2AXYA

Crystal structure of kh1 domain of human poly(c)-binding protein-2 with c-rich strand of human telomeric dna
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
72
structure length
72
Chain Sequence
KNVTLTIRLLMHGKEVGSIIGKKGESVKKMREESGARINISEGNCPERIITLAGPTNAIFKAFAMIIDKLEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/dna
molecule keywords C-rich strand of human telomeric dna
publication title Crystal Structure of the First KH Domain of Human Poly(C)-binding Protein-2 in Complex with a C-rich Strand of Human Telomeric DNA at 1.7 A
pubmed doi rcsb
source organism Homo sapiens
total genus 16
structure length 72
sequence length 72
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 2axyA00
3U1KA 1DTJA 1X4NA 2JZXA 2CTFA 1ZZJA 1K1GA 1WVNA 4BA1I 2MJHA 4QMFB 2CTMA 2ANNA 5K36G 5JEAG 4WALA 2BL5A 1J4WA 2P2RA 4BA2I 1DT4A 1ZTGA 2FMRA 2JEBI 2CTKA 2PY9A 1X4MA 1J5KA 2ANRA 2BA0A 2CTEA 1VIHA 1TUAA 3AEVB 2OPUA 3V69A 4IFDG 1EC6A 2JA9A 3L7ZC 4JVYA 2QNDA 1WE8A 4AM3A 2HH3A 4NBQA 2OPVA 3VKEA 2JE6I 2AXYA 2DGRA 4LIJA 2PQUA 2CTJA 2Z0SA 1VIGA 2YQRA 4AIMA 2HH2A 4OO1G 1ZZIA 2JEAI 4B8TA 4WANA 5C0XG 2CPQA 1KHMA 4JVHA 2CTLA 2NN6G 1ZZKA 2E3UA 2JVZA
chains in the Genus database with same CATH superfamily
4X66H 1DTJA 4DR7H 2CTFA 4LFAH 3JAMW 5DT9A 1ODHA 5K36G 4DUZH 1X0AA 3KDKA 1J4WA 2P2RA 2UXDH 3OTOH 1N33H 1ZTGA 5BR8H 4LFBH 4OO1G 1MSZA 1X4MA 2LRRA 1N34H 2BA0A 4DR3H 2ANRA 2PY9A 4BA2I 1VIHA 1TUAA 4LF7H 1S20A 5LMUH 1HNZH 4JV5H 1X9ZA 4LF9H 1Z2IA 4DR2H 1SEIA 3L7ZC 4DV6H 4DUYH 4AQYH 2UUBH 4AM3A 4PDBA 4DV0H 2E5LH 4DR5H 3VKEA 4DV4H 2UUCH 4NXNH 3FAUA 4K0KH 4WANA 1HNWH 4JVHA 1UG8A 2NN6G 2ANNA 2LF0A 4JVYA 2D9IA 3T1HH 4B3MH 1FJGH 4EC5A 1ZZJA 5JEAG 1HNXH 2BL5A 4OX9H 5A2QW 3UOEA 1DT4A 1WTJA 1NXUA 4DV3H 2ZM6H 2LTMA 2UU9H 2CTKA 4JI1H 4DV5H 1IBKH 4LF8H 3QD7X 4NZRM 3AEVB 2CPMA 3NCVA 4E9JA 3V69A 2VQFH 4JI7H 1EC6A 4FJSA 2CWFA 2CWHA 2A1SA 1PQXA 2HH3A 1N36H 3OETA 1J5EH 4KHPH 2OPVA 2AXYA 2DGRA 1IBMH 2M8WA 1VIGA 1V8CA 2M6QA 4GKJH 2JEAI 3GABA 4B8TA 1I6UA 2CPQA 1HR0H 4X65H 1IBLH 2CTLA 2LTLA 3U1KA 1V9NA 2HHHH 1WVNA 1S03G 2CTMA 2K1HA 4X64H 3EZJA 4DV1H 2FMRA 2JEBI 2PT7G 2CTEA 3GKUA 5IWAH 2G8YA 4JI8H 2Y3MA 4DR6H 2VQEH 4JI3H 1VBIA 4H8AA 3RF2A 4OD6A 4DR4H 3GR5A 2CTJA 1FKAH 2Z0SA 2F4VH 4AIMA 2HH2A 4DV7H 3J81W 3T1YH 4B3SH 1XNRH 2FFMA 3I0PA 3J80W 4JI5H 1F0XA 4LF6H 1XMQH 5C0XG 1XMOH 4JYAH 1ZZKA 3KDGA 4IFDG 2QNDA 2JVZA 1WHRA 5IT9W 1X4NA 2JZXA 1AN7A 4NZTM 1K1GA 4BA1I 2MJHA 4B3TH 4QMFB 2UXCH 4WALA 4YY3H 4FJUA 5FLXW 2UUAH 4LF5H 4JI2H 1J5KA 2X06A 2UXBH 4DR1H 2VKCA 5LL6b 4GKKH 2OPUA 4JI4H 2JA9A 4JI0H 1WE8A 4NXMH 4DV2H 4NBQA 1XRHA 2JE6I 2FPHX 2PQUA 4LIJA 4JI6H 4B3RH 5LMNH 1N32H 4LF4H 2YQRA 4OCHA 2ZQEA 4G08A 4LFCH 3J7AK 3SB1A 1ZZIA 1I94H 3OSSD 4X62H 4B8CD 4YHHH 1KHMA 2O4CA 1XNQH 2E3UA
chains in the Genus database with same CATH topology
3U1KA 1DTJA 1X4NA 2JZXA 2CTFA 1ZZJA 1K1GA 1WVNA 4BA1I 2MJHA 4QMFB 2CTMA 2ANNA 5K36G 5JEAG 4WALA 2BL5A 1J4WA 2P2RA 4BA2I 1DT4A 1ZTGA 2FMRA 2JEBI 2CTKA 2PY9A 1X4MA 1J5KA 2ANRA 2BA0A 2CTEA 1VIHA 1TUAA 3AEVB 2OPUA 3V69A 4IFDG 1EC6A 2JA9A 3L7ZC 4JVYA 2QNDA 1WE8A 4AM3A 2HH3A 4NBQA 2OPVA 3VKEA 2JE6I 2AXYA 2DGRA 4LIJA 2PQUA 2CTJA 2Z0SA 1VIGA 2YQRA 4AIMA 2HH2A 4OO1G 1ZZIA 2JEAI 4B8TA 4WANA 5C0XG 2CPQA 1KHMA 4JVHA 2CTLA 2NN6G 1ZZKA 2E3UA 2JVZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U1K A;  1DTJ A;  1X4N A;  2JZX A;  2CTF A;  1ZZJ A;  1K1G A;  1WVN A;  4BA1 I;  2MJH A;  4QMF B;  2CTM A;  2ANN A;  5K36 G;  5JEA G;  4WAL A;  2BL5 A;  1J4W A;  2P2R A;  4BA2 I;  1DT4 A;  1ZTG A;  2FMR A;  2JEB I;  2CTK A;  2PY9 A;  1X4M A;  1J5K A;  2ANR A;  2BA0 A;  2CTE A;  1VIH A;  1TUA A;  3AEV B;  2OPU A;  3V69 A;  4IFD G;  1EC6 A;  2JA9 A;  3L7Z C;  4JVY A;  2QND A;  1WE8 A;  4AM3 A;  2HH3 A;  4NBQ A;  2OPV A;  3VKE A;  2JE6 I;  2AXY A;  2DGR A;  4LIJ A;  2PQU A;  2CTJ A;  2Z0S A;  1VIG A;  2YQR A;  4AIM A;  2HH2 A;  4OO1 G;  1ZZI A;  2JEA I;  4B8T A;  4WAN A;  5C0X G;  2CPQ A;  1KHM A;  4JVH A;  2CTL A;  2NN6 G;  1ZZK A;  2E3U A;  2JVZ A; 
#chains in the Genus database with same CATH topology
 4X66 H;  1DTJ A;  4DR7 H;  2CTF A;  4LFA H;  3JAM W;  5DT9 A;  1ODH A;  5K36 G;  4DUZ H;  1X0A A;  3KDK A;  1J4W A;  2P2R A;  2UXD H;  3OTO H;  1N33 H;  1ZTG A;  5BR8 H;  4LFB H;  4OO1 G;  1MSZ A;  1X4M A;  2LRR A;  1N34 H;  2BA0 A;  4DR3 H;  2ANR A;  2PY9 A;  4BA2 I;  1VIH A;  1TUA A;  4LF7 H;  1S20 A;  5LMU H;  1HNZ H;  4JV5 H;  1X9Z A;  4LF9 H;  1Z2I A;  4DR2 H;  1SEI A;  3L7Z C;  4DV6 H;  4DUY H;  4AQY H;  2UUB H;  4AM3 A;  4PDB A;  4DV0 H;  2E5L H;  4DR5 H;  3VKE A;  4DV4 H;  2UUC H;  4NXN H;  3FAU A;  4K0K H;  4WAN A;  1HNW H;  4JVH A;  1UG8 A;  2NN6 G;  2ANN A;  2LF0 A;  4JVY A;  2D9I A;  3T1H H;  4B3M H;  1FJG H;  4EC5 A;  1ZZJ A;  5JEA G;  1HNX H;  2BL5 A;  4OX9 H;  5A2Q W;  3UOE A;  1DT4 A;  1WTJ A;  1NXU A;  4DV3 H;  2ZM6 H;  2LTM A;  2UU9 H;  2CTK A;  4JI1 H;  4DV5 H;  1IBK H;  4LF8 H;  3QD7 X;  4NZR M;  3AEV B;  2CPM A;  3NCV A;  4E9J A;  3V69 A;  2VQF H;  4JI7 H;  1EC6 A;  4FJS A;  2CWF A;  2CWH A;  2A1S A;  1PQX A;  2HH3 A;  1N36 H;  3OET A;  1J5E H;  4KHP H;  2OPV A;  2AXY A;  2DGR A;  1IBM H;  2M8W A;  1VIG A;  1V8C A;  2M6Q A;  4GKJ H;  2JEA I;  3GAB A;  4B8T A;  1I6U A;  2CPQ A;  1HR0 H;  4X65 H;  1IBL H;  2CTL A;  2LTL A;  3U1K A;  1V9N A;  2HHH H;  1WVN A;  1S03 G;  2CTM A;  2K1H A;  4X64 H;  3EZJ A;  4DV1 H;  2FMR A;  2JEB I;  2PT7 G;  2CTE A;  3GKU A;  5IWA H;  2G8Y A;  4JI8 H;  2Y3M A;  4DR6 H;  2VQE H;  4JI3 H;  1VBI A;  4H8A A;  3RF2 A;  4OD6 A;  4DR4 H;  3GR5 A;  2CTJ A;  1FKA H;  2Z0S A;  2F4V H;  4AIM A;  2HH2 A;  4DV7 H;  3J81 W;  3T1Y H;  4B3S H;  1XNR H;  2FFM A;  3I0P A;  3J80 W;  4JI5 H;  1F0X A;  4LF6 H;  1XMQ H;  5C0X G;  1XMO H;  4JYA H;  1ZZK A;  3KDG A;  4IFD G;  2QND A;  2JVZ A;  1WHR A;  5IT9 W;  1X4N A;  2JZX A;  1AN7 A;  4NZT M;  1K1G A;  4BA1 I;  2MJH A;  4B3T H;  4QMF B;  2UXC H;  4WAL A;  4YY3 H;  4FJU A;  5FLX W;  2UUA H;  4LF5 H;  4JI2 H;  1J5K A;  2X06 A;  2UXB H;  4DR1 H;  2VKC A;  5LL6 b;  4GKK H;  2OPU A;  4JI4 H;  2JA9 A;  4JI0 H;  1WE8 A;  4NXM H;  4DV2 H;  4NBQ A;  1XRH A;  2JE6 I;  2FPH X;  2PQU A;  4LIJ A;  4JI6 H;  4B3R H;  5LMN H;  1N32 H;  4LF4 H;  2YQR A;  4OCH A;  2ZQE A;  4G08 A;  4LFC H;  3J7A K;  3SB1 A;  1ZZI A;  1I94 H;  3OSS D;  4X62 H;  4B8C D;  4YHH H;  1KHM A;  2O4C A;  1XNQ H;  2E3U A; 
#chains in the Genus database with same CATH homology
 3U1K A;  1DTJ A;  1X4N A;  2JZX A;  2CTF A;  1ZZJ A;  1K1G A;  1WVN A;  4BA1 I;  2MJH A;  4QMF B;  2CTM A;  2ANN A;  5K36 G;  5JEA G;  4WAL A;  2BL5 A;  1J4W A;  2P2R A;  4BA2 I;  1DT4 A;  1ZTG A;  2FMR A;  2JEB I;  2CTK A;  2PY9 A;  1X4M A;  1J5K A;  2ANR A;  2BA0 A;  2CTE A;  1VIH A;  1TUA A;  3AEV B;  2OPU A;  3V69 A;  4IFD G;  1EC6 A;  2JA9 A;  3L7Z C;  4JVY A;  2QND A;  1WE8 A;  4AM3 A;  2HH3 A;  4NBQ A;  2OPV A;  3VKE A;  2JE6 I;  2AXY A;  2DGR A;  4LIJ A;  2PQU A;  2CTJ A;  2Z0S A;  1VIG A;  2YQR A;  4AIM A;  2HH2 A;  4OO1 G;  1ZZI A;  2JEA I;  4B8T A;  4WAN A;  5C0X G;  2CPQ A;  1KHM A;  4JVH A;  2CTL A;  2NN6 G;  1ZZK A;  2E3U A;  2JVZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...