1VIHA

Nmr study of vigilin, repeat 6, minimized average structure
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
71
structure length
71
Chain Sequence
INRMDYVEINIDHKFHRHLIGKSGANINRIKDQYKVSVRIPPDSEKSNLIRIEGDPQGVQQAKRELLELAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VIGILIN
publication title Three-dimensional structure and stability of the KH domain: molecular insights into the fragile X syndrome.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ribonucleoprotein
total genus 12
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 1995-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 1vihA00
2JEBI 2BL5A 2OPVA 2QNDA 2JE6I 1WE8A 2CTKA 2JVZA 2PQUA 1WVNA 3U1KA 1ZZJA 1ZZKA 5K36G 1KHMA 2BA0A 3VKEA 1VIHA 1ZTGA 2ANRA 2OPUA 1EC6A 2MJHA 4WANA 2CTLA 2DGRA 2PY9A 2E3UA 4LIJA 4JVYA 2CTFA 1TUAA 2HH3A 4AIMA 2CTJA 2CPQA 1VIGA 3L7ZC 5JEAG 2JZXA 1DTJA 4NBQA 2FMRA 2HH2A 4BA1I 2YQRA 5C0XG 1DT4A 2ANNA 3AEVB 2JA9A 2AXYA 1J4WA 1K1GA 2Z0SA 3V69A 2JEAI 4WALA 1X4MA 4QMFB 1ZZIA 4AM3A 4OO1G 1J5KA 2P2RA 4JVHA 1X4NA 4IFDG 2NN6G 4BA2I 2CTMA 4B8TA 2CTEA
chains in the Genus database with same CATH superfamily
4LF8H 2UXDH 4JI0H 4JI5H 2JE6I 1SEIA 2CTKA 2JVZA 3VKEA 2G8YA 2PT7G 4JVYA 4LIJA 3OTOH 1I6UA 4B3RH 2F4VH 4K0KH 2CPQA 3L7ZC 2JZXA 2LRRA 2UXBH 4GKJH 2FMRA 4EC5A 2HH2A 4DR4H 2YQRA 4FJUA 1HR0H 4JI6H 3T1YH 2UUAH 2AXYA 4DV4H 4JI2H 4DR3H 2CWHA 4AM3A 1X4MA 2LF0A 2P2RA 5IT9W 1HNWH 4DUZH 2E5LH 4IFDG 2FPHX 2NN6G 3J80W 2HHHH 3J81W 3OSSD 4DV1H 1FJGH 4OCHA 1NXUA 1DT4A 2CTEA 2LTMA 4KHPH 1S20A 3EZJA 1WHRA 4NXNH 4JV5H 1ZZJA 4B3MH 1ZZKA 4NXMH 5K36G 4LF9H 4WANA 2DGRA 2VKCA 3QD7X 2HH3A 1FKAH 5DT9A 1XMQH 2K1HA 4DV3H 1I94H 3SB1A 4FJSA 3OETA 1AN7A 3GABA 4DR6H 2UUBH 4QMFB 3FAUA 1X0AA 4OO1G 3J7AK 2FFMA 3GR5A 1X4NA 1HNZH 2O4CA 4BA2I 4JYAH 2UXCH 5A2QW 2CTMA 1MSZA 4X64H 3JAMW 4B8TA 3KDGA 2UU9H 4LFBH 2BL5A 2QNDA 4DR5H 4X62H 4X66H 5IWAH 2ZQEA 2PQUA 2UUCH 1WVNA 4JI8H 4DR7H 2Y3MA 5LMNH 1ZTGA 2ANRA 4JI1H 2CPMA 4JI7H 2MJHA 1EC6A 2M8WA 5FLXW 5LL6b 2E3UA 1N32H 4X65H 2CTFA 1V8CA 4AIMA 1XMOH 5JEAG 1DTJA 1XRHA 4YY3H 1N34H 4YHHH 2VQEH 4OX9H 3AEVB 2ANNA 1IBLH 2JA9A 1K1GA 3T1HH 1J4WA 1S03G 4NZTM 4WALA 1ZZIA 3GKUA 1X9ZA 4DV0H 1XNQH 1J5EH 3NCVA 2ZM6H 4LFAH 3I0PA 4AQYH 2JEBI 4NZRM 1IBKH 4LF5H 2OPVA 4JI4H 2CWFA 1WE8A 1F0XA 2A1SA 1V9NA 3U1KA 3RF2A 1KHMA 2BA0A 4B3SH 1VIHA 1IBMH 1N33H 2OPUA 4JI3H 4LF4H 2CTLA 4DR1H 2PY9A 4B8CD 1TUAA 2D9IA 1UG8A 2CTJA 2M6QA 1VIGA 4GKKH 5LMUH 1PQXA 4NBQA 1N36H 1HNXH 2LTLA 5C0XG 4BA1I 1Z2IA 3UOEA 3KDKA 4LF7H 2VQFH 4LF6H 1XNRH 2Z0SA 3V69A 4OD6A 1WTJA 4DV2H 4DV7H 2JEAI 4H8AA 4E9JA 4B3TH 1J5KA 4JVHA 4DV6H 1ODHA 4LFCH 4G08A 4DV5H 4PDBA 5BR8H 4DUYH 4DR2H 1VBIA 2X06A
chains in the Genus database with same CATH topology
2JEBI 2BL5A 2OPVA 2QNDA 2JE6I 1WE8A 2CTKA 2JVZA 2PQUA 1WVNA 3U1KA 1ZZJA 1ZZKA 5K36G 1KHMA 2BA0A 3VKEA 1VIHA 1ZTGA 2ANRA 2OPUA 1EC6A 2MJHA 4WANA 2CTLA 2DGRA 2PY9A 2E3UA 4LIJA 4JVYA 2CTFA 1TUAA 2HH3A 4AIMA 2CTJA 2CPQA 1VIGA 3L7ZC 5JEAG 2JZXA 1DTJA 4NBQA 2FMRA 2HH2A 4BA1I 2YQRA 5C0XG 1DT4A 2ANNA 3AEVB 2JA9A 2AXYA 1J4WA 1K1GA 2Z0SA 3V69A 2JEAI 4WALA 1X4MA 4QMFB 1ZZIA 4AM3A 4OO1G 1J5KA 2P2RA 4JVHA 1X4NA 4IFDG 2NN6G 4BA2I 2CTMA 4B8TA 2CTEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JEB I;  2BL5 A;  2OPV A;  2QND A;  2JE6 I;  1WE8 A;  2CTK A;  2JVZ A;  2PQU A;  1WVN A;  3U1K A;  1ZZJ A;  1ZZK A;  5K36 G;  1KHM A;  2BA0 A;  3VKE A;  1VIH A;  1ZTG A;  2ANR A;  2OPU A;  1EC6 A;  2MJH A;  4WAN A;  2CTL A;  2DGR A;  2PY9 A;  2E3U A;  4LIJ A;  4JVY A;  2CTF A;  1TUA A;  2HH3 A;  4AIM A;  2CTJ A;  2CPQ A;  1VIG A;  3L7Z C;  5JEA G;  2JZX A;  1DTJ A;  4NBQ A;  2FMR A;  2HH2 A;  4BA1 I;  2YQR A;  5C0X G;  1DT4 A;  2ANN A;  3AEV B;  2JA9 A;  2AXY A;  1J4W A;  1K1G A;  2Z0S A;  3V69 A;  2JEA I;  4WAL A;  1X4M A;  4QMF B;  1ZZI A;  4AM3 A;  4OO1 G;  1J5K A;  2P2R A;  4JVH A;  1X4N A;  4IFD G;  2NN6 G;  4BA2 I;  2CTM A;  4B8T A;  2CTE A; 
#chains in the Genus database with same CATH topology
 4LF8 H;  2UXD H;  4JI0 H;  4JI5 H;  2JE6 I;  1SEI A;  2CTK A;  2JVZ A;  3VKE A;  2G8Y A;  2PT7 G;  4JVY A;  4LIJ A;  3OTO H;  1I6U A;  4B3R H;  2F4V H;  4K0K H;  2CPQ A;  3L7Z C;  2JZX A;  2LRR A;  2UXB H;  4GKJ H;  2FMR A;  4EC5 A;  2HH2 A;  4DR4 H;  2YQR A;  4FJU A;  1HR0 H;  4JI6 H;  3T1Y H;  2UUA H;  2AXY A;  4DV4 H;  4JI2 H;  4DR3 H;  2CWH A;  4AM3 A;  1X4M A;  2LF0 A;  2P2R A;  5IT9 W;  1HNW H;  4DUZ H;  2E5L H;  4IFD G;  2FPH X;  2NN6 G;  3J80 W;  2HHH H;  3J81 W;  3OSS D;  4DV1 H;  1FJG H;  4OCH A;  1NXU A;  1DT4 A;  2CTE A;  2LTM A;  4KHP H;  1S20 A;  3EZJ A;  1WHR A;  4NXN H;  4JV5 H;  1ZZJ A;  4B3M H;  1ZZK A;  4NXM H;  5K36 G;  4LF9 H;  4WAN A;  2DGR A;  2VKC A;  3QD7 X;  2HH3 A;  1FKA H;  5DT9 A;  1XMQ H;  2K1H A;  4DV3 H;  1I94 H;  3SB1 A;  4FJS A;  3OET A;  1AN7 A;  3GAB A;  4DR6 H;  2UUB H;  4QMF B;  3FAU A;  1X0A A;  4OO1 G;  3J7A K;  2FFM A;  3GR5 A;  1X4N A;  1HNZ H;  2O4C A;  4BA2 I;  4JYA H;  2UXC H;  5A2Q W;  2CTM A;  1MSZ A;  4X64 H;  3JAM W;  4B8T A;  3KDG A;  2UU9 H;  4LFB H;  2BL5 A;  2QND A;  4DR5 H;  4X62 H;  4X66 H;  5IWA H;  2ZQE A;  2PQU A;  2UUC H;  1WVN A;  4JI8 H;  4DR7 H;  2Y3M A;  5LMN H;  1ZTG A;  2ANR A;  4JI1 H;  2CPM A;  4JI7 H;  2MJH A;  1EC6 A;  2M8W A;  5FLX W;  5LL6 b;  2E3U A;  1N32 H;  4X65 H;  2CTF A;  1V8C A;  4AIM A;  1XMO H;  5JEA G;  1DTJ A;  1XRH A;  4YY3 H;  1N34 H;  4YHH H;  2VQE H;  4OX9 H;  3AEV B;  2ANN A;  1IBL H;  2JA9 A;  1K1G A;  3T1H H;  1J4W A;  1S03 G;  4NZT M;  4WAL A;  1ZZI A;  3GKU A;  1X9Z A;  4DV0 H;  1XNQ H;  1J5E H;  3NCV A;  2ZM6 H;  4LFA H;  3I0P A;  4AQY H;  2JEB I;  4NZR M;  1IBK H;  4LF5 H;  2OPV A;  4JI4 H;  2CWF A;  1WE8 A;  1F0X A;  2A1S A;  1V9N A;  3U1K A;  3RF2 A;  1KHM A;  2BA0 A;  4B3S H;  1VIH A;  1IBM H;  1N33 H;  2OPU A;  4JI3 H;  4LF4 H;  2CTL A;  4DR1 H;  2PY9 A;  4B8C D;  1TUA A;  2D9I A;  1UG8 A;  2CTJ A;  2M6Q A;  1VIG A;  4GKK H;  5LMU H;  1PQX A;  4NBQ A;  1N36 H;  1HNX H;  2LTL A;  5C0X G;  4BA1 I;  1Z2I A;  3UOE A;  3KDK A;  4LF7 H;  2VQF H;  4LF6 H;  1XNR H;  2Z0S A;  3V69 A;  4OD6 A;  1WTJ A;  4DV2 H;  4DV7 H;  2JEA I;  4H8A A;  4E9J A;  4B3T H;  1J5K A;  4JVH A;  4DV6 H;  1ODH A;  4LFC H;  4G08 A;  4DV5 H;  4PDB A;  5BR8 H;  4DUY H;  4DR2 H;  1VBI A;  2X06 A; 
#chains in the Genus database with same CATH homology
 2JEB I;  2BL5 A;  2OPV A;  2QND A;  2JE6 I;  1WE8 A;  2CTK A;  2JVZ A;  2PQU A;  1WVN A;  3U1K A;  1ZZJ A;  1ZZK A;  5K36 G;  1KHM A;  2BA0 A;  3VKE A;  1VIH A;  1ZTG A;  2ANR A;  2OPU A;  1EC6 A;  2MJH A;  4WAN A;  2CTL A;  2DGR A;  2PY9 A;  2E3U A;  4LIJ A;  4JVY A;  2CTF A;  1TUA A;  2HH3 A;  4AIM A;  2CTJ A;  2CPQ A;  1VIG A;  3L7Z C;  5JEA G;  2JZX A;  1DTJ A;  4NBQ A;  2FMR A;  2HH2 A;  4BA1 I;  2YQR A;  5C0X G;  1DT4 A;  2ANN A;  3AEV B;  2JA9 A;  2AXY A;  1J4W A;  1K1G A;  2Z0S A;  3V69 A;  2JEA I;  4WAL A;  1X4M A;  4QMF B;  1ZZI A;  4AM3 A;  4OO1 G;  1J5K A;  2P2R A;  4JVH A;  1X4N A;  4IFD G;  2NN6 G;  4BA2 I;  2CTM A;  4B8T A;  2CTE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...