2D9IA

Solution structure of the smr domain of nedd4-binding protein 2
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
96
structure length
96
Chain Sequence
GSSGSSGQNVLDLHGLHVDEALEHLMRVLEKKTEEFKQNGGKPYLSVITGRGNHSQGGVARIKPAVIKYLISHSFRFSEIKPGCLKVMLKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Apoptosis
molecule keywords NEDD4-binding protein 2
publication title Solution structure of the SMR domain of NEDD4-binding protein 2
rcsb
source organism Homo sapiens
total genus 21
structure length 96
sequence length 96
ec nomenclature ec 3.-.-.-:
pdb deposition date 2005-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01713 Smr Smr domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.110 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 2d9iA00
3QD7X 3FAUA 4OD6A 2D9IA 2VKCA 2ZQEA 4OCHA
chains in the Genus database with same CATH superfamily
1X9ZA 1HNXH 4NXMH 2UUCH 4NXNH 1XNRH 4B3SH 4DR1H 4JI5H 4OO1G 4DUYH 3J80W 3U1KA 4B8TA 2JVZA 3NCVA 2A1SA 4LFCH 1N32H 1WHRA 2LF0A 3KDKA 3SB1A 4BA1I 5BR8H 1N36H 2CPQA 1N34H 2UUAH 5LMUH 1X0AA 2AXYA 1XMOH 4JI4H 1FJGH 4DR5H 2UXCH 2JEBI 4JV5H 4PDBA 2UU9H 4X62H 1J4WA 4JI0H 3GR5A 4DR3H 2LTLA 1J5EH 2JEAI 5LMNH 4OD6A 4G08A 3AEVB 2UXBH 3J7AK 4IFDG 1DT4A 1IBKH 1HNWH 1XRHA 2NN6G 4NZTM 3T1YH 2HHHH 4GKKH 3GABA 3EZJA 2CTLA 2D9IA 4K0KH 4X66H 1X4NA 3T1HH 2CWHA 2HH2A 4FJSA 2PY9A 4NZRM 4DV2H 4AIMA 3J81W 4FJUA 3OTOH 4YHHH 1HR0H 1WTJA 2ZQEA 4JVHA 4GKJH 2HH3A 4JVYA 4H8AA 4DV1H 4LFBH 1N33H 4JI1H 5K36G 2CTMA 2G8YA 1IBMH 4WALA 1J5KA 4YY3H 4B3MH 1ZZIA 1NXUA 1ODHA 2CPMA 4DUZH 2LRRA 2OPVA 2CTEA 2Y3MA 1Z2IA 2CWFA 4B8CD 2ZM6H 1IBLH 4OX9H 3VKEA 1KHMA 5IWAH 1V9NA 2E3UA 4QMFB 2VQEH 1UG8A 2FFMA 4B3RH 5IT9W 4EC5A 3GKUA 4AQYH 2JZXA 2UUBH 1PQXA 1ZZJA 5JEAG 4LF8H 1I94H 4LF6H 2ANNA 3I0PA 1MSZA 2LTMA 4JI2H 4E9JA 4X64H 2JE6I 3OETA 2VQFH 4DV5H 3KDGA 2ANRA 4BA2I 5C0XG 5DT9A 2PQUA 4DV4H 4DR4H 1AN7A 1VIHA 2O4CA 4DR7H 2CTKA 1K1GA 2OPUA 1TUAA 3RF2A 3OSSD 4LIJA 2JA9A 2CTJA 4LF4H 3L7ZC 4LF7H 1S03G 4KHPH 2F4VH 2FMRA 2P2RA 4DV7H 2CTFA 4DR6H 1ZZKA 2PT7G 2YQRA 2X06A 3QD7X 3V69A 4B3TH 4LF9H 3UOEA 4AM3A 2UXDH 2M6QA 5A2QW 1EC6A 4WANA 4OCHA 2QNDA 2BL5A 2DGRA 2BA0A 3JAMW 1VBIA 4JI6H 1ZTGA 1I6UA 4X65H 2MJHA 2Z0SA 4JYAH 1F0XA 1FKAH 4DV0H 1XMQH 3FAUA 2K1HA 5LL6b 1X4MA 1WVNA 4JI8H 1XNQH 1DTJA 4JI7H 2FPHX 4NBQA 1V8CA 4DV6H 1HNZH 4JI3H 4LFAH 1SEIA 1S20A 5FLXW 2E5LH 1WE8A 4DR2H 2VKCA 4LF5H 2M8WA 4DV3H 1VIGA
chains in the Genus database with same CATH topology
1X9ZA 1HNXH 4NXMH 2UUCH 4NXNH 1XNRH 4B3SH 4DR1H 4JI5H 4DUYH 3J80W 3NCVA 4LFCH 1N32H 3KDKA 2LF0A 1N36H 3SB1A 5BR8H 1N34H 2UUAH 5LMUH 1XMOH 4JI4H 1FJGH 4DR5H 2UXCH 4JV5H 4PDBA 2UU9H 4X62H 4JI0H 3GR5A 4DR3H 1J5EH 5LMNH 4OD6A 4G08A 2UXBH 3J7AK 1IBKH 1HNWH 4NZTM 3T1YH 2HHHH 4GKKH 3GABA 3EZJA 2D9IA 4K0KH 4X66H 3T1HH 4NZRM 4DV2H 3J81W 3OTOH 4YHHH 1HR0H 2ZQEA 4GKJH 4DV1H 4LFBH 1N33H 4JI1H 1IBMH 4YY3H 4B3MH 1ODHA 4DUZH 2Y3MA 4B8CD 1IBLH 2ZM6H 4OX9H 2VQEH 5IT9W 4B3RH 4EC5A 4AQYH 2UUBH 4LF8H 1I94H 4LF6H 4X64H 4JI2H 4E9JA 3OETA 2VQFH 4DV5H 3KDGA 5DT9A 4DV4H 4DR4H 1AN7A 2O4CA 4DR7H 3RF2A 3OSSD 4LF4H 1S03G 4LF7H 4KHPH 2F4VH 4DV7H 4DR6H 2PT7G 3QD7X 4B3TH 4LF9H 2UXDH 5A2QW 4OCHA 3JAMW 4JI6H 1I6UA 4X65H 4JYAH 1F0XA 1FKAH 4DV0H 1XMQH 3FAUA 5LL6b 1XNQH 4JI8H 4JI7H 2FPHX 4DV6H 1HNZH 4JI3H 4LFAH 1SEIA 5FLXW 2E5LH 4DR2H 2VKCA 4LF5H 4DV3H 5IWAH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QD7 X;  3FAU A;  4OD6 A;  2D9I A;  2VKC A;  2ZQE A;  4OCH A; 
#chains in the Genus database with same CATH topology
 1X9Z A;  1HNX H;  4NXM H;  2UUC H;  4NXN H;  1XNR H;  4B3S H;  4DR1 H;  4JI5 H;  4OO1 G;  4DUY H;  3J80 W;  3U1K A;  4B8T A;  2JVZ A;  3NCV A;  2A1S A;  4LFC H;  1N32 H;  1WHR A;  2LF0 A;  3KDK A;  3SB1 A;  4BA1 I;  5BR8 H;  1N36 H;  2CPQ A;  1N34 H;  2UUA H;  5LMU H;  1X0A A;  2AXY A;  1XMO H;  4JI4 H;  1FJG H;  4DR5 H;  2UXC H;  2JEB I;  4JV5 H;  4PDB A;  2UU9 H;  4X62 H;  1J4W A;  4JI0 H;  3GR5 A;  4DR3 H;  2LTL A;  1J5E H;  2JEA I;  5LMN H;  4OD6 A;  4G08 A;  3AEV B;  2UXB H;  3J7A K;  4IFD G;  1DT4 A;  1IBK H;  1HNW H;  1XRH A;  2NN6 G;  4NZT M;  3T1Y H;  2HHH H;  4GKK H;  3GAB A;  3EZJ A;  2CTL A;  2D9I A;  4K0K H;  4X66 H;  1X4N A;  3T1H H;  2CWH A;  2HH2 A;  4FJS A;  2PY9 A;  4NZR M;  4DV2 H;  4AIM A;  3J81 W;  4FJU A;  3OTO H;  4YHH H;  1HR0 H;  1WTJ A;  2ZQE A;  4JVH A;  4GKJ H;  2HH3 A;  4JVY A;  4H8A A;  4DV1 H;  4LFB H;  1N33 H;  4JI1 H;  5K36 G;  2CTM A;  2G8Y A;  1IBM H;  4WAL A;  1J5K A;  4YY3 H;  4B3M H;  1ZZI A;  1NXU A;  1ODH A;  2CPM A;  4DUZ H;  2LRR A;  2OPV A;  2CTE A;  2Y3M A;  1Z2I A;  2CWF A;  4B8C D;  2ZM6 H;  1IBL H;  4OX9 H;  3VKE A;  1KHM A;  5IWA H;  1V9N A;  2E3U A;  4QMF B;  2VQE H;  1UG8 A;  2FFM A;  4B3R H;  5IT9 W;  4EC5 A;  3GKU A;  4AQY H;  2JZX A;  2UUB H;  1PQX A;  1ZZJ A;  5JEA G;  4LF8 H;  1I94 H;  4LF6 H;  2ANN A;  3I0P A;  1MSZ A;  2LTM A;  4JI2 H;  4E9J A;  4X64 H;  2JE6 I;  3OET A;  2VQF H;  4DV5 H;  3KDG A;  2ANR A;  4BA2 I;  5C0X G;  5DT9 A;  2PQU A;  4DV4 H;  4DR4 H;  1AN7 A;  1VIH A;  2O4C A;  4DR7 H;  2CTK A;  1K1G A;  2OPU A;  1TUA A;  3RF2 A;  3OSS D;  4LIJ A;  2JA9 A;  2CTJ A;  4LF4 H;  3L7Z C;  4LF7 H;  1S03 G;  4KHP H;  2F4V H;  2FMR A;  2P2R A;  4DV7 H;  2CTF A;  4DR6 H;  1ZZK A;  2PT7 G;  2YQR A;  2X06 A;  3QD7 X;  3V69 A;  4B3T H;  4LF9 H;  3UOE A;  4AM3 A;  2UXD H;  2M6Q A;  5A2Q W;  1EC6 A;  4WAN A;  4OCH A;  2QND A;  2BL5 A;  2DGR A;  2BA0 A;  3JAM W;  1VBI A;  4JI6 H;  1ZTG A;  1I6U A;  4X65 H;  2MJH A;  2Z0S A;  4JYA H;  1F0X A;  1FKA H;  4DV0 H;  1XMQ H;  3FAU A;  2K1H A;  5LL6 b;  1X4M A;  1WVN A;  4JI8 H;  1XNQ H;  1DTJ A;  4JI7 H;  2FPH X;  4NBQ A;  1V8C A;  4DV6 H;  1HNZ H;  4JI3 H;  4LFA H;  1SEI A;  1S20 A;  5FLX W;  2E5L H;  1WE8 A;  4DR2 H;  2VKC A;  4LF5 H;  2M8W A;  4DV3 H;  1VIG A; 
#chains in the Genus database with same CATH homology
 1X9Z A;  1HNX H;  4NXM H;  2UUC H;  4NXN H;  1XNR H;  4B3S H;  4DR1 H;  4JI5 H;  4DUY H;  3J80 W;  3NCV A;  4LFC H;  1N32 H;  3KDK A;  2LF0 A;  1N36 H;  3SB1 A;  5BR8 H;  1N34 H;  2UUA H;  5LMU H;  1XMO H;  4JI4 H;  1FJG H;  4DR5 H;  2UXC H;  4JV5 H;  4PDB A;  2UU9 H;  4X62 H;  4JI0 H;  3GR5 A;  4DR3 H;  1J5E H;  5LMN H;  4OD6 A;  4G08 A;  2UXB H;  3J7A K;  1IBK H;  1HNW H;  4NZT M;  3T1Y H;  2HHH H;  4GKK H;  3GAB A;  3EZJ A;  2D9I A;  4K0K H;  4X66 H;  3T1H H;  4NZR M;  4DV2 H;  3J81 W;  3OTO H;  4YHH H;  1HR0 H;  2ZQE A;  4GKJ H;  4DV1 H;  4LFB H;  1N33 H;  4JI1 H;  1IBM H;  4YY3 H;  4B3M H;  1ODH A;  4DUZ H;  2Y3M A;  4B8C D;  1IBL H;  2ZM6 H;  4OX9 H;  2VQE H;  5IT9 W;  4B3R H;  4EC5 A;  4AQY H;  2UUB H;  4LF8 H;  1I94 H;  4LF6 H;  4X64 H;  4JI2 H;  4E9J A;  3OET A;  2VQF H;  4DV5 H;  3KDG A;  5DT9 A;  4DV4 H;  4DR4 H;  1AN7 A;  2O4C A;  4DR7 H;  3RF2 A;  3OSS D;  4LF4 H;  1S03 G;  4LF7 H;  4KHP H;  2F4V H;  4DV7 H;  4DR6 H;  2PT7 G;  3QD7 X;  4B3T H;  4LF9 H;  2UXD H;  5A2Q W;  4OCH A;  3JAM W;  4JI6 H;  1I6U A;  4X65 H;  4JYA H;  1F0X A;  1FKA H;  4DV0 H;  1XMQ H;  3FAU A;  5LL6 b;  1XNQ H;  4JI8 H;  4JI7 H;  2FPH X;  4DV6 H;  1HNZ H;  4JI3 H;  4LFA H;  1SEI A;  5FLX W;  2E5L H;  4DR2 H;  2VKC A;  4LF5 H;  4DV3 H;  5IWA H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...