1K1GA

Structural basis for recognition of the intron branch site rna by splicing factor 1
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
122
structure length
122
Chain Sequence
TRVSDKVMIPQDEYPEINFVGLLIGPRGNTLKNIEKECNAKIMIRGKGSVKEGKVGRKDGQMLPGEDEPLHALVTANTMENVKKAVEQIRNILKQGIETPEDQNDLRKMQLRELARLNGTLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for recognition of the intron branch site RNA by splicing factor 1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation/rna
molecule keywords 5'-R(*UP*AP*UP*AP*CP*UP*AP*AP*CP*AP*A)-3'
total genus 24
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2001-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 1k1gA00
2CTEA 2JEBI 2JVZA 1WE8A 1WVNA 2CTMA 3VKEA 4WANA 1X4NA 1ZTGA 2JZXA 4OO1G 1TUAA 1DT4A 2FMRA 2YQRA 1J4WA 4JVYA 4JVHA 2PQUA 4LIJA 2E3UA 4NBQA 2PY9A 3AEVB 2OPUA 2CTLA 3L7ZC 4AIMA 5JEAG 2AXYA 1DTJA 1ZZKA 2ANNA 1VIHA 2CTJA 5C0XG 2JA9A 2BL5A 3U1KA 1X4MA 2HH2A 3V69A 4BA2I 2JEAI 1KHMA 2OPVA 2CTFA 4IFDG 4BA1I 2MJHA 2QNDA 4WALA 4AM3A 5K36G 2BA0A 2DGRA 2P2RA 2CPQA 1ZZIA 2ANRA 2CTKA 4B8TA 1J5KA 2JE6I 2Z0SA 1EC6A 1VIGA 2HH3A 2NN6G 4QMFB 1ZZJA 1K1GA
chains in the Genus database with same CATH superfamily
1S03G 4DR3H 1WE8A 2HHHH 1X4NA 1NXUA 2JZXA 4X65H 4X66H 3RF2A 4LF6H 4LF7H 4JYAH 4OO1G 4DR2H 2FMRA 2YQRA 1J4WA 4JVYA 4JI4H 4JVHA 4GKKH 2VQEH 4B3RH 5LMNH 4NBQA 1FKAH 2UUCH 2PY9A 2A1SA 5BR8H 4IFDG 2JEAI 1ZZKA 1XMQH 1VIHA 2CTJA 4BA2I 3V69A 3KDGA 1X4MA 2PT7G 1KHMA 1VBIA 4DV7H 4BA1I 5LL6b 5K36G 2BA0A 2CWHA 4DV5H 3GABA 4DR4H 4K0KH 1XMOH 3OTOH 4FJUA 1ZZIA 1I94H 3GR5A 4FJSA 4H8AA 1J5KA 5A2QW 4DV3H 1IBKH 2D9IA 1HR0H 1IBMH 3J80W 2X06A 1MSZA 1HNXH 4QMFB 5IWAH 1ZZJA 4JI2H 1F0XA 4B3TH 3VKEA 1ZTGA 4DV2H 1V9NA 4DV4H 4LIJA 2CTLA 2O4CA 3L7ZC 4DR7H 3KDKA 2ANNA 5C0XG 3JAMW 2BL5A 4NZRM 3EZJA 1UG8A 3FAUA 4B3SH 2CTFA 4AM3A 1X0AA 2QNDA 4E9JA 4WALA 4LFBH 4X62H 4DUZH 4X64H 2UU9H 1FJGH 1HNWH 1N32H 2ANRA 3T1YH 2CPMA 4GKJH 2UXCH 4JI8H 1VIGA 1ODHA 2G8YA 2K1HA 4LFAH 4LF9H 4LF8H 4DR1H 4YY3H 3SB1A 1K1GA 4NXMH 2FPHX 2JVZA 1WVNA 4WANA 2CTMA 2LTLA 4DR5H 1WHRA 5LMUH 4DV1H 4DV0H 3QD7X 1IBLH 2ZM6H 4AIMA 4OX9H 5JEAG 2VQFH 1AN7A 2LF0A 3U1KA 2HH2A 1V8CA 1Z2IA 4JV5H 4JI0H 2UUBH 2CWFA 3OETA 1XNRH 1PQXA 2P2RA 4EC5A 2UXDH 5DT9A 4LF5H 2Z0SA 5FLXW 5IT9W 4B8CD 2HH3A 2FFMA 2NN6G 1N33H 1HNZH 3J7AK 4JI7H 4JI1H 4JI6H 2CTEA 2JEBI 4JI5H 2F4VH 4DR6H 2UUAH 3T1HH 3J81W 2VKCA 1TUAA 2LTMA 2UXBH 1DT4A 4YHHH 3GKUA 3UOEA 2PQUA 2M6QA 1X9ZA 4AQYH 1N34H 1WTJA 2E3UA 1XNQH 2ZQEA 2OPUA 3AEVB 2AXYA 1DTJA 4OD6A 2JA9A 1SEIA 2M8WA 4DUYH 4PDBA 3I0PA 4B3MH 4LFCH 2OPVA 4JI3H 2MJHA 4DV6H 2DGRA 4NXNH 3NCVA 4NZTM 4G08A 2E5LH 3OSSD 2CPQA 2LRRA 2CTKA 1S20A 4B8TA 1XRHA 2JE6I 4OCHA 1N36H 1EC6A 4LF4H 1I6UA 2Y3MA 1J5EH 4KHPH
chains in the Genus database with same CATH topology
2CTEA 2JEBI 2JVZA 1WE8A 1WVNA 2CTMA 3VKEA 4WANA 1X4NA 1ZTGA 2JZXA 4OO1G 1TUAA 1DT4A 2FMRA 2YQRA 1J4WA 4JVYA 4JVHA 2PQUA 4LIJA 2E3UA 4NBQA 2PY9A 3AEVB 2OPUA 2CTLA 3L7ZC 4AIMA 5JEAG 2AXYA 1DTJA 1ZZKA 2ANNA 1VIHA 2CTJA 5C0XG 2JA9A 2BL5A 3U1KA 1X4MA 2HH2A 3V69A 4BA2I 2JEAI 1KHMA 2OPVA 2CTFA 4IFDG 4BA1I 2MJHA 2QNDA 4WALA 4AM3A 5K36G 2BA0A 2DGRA 2P2RA 2CPQA 1ZZIA 2ANRA 2CTKA 4B8TA 1J5KA 2JE6I 2Z0SA 1EC6A 1VIGA 2HH3A 2NN6G 4QMFB 1ZZJA 1K1GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CTE A;  2JEB I;  2JVZ A;  1WE8 A;  1WVN A;  2CTM A;  3VKE A;  4WAN A;  1X4N A;  1ZTG A;  2JZX A;  4OO1 G;  1TUA A;  1DT4 A;  2FMR A;  2YQR A;  1J4W A;  4JVY A;  4JVH A;  2PQU A;  4LIJ A;  2E3U A;  4NBQ A;  2PY9 A;  3AEV B;  2OPU A;  2CTL A;  3L7Z C;  4AIM A;  5JEA G;  2AXY A;  1DTJ A;  1ZZK A;  2ANN A;  1VIH A;  2CTJ A;  5C0X G;  2JA9 A;  2BL5 A;  3U1K A;  1X4M A;  2HH2 A;  3V69 A;  4BA2 I;  2JEA I;  1KHM A;  2OPV A;  2CTF A;  4IFD G;  4BA1 I;  2MJH A;  2QND A;  4WAL A;  4AM3 A;  5K36 G;  2BA0 A;  2DGR A;  2P2R A;  2CPQ A;  1ZZI A;  2ANR A;  2CTK A;  4B8T A;  1J5K A;  2JE6 I;  2Z0S A;  1EC6 A;  1VIG A;  2HH3 A;  2NN6 G;  4QMF B;  1ZZJ A;  1K1G A; 
#chains in the Genus database with same CATH topology
 1S03 G;  4DR3 H;  1WE8 A;  2HHH H;  1X4N A;  1NXU A;  2JZX A;  4X65 H;  4X66 H;  3RF2 A;  4LF6 H;  4LF7 H;  4JYA H;  4OO1 G;  4DR2 H;  2FMR A;  2YQR A;  1J4W A;  4JVY A;  4JI4 H;  4JVH A;  4GKK H;  2VQE H;  4B3R H;  5LMN H;  4NBQ A;  1FKA H;  2UUC H;  2PY9 A;  2A1S A;  5BR8 H;  4IFD G;  2JEA I;  1ZZK A;  1XMQ H;  1VIH A;  2CTJ A;  4BA2 I;  3V69 A;  3KDG A;  1X4M A;  2PT7 G;  1KHM A;  1VBI A;  4DV7 H;  4BA1 I;  5LL6 b;  5K36 G;  2BA0 A;  2CWH A;  4DV5 H;  3GAB A;  4DR4 H;  4K0K H;  1XMO H;  3OTO H;  4FJU A;  1ZZI A;  1I94 H;  3GR5 A;  4FJS A;  4H8A A;  1J5K A;  5A2Q W;  4DV3 H;  1IBK H;  2D9I A;  1HR0 H;  1IBM H;  3J80 W;  2X06 A;  1MSZ A;  1HNX H;  4QMF B;  5IWA H;  1ZZJ A;  4JI2 H;  1F0X A;  4B3T H;  3VKE A;  1ZTG A;  4DV2 H;  1V9N A;  4DV4 H;  4LIJ A;  2CTL A;  2O4C A;  3L7Z C;  4DR7 H;  3KDK A;  2ANN A;  5C0X G;  3JAM W;  2BL5 A;  4NZR M;  3EZJ A;  1UG8 A;  3FAU A;  4B3S H;  2CTF A;  4AM3 A;  1X0A A;  2QND A;  4E9J A;  4WAL A;  4LFB H;  4X62 H;  4DUZ H;  4X64 H;  2UU9 H;  1FJG H;  1HNW H;  1N32 H;  2ANR A;  3T1Y H;  2CPM A;  4GKJ H;  2UXC H;  4JI8 H;  1VIG A;  1ODH A;  2G8Y A;  2K1H A;  4LFA H;  4LF9 H;  4LF8 H;  4DR1 H;  4YY3 H;  3SB1 A;  1K1G A;  4NXM H;  2FPH X;  2JVZ A;  1WVN A;  4WAN A;  2CTM A;  2LTL A;  4DR5 H;  1WHR A;  5LMU H;  4DV1 H;  4DV0 H;  3QD7 X;  1IBL H;  2ZM6 H;  4AIM A;  4OX9 H;  5JEA G;  2VQF H;  1AN7 A;  2LF0 A;  3U1K A;  2HH2 A;  1V8C A;  1Z2I A;  4JV5 H;  4JI0 H;  2UUB H;  2CWF A;  3OET A;  1XNR H;  1PQX A;  2P2R A;  4EC5 A;  2UXD H;  5DT9 A;  4LF5 H;  2Z0S A;  5FLX W;  5IT9 W;  4B8C D;  2HH3 A;  2FFM A;  2NN6 G;  1N33 H;  1HNZ H;  3J7A K;  4JI7 H;  4JI1 H;  4JI6 H;  2CTE A;  2JEB I;  4JI5 H;  2F4V H;  4DR6 H;  2UUA H;  3T1H H;  3J81 W;  2VKC A;  1TUA A;  2LTM A;  2UXB H;  1DT4 A;  4YHH H;  3GKU A;  3UOE A;  2PQU A;  2M6Q A;  1X9Z A;  4AQY H;  1N34 H;  1WTJ A;  2E3U A;  1XNQ H;  2ZQE A;  2OPU A;  3AEV B;  2AXY A;  1DTJ A;  4OD6 A;  2JA9 A;  1SEI A;  2M8W A;  4DUY H;  4PDB A;  3I0P A;  4B3M H;  4LFC H;  2OPV A;  4JI3 H;  2MJH A;  4DV6 H;  2DGR A;  4NXN H;  3NCV A;  4NZT M;  4G08 A;  2E5L H;  3OSS D;  2CPQ A;  2LRR A;  2CTK A;  1S20 A;  4B8T A;  1XRH A;  2JE6 I;  4OCH A;  1N36 H;  1EC6 A;  4LF4 H;  1I6U A;  2Y3M A;  1J5E H;  4KHP H; 
#chains in the Genus database with same CATH homology
 2CTE A;  2JEB I;  2JVZ A;  1WE8 A;  1WVN A;  2CTM A;  3VKE A;  4WAN A;  1X4N A;  1ZTG A;  2JZX A;  4OO1 G;  1TUA A;  1DT4 A;  2FMR A;  2YQR A;  1J4W A;  4JVY A;  4JVH A;  2PQU A;  4LIJ A;  2E3U A;  4NBQ A;  2PY9 A;  3AEV B;  2OPU A;  2CTL A;  3L7Z C;  4AIM A;  5JEA G;  2AXY A;  1DTJ A;  1ZZK A;  2ANN A;  1VIH A;  2CTJ A;  5C0X G;  2JA9 A;  2BL5 A;  3U1K A;  1X4M A;  2HH2 A;  3V69 A;  4BA2 I;  2JEA I;  1KHM A;  2OPV A;  2CTF A;  4IFD G;  4BA1 I;  2MJH A;  2QND A;  4WAL A;  4AM3 A;  5K36 G;  2BA0 A;  2DGR A;  2P2R A;  2CPQ A;  1ZZI A;  2ANR A;  2CTK A;  4B8T A;  1J5K A;  2JE6 I;  2Z0S A;  1EC6 A;  1VIG A;  2HH3 A;  2NN6 G;  4QMF B;  1ZZJ A;  1K1G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...