1K1GA

Structural basis for recognition of the intron branch site rna by splicing factor 1
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
122
structure length
122
Chain Sequence
TRVSDKVMIPQDEYPEINFVGLLIGPRGNTLKNIEKECNAKIMIRGKGSVKEGKVGRKDGQMLPGEDEPLHALVTANTMENVKKAVEQIRNILKQGIETPEDQNDLRKMQLRELARLNGTLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 5'-R(*UP*AP*UP*AP*CP*UP*AP*AP*CP*AP*A)-3'
publication title Structural basis for recognition of the intron branch site RNA by splicing factor 1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation/rna
total genus 24
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2001-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 1k1gA00
2BA0A 2OPUA 2DGRA 2FMRA 2HH2A 3VKEA 1J4WA 4AM3A 2YQRA 4OO1G 2CTMA 4WANA 2CTKA 2CPQA 1VIHA 2JEAI 4JVYA 2JA9A 3AEVB 5JEAG 2PY9A 4BA1I 2ANNA 2BL5A 1K1GA 3V69A 2ANRA 1DT4A 1ZZIA 3L7ZC 1ZTGA 5C0XG 1DTJA 4IFDG 4AIMA 1KHMA 2OPVA 2Z0SA 2P2RA 4JVHA 4QMFB 4BA2I 4B8TA 1VIGA 2PQUA 2JVZA 1TUAA 2JEBI 1WE8A 4LIJA 4NBQA 5K36G 1ZZJA 2E3UA 2CTLA 1ZZKA 1WVNA 3U1KA 1EC6A 2CTJA 2JZXA 1X4NA 2QNDA 2CTEA 4WALA 1J5KA 2AXYA 2HH3A 2MJHA 2JE6I 1X4MA 2CTFA 2NN6G
chains in the Genus database with same CATH superfamily
1N33H 2DGRA 4JV5H 4LFAH 3J81W 5IT9W 5LMUH 4JI8H 1VIHA 4JVYA 2JA9A 4B3SH 2PY9A 2CPMA 2O4CA 4BA1I 2BL5A 1K1GA 1WHRA 2ANRA 1SEIA 4JI4H 3T1HH 1ZTGA 5DT9A 1HNWH 1XRHA 4LF7H 4OX9H 4BA2I 2PQUA 4LFCH 1TUAA 3EZJA 4NXNH 1S03G 2Y3MA 4JI0H 4DV0H 2ZQEA 4B3RH 1ZZKA 3U1KA 1WVNA 2ZM6H 2F4VH 3JAMW 4GKJH 2CTJA 2JZXA 1X4NA 5A2QW 1J5EH 4JI1H 1XNQH 3KDKA 2LRRA 4YY3H 2E5LH 1X4MA 3QD7X 4YHHH 1F0XA 1EC6A 2OPUA 1XMOH 1N34H 1MSZA 1FJGH 4LF5H 1S20A 2LF0A 1WTJA 3FAUA 3KDGA 2YQRA 3OSSD 2CPQA 4G08A 4X65H 2PT7G 4LF8H 1XNRH 4DR7H 2ANNA 4FJSA 4DV3H 3SB1A 3OTOH 1ZZIA 4LF9H 3L7ZC 2HHHH 1AN7A 5LL6b 5C0XG 1DTJA 4LF6H 1KHMA 2P2RA 3J7AK 4DV5H 4JYAH 5LMNH 4AQYH 4H8AA 1ODHA 3UOEA 4JI5H 3NCVA 4DR3H 4LFBH 2E3UA 4GKKH 1HNXH 2X06A 2CWFA 4JI2H 4DR2H 4B3MH 4JI6H 2FFMA 4DV7H 2UU9H 1HNZH 2JE6I 2A1SA 2CTFA 1X9ZA 2NN6G 4KHPH 2FMRA 3GKUA 1IBLH 2HH2A 1J4WA 4AM3A 4DV2H 4OD6A 2CTMA 2CTKA 2VKCA 2LTMA 4PDBA 5JEAG 2K1HA 4FJUA 4DR4H 4DV4H 2UUAH 4JI7H 1I6UA 4DV6H 4B8CD 3OETA 3RF2A 4AIMA 4X64H 2OPVA 1X0AA 5FLXW 4DV1H 2UXCH 4EC5A 1WE8A 2G8YA 5K36G 1PQXA 2LTLA 2CTLA 3I0PA 4JI3H 4DR1H 1Z2IA 4DR5H 4WALA 1XMQH 2D9IA 2AXYA 2HH3A 3AEVB 2CWHA 1NXUA 4WANA 2BA0A 4DR6H 1IBKH 5BR8H 3GABA 2UXBH 5IWAH 3VKEA 3T1YH 1IBMH 4B3TH 4OO1G 1V8CA 2UUCH 2JEAI 2VQFH 4X66H 4X62H 2M6QA 2UXDH 1VBIA 3V69A 1HR0H 1DT4A 4NXMH 2UUBH 4LF4H 1N36H 1V9NA 4NZRM 2VQEH 1I94H 1FKAH 2Z0SA 4JVHA 4QMFB 4B8TA 1VIGA 2JVZA 2JEBI 4LIJA 4NBQA 3J80W 3GR5A 1ZZJA 1UG8A 4NZTM 4K0KH 2FPHX 2QNDA 2CTEA 4DUZH 2M8WA 1J5KA 4DUYH 1N32H 4E9JA 2MJHA 4IFDG 4OCHA
chains in the Genus database with same CATH topology
2BA0A 2OPUA 2DGRA 2FMRA 2HH2A 3VKEA 1J4WA 4AM3A 2YQRA 4OO1G 2CTMA 4WANA 2CTKA 2CPQA 1VIHA 2JEAI 4JVYA 2JA9A 3AEVB 5JEAG 2PY9A 4BA1I 2ANNA 2BL5A 1K1GA 3V69A 2ANRA 1DT4A 1ZZIA 3L7ZC 1ZTGA 5C0XG 1DTJA 4IFDG 4AIMA 1KHMA 2OPVA 2Z0SA 2P2RA 4JVHA 4QMFB 4BA2I 4B8TA 1VIGA 2PQUA 2JVZA 1TUAA 2JEBI 1WE8A 4LIJA 4NBQA 5K36G 1ZZJA 2E3UA 2CTLA 1ZZKA 1WVNA 3U1KA 1EC6A 2CTJA 2JZXA 1X4NA 2QNDA 2CTEA 4WALA 1J5KA 2AXYA 2HH3A 2MJHA 2JE6I 1X4MA 2CTFA 2NN6G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BA0 A;  2OPU A;  2DGR A;  2FMR A;  2HH2 A;  3VKE A;  1J4W A;  4AM3 A;  2YQR A;  4OO1 G;  2CTM A;  4WAN A;  2CTK A;  2CPQ A;  1VIH A;  2JEA I;  4JVY A;  2JA9 A;  3AEV B;  5JEA G;  2PY9 A;  4BA1 I;  2ANN A;  2BL5 A;  1K1G A;  3V69 A;  2ANR A;  1DT4 A;  1ZZI A;  3L7Z C;  1ZTG A;  5C0X G;  1DTJ A;  4IFD G;  4AIM A;  1KHM A;  2OPV A;  2Z0S A;  2P2R A;  4JVH A;  4QMF B;  4BA2 I;  4B8T A;  1VIG A;  2PQU A;  2JVZ A;  1TUA A;  2JEB I;  1WE8 A;  4LIJ A;  4NBQ A;  5K36 G;  1ZZJ A;  2E3U A;  2CTL A;  1ZZK A;  1WVN A;  3U1K A;  1EC6 A;  2CTJ A;  2JZX A;  1X4N A;  2QND A;  2CTE A;  4WAL A;  1J5K A;  2AXY A;  2HH3 A;  2MJH A;  2JE6 I;  1X4M A;  2CTF A;  2NN6 G; 
#chains in the Genus database with same CATH topology
 1N33 H;  2DGR A;  4JV5 H;  4LFA H;  3J81 W;  5IT9 W;  5LMU H;  4JI8 H;  1VIH A;  4JVY A;  2JA9 A;  4B3S H;  2PY9 A;  2CPM A;  2O4C A;  4BA1 I;  2BL5 A;  1K1G A;  1WHR A;  2ANR A;  1SEI A;  4JI4 H;  3T1H H;  1ZTG A;  5DT9 A;  1HNW H;  1XRH A;  4LF7 H;  4OX9 H;  4BA2 I;  2PQU A;  4LFC H;  1TUA A;  3EZJ A;  4NXN H;  1S03 G;  2Y3M A;  4JI0 H;  4DV0 H;  2ZQE A;  4B3R H;  1ZZK A;  3U1K A;  1WVN A;  2ZM6 H;  2F4V H;  3JAM W;  4GKJ H;  2CTJ A;  2JZX A;  1X4N A;  5A2Q W;  1J5E H;  4JI1 H;  1XNQ H;  3KDK A;  2LRR A;  4YY3 H;  2E5L H;  1X4M A;  3QD7 X;  4YHH H;  1F0X A;  1EC6 A;  2OPU A;  1XMO H;  1N34 H;  1MSZ A;  1FJG H;  4LF5 H;  1S20 A;  2LF0 A;  1WTJ A;  3FAU A;  3KDG A;  2YQR A;  3OSS D;  2CPQ A;  4G08 A;  4X65 H;  2PT7 G;  4LF8 H;  1XNR H;  4DR7 H;  2ANN A;  4FJS A;  4DV3 H;  3SB1 A;  3OTO H;  1ZZI A;  4LF9 H;  3L7Z C;  2HHH H;  1AN7 A;  5LL6 b;  5C0X G;  1DTJ A;  4LF6 H;  1KHM A;  2P2R A;  3J7A K;  4DV5 H;  4JYA H;  5LMN H;  4AQY H;  4H8A A;  1ODH A;  3UOE A;  4JI5 H;  3NCV A;  4DR3 H;  4LFB H;  2E3U A;  4GKK H;  1HNX H;  2X06 A;  2CWF A;  4JI2 H;  4DR2 H;  4B3M H;  4JI6 H;  2FFM A;  4DV7 H;  2UU9 H;  1HNZ H;  2JE6 I;  2A1S A;  2CTF A;  1X9Z A;  2NN6 G;  4KHP H;  2FMR A;  3GKU A;  1IBL H;  2HH2 A;  1J4W A;  4AM3 A;  4DV2 H;  4OD6 A;  2CTM A;  2CTK A;  2VKC A;  2LTM A;  4PDB A;  5JEA G;  2K1H A;  4FJU A;  4DR4 H;  4DV4 H;  2UUA H;  4JI7 H;  1I6U A;  4DV6 H;  4B8C D;  3OET A;  3RF2 A;  4AIM A;  4X64 H;  2OPV A;  1X0A A;  5FLX W;  4DV1 H;  2UXC H;  4EC5 A;  1WE8 A;  2G8Y A;  5K36 G;  1PQX A;  2LTL A;  2CTL A;  3I0P A;  4JI3 H;  4DR1 H;  1Z2I A;  4DR5 H;  4WAL A;  1XMQ H;  2D9I A;  2AXY A;  2HH3 A;  3AEV B;  2CWH A;  1NXU A;  4WAN A;  2BA0 A;  4DR6 H;  1IBK H;  5BR8 H;  3GAB A;  2UXB H;  5IWA H;  3VKE A;  3T1Y H;  1IBM H;  4B3T H;  4OO1 G;  1V8C A;  2UUC H;  2JEA I;  2VQF H;  4X66 H;  4X62 H;  2M6Q A;  2UXD H;  1VBI A;  3V69 A;  1HR0 H;  1DT4 A;  4NXM H;  2UUB H;  4LF4 H;  1N36 H;  1V9N A;  4NZR M;  2VQE H;  1I94 H;  1FKA H;  2Z0S A;  4JVH A;  4QMF B;  4B8T A;  1VIG A;  2JVZ A;  2JEB I;  4LIJ A;  4NBQ A;  3J80 W;  3GR5 A;  1ZZJ A;  1UG8 A;  4NZT M;  4K0K H;  2FPH X;  2QND A;  2CTE A;  4DUZ H;  2M8W A;  1J5K A;  4DUY H;  1N32 H;  4E9J A;  2MJH A;  4IFD G;  4OCH A; 
#chains in the Genus database with same CATH homology
 2BA0 A;  2OPU A;  2DGR A;  2FMR A;  2HH2 A;  3VKE A;  1J4W A;  4AM3 A;  2YQR A;  4OO1 G;  2CTM A;  4WAN A;  2CTK A;  2CPQ A;  1VIH A;  2JEA I;  4JVY A;  2JA9 A;  3AEV B;  5JEA G;  2PY9 A;  4BA1 I;  2ANN A;  2BL5 A;  1K1G A;  3V69 A;  2ANR A;  1DT4 A;  1ZZI A;  3L7Z C;  1ZTG A;  5C0X G;  1DTJ A;  4IFD G;  4AIM A;  1KHM A;  2OPV A;  2Z0S A;  2P2R A;  4JVH A;  4QMF B;  4BA2 I;  4B8T A;  1VIG A;  2PQU A;  2JVZ A;  1TUA A;  2JEB I;  1WE8 A;  4LIJ A;  4NBQ A;  5K36 G;  1ZZJ A;  2E3U A;  2CTL A;  1ZZK A;  1WVN A;  3U1K A;  1EC6 A;  2CTJ A;  2JZX A;  1X4N A;  2QND A;  2CTE A;  4WAL A;  1J5K A;  2AXY A;  2HH3 A;  2MJH A;  2JE6 I;  1X4M A;  2CTF A;  2NN6 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...