1K1GA

Structural basis for recognition of the intron branch site rna by splicing factor 1
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
122
structure length
122
Chain Sequence
b'TRVSDKVMIPQDEYPEINFVGLLIGPRGNTLKNIEKECNAKIMIRGKGSVKEGKVGRKDGQMLPGEDEPLHALVTANTMENVKKAVEQIRNILKQGIETPEDQNDLRKMQLRELARLNGTLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 5'-R(*UP*AP*UP*AP*CP*UP*AP*AP*CP*AP*A)-3'
publication title Structural basis for recognition of the intron branch site RNA by splicing factor 1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation/rna
total genus 24
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2001-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 1k1gA00
4B8TA 3VKEA 2HH3A 4LIJA 5JEAG 1K1GA 4OO1G 1DT4A 2JVZA 1ZTGA 2BA0A 1KHMA 4JVHA 2OPUA 5C0XG 2NN6G 2Z0SA 3U1KA 2MJHA 4JVYA 2JZXA 2JE6I 2BL5A 4NBQA 4AM3A 1ZZJA 2CTJA 4WANA 1J4WA 2HH2A 5K36G 2OPVA 2CTEA 2CPQA 2AXYA 2CTFA 2JA9A 4IFDG 2QNDA 2CTMA 2JEBI 2ANNA 1X4MA 2FMRA 4QMFB 4BA1I 2PQUA 2ANRA 2DGRA 1J5KA 1TUAA 1VIHA 2YQRA 2CTKA 4AIMA 2P2RA 1WE8A 2CTLA 2JEAI 1VIGA 1DTJA 1EC6A 1ZZKA 4WALA 3AEVB 3V69A 2E3UA 2PY9A 4BA2I 1WVNA 1ZZIA 1X4NA 3L7ZC
chains in the Genus database with same CATH superfamily
4LFAH 3VKEA 2E5LH 4OO1G 2JVZA 1FJGH 1IBKH 4JVHA 4NXNH 2MJHA 1MSZA 4NXMH 4E9JA 4GKJH 3JAMW 4DR2H 4NZRM 4JI4H 1AN7A 2VKCA 3SB1A 2M8WA 4DR4H 1XMQH 4JI8H 2PT7G 2ZM6H 1I6UA 4QMFB 2HHHH 4B3TH 2ANRA 1J5KA 4GKKH 1S03G 4OD6A 4DR7H 2CPMA 1VIHA 2JEAI 4AIMA 2X06A 2CWHA 2A1SA 4JI1H 1WHRA 2CWFA 4DR5H 1I94H 2FPHX 5LL6b 2ZQEA 4JI3H 1Z2IA 4X64H 2UXCH 1HR0H 3OTOH 2K1HA 5LMUH 2BA0A 5DT9A 2FFMA 3J80W 2Z0SA 3U1KA 1FKAH 1XNQH 4JVYA 2JZXA 2JE6I 2BL5A 4AQYH 2CTJA 4FJSA 1XRHA 2G8YA 2HH2A 1VBIA 4FJUA 2CTEA 2CPQA 2CTFA 2JA9A 3KDKA 4DV5H 1N34H 4JI7H 2ANNA 4X62H 1X4MA 4JI5H 1F0XA 4BA1I 4DUYH 1XNRH 2DGRA 4YY3H 2VQFH 1HNXH 4LF4H 2UXBH 1IBLH 4NZTM 1N32H 2UXDH 2YQRA 2CTKA 1WE8A 3GR5A 1EC6A 5IWAH 1ZZKA 1S20A 1IBMH 4DV3H 3V69A 2PY9A 1WVNA 4KHPH 4JYAH 2UU9H 3AEVB 4B8TA 3FAUA 4YHHH 3GABA 4B8CD 3GKUA 3KDGA 1ZTGA 2D9IA 4JI0H 1KHMA 1WTJA 2Y3MA 2OPUA 1J5EH 2NN6G 4DV1H 4B3RH 4NBQA 4WANA 4DUZH 4B3SH 1X9ZA 5K36G 2LTMA 2CTMA 2QNDA 2LF0A 4LF8H 5BR8H 4JI6H 4K0KH 3I0PA 4X65H 4B3MH 2F4VH 3NCVA 4LF9H 1N36H 1TUAA 2UUCH 4LF7H 4DV4H 4DR1H 2LRRA 4G08A 1DTJA 3QD7X 4EC5A 4DR3H 2LTLA 4WALA 4LFBH 4OX9H 2E3UA 1SEIA 3T1YH 4BA2I 1ZZIA 3J7AK 2UUBH 1UG8A 3OETA 3L7ZC 3OSSD 4JV5H 2HH3A 4LIJA 5JEAG 1XMOH 4OCHA 1K1GA 1HNZH 1DT4A 5FLXW 4PDBA 1PQXA 4DV0H 4LF5H 2VQEH 5C0XG 1ODHA 1X0AA 2M6QA 4X66H 3J81W 4AM3A 1ZZJA 4H8AA 1J4WA 2OPVA 4IFDG 2AXYA 3UOEA 4DV7H 2JEBI 5IT9W 4LFCH 2FMRA 3EZJA 1V9NA 3T1HH 2PQUA 2P2RA 1V8CA 1HNWH 2CTLA 4DV6H 2O4CA 4LF6H 1VIGA 5LMNH 1N33H 2UUAH 4DV2H 3RF2A 4DR6H 1X4NA 1NXUA 4JI2H 5A2QW
chains in the Genus database with same CATH topology
4B8TA 3VKEA 2HH3A 4LIJA 5JEAG 1K1GA 4OO1G 1DT4A 2JVZA 1ZTGA 2BA0A 1KHMA 4JVHA 2OPUA 5C0XG 2NN6G 2Z0SA 3U1KA 2MJHA 4JVYA 2JZXA 2JE6I 2BL5A 4NBQA 4AM3A 1ZZJA 2CTJA 4WANA 1J4WA 2HH2A 5K36G 2OPVA 2CTEA 2CPQA 2AXYA 2CTFA 2JA9A 4IFDG 2QNDA 2CTMA 2JEBI 2ANNA 1X4MA 2FMRA 4QMFB 4BA1I 2PQUA 2ANRA 2DGRA 1J5KA 1TUAA 1VIHA 2YQRA 2CTKA 4AIMA 2P2RA 1WE8A 2CTLA 2JEAI 1VIGA 1DTJA 1EC6A 1ZZKA 4WALA 3AEVB 3V69A 2E3UA 2PY9A 4BA2I 1WVNA 1ZZIA 1X4NA 3L7ZC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B8T A;  3VKE A;  2HH3 A;  4LIJ A;  5JEA G;  1K1G A;  4OO1 G;  1DT4 A;  2JVZ A;  1ZTG A;  2BA0 A;  1KHM A;  4JVH A;  2OPU A;  5C0X G;  2NN6 G;  2Z0S A;  3U1K A;  2MJH A;  4JVY A;  2JZX A;  2JE6 I;  2BL5 A;  4NBQ A;  4AM3 A;  1ZZJ A;  2CTJ A;  4WAN A;  1J4W A;  2HH2 A;  5K36 G;  2OPV A;  2CTE A;  2CPQ A;  2AXY A;  2CTF A;  2JA9 A;  4IFD G;  2QND A;  2CTM A;  2JEB I;  2ANN A;  1X4M A;  2FMR A;  4QMF B;  4BA1 I;  2PQU A;  2ANR A;  2DGR A;  1J5K A;  1TUA A;  1VIH A;  2YQR A;  2CTK A;  4AIM A;  2P2R A;  1WE8 A;  2CTL A;  2JEA I;  1VIG A;  1DTJ A;  1EC6 A;  1ZZK A;  4WAL A;  3AEV B;  3V69 A;  2E3U A;  2PY9 A;  4BA2 I;  1WVN A;  1ZZI A;  1X4N A;  3L7Z C; 
#chains in the Genus database with same CATH topology
 4LFA H;  3VKE A;  2E5L H;  4OO1 G;  2JVZ A;  1FJG H;  1IBK H;  4JVH A;  4NXN H;  2MJH A;  1MSZ A;  4NXM H;  4E9J A;  4GKJ H;  3JAM W;  4DR2 H;  4NZR M;  4JI4 H;  1AN7 A;  2VKC A;  3SB1 A;  2M8W A;  4DR4 H;  1XMQ H;  4JI8 H;  2PT7 G;  2ZM6 H;  1I6U A;  4QMF B;  2HHH H;  4B3T H;  2ANR A;  1J5K A;  4GKK H;  1S03 G;  4OD6 A;  4DR7 H;  2CPM A;  1VIH A;  2JEA I;  4AIM A;  2X06 A;  2CWH A;  2A1S A;  4JI1 H;  1WHR A;  2CWF A;  4DR5 H;  1I94 H;  2FPH X;  5LL6 b;  2ZQE A;  4JI3 H;  1Z2I A;  4X64 H;  2UXC H;  1HR0 H;  3OTO H;  2K1H A;  5LMU H;  2BA0 A;  5DT9 A;  2FFM A;  3J80 W;  2Z0S A;  3U1K A;  1FKA H;  1XNQ H;  4JVY A;  2JZX A;  2JE6 I;  2BL5 A;  4AQY H;  2CTJ A;  4FJS A;  1XRH A;  2G8Y A;  2HH2 A;  1VBI A;  4FJU A;  2CTE A;  2CPQ A;  2CTF A;  2JA9 A;  3KDK A;  4DV5 H;  1N34 H;  4JI7 H;  2ANN A;  4X62 H;  1X4M A;  4JI5 H;  1F0X A;  4BA1 I;  4DUY H;  1XNR H;  2DGR A;  4YY3 H;  2VQF H;  1HNX H;  4LF4 H;  2UXB H;  1IBL H;  4NZT M;  1N32 H;  2UXD H;  2YQR A;  2CTK A;  1WE8 A;  3GR5 A;  1EC6 A;  5IWA H;  1ZZK A;  1S20 A;  1IBM H;  4DV3 H;  3V69 A;  2PY9 A;  1WVN A;  4KHP H;  4JYA H;  2UU9 H;  3AEV B;  4B8T A;  3FAU A;  4YHH H;  3GAB A;  4B8C D;  3GKU A;  3KDG A;  1ZTG A;  2D9I A;  4JI0 H;  1KHM A;  1WTJ A;  2Y3M A;  2OPU A;  1J5E H;  2NN6 G;  4DV1 H;  4B3R H;  4NBQ A;  4WAN A;  4DUZ H;  4B3S H;  1X9Z A;  5K36 G;  2LTM A;  2CTM A;  2QND A;  2LF0 A;  4LF8 H;  5BR8 H;  4JI6 H;  4K0K H;  3I0P A;  4X65 H;  4B3M H;  2F4V H;  3NCV A;  4LF9 H;  1N36 H;  1TUA A;  2UUC H;  4LF7 H;  4DV4 H;  4DR1 H;  2LRR A;  4G08 A;  1DTJ A;  3QD7 X;  4EC5 A;  4DR3 H;  2LTL A;  4WAL A;  4LFB H;  4OX9 H;  2E3U A;  1SEI A;  3T1Y H;  4BA2 I;  1ZZI A;  3J7A K;  2UUB H;  1UG8 A;  3OET A;  3L7Z C;  3OSS D;  4JV5 H;  2HH3 A;  4LIJ A;  5JEA G;  1XMO H;  4OCH A;  1K1G A;  1HNZ H;  1DT4 A;  5FLX W;  4PDB A;  1PQX A;  4DV0 H;  4LF5 H;  2VQE H;  5C0X G;  1ODH A;  1X0A A;  2M6Q A;  4X66 H;  3J81 W;  4AM3 A;  1ZZJ A;  4H8A A;  1J4W A;  2OPV A;  4IFD G;  2AXY A;  3UOE A;  4DV7 H;  2JEB I;  5IT9 W;  4LFC H;  2FMR A;  3EZJ A;  1V9N A;  3T1H H;  2PQU A;  2P2R A;  1V8C A;  1HNW H;  2CTL A;  4DV6 H;  2O4C A;  4LF6 H;  1VIG A;  5LMN H;  1N33 H;  2UUA H;  4DV2 H;  3RF2 A;  4DR6 H;  1X4N A;  1NXU A;  4JI2 H;  5A2Q W; 
#chains in the Genus database with same CATH homology
 4B8T A;  3VKE A;  2HH3 A;  4LIJ A;  5JEA G;  1K1G A;  4OO1 G;  1DT4 A;  2JVZ A;  1ZTG A;  2BA0 A;  1KHM A;  4JVH A;  2OPU A;  5C0X G;  2NN6 G;  2Z0S A;  3U1K A;  2MJH A;  4JVY A;  2JZX A;  2JE6 I;  2BL5 A;  4NBQ A;  4AM3 A;  1ZZJ A;  2CTJ A;  4WAN A;  1J4W A;  2HH2 A;  5K36 G;  2OPV A;  2CTE A;  2CPQ A;  2AXY A;  2CTF A;  2JA9 A;  4IFD G;  2QND A;  2CTM A;  2JEB I;  2ANN A;  1X4M A;  2FMR A;  4QMF B;  4BA1 I;  2PQU A;  2ANR A;  2DGR A;  1J5K A;  1TUA A;  1VIH A;  2YQR A;  2CTK A;  4AIM A;  2P2R A;  1WE8 A;  2CTL A;  2JEA I;  1VIG A;  1DTJ A;  1EC6 A;  1ZZK A;  4WAL A;  3AEV B;  3V69 A;  2E3U A;  2PY9 A;  4BA2 I;  1WVN A;  1ZZI A;  1X4N A;  3L7Z C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...