2D9IA

Solution structure of the smr domain of nedd4-binding protein 2
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
96
structure length
96
Chain Sequence
GSSGSSGQNVLDLHGLHVDEALEHLMRVLEKKTEEFKQNGGKPYLSVITGRGNHSQGGVARIKPAVIKYLISHSFRFSEIKPGCLKVMLKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NEDD4-binding protein 2
publication title Solution structure of the SMR domain of NEDD4-binding protein 2
rcsb
source organism Homo sapiens
molecule tags Apoptosis
total genus 21
structure length 96
sequence length 96
ec nomenclature ec 3.-.-.-:
pdb deposition date 2005-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01713 Smr Smr domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.110 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 2d9iA00
2VKCA 2D9IA 4OCHA 2ZQEA 4OD6A 3QD7X 3FAUA
chains in the Genus database with same CATH superfamily
3JAMW 1J5EH 2FMRA 1VIGA 3J80W 3J81W 2PT7G 2M8WA 4JI7H 5LL6b 1I94H 4JI5H 4LF5H 2HHHH 4DV6H 3L7ZC 2ANNA 1S20A 1X9ZA 3GABA 1V9NA 2JEBI 3EZJA 4DUYH 3T1YH 2AXYA 4OX9H 2JVZA 5FLXW 3RF2A 5C0XG 5LMNH 4LFBH 4JI4H 1S03G 4DV1H 2UU9H 3GKUA 1I6UA 4B3SH 4E9JA 3FAUA 1ZZKA 2K1HA 1N34H 1DTJA 1FJGH 1IBMH 2CWHA 4DR5H 4X62H 1SEIA 2LTMA 4OO1G 2PQUA 4DUZH 4DR7H 1J5KA 4JI1H 5IWAH 1X4NA 4KHPH 2CTLA 1XMQH 2BA0A 4AQYH 4K0KH 4LF6H 2ZM6H 4PDBA 3KDKA 4QMFB 1ODHA 2JEAI 1N32H 2DGRA 2VQFH 3OSSD 1KHMA 2CPMA 2HH2A 4YHHH 2FFMA 2NN6G 4EC5A 2Z0SA 3I0PA 2UUCH 4DV5H 1HNWH 4B3TH 4FJUA 4X66H 2ZQEA 2ANRA 5A2QW 1MSZA 1FKAH 2E3UA 4NZRM 4DR1H 4B3RH 1NXUA 1XRHA 2PY9A 2D9IA 3UOEA 4OCHA 4GKKH 1DT4A 2CTKA 3VKEA 1UG8A 2HH3A 2CTFA 2Y3MA 3V69A 5K36G 3OETA 5JEAG 4X65H 1EC6A 1IBKH 3U1KA 1IBLH 2G8YA 4JVYA 1N33H 3SB1A 2LTLA 2VQEH 4JI8H 4JYAH 2UXCH 2LRRA 1WHRA 2UUAH 4LIJA 2OPUA 4LF7H 5DT9A 4LF9H 4BA2I 1AN7A 1WVNA 2A1SA 2CWFA 1WTJA 4LFAH 1ZTGA 4NXNH 4LFCH 4H8AA 2UXDH 3KDGA 1VIHA 1X0AA 4YY3H 5BR8H 2FPHX 2JA9A 2OPVA 4G08A 4BA1I 4B8CD 1HNXH 4LF4H 4DR6H 3OTOH 4B8TA 1TUAA 5IT9W 1XNRH 2JE6I 2VKCA 2X06A 4NXMH 2BL5A 2YQRA 1Z2IA 4AIMA 4JI3H 2F4VH 1N36H 4DV7H 1PQXA 1ZZJA 4NBQA 2UUBH 2LF0A 4DR2H 1F0XA 4IFDG 4WALA 1X4MA 2CPQA 1WE8A 4DR3H 2MJHA 3AEVB 4JI6H 4FJSA 4LF8H 4DV2H 4DV4H 2UXBH 3GR5A 1ZZIA 4GKJH 3NCVA 1J4WA 4DR4H 2JZXA 4NZTM 1VBIA 5LMUH 3J7AK 4X64H 1HR0H 2CTJA 1XMOH 1HNZH 4JV5H 2P2RA 2QNDA 4JI0H 4AM3A 2CTMA 2CTEA 2E5LH 1V8CA 4OD6A 4DV0H 4JVHA 1K1GA 1XNQH 4B3MH 4WANA 4DV3H 3T1HH 2O4CA 4JI2H 3QD7X 2M6QA
chains in the Genus database with same CATH topology
3JAMW 1J5EH 3J80W 3J81W 2PT7G 4JI7H 5LL6b 1I94H 4JI5H 4LF5H 2HHHH 4DV6H 3GABA 1X9ZA 4OX9H 4DUYH 3T1YH 3EZJA 5FLXW 5LMNH 4LFBH 4JI4H 1S03G 4DV1H 2UU9H 1I6UA 4B3SH 4E9JA 3FAUA 1N34H 1FJGH 1IBMH 4DR5H 4X62H 1SEIA 4DUZH 4DR7H 4JI1H 5IWAH 4KHPH 1XMQH 4AQYH 4K0KH 4PDBA 4LF6H 2ZM6H 3KDKA 1ODHA 1N32H 2VQFH 3OSSD 4YHHH 4EC5A 2UUCH 4DV5H 1HNWH 4B3TH 4X66H 2ZQEA 5A2QW 1FKAH 4B3RH 4NZRM 4DR1H 2D9IA 4OCHA 4GKKH 2Y3MA 3OETA 4X65H 1IBKH 1IBLH 1N33H 3SB1A 4JYAH 2VQEH 4JI8H 2UXCH 2UUAH 4LF7H 5DT9A 4LF9H 1AN7A 4LFAH 4NXNH 4LFCH 2UXDH 3KDGA 4YY3H 5BR8H 2FPHX 4G08A 1HNXH 4LF4H 4DR6H 3OTOH 5IT9W 1XNRH 4NXMH 2VKCA 4JI3H 2F4VH 1N36H 4JI2H 4DV7H 2UUBH 2LF0A 4DR2H 1F0XA 4DR3H 4JI6H 4LF8H 4DV2H 4DV4H 2UXBH 3GR5A 4GKJH 3NCVA 4DR4H 4NZTM 5LMUH 3J7AK 4X64H 1HR0H 1XMOH 1HNZH 4JV5H 4JI0H 2E5LH 4OD6A 4DV0H 2O4CA 1XNQH 4B3MH 4DV3H 3T1HH 3RF2A 4B8CD 3QD7X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VKC A;  2D9I A;  4OCH A;  2ZQE A;  4OD6 A;  3QD7 X;  3FAU A; 
#chains in the Genus database with same CATH topology
 3JAM W;  1J5E H;  2FMR A;  1VIG A;  3J80 W;  3J81 W;  2PT7 G;  2M8W A;  4JI7 H;  5LL6 b;  1I94 H;  4JI5 H;  4LF5 H;  2HHH H;  4DV6 H;  3L7Z C;  2ANN A;  1S20 A;  1X9Z A;  3GAB A;  1V9N A;  2JEB I;  3EZJ A;  4DUY H;  3T1Y H;  2AXY A;  4OX9 H;  2JVZ A;  5FLX W;  3RF2 A;  5C0X G;  5LMN H;  4LFB H;  4JI4 H;  1S03 G;  4DV1 H;  2UU9 H;  3GKU A;  1I6U A;  4B3S H;  4E9J A;  3FAU A;  1ZZK A;  2K1H A;  1N34 H;  1DTJ A;  1FJG H;  1IBM H;  2CWH A;  4DR5 H;  4X62 H;  1SEI A;  2LTM A;  4OO1 G;  2PQU A;  4DUZ H;  4DR7 H;  1J5K A;  4JI1 H;  5IWA H;  1X4N A;  4KHP H;  2CTL A;  1XMQ H;  2BA0 A;  4AQY H;  4K0K H;  4LF6 H;  2ZM6 H;  4PDB A;  3KDK A;  4QMF B;  1ODH A;  2JEA I;  1N32 H;  2DGR A;  2VQF H;  3OSS D;  1KHM A;  2CPM A;  2HH2 A;  4YHH H;  2FFM A;  2NN6 G;  4EC5 A;  2Z0S A;  3I0P A;  2UUC H;  4DV5 H;  1HNW H;  4B3T H;  4FJU A;  4X66 H;  2ZQE A;  2ANR A;  5A2Q W;  1MSZ A;  1FKA H;  2E3U A;  4NZR M;  4DR1 H;  4B3R H;  1NXU A;  1XRH A;  2PY9 A;  2D9I A;  3UOE A;  4OCH A;  4GKK H;  1DT4 A;  2CTK A;  3VKE A;  1UG8 A;  2HH3 A;  2CTF A;  2Y3M A;  3V69 A;  5K36 G;  3OET A;  5JEA G;  4X65 H;  1EC6 A;  1IBK H;  3U1K A;  1IBL H;  2G8Y A;  4JVY A;  1N33 H;  3SB1 A;  2LTL A;  2VQE H;  4JI8 H;  4JYA H;  2UXC H;  2LRR A;  1WHR A;  2UUA H;  4LIJ A;  2OPU A;  4LF7 H;  5DT9 A;  4LF9 H;  4BA2 I;  1AN7 A;  1WVN A;  2A1S A;  2CWF A;  1WTJ A;  4LFA H;  1ZTG A;  4NXN H;  4LFC H;  4H8A A;  2UXD H;  3KDG A;  1VIH A;  1X0A A;  4YY3 H;  5BR8 H;  2FPH X;  2JA9 A;  2OPV A;  4G08 A;  4BA1 I;  4B8C D;  1HNX H;  4LF4 H;  4DR6 H;  3OTO H;  4B8T A;  1TUA A;  5IT9 W;  1XNR H;  2JE6 I;  2VKC A;  2X06 A;  4NXM H;  2BL5 A;  2YQR A;  1Z2I A;  4AIM A;  4JI3 H;  2F4V H;  1N36 H;  4DV7 H;  1PQX A;  1ZZJ A;  4NBQ A;  2UUB H;  2LF0 A;  4DR2 H;  1F0X A;  4IFD G;  4WAL A;  1X4M A;  2CPQ A;  1WE8 A;  4DR3 H;  2MJH A;  3AEV B;  4JI6 H;  4FJS A;  4LF8 H;  4DV2 H;  4DV4 H;  2UXB H;  3GR5 A;  1ZZI A;  4GKJ H;  3NCV A;  1J4W A;  4DR4 H;  2JZX A;  4NZT M;  1VBI A;  5LMU H;  3J7A K;  4X64 H;  1HR0 H;  2CTJ A;  1XMO H;  1HNZ H;  4JV5 H;  2P2R A;  2QND A;  4JI0 H;  4AM3 A;  2CTM A;  2CTE A;  2E5L H;  1V8C A;  4OD6 A;  4DV0 H;  4JVH A;  1K1G A;  1XNQ H;  4B3M H;  4WAN A;  4DV3 H;  3T1H H;  2O4C A;  4JI2 H;  3QD7 X;  2M6Q A; 
#chains in the Genus database with same CATH homology
 3JAM W;  1J5E H;  3J80 W;  3J81 W;  2PT7 G;  4JI7 H;  5LL6 b;  1I94 H;  4JI5 H;  4LF5 H;  2HHH H;  4DV6 H;  3GAB A;  1X9Z A;  4OX9 H;  4DUY H;  3T1Y H;  3EZJ A;  5FLX W;  5LMN H;  4LFB H;  4JI4 H;  1S03 G;  4DV1 H;  2UU9 H;  1I6U A;  4B3S H;  4E9J A;  3FAU A;  1N34 H;  1FJG H;  1IBM H;  4DR5 H;  4X62 H;  1SEI A;  4DUZ H;  4DR7 H;  4JI1 H;  5IWA H;  4KHP H;  1XMQ H;  4AQY H;  4K0K H;  4PDB A;  4LF6 H;  2ZM6 H;  3KDK A;  1ODH A;  1N32 H;  2VQF H;  3OSS D;  4YHH H;  4EC5 A;  2UUC H;  4DV5 H;  1HNW H;  4B3T H;  4X66 H;  2ZQE A;  5A2Q W;  1FKA H;  4B3R H;  4NZR M;  4DR1 H;  2D9I A;  4OCH A;  4GKK H;  2Y3M A;  3OET A;  4X65 H;  1IBK H;  1IBL H;  1N33 H;  3SB1 A;  4JYA H;  2VQE H;  4JI8 H;  2UXC H;  2UUA H;  4LF7 H;  5DT9 A;  4LF9 H;  1AN7 A;  4LFA H;  4NXN H;  4LFC H;  2UXD H;  3KDG A;  4YY3 H;  5BR8 H;  2FPH X;  4G08 A;  1HNX H;  4LF4 H;  4DR6 H;  3OTO H;  5IT9 W;  1XNR H;  4NXM H;  2VKC A;  4JI3 H;  2F4V H;  1N36 H;  4JI2 H;  4DV7 H;  2UUB H;  2LF0 A;  4DR2 H;  1F0X A;  4DR3 H;  4JI6 H;  4LF8 H;  4DV2 H;  4DV4 H;  2UXB H;  3GR5 A;  4GKJ H;  3NCV A;  4DR4 H;  4NZT M;  5LMU H;  3J7A K;  4X64 H;  1HR0 H;  1XMO H;  1HNZ H;  4JV5 H;  4JI0 H;  2E5L H;  4OD6 A;  4DV0 H;  2O4C A;  1XNQ H;  4B3M H;  4DV3 H;  3T1H H;  3RF2 A;  4B8C D;  3QD7 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...