2AXYA

Crystal structure of kh1 domain of human poly(c)-binding protein-2 with c-rich strand of human telomeric dna
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
72
structure length
72
Chain Sequence
b'KNVTLTIRLLMHGKEVGSIIGKKGESVKKMREESGARINISEGNCPERIITLAGPTNAIFKAFAMIIDKLEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords C-rich strand of human telomeric dna
publication title Crystal Structure of the First KH Domain of Human Poly(C)-binding Protein-2 in Complex with a C-rich Strand of Human Telomeric DNA at 1.7 A
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
total genus 16
structure length 72
sequence length 72
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 2axyA00
2JVZA 2CTFA 1WE8A 1ZZIA 2BL5A 2PY9A 2JEBI 1ZZJA 2HH3A 3AEVB 5C0XG 2CTKA 2DGRA 2QNDA 1TUAA 2JA9A 2NN6G 4QMFB 3U1KA 2CTJA 4IFDG 5K36G 2PQUA 1ZZKA 1DTJA 4WANA 1X4MA 1J5KA 2ANRA 4JVYA 2YQRA 2HH2A 4JVHA 1WVNA 2CPQA 1DT4A 1ZTGA 1EC6A 4NBQA 2JE6I 1K1GA 4LIJA 2Z0SA 2CTLA 2OPVA 3L7ZC 3V69A 4BA1I 2MJHA 2BA0A 2CTEA 2JEAI 2E3UA 3VKEA 5JEAG 1J4WA 1KHMA 4BA2I 4AIMA 2ANNA 2OPUA 2JZXA 1VIGA 4B8TA 2AXYA 4AM3A 1VIHA 2P2RA 4WALA 2FMRA 2CTMA 4OO1G 1X4NA
chains in the Genus database with same CATH superfamily
4DR7H 2JVZA 2BL5A 2PY9A 1IBKH 1FKAH 4DV2H 3SB1A 3UOEA 4JI6H 4DR1H 1IBMH 4QMFB 1XRHA 4LF9H 2Y3MA 4IFDG 1ZZKA 4FJSA 4WANA 3KDGA 2YQRA 2A1SA 4JV5H 2FPHX 4X65H 4NBQA 3T1YH 2JE6I 4DV3H 4LF7H 3V69A 4BA1I 2OPVA 2MJHA 4DR6H 3FAUA 2CTEA 2JEAI 2UXCH 2UXDH 4PDBA 5LMNH 2LTLA 4B8CD 1VIGA 3QD7X 4B8TA 2AXYA 4AM3A 2LTMA 1MSZA 2CWHA 1XMOH 1X4NA 4OO1G 2VQFH 1ZZIA 1SEIA 2JEBI 3GKUA 3AEVB 4DR4H 3OETA 2NN6G 4OD6A 2G8YA 1N34H 1V9NA 4NXMH 2PT7G 2LF0A 2F4VH 4JVYA 5BR8H 4NZRM 2M8WA 3GABA 3OTOH 4YHHH 1Z2IA 1HNZH 1WVNA 4OCHA 2D9IA 4G08A 4B3MH 4OX9H 1DT4A 4DV4H 4E9JA 1IBLH 1K1GA 1FJGH 4LF4H 4JI0H 4DR2H 1S20A 1NXUA 2CTLA 2UUCH 4X62H 2BA0A 3KDKA 4H8AA 3VKEA 2HHHH 2ANNA 3I0PA 2OPUA 2JZXA 3GR5A 4NXNH 1PQXA 1N33H 1F0XA 5IT9W 4K0KH 2FFMA 2CTMA 4JI2H 1AN7A 1WE8A 4JI1H 1N36H 4LF5H 2UU9H 1ZZJA 2K1HA 2HH3A 2X06A 1HNXH 2UUAH 5C0XG 1XNQH 4KHPH 2CTKA 1TUAA 4B3TH 2JA9A 3JAMW 4X64H 2PQUA 5K36G 1DTJA 3RF2A 4DUYH 2ANRA 1ODHA 2HH2A 2VKCA 5IWAH 1HR0H 3EZJA 4EC5A 1X0AA 4JVHA 2CPQA 1ZTGA 1EC6A 1HNWH 4JI8H 1S03G 5A2QW 4LFBH 4X66H 4B3SH 4FJUA 1I94H 4GKJH 5JEAG 1KHMA 4JYAH 5LL6b 4NZTM 4DV0H 2ZQEA 4LF8H 4YY3H 4DR5H 3T1HH 2O4CA 1UG8A 1VIHA 2FMRA 3U1KA 4LIJA 4LFCH 3J7AK 3J81W 1XNRH 2CTFA 1WHRA 5FLXW 4JI5H 2M6QA 1I6UA 2DGRA 3NCVA 1XMQH 2QNDA 1J5EH 4DV6H 2VQEH 2CTJA 2CPMA 1VBIA 4DUZH 1X4MA 1J5KA 4DV7H 4B3RH 4DV5H 1X9ZA 2ZM6H 4JI4H 2UUBH 4AQYH 2Z0SA 3L7ZC 4DV1H 3OSSD 4GKKH 2LRRA 4DR3H 5DT9A 2E3UA 4LFAH 1J4WA 2UXBH 4BA2I 4JI3H 4AIMA 2E5LH 4LF6H 1N32H 1V8CA 1WTJA 3J80W 4JI7H 2CWFA 2P2RA 4WALA 5LMUH
chains in the Genus database with same CATH topology
2JVZA 2CTFA 1WE8A 1ZZIA 2BL5A 2PY9A 2JEBI 1ZZJA 2HH3A 3AEVB 5C0XG 2CTKA 2DGRA 2QNDA 1TUAA 2JA9A 2NN6G 4QMFB 3U1KA 2CTJA 4IFDG 5K36G 2PQUA 1ZZKA 1DTJA 4WANA 1X4MA 1J5KA 2ANRA 4JVYA 2YQRA 2HH2A 4JVHA 1WVNA 2CPQA 1DT4A 1ZTGA 1EC6A 4NBQA 2JE6I 1K1GA 4LIJA 2Z0SA 2CTLA 2OPVA 3L7ZC 3V69A 4BA1I 2MJHA 2BA0A 2CTEA 2JEAI 2E3UA 3VKEA 5JEAG 1J4WA 1KHMA 4BA2I 4AIMA 2ANNA 2OPUA 2JZXA 1VIGA 4B8TA 2AXYA 4AM3A 1VIHA 2P2RA 4WALA 2FMRA 2CTMA 4OO1G 1X4NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JVZ A;  2CTF A;  1WE8 A;  1ZZI A;  2BL5 A;  2PY9 A;  2JEB I;  1ZZJ A;  2HH3 A;  3AEV B;  5C0X G;  2CTK A;  2DGR A;  2QND A;  1TUA A;  2JA9 A;  2NN6 G;  4QMF B;  3U1K A;  2CTJ A;  4IFD G;  5K36 G;  2PQU A;  1ZZK A;  1DTJ A;  4WAN A;  1X4M A;  1J5K A;  2ANR A;  4JVY A;  2YQR A;  2HH2 A;  4JVH A;  1WVN A;  2CPQ A;  1DT4 A;  1ZTG A;  1EC6 A;  4NBQ A;  2JE6 I;  1K1G A;  4LIJ A;  2Z0S A;  2CTL A;  2OPV A;  3L7Z C;  3V69 A;  4BA1 I;  2MJH A;  2BA0 A;  2CTE A;  2JEA I;  2E3U A;  3VKE A;  5JEA G;  1J4W A;  1KHM A;  4BA2 I;  4AIM A;  2ANN A;  2OPU A;  2JZX A;  1VIG A;  4B8T A;  2AXY A;  4AM3 A;  1VIH A;  2P2R A;  4WAL A;  2FMR A;  2CTM A;  4OO1 G;  1X4N A; 
#chains in the Genus database with same CATH topology
 4DR7 H;  2JVZ A;  2BL5 A;  2PY9 A;  1IBK H;  1FKA H;  4DV2 H;  3SB1 A;  3UOE A;  4JI6 H;  4DR1 H;  1IBM H;  4QMF B;  1XRH A;  4LF9 H;  2Y3M A;  4IFD G;  1ZZK A;  4FJS A;  4WAN A;  3KDG A;  2YQR A;  2A1S A;  4JV5 H;  2FPH X;  4X65 H;  4NBQ A;  3T1Y H;  2JE6 I;  4DV3 H;  4LF7 H;  3V69 A;  4BA1 I;  2OPV A;  2MJH A;  4DR6 H;  3FAU A;  2CTE A;  2JEA I;  2UXC H;  2UXD H;  4PDB A;  5LMN H;  2LTL A;  4B8C D;  1VIG A;  3QD7 X;  4B8T A;  2AXY A;  4AM3 A;  2LTM A;  1MSZ A;  2CWH A;  1XMO H;  1X4N A;  4OO1 G;  2VQF H;  1ZZI A;  1SEI A;  2JEB I;  3GKU A;  3AEV B;  4DR4 H;  3OET A;  2NN6 G;  4OD6 A;  2G8Y A;  1N34 H;  1V9N A;  4NXM H;  2PT7 G;  2LF0 A;  2F4V H;  4JVY A;  5BR8 H;  4NZR M;  2M8W A;  3GAB A;  3OTO H;  4YHH H;  1Z2I A;  1HNZ H;  1WVN A;  4OCH A;  2D9I A;  4G08 A;  4B3M H;  4OX9 H;  1DT4 A;  4DV4 H;  4E9J A;  1IBL H;  1K1G A;  1FJG H;  4LF4 H;  4JI0 H;  4DR2 H;  1S20 A;  1NXU A;  2CTL A;  2UUC H;  4X62 H;  2BA0 A;  3KDK A;  4H8A A;  3VKE A;  2HHH H;  2ANN A;  3I0P A;  2OPU A;  2JZX A;  3GR5 A;  4NXN H;  1PQX A;  1N33 H;  1F0X A;  5IT9 W;  4K0K H;  2FFM A;  2CTM A;  4JI2 H;  1AN7 A;  1WE8 A;  4JI1 H;  1N36 H;  4LF5 H;  2UU9 H;  1ZZJ A;  2K1H A;  2HH3 A;  2X06 A;  1HNX H;  2UUA H;  5C0X G;  1XNQ H;  4KHP H;  2CTK A;  1TUA A;  4B3T H;  2JA9 A;  3JAM W;  4X64 H;  2PQU A;  5K36 G;  1DTJ A;  3RF2 A;  4DUY H;  2ANR A;  1ODH A;  2HH2 A;  2VKC A;  5IWA H;  1HR0 H;  3EZJ A;  4EC5 A;  1X0A A;  4JVH A;  2CPQ A;  1ZTG A;  1EC6 A;  1HNW H;  4JI8 H;  1S03 G;  5A2Q W;  4LFB H;  4X66 H;  4B3S H;  4FJU A;  1I94 H;  4GKJ H;  5JEA G;  1KHM A;  4JYA H;  5LL6 b;  4NZT M;  4DV0 H;  2ZQE A;  4LF8 H;  4YY3 H;  4DR5 H;  3T1H H;  2O4C A;  1UG8 A;  1VIH A;  2FMR A;  3U1K A;  4LIJ A;  4LFC H;  3J7A K;  3J81 W;  1XNR H;  2CTF A;  1WHR A;  5FLX W;  4JI5 H;  2M6Q A;  1I6U A;  2DGR A;  3NCV A;  1XMQ H;  2QND A;  1J5E H;  4DV6 H;  2VQE H;  2CTJ A;  2CPM A;  1VBI A;  4DUZ H;  1X4M A;  1J5K A;  4DV7 H;  4B3R H;  4DV5 H;  1X9Z A;  2ZM6 H;  4JI4 H;  2UUB H;  4AQY H;  2Z0S A;  3L7Z C;  4DV1 H;  3OSS D;  4GKK H;  2LRR A;  4DR3 H;  5DT9 A;  2E3U A;  4LFA H;  1J4W A;  2UXB H;  4BA2 I;  4JI3 H;  4AIM A;  2E5L H;  4LF6 H;  1N32 H;  1V8C A;  1WTJ A;  3J80 W;  4JI7 H;  2CWF A;  2P2R A;  4WAL A;  5LMU H; 
#chains in the Genus database with same CATH homology
 2JVZ A;  2CTF A;  1WE8 A;  1ZZI A;  2BL5 A;  2PY9 A;  2JEB I;  1ZZJ A;  2HH3 A;  3AEV B;  5C0X G;  2CTK A;  2DGR A;  2QND A;  1TUA A;  2JA9 A;  2NN6 G;  4QMF B;  3U1K A;  2CTJ A;  4IFD G;  5K36 G;  2PQU A;  1ZZK A;  1DTJ A;  4WAN A;  1X4M A;  1J5K A;  2ANR A;  4JVY A;  2YQR A;  2HH2 A;  4JVH A;  1WVN A;  2CPQ A;  1DT4 A;  1ZTG A;  1EC6 A;  4NBQ A;  2JE6 I;  1K1G A;  4LIJ A;  2Z0S A;  2CTL A;  2OPV A;  3L7Z C;  3V69 A;  4BA1 I;  2MJH A;  2BA0 A;  2CTE A;  2JEA I;  2E3U A;  3VKE A;  5JEA G;  1J4W A;  1KHM A;  4BA2 I;  4AIM A;  2ANN A;  2OPU A;  2JZX A;  1VIG A;  4B8T A;  2AXY A;  4AM3 A;  1VIH A;  2P2R A;  4WAL A;  2FMR A;  2CTM A;  4OO1 G;  1X4N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...