4 H;  1MSZ A;  1DTJ A;  4JI4 H;  1F0X A;  1VIH A;  2UUA H;  3EZJ A;  1J5E H;  4JVH A;  4OCH A;  2VQE H;  1WE8 A;  4JI7 H;  4NZT M;  4DR3 H;  2JVZ A;  2DGR A;  3NCV A;  4NXN H;  5LMU H;  2JEB I;  2BA0 A;  2OPV A;  3AEV B;  1TUA A;  3OSS D;  1X4M A;  4DV2 H;  4DR5 H;  3U1K A;  4X65 H;  4DUZ H;  1I94 H;  1XRH A;  2Y3M A;  2HHH H;  4OX9 H;  4JI0 H;  4JI6 H;  4X66 H;  2ANN A;  4G08 A;  4AQY H;  2P2R A;  2A1S A;  4EC5 A;  2UUB H;  3J7A K;  4BA1 I;  1J4W A;  1V9N A;  2YQR A;  1WVN A;  2E3U A;  2JZX A;  2Z0S A;  4YY3 H;  5BR8 H;  1FKA H;  1HR0 H;  4JI5 H;  5K36 G;  4LF5 H;  1HNX H;  4LF4 H;  2FMR A;  1EC6 A;  2CTJ A;  2PT7 G;  1PQX A;  4QMF B;  2CTE A;  4B3R H;  2VQF H;  4DV5 H;  2X06 A;  3SB1 A;  2M8W A;  2MJH A;  4FJS A;  4YHH H;  4NXM H;  2D9I A;  3UOE A;  5LMN H;  2O4C A;  4B8T A;  1ZZI A;  4JI1 H;  4LF8 H;  1I6U A;  2UUC H;  4DR4 H;  2ANR A;  2NN6 G;  4LF7 H;  3I0P A;  4DR1 H;  4DV0 H;  2LF0 A;  4LF6 H;  4OO1 G;  4DV6 H;  1K1G A;  1IBL H;  1XNR H;  2HH3 A;  4DV3 H;  3L7Z C;  2ZM6 H;  1J5K A;  5LL6 b;  2JE6 I;  2BL5 A;  3OET A;  3OTO H;  1X0A A;  1UG8 A;  3J80 W;  1SEI A;  2QND A;  1S03 G;  2ZQE A;  2K1H A;  4H8A A;  4DR6 H;  4DV1 H;  3JAM W;  1V8C A;  1HNZ H;  2JEA I;  1IBM H;  4LIJ A;  2UXD H;  1VBI A;  1ZTG A;  1NXU A; 
#chains in the Genus database with same CATH homology
 4WAN A;  2JVZ A;  2DGR A;  4B8T A;  1ZZI A;  2CTL A;  2CTK A;  2JEB I;  1X4N A;  2BA0 A;  2OPU A;  2ANR A;  2NN6 G;  2OPV A;  3AEV B;  1TUA A;  2PY9 A;  1X4M A;  3VKE A;  3U1K A;  1ZZK A;  2CPQ A;  1DT4 A;  1K1G A;  4OO1 G;  4JVY A;  2PQU A;  2HH3 A;  3L7Z C;  1ZZJ A;  2P2R A;  4AIM A;  5C0X G;  1J5K A;  2ANN A;  4BA1 I;  2JE6 I;  1J4W A;  2BL5 A;  2YQR A;  1WVN A;  2E3U A;  1VIG A;  2JZX A;  2Z0S A;  5JEA G;  4AM3 A;  4IFD G;  1KHM A;  5K36 G;  2QND A;  4BA2 I;  2HH2 A;  2CTM A;  2FMR A;  2CTF A;  2JA9 A;  3V69 A;  4NBQ A;  1DTJ A;  1EC6 A;  2CTJ A;  4WAL A;  1VIH A;  4QMF B;  2CTE A;  2JEA I;  4LIJ A;  4JVH A;  1ZTG A;  2AXY A;  2MJH A;  1WE8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...