2AXYA

Crystal structure of kh1 domain of human poly(c)-binding protein-2 with c-rich strand of human telomeric dna
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
72
structure length
72
Chain Sequence
KNVTLTIRLLMHGKEVGSIIGKKGESVKKMREESGARINISEGNCPERIITLAGPTNAIFKAFAMIIDKLEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords C-rich strand of human telomeric dna
publication title Crystal Structure of the First KH Domain of Human Poly(C)-binding Protein-2 in Complex with a C-rich Strand of Human Telomeric DNA at 1.7 A
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
total genus 16
structure length 72
sequence length 72
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 2axyA00
1X4MA 2CTLA 2JE6I 3AEVB 4AIMA 5K36G 1K1GA 4QMFB 2NN6G 2JEBI 2HH2A 4OO1G 3U1KA 1EC6A 2P2RA 4B8TA 2Z0SA 2JZXA 2PY9A 2QNDA 2CTFA 4AM3A 2BL5A 2AXYA 2JEAI 1KHMA 2BA0A 1WE8A 4JVHA 1DT4A 2OPVA 1ZZJA 2CTMA 1J4WA 2CTJA 2JA9A 2JVZA 1X4NA 1TUAA 4BA1I 2FMRA 1ZTGA 5JEAG 2MJHA 2ANNA 1ZZKA 1VIHA 2CPQA 2CTEA 2YQRA 3V69A 5C0XG 1WVNA 4BA2I 3VKEA 4WANA 4IFDG 1DTJA 2DGRA 2PQUA 2CTKA 2E3UA 3L7ZC 1J5KA 1VIGA 2ANRA 4LIJA 4WALA 4JVYA 2HH3A 2OPUA 4NBQA 1ZZIA
chains in the Genus database with same CATH superfamily
4LFAH 2X06A 2VQFH 4E9JA 3JAMW 1SEIA 3T1HH 1K1GA 4QMFB 4JI5H 1N33H 3UOEA 4DUYH 5DT9A 3T1YH 4DV7H 4AM3A 4K0KH 2JEAI 4G08A 2M8WA 1DT4A 1N32H 2VKCA 1WTJA 4BA1I 1ZTGA 1TUAA 3RF2A 5JEAG 4X64H 4X66H 4DV0H 4LF8H 1VIHA 2CPQA 1I6UA 5IWAH 3VKEA 1HNXH 3L7ZC 1J5KA 1VIGA 1XRHA 2HHHH 4JV5H 1XNQH 2OPUA 4B3SH 2K1HA 4LF9H 4OX9H 2CTLA 4JYAH 1HNZH 2UUBH 5LMUH 4GKJH 4JI8H 3GKUA 2M6QA 2UXDH 2VQEH 4JI2H 3OSSD 2O4CA 1IBMH 1AN7A 4AQYH 4NXNH 3OTOH 2PY9A 2CPMA 2LF0A 4DV5H 3OETA 4JI4H 4DV2H 1KHMA 1WE8A 1FJGH 4EC5A 3KDGA 2OPVA 4FJSA 2F4VH 2CTMA 4DR7H 1HR0H 2JA9A 2JVZA 2FFMA 2LRRA 4JI7H 3GABA 1IBLH 2MJHA 5IT9W 4JVHA 1X0AA 2CTEA 4BA2I 4NXMH 4WANA 4NZTM 5A2QW 1FKAH 4IFDG 1DTJA 2UUAH 1HNWH 4LIJA 3J80W 1I94H 2HH3A 4YHHH 1V8CA 2JE6I 1ODHA 2G8YA 2PT7G 3AEVB 3GR5A 4DR3H 1MSZA 1X9ZA 4DR1H 2UU9H 4LFBH 2NN6G 3EZJA 4OO1G 3FAUA 3U1KA 4B8CD 2P2RA 4JI0H 2CWFA 4DV6H 2JZXA 4DV4H 2D9IA 2LTLA 4OCHA 4X62H 4DR6H 4GKKH 2FPHX 2BA0A 4OD6A 3J81W 4LF4H 1IBKH 2UXCH 4JI1H 2CTJA 2A1SA 2ANNA 4H8AA 2FMRA 1N36H 4B3TH 1S20A 4DV3H 4B3RH 4LF6H 1ZZKA 2YQRA 1V9NA 3V69A 5C0XG 2ZM6H 3KDKA 1S03G 5BR8H 2DGRA 5K36G 2ZQEA 4NZRM 4WALA 2Y3MA 4LF7H 1PQXA 1Z2IA 5LL6b 2CWHA 1VBIA 1X4MA 3SB1A 4AIMA 4LFCH 4LF5H 1WHRA 4KHPH 2JEBI 4DUZH 1NXUA 2HH2A 1EC6A 2UXBH 4DV1H 4B8TA 1UG8A 1XMOH 2UUCH 2Z0SA 2QNDA 1XNRH 2CTFA 3NCVA 2BL5A 2AXYA 4DR5H 4DR4H 3QD7X 4JI6H 1ZZJA 4DR2H 5LMNH 1J5EH 4JI3H 1J4WA 1X4NA 4YY3H 5FLXW 1N34H 2LTMA 4B3MH 1F0XA 3I0PA 1WVNA 4PDBA 2PQUA 4FJUA 2CTKA 2E3UA 2ANRA 4JVYA 4X65H 3J7AK 2E5LH 4NBQA 1ZZIA 1XMQH
chains in the Genus database with same CATH topology
1X4MA 2CTLA 2JE6I 3AEVB 4AIMA 5K36G 1K1GA 4QMFB 2NN6G 2JEBI 2HH2A 4OO1G 3U1KA 1EC6A 2P2RA 4B8TA 2Z0SA 2JZXA 2PY9A 2QNDA 2CTFA 4AM3A 2BL5A 2AXYA 2JEAI 1KHMA 2BA0A 1WE8A 4JVHA 1DT4A 2OPVA 1ZZJA 2CTMA 1J4WA 2CTJA 2JA9A 2JVZA 1X4NA 1TUAA 4BA1I 2FMRA 1ZTGA 5JEAG 2MJHA 2ANNA 1ZZKA 1VIHA 2CPQA 2CTEA 2YQRA 3V69A 5C0XG 1WVNA 4BA2I 3VKEA 4WANA 4IFDG 1DTJA 2DGRA 2PQUA 2CTKA 2E3UA 3L7ZC 1J5KA 1VIGA 2ANRA 4LIJA 4WALA 4JVYA 2HH3A 2OPUA 4NBQA 1ZZIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X4M A;  2CTL A;  2JE6 I;  3AEV B;  4AIM A;  5K36 G;  1K1G A;  4QMF B;  2NN6 G;  2JEB I;  2HH2 A;  4OO1 G;  3U1K A;  1EC6 A;  2P2R A;  4B8T A;  2Z0S A;  2JZX A;  2PY9 A;  2QND A;  2CTF A;  4AM3 A;  2BL5 A;  2AXY A;  2JEA I;  1KHM A;  2BA0 A;  1WE8 A;  4JVH A;  1DT4 A;  2OPV A;  1ZZJ A;  2CTM A;  1J4W A;  2CTJ A;  2JA9 A;  2JVZ A;  1X4N A;  1TUA A;  4BA1 I;  2FMR A;  1ZTG A;  5JEA G;  2MJH A;  2ANN A;  1ZZK A;  1VIH A;  2CPQ A;  2CTE A;  2YQR A;  3V69 A;  5C0X G;  1WVN A;  4BA2 I;  3VKE A;  4WAN A;  4IFD G;  1DTJ A;  2DGR A;  2PQU A;  2CTK A;  2E3U A;  3L7Z C;  1J5K A;  1VIG A;  2ANR A;  4LIJ A;  4WAL A;  4JVY A;  2HH3 A;  2OPU A;  4NBQ A;  1ZZI A; 
#chains in the Genus database with same CATH topology
 4LFA H;  2X06 A;  2VQF H;  4E9J A;  3JAM W;  1SEI A;  3T1H H;  1K1G A;  4QMF B;  4JI5 H;  1N33 H;  3UOE A;  4DUY H;  5DT9 A;  3T1Y H;  4DV7 H;  4AM3 A;  4K0K H;  2JEA I;  4G08 A;  2M8W A;  1DT4 A;  1N32 H;  2VKC A;  1WTJ A;  4BA1 I;  1ZTG A;  1TUA A;  3RF2 A;  5JEA G;  4X64 H;  4X66 H;  4DV0 H;  4LF8 H;  1VIH A;  2CPQ A;  1I6U A;  5IWA H;  3VKE A;  1HNX H;  3L7Z C;  1J5K A;  1VIG A;  1XRH A;  2HHH H;  4JV5 H;  1XNQ H;  2OPU A;  4B3S H;  2K1H A;  4LF9 H;  4OX9 H;  2CTL A;  4JYA H;  1HNZ H;  2UUB H;  5LMU H;  4GKJ H;  4JI8 H;  3GKU A;  2M6Q A;  2UXD H;  2VQE H;  4JI2 H;  3OSS D;  2O4C A;  1IBM H;  1AN7 A;  4AQY H;  4NXN H;  3OTO H;  2PY9 A;  2CPM A;  2LF0 A;  4DV5 H;  3OET A;  4JI4 H;  4DV2 H;  1KHM A;  1WE8 A;  1FJG H;  4EC5 A;  3KDG A;  2OPV A;  4FJS A;  2F4V H;  2CTM A;  4DR7 H;  1HR0 H;  2JA9 A;  2JVZ A;  2FFM A;  2LRR A;  4JI7 H;  3GAB A;  1IBL H;  2MJH A;  5IT9 W;  4JVH A;  1X0A A;  2CTE A;  4BA2 I;  4NXM H;  4WAN A;  4NZT M;  5A2Q W;  1FKA H;  4IFD G;  1DTJ A;  2UUA H;  1HNW H;  4LIJ A;  3J80 W;  1I94 H;  2HH3 A;  4YHH H;  1V8C A;  2JE6 I;  1ODH A;  2G8Y A;  2PT7 G;  3AEV B;  3GR5 A;  4DR3 H;  1MSZ A;  1X9Z A;  4DR1 H;  2UU9 H;  4LFB H;  2NN6 G;  3EZJ A;  4OO1 G;  3FAU A;  3U1K A;  4B8C D;  2P2R A;  4JI0 H;  2CWF A;  4DV6 H;  2JZX A;  4DV4 H;  2D9I A;  2LTL A;  4OCH A;  4X62 H;  4DR6 H;  4GKK H;  2FPH X;  2BA0 A;  4OD6 A;  3J81 W;  4LF4 H;  1IBK H;  2UXC H;  4JI1 H;  2CTJ A;  2A1S A;  2ANN A;  4H8A A;  2FMR A;  1N36 H;  4B3T H;  1S20 A;  4DV3 H;  4B3R H;  4LF6 H;  1ZZK A;  2YQR A;  1V9N A;  3V69 A;  5C0X G;  2ZM6 H;  3KDK A;  1S03 G;  5BR8 H;  2DGR A;  5K36 G;  2ZQE A;  4NZR M;  4WAL A;  2Y3M A;  4LF7 H;  1PQX A;  1Z2I A;  5LL6 b;  2CWH A;  1VBI A;  1X4M A;  3SB1 A;  4AIM A;  4LFC H;  4LF5 H;  1WHR A;  4KHP H;  2JEB I;  4DUZ H;  1NXU A;  2HH2 A;  1EC6 A;  2UXB H;  4DV1 H;  4B8T A;  1UG8 A;  1XMO H;  2UUC H;  2Z0S A;  2QND A;  1XNR H;  2CTF A;  3NCV A;  2BL5 A;  2AXY A;  4DR5 H;  4DR4 H;  3QD7 X;  4JI6 H;  1ZZJ A;  4DR2 H;  5LMN H;  1J5E H;  4JI3 H;  1J4W A;  1X4N A;  4YY3 H;  5FLX W;  1N34 H;  2LTM A;  4B3M H;  1F0X A;  3I0P A;  1WVN A;  4PDB A;  2PQU A;  4FJU A;  2CTK A;  2E3U A;  2ANR A;  4JVY A;  4X65 H;  3J7A K;  2E5L H;  4NBQ A;  1ZZI A;  1XMQ H; 
#chains in the Genus database with same CATH homology
 1X4M A;  2CTL A;  2JE6 I;  3AEV B;  4AIM A;  5K36 G;  1K1G A;  4QMF B;  2NN6 G;  2JEB I;  2HH2 A;  4OO1 G;  3U1K A;  1EC6 A;  2P2R A;  4B8T A;  2Z0S A;  2JZX A;  2PY9 A;  2QND A;  2CTF A;  4AM3 A;  2BL5 A;  2AXY A;  2JEA I;  1KHM A;  2BA0 A;  1WE8 A;  4JVH A;  1DT4 A;  2OPV A;  1ZZJ A;  2CTM A;  1J4W A;  2CTJ A;  2JA9 A;  2JVZ A;  1X4N A;  1TUA A;  4BA1 I;  2FMR A;  1ZTG A;  5JEA G;  2MJH A;  2ANN A;  1ZZK A;  1VIH A;  2CPQ A;  2CTE A;  2YQR A;  3V69 A;  5C0X G;  1WVN A;  4BA2 I;  3VKE A;  4WAN A;  4IFD G;  1DTJ A;  2DGR A;  2PQU A;  2CTK A;  2E3U A;  3L7Z C;  1J5K A;  1VIG A;  2ANR A;  4LIJ A;  4WAL A;  4JVY A;  2HH3 A;  2OPU A;  4NBQ A;  1ZZI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...