1K1GA

Structural basis for recognition of the intron branch site rna by splicing factor 1
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
122
structure length
122
Chain Sequence
TRVSDKVMIPQDEYPEINFVGLLIGPRGNTLKNIEKECNAKIMIRGKGSVKEGKVGRKDGQMLPGEDEPLHALVTANTMENVKKAVEQIRNILKQGIETPEDQNDLRKMQLRELARLNGTLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Gene regulation/rna
molecule keywords 5'-R(*UP*AP*UP*AP*CP*UP*AP*AP*CP*AP*A)-3'
publication title Structural basis for recognition of the intron branch site RNA by splicing factor 1.
pubmed doi rcsb
source organism Homo sapiens
total genus 24
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2001-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 1k1gA00
2OPUA 5C0XG 1J5KA 4WANA 2P2RA 1KHMA 4AIMA 2BA0A 3L7ZC 4BA1I 2BL5A 1J4WA 2JVZA 2CTKA 2JZXA 2JE6I 2PQUA 2DGRA 2MJHA 4WALA 3U1KA 2E3UA 1X4NA 1VIHA 2YQRA 1WE8A 2CTFA 1ZTGA 2ANRA 2ANNA 2FMRA 2OPVA 1EC6A 2CTLA 1X4MA 1DT4A 1DTJA 2JEBI 1K1GA 4AM3A 4IFDG 1ZZKA 4B8TA 5K36G 2JEAI 2HH2A 2JA9A 1WVNA 2CTJA 2CPQA 3V69A 2Z0SA 2QNDA 2PY9A 1ZZJA 2HH3A 2CTEA 4QMFB 5JEAG 4OO1G 2CTMA 3VKEA 2AXYA 1TUAA 1ZZIA 4JVYA 1VIGA 4JVHA 2NN6G 4BA2I 4NBQA 3AEVB 4LIJA
chains in the Genus database with same CATH superfamily
1UG8A 4OD6A 4LF4H 1XNRH 4DV3H 4WANA 4K0KH 4AIMA 5IWAH 2UUAH 1PQXA 1V8CA 4FJUA 2DGRA 4X66H 2MJHA 2E3UA 1HNWH 2YQRA 1WE8A 3T1HH 2ANNA 4FJSA 2VQFH 4X62H 4JI5H 4GKKH 4LF6H 2G8YA 1MSZA 2HH2A 4DR2H 2M6QA 3RF2A 2UXBH 2UUCH 4DV1H 4X65H 1I6UA 3GABA 4QMFB 4DR3H 3VKEA 1VBIA 4DV7H 1NXUA 1N33H 4JVYA 4JVHA 2HHHH 4NBQA 4LF7H 2O4CA 4AQYH 3OTOH 2UUBH 2E5LH 4JI0H 4OX9H 1HNXH 4KHPH 1J5EH 2BA0A 2Y3MA 3L7ZC 2ZQEA 1J4WA 5IT9W 2CWHA 1V9NA 3U1KA 4DV6H 4JI1H 2CPMA 2A1SA 3NCVA 4NZTM 2ANRA 3I0PA 2OPVA 1XRHA 4DUZH 1X4MA 2FFMA 4LFAH 4JI4H 2JEAI 4YY3H 4YHHH 2JA9A 2CTJA 4JI8H 2CPQA 4DV4H 1S03G 3V69A 1Z2IA 4B3SH 1AN7A 2QNDA 1IBLH 1ZZJA 3OETA 5LL6b 1HNZH 2UXDH 4BA2I 2LTMA 2FPHX 1X0AA 4B8CD 3T1YH 2OPUA 4NXNH 1X9ZA 5LMNH 4DV5H 1XNQH 4BA1I 2BL5A 2CTKA 2JZXA 2JE6I 2PT7G 5BR8H 1XMQH 4LF8H 4DR1H 3EZJA 3UOEA 3OSSD 2FMRA 1IBKH 2CTLA 4OCHA 1FKAH 1HR0H 1I94H 4B8TA 1IBMH 5K36G 1WVNA 3KDKA 1ODHA 4DV0H 4LFBH 4DR4H 2Z0SA 3JAMW 4JI6H 4LF5H 2HH3A 2CTEA 2M8WA 4LF9H 2CTMA 4JV5H 1WTJA 1TUAA 1ZZIA 1N34H 4DR7H 1N32H 4NZRM 5JEAG 1FJGH 2LF0A 3SB1A 3FAUA 3J81W 3J7AK 5C0XG 5DT9A 1J5KA 1F0XA 1WHRA 4JI2H 2P2RA 1KHMA 2VKCA 4X64H 3QD7X 2JVZA 3KDGA 4DV2H 2PQUA 3GR5A 4GKJH 4WALA 5FLXW 1N36H 1X4NA 1VIHA 4G08A 2D9IA 2CTFA 4DUYH 1ZTGA 4EC5A 1EC6A 2UXCH 4JI3H 3J80W 1DT4A 1DTJA 2JEBI 4IFDG 1K1GA 4AM3A 1SEIA 1ZZKA 2VQEH 4PDBA 2F4VH 2CWFA 4NXMH 4JI7H 5LMUH 4DR6H 4E9JA 1S20A 2LTLA 2PY9A 5A2QW 3GKUA 4B3MH 4LFCH 2LRRA 4OO1G 1XMOH 4B3TH 4B3RH 2AXYA 4JYAH 2K1HA 2X06A 1VIGA 2ZM6H 2NN6G 4H8AA 4DR5H 3AEVB 2UU9H 4LIJA
chains in the Genus database with same CATH topology
2OPUA 5C0XG 1J5KA 4WANA 2P2RA 1KHMA 4AIMA 2BA0A 3L7ZC 4BA1I 2BL5A 1J4WA 2JVZA 2CTKA 2JZXA 2JE6I 2PQUA 2DGRA 2MJHA 4WALA 3U1KA 2E3UA 1X4NA 1VIHA 2YQRA 1WE8A 2CTFA 1ZTGA 2ANRA 2ANNA 2FMRA 2OPVA 1EC6A 2CTLA 1X4MA 1DT4A 1DTJA 2JEBI 1K1GA 4AM3A 4IFDG 1ZZKA 4B8TA 5K36G 2JEAI 2HH2A 2JA9A 1WVNA 2CTJA 2CPQA 3V69A 2Z0SA 2QNDA 2PY9A 1ZZJA 2HH3A 2CTEA 4QMFB 5JEAG 4OO1G 2CTMA 3VKEA 2AXYA 1TUAA 1ZZIA 4JVYA 1VIGA 4JVHA 2NN6G 4BA2I 4NBQA 3AEVB 4LIJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OPU A;  5C0X G;  1J5K A;  4WAN A;  2P2R A;  1KHM A;  4AIM A;  2BA0 A;  3L7Z C;  4BA1 I;  2BL5 A;  1J4W A;  2JVZ A;  2CTK A;  2JZX A;  2JE6 I;  2PQU A;  2DGR A;  2MJH A;  4WAL A;  3U1K A;  2E3U A;  1X4N A;  1VIH A;  2YQR A;  1WE8 A;  2CTF A;  1ZTG A;  2ANR A;  2ANN A;  2FMR A;  2OPV A;  1EC6 A;  2CTL A;  1X4M A;  1DT4 A;  1DTJ A;  2JEB I;  1K1G A;  4AM3 A;  4IFD G;  1ZZK A;  4B8T A;  5K36 G;  2JEA I;  2HH2 A;  2JA9 A;  1WVN A;  2CTJ A;  2CPQ A;  3V69 A;  2Z0S A;  2QND A;  2PY9 A;  1ZZJ A;  2HH3 A;  2CTE A;  4QMF B;  5JEA G;  4OO1 G;  2CTM A;  3VKE A;  2AXY A;  1TUA A;  1ZZI A;  4JVY A;  1VIG A;  4JVH A;  2NN6 G;  4BA2 I;  4NBQ A;  3AEV B;  4LIJ A; 
#chains in the Genus database with same CATH topology
 1UG8 A;  4OD6 A;  4LF4 H;  1XNR H;  4DV3 H;  4WAN A;  4K0K H;  4AIM A;  5IWA H;  2UUA H;  1PQX A;  1V8C A;  4FJU A;  2DGR A;  4X66 H;  2MJH A;  2E3U A;  1HNW H;  2YQR A;  1WE8 A;  3T1H H;  2ANN A;  4FJS A;  2VQF H;  4X62 H;  4JI5 H;  4GKK H;  4LF6 H;  2G8Y A;  1MSZ A;  2HH2 A;  4DR2 H;  2M6Q A;  3RF2 A;  2UXB H;  2UUC H;  4DV1 H;  4X65 H;  1I6U A;  3GAB A;  4QMF B;  4DR3 H;  3VKE A;  1VBI A;  4DV7 H;  1NXU A;  1N33 H;  4JVY A;  4JVH A;  2HHH H;  4NBQ A;  4LF7 H;  2O4C A;  4AQY H;  3OTO H;  2UUB H;  2E5L H;  4JI0 H;  4OX9 H;  1HNX H;  4KHP H;  1J5E H;  2BA0 A;  2Y3M A;  3L7Z C;  2ZQE A;  1J4W A;  5IT9 W;  2CWH A;  1V9N A;  3U1K A;  4DV6 H;  4JI1 H;  2CPM A;  2A1S A;  3NCV A;  4NZT M;  2ANR A;  3I0P A;  2OPV A;  1XRH A;  4DUZ H;  1X4M A;  2FFM A;  4LFA H;  4JI4 H;  2JEA I;  4YY3 H;  4YHH H;  2JA9 A;  2CTJ A;  4JI8 H;  2CPQ A;  4DV4 H;  1S03 G;  3V69 A;  1Z2I A;  4B3S H;  1AN7 A;  2QND A;  1IBL H;  1ZZJ A;  3OET A;  5LL6 b;  1HNZ H;  2UXD H;  4BA2 I;  2LTM A;  2FPH X;  1X0A A;  4B8C D;  3T1Y H;  2OPU A;  4NXN H;  1X9Z A;  5LMN H;  4DV5 H;  1XNQ H;  4BA1 I;  2BL5 A;  2CTK A;  2JZX A;  2JE6 I;  2PT7 G;  5BR8 H;  1XMQ H;  4LF8 H;  4DR1 H;  3EZJ A;  3UOE A;  3OSS D;  2FMR A;  1IBK H;  2CTL A;  4OCH A;  1FKA H;  1HR0 H;  1I94 H;  4B8T A;  1IBM H;  5K36 G;  1WVN A;  3KDK A;  1ODH A;  4DV0 H;  4LFB H;  4DR4 H;  2Z0S A;  3JAM W;  4JI6 H;  4LF5 H;  2HH3 A;  2CTE A;  2M8W A;  4LF9 H;  2CTM A;  4JV5 H;  1WTJ A;  1TUA A;  1ZZI A;  1N34 H;  4DR7 H;  1N32 H;  4NZR M;  5JEA G;  1FJG H;  2LF0 A;  3SB1 A;  3FAU A;  3J81 W;  3J7A K;  5C0X G;  5DT9 A;  1J5K A;  1F0X A;  1WHR A;  4JI2 H;  2P2R A;  1KHM A;  2VKC A;  4X64 H;  3QD7 X;  2JVZ A;  3KDG A;  4DV2 H;  2PQU A;  3GR5 A;  4GKJ H;  4WAL A;  5FLX W;  1N36 H;  1X4N A;  1VIH A;  4G08 A;  2D9I A;  2CTF A;  4DUY H;  1ZTG A;  4EC5 A;  1EC6 A;  2UXC H;  4JI3 H;  3J80 W;  1DT4 A;  1DTJ A;  2JEB I;  4IFD G;  1K1G A;  4AM3 A;  1SEI A;  1ZZK A;  2VQE H;  4PDB A;  2F4V H;  2CWF A;  4NXM H;  4JI7 H;  5LMU H;  4DR6 H;  4E9J A;  1S20 A;  2LTL A;  2PY9 A;  5A2Q W;  3GKU A;  4B3M H;  4LFC H;  2LRR A;  4OO1 G;  1XMO H;  4B3T H;  4B3R H;  2AXY A;  4JYA H;  2K1H A;  2X06 A;  1VIG A;  2ZM6 H;  2NN6 G;  4H8A A;  4DR5 H;  3AEV B;  2UU9 H;  4LIJ A; 
#chains in the Genus database with same CATH homology
 2OPU A;  5C0X G;  1J5K A;  4WAN A;  2P2R A;  1KHM A;  4AIM A;  2BA0 A;  3L7Z C;  4BA1 I;  2BL5 A;  1J4W A;  2JVZ A;  2CTK A;  2JZX A;  2JE6 I;  2PQU A;  2DGR A;  2MJH A;  4WAL A;  3U1K A;  2E3U A;  1X4N A;  1VIH A;  2YQR A;  1WE8 A;  2CTF A;  1ZTG A;  2ANR A;  2ANN A;  2FMR A;  2OPV A;  1EC6 A;  2CTL A;  1X4M A;  1DT4 A;  1DTJ A;  2JEB I;  1K1G A;  4AM3 A;  4IFD G;  1ZZK A;  4B8T A;  5K36 G;  2JEA I;  2HH2 A;  2JA9 A;  1WVN A;  2CTJ A;  2CPQ A;  3V69 A;  2Z0S A;  2QND A;  2PY9 A;  1ZZJ A;  2HH3 A;  2CTE A;  4QMF B;  5JEA G;  4OO1 G;  2CTM A;  3VKE A;  2AXY A;  1TUA A;  1ZZI A;  4JVY A;  1VIG A;  4JVH A;  2NN6 G;  4BA2 I;  4NBQ A;  3AEV B;  4LIJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...