2D9IA

Solution structure of the smr domain of nedd4-binding protein 2
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
96
structure length
96
Chain Sequence
GSSGSSGQNVLDLHGLHVDEALEHLMRVLEKKTEEFKQNGGKPYLSVITGRGNHSQGGVARIKPAVIKYLISHSFRFSEIKPGCLKVMLKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NEDD4-binding protein 2
publication title Solution structure of the SMR domain of NEDD4-binding protein 2
rcsb
source organism Homo sapiens
molecule tags Apoptosis
total genus 21
structure length 96
sequence length 96
ec nomenclature ec 3.-.-.-:
pdb deposition date 2005-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01713 Smr Smr domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.110 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 2d9iA00
3FAUA 4OCHA 2D9IA 3QD7X 2ZQEA 4OD6A 2VKCA
chains in the Genus database with same CATH superfamily
3GKUA 2G8YA 4JI3H 3JAMW 1K1GA 3T1YH 1J5EH 3AEVB 4AQYH 4GKKH 1WE8A 1XNRH 1ZZJA 2UUBH 4NZRM 4OD6A 4B3MH 1IBKH 1X0AA 2LTMA 3FAUA 3V69A 4FJSA 2PT7G 1J5KA 2E5LH 2ZQEA 2JVZA 2FFMA 2CPQA 4DV3H 1X4NA 3SB1A 2FPHX 2VKCA 2BA0A 2YQRA 2AXYA 2UUAH 4X62H 2LF0A 4LFAH 4LFBH 1I6UA 2QNDA 4X66H 4OO1G 2OPVA 1V8CA 2FMRA 5JEAG 2PQUA 3J80W 4NBQA 2LRRA 1IBLH 3VKEA 4LF4H 4DR5H 4E9JA 4WALA 3EZJA 4LF6H 4B3SH 1X4MA 2CTKA 1HR0H 2Z0SA 1KHMA 3OSSD 4JI0H 5LMUH 1HNWH 1AN7A 4B3TH 4IFDG 4KHPH 2UXCH 4JI7H 3I0PA 2A1SA 4AIMA 2JEBI 2CWFA 4DR6H 3UOEA 4JV5H 4X65H 4DV2H 1VIGA 4EC5A 5BR8H 2UXBH 2MJHA 3KDGA 2X06A 1XMOH 2M8WA 4X64H 1SEIA 4JVYA 3U1KA 3T1HH 1FJGH 4JYAH 3J81W 2CTEA 2HH3A 4WANA 3GR5A 4DUZH 2JE6I 1VIHA 4JI4H 2HH2A 1HNZH 4LFCH 2PY9A 4G08A 4B8CD 1ZZIA 2D9IA 5A2QW 4DV6H 1J4WA 2UXDH 2VQEH 4DV4H 2ZM6H 2CTLA 1WHRA 1XRHA 4JI8H 1X9ZA 2CTFA 1XMQH 1VBIA 4BA2I 4JI2H 1UG8A 5IWAH 3OETA 5FLXW 4OCHA 5LMNH 3J7AK 4NZTM 4DV5H 4H8AA 4QMFB 2BL5A 2CTMA 4DR1H 1MSZA 3KDKA 2VQFH 1N34H 1S20A 1FKAH 4JI5H 1S03G 4B8TA 3GABA 2M6QA 4DV1H 4B3RH 2CWHA 4LIJA 1N36H 2K1HA 2UU9H 5IT9W 2HHHH 5K36G 4JI1H 1XNQH 4BA1I 1I94H 4K0KH 1ZTGA 5C0XG 4DR3H 4LF9H 2UUCH 2F4VH 4FJUA 1V9NA 1WVNA 4OX9H 5LL6b 4JVHA 2O4CA 2P2RA 2NN6G 3OTOH 4LF8H 4DUYH 4AM3A 1NXUA 2LTLA 2CTJA 5DT9A 4JI6H 4LF7H 1F0XA 4PDBA 1ODHA 2JZXA 4NXMH 4YY3H 1WTJA 2ANNA 2DGRA 1Z2IA 2OPUA 4DR4H 1TUAA 4DV0H 3RF2A 2Y3MA 3QD7X 2CPMA 4DV7H 4LF5H 2JEAI 3L7ZC 4YHHH 1N33H 1EC6A 3NCVA 2ANRA 1ZZKA 4GKJH 2E3UA 4NXNH 2JA9A 1IBMH 4DR2H 1PQXA 1HNXH 4DR7H 1N32H 1DT4A 1DTJA
chains in the Genus database with same CATH topology
4JI3H 3JAMW 4GKKH 3T1YH 1J5EH 4AQYH 1XNRH 2UUBH 4NZRM 4OD6A 1IBKH 3FAUA 2E5LH 2PT7G 2ZQEA 4DV3H 3SB1A 4B3MH 2FPHX 2VKCA 2UUAH 1I6UA 4X62H 2LF0A 4LFAH 4LFBH 4X66H 3J80W 1IBLH 4LF4H 4DR5H 4E9JA 3EZJA 4LF6H 4B3SH 1HR0H 3OSSD 4JI0H 5LMUH 1HNWH 1AN7A 4B3TH 4KHPH 2UXCH 4DR6H 4JV5H 4X65H 4DV2H 4EC5A 5BR8H 2UXBH 3KDGA 1XMOH 4X64H 1SEIA 3T1HH 1FJGH 4JYAH 3GR5A 4DUZH 4JI4H 4LFCH 1HNZH 4G08A 4B8CD 2D9IA 5A2QW 4DV6H 2UXDH 4DV4H 2VQEH 2ZM6H 4JI8H 1X9ZA 1XMQH 4JI2H 5IWAH 3OETA 5FLXW 4OCHA 5LMNH 3J7AK 4NZTM 4DV5H 4JI7H 4DR1H 3KDKA 2VQFH 1N34H 4JI5H 1FKAH 1S03G 3GABA 4DV1H 4B3RH 1N36H 2UU9H 5IT9W 2HHHH 4JI1H 1XNQH 1I94H 4K0KH 4DR3H 4LF9H 2UUCH 2F4VH 4OX9H 5LL6b 2O4CA 3OTOH 4LF8H 4DUYH 4LF7H 4JI6H 4PDBA 5DT9A 1F0XA 1ODHA 4NXMH 4YY3H 4DR4H 4DV0H 3RF2A 2Y3MA 3QD7X 4DV7H 4LF5H 4YHHH 1N33H 3NCVA 4GKJH 4NXNH 1IBMH 4DR2H 1HNXH 4DR7H 1N32H 3J81W
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FAU A;  4OCH A;  2D9I A;  3QD7 X;  2ZQE A;  4OD6 A;  2VKC A; 
#chains in the Genus database with same CATH topology
 3GKU A;  2G8Y A;  4JI3 H;  3JAM W;  1K1G A;  3T1Y H;  1J5E H;  3AEV B;  4AQY H;  4GKK H;  1WE8 A;  1XNR H;  1ZZJ A;  2UUB H;  4NZR M;  4OD6 A;  4B3M H;  1IBK H;  1X0A A;  2LTM A;  3FAU A;  3V69 A;  4FJS A;  2PT7 G;  1J5K A;  2E5L H;  2ZQE A;  2JVZ A;  2FFM A;  2CPQ A;  4DV3 H;  1X4N A;  3SB1 A;  2FPH X;  2VKC A;  2BA0 A;  2YQR A;  2AXY A;  2UUA H;  4X62 H;  2LF0 A;  4LFA H;  4LFB H;  1I6U A;  2QND A;  4X66 H;  4OO1 G;  2OPV A;  1V8C A;  2FMR A;  5JEA G;  2PQU A;  3J80 W;  4NBQ A;  2LRR A;  1IBL H;  3VKE A;  4LF4 H;  4DR5 H;  4E9J A;  4WAL A;  3EZJ A;  4LF6 H;  4B3S H;  1X4M A;  2CTK A;  1HR0 H;  2Z0S A;  1KHM A;  3OSS D;  4JI0 H;  5LMU H;  1HNW H;  1AN7 A;  4B3T H;  4IFD G;  4KHP H;  2UXC H;  4JI7 H;  3I0P A;  2A1S A;  4AIM A;  2JEB I;  2CWF A;  4DR6 H;  3UOE A;  4JV5 H;  4X65 H;  4DV2 H;  1VIG A;  4EC5 A;  5BR8 H;  2UXB H;  2MJH A;  3KDG A;  2X06 A;  1XMO H;  2M8W A;  4X64 H;  1SEI A;  4JVY A;  3U1K A;  3T1H H;  1FJG H;  4JYA H;  3J81 W;  2CTE A;  2HH3 A;  4WAN A;  3GR5 A;  4DUZ H;  2JE6 I;  1VIH A;  4JI4 H;  2HH2 A;  1HNZ H;  4LFC H;  2PY9 A;  4G08 A;  4B8C D;  1ZZI A;  2D9I A;  5A2Q W;  4DV6 H;  1J4W A;  2UXD H;  2VQE H;  4DV4 H;  2ZM6 H;  2CTL A;  1WHR A;  1XRH A;  4JI8 H;  1X9Z A;  2CTF A;  1XMQ H;  1VBI A;  4BA2 I;  4JI2 H;  1UG8 A;  5IWA H;  3OET A;  5FLX W;  4OCH A;  5LMN H;  3J7A K;  4NZT M;  4DV5 H;  4H8A A;  4QMF B;  2BL5 A;  2CTM A;  4DR1 H;  1MSZ A;  3KDK A;  2VQF H;  1N34 H;  1S20 A;  1FKA H;  4JI5 H;  1S03 G;  4B8T A;  3GAB A;  2M6Q A;  4DV1 H;  4B3R H;  2CWH A;  4LIJ A;  1N36 H;  2K1H A;  2UU9 H;  5IT9 W;  2HHH H;  5K36 G;  4JI1 H;  1XNQ H;  4BA1 I;  1I94 H;  4K0K H;  1ZTG A;  5C0X G;  4DR3 H;  4LF9 H;  2UUC H;  2F4V H;  4FJU A;  1V9N A;  1WVN A;  4OX9 H;  5LL6 b;  4JVH A;  2O4C A;  2P2R A;  2NN6 G;  3OTO H;  4LF8 H;  4DUY H;  4AM3 A;  1NXU A;  2LTL A;  2CTJ A;  5DT9 A;  4JI6 H;  4LF7 H;  1F0X A;  4PDB A;  1ODH A;  2JZX A;  4NXM H;  4YY3 H;  1WTJ A;  2ANN A;  2DGR A;  1Z2I A;  2OPU A;  4DR4 H;  1TUA A;  4DV0 H;  3RF2 A;  2Y3M A;  3QD7 X;  2CPM A;  4DV7 H;  4LF5 H;  2JEA I;  3L7Z C;  4YHH H;  1N33 H;  1EC6 A;  3NCV A;  2ANR A;  1ZZK A;  4GKJ H;  2E3U A;  4NXN H;  2JA9 A;  1IBM H;  4DR2 H;  1PQX A;  1HNX H;  4DR7 H;  1N32 H;  1DT4 A;  1DTJ A; 
#chains in the Genus database with same CATH homology
 4JI3 H;  3JAM W;  4GKK H;  3T1Y H;  1J5E H;  4AQY H;  1XNR H;  2UUB H;  4NZR M;  4OD6 A;  1IBK H;  3FAU A;  2E5L H;  2PT7 G;  2ZQE A;  4DV3 H;  3SB1 A;  4B3M H;  2FPH X;  2VKC A;  2UUA H;  1I6U A;  4X62 H;  2LF0 A;  4LFA H;  4LFB H;  4X66 H;  3J80 W;  1IBL H;  4LF4 H;  4DR5 H;  4E9J A;  3EZJ A;  4LF6 H;  4B3S H;  1HR0 H;  3OSS D;  4JI0 H;  5LMU H;  1HNW H;  1AN7 A;  4B3T H;  4KHP H;  2UXC H;  4DR6 H;  4JV5 H;  4X65 H;  4DV2 H;  4EC5 A;  5BR8 H;  2UXB H;  3KDG A;  1XMO H;  4X64 H;  1SEI A;  3T1H H;  1FJG H;  4JYA H;  3GR5 A;  4DUZ H;  4JI4 H;  4LFC H;  1HNZ H;  4G08 A;  4B8C D;  2D9I A;  5A2Q W;  4DV6 H;  2UXD H;  4DV4 H;  2VQE H;  2ZM6 H;  4JI8 H;  1X9Z A;  1XMQ H;  4JI2 H;  5IWA H;  3OET A;  5FLX W;  4OCH A;  5LMN H;  3J7A K;  4NZT M;  4DV5 H;  4JI7 H;  4DR1 H;  3KDK A;  2VQF H;  1N34 H;  4JI5 H;  1FKA H;  1S03 G;  3GAB A;  4DV1 H;  4B3R H;  1N36 H;  2UU9 H;  5IT9 W;  2HHH H;  4JI1 H;  1XNQ H;  1I94 H;  4K0K H;  4DR3 H;  4LF9 H;  2UUC H;  2F4V H;  4OX9 H;  5LL6 b;  2O4C A;  3OTO H;  4LF8 H;  4DUY H;  4LF7 H;  4JI6 H;  4PDB A;  5DT9 A;  1F0X A;  1ODH A;  4NXM H;  4YY3 H;  4DR4 H;  4DV0 H;  3RF2 A;  2Y3M A;  3QD7 X;  4DV7 H;  4LF5 H;  4YHH H;  1N33 H;  3NCV A;  4GKJ H;  4NXN H;  1IBM H;  4DR2 H;  1HNX H;  4DR7 H;  1N32 H;  3J81 W; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...