2AXYA

Crystal structure of kh1 domain of human poly(c)-binding protein-2 with c-rich strand of human telomeric dna
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
72
structure length
72
Chain Sequence
b'KNVTLTIRLLMHGKEVGSIIGKKGESVKKMREESGARINISEGNCPERIITLAGPTNAIFKAFAMIIDKLEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords C-rich strand of human telomeric dna
molecule tags Dna binding protein/dna
source organism Homo sapiens
publication title Crystal Structure of the First KH Domain of Human Poly(C)-binding Protein-2 in Complex with a C-rich Strand of Human Telomeric DNA at 1.7 A
pubmed doi rcsb
total genus 16
structure length 72
sequence length 72
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 2axyA00
4JVHA 2CTFA 1DT4A 1KHMA 1EC6A 2JZXA 4LIJA 5C0XG 2JEAI 1X4MA 4JVYA 4WALA 2P2RA 2PY9A 1X4NA 2HH2A 2OPVA 4NBQA 4BA1I 1WVNA 2CTJA 5JEAG 1VIHA 2CTMA 2JE6I 2BL5A 2DGRA 2JVZA 3L7ZC 2JEBI 2CTLA 5K36G 2QNDA 1ZZJA 1WE8A 3AEVB 3V69A 4B8TA 2CTEA 2YQRA 2AXYA 4BA2I 2ANRA 4QMFB 1DTJA 1J5KA 1K1GA 4WANA 1J4WA 3VKEA 2BA0A 2NN6G 4OO1G 2CTKA 4AIMA 2JA9A 2PQUA 2FMRA 2Z0SA 2ANNA 2OPUA 1ZTGA 1TUAA 2CPQA 3U1KA 4AM3A 4IFDG 2E3UA 2HH3A 1ZZIA 1VIGA 2MJHA 1ZZKA
chains in the Genus database with same CATH superfamily
1IBKH 4PDBA 2VQEH 4JI3H 1S20A 2LF0A 2ZQEA 1SEIA 1N36H 1DT4A 2LTLA 1I94H 2UUBH 4LF9H 4OCHA 1WHRA 2UU9H 5IT9W 1AN7A 2CPMA 3OSSD 4WALA 4B3TH 4JYAH 3OETA 1V8CA 4GKJH 2UUAH 2LRRA 3EZJA 5JEAG 1F0XA 2CTMA 1PQXA 2CWHA 2PT7G 2JEBI 2CTLA 3I0PA 3SB1A 4H8AA 5LMNH 3FAUA 4DV0H 5LL6b 1IBMH 1DTJA 4DV2H 4LFBH 4FJSA 2BA0A 4NZRM 4NZTM 2MJHA 2F4VH 4LF6H 2UXDH 4OD6A 3J81W 2D9IA 4LF7H 1HNXH 4DR6H 2Z0SA 4B8CD 4DR1H 3U1KA 1VIGA 1XMOH 4JI2H 4JVHA 2FPHX 4DV3H 4JI5H 5BR8H 4DUZH 5C0XG 2JEAI 1EC6A 1X4MA 2K1HA 2P2RA 1N34H 4LF8H 1V9NA 2FFMA 2HH2A 4NBQA 3KDGA 4GKKH 2Y3MA 1XRHA 4X62H 1HNWH 5A2QW 5K36G 3T1HH 5IWAH 4JI4H 4G08A 1WE8A 5DT9A 1FKAH 2LTMA 3V69A 3QD7X 4B3SH 1X0AA 1NXUA 3UOEA 4B3RH 1I6UA 4DV1H 4LF5H 2NN6G 4OO1G 1N33H 2CTKA 4JI0H 4AIMA 2O4CA 2JA9A 2PQUA 1Z2IA 5FLXW 4LFCH 3RF2A 4JV5H 2OPUA 1FJGH 1ZTGA 2CPQA 4IFDG 1J5EH 4DR3H 4AM3A 4X64H 4JI1H 2M6QA 4X65H 1XMQH 1KHMA 2X06A 2JZXA 4DUYH 3JAMW 4LFAH 4JVYA 4AQYH 4DR5H 4NXMH 4DR4H 1WVNA 3NCVA 2QNDA 1ZZJA 4B8TA 2YQRA 4BA2I 4JI8H 1S03G 2UXCH 4QMFB 1ODHA 4DV5H 1J5KA 2VKCA 1X9ZA 2M8WA 4YY3H 4DV6H 2VQFH 4FJUA 2FMRA 1HR0H 2UUCH 1TUAA 1N32H 1ZZIA 1UG8A 2CTFA 1XNQH 4DV7H 1MSZA 3J7AK 2HHHH 2G8YA 2ZM6H 4LIJA 3OTOH 4DV4H 2CWFA 2UXBH 4LF4H 4B3MH 4JI7H 4KHPH 2PY9A 1X4NA 2OPVA 4BA1I 2A1SA 1WTJA 4DR7H 2E5LH 2CTJA 4EC5A 4NXNH 1VIHA 3L7ZC 2JE6I 2BL5A 2DGRA 2JVZA 4E9JA 4K0KH 3AEVB 2CTEA 3GKUA 2AXYA 4DR2H 4YHHH 5LMUH 2ANRA 3J80W 1K1GA 4WANA 3GR5A 1J4WA 3VKEA 1HNZH 1XNRH 3GABA 2ANNA 3T1YH 4JI6H 4OX9H 1VBIA 4X66H 2E3UA 2HH3A 1IBLH 3KDKA 1ZZKA
chains in the Genus database with same CATH topology
4JVHA 2CTFA 1DT4A 1KHMA 1EC6A 2JZXA 4LIJA 5C0XG 2JEAI 1X4MA 4JVYA 4WALA 2P2RA 2PY9A 1X4NA 2HH2A 2OPVA 4NBQA 4BA1I 1WVNA 2CTJA 5JEAG 1VIHA 2CTMA 2JE6I 2BL5A 2DGRA 2JVZA 3L7ZC 2JEBI 2CTLA 5K36G 2QNDA 1ZZJA 1WE8A 3AEVB 3V69A 4B8TA 2CTEA 2YQRA 2AXYA 4BA2I 2ANRA 4QMFB 1DTJA 1J5KA 1K1GA 4WANA 1J4WA 3VKEA 2BA0A 2NN6G 4OO1G 2CTKA 4AIMA 2JA9A 2PQUA 2FMRA 2Z0SA 2ANNA 2OPUA 1ZTGA 1TUAA 2CPQA 3U1KA 4AM3A 4IFDG 2E3UA 2HH3A 1ZZIA 1VIGA 2MJHA 1ZZKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JVH A;  2CTF A;  1DT4 A;  1KHM A;  1EC6 A;  2JZX A;  4LIJ A;  5C0X G;  2JEA I;  1X4M A;  4JVY A;  4WAL A;  2P2R A;  2PY9 A;  1X4N A;  2HH2 A;  2OPV A;  4NBQ A;  4BA1 I;  1WVN A;  2CTJ A;  5JEA G;  1VIH A;  2CTM A;  2JE6 I;  2BL5 A;  2DGR A;  2JVZ A;  3L7Z C;  2JEB I;  2CTL A;  5K36 G;  2QND A;  1ZZJ A;  1WE8 A;  3AEV B;  3V69 A;  4B8T A;  2CTE A;  2YQR A;  2AXY A;  4BA2 I;  2ANR A;  4QMF B;  1DTJ A;  1J5K A;  1K1G A;  4WAN A;  1J4W A;  3VKE A;  2BA0 A;  2NN6 G;  4OO1 G;  2CTK A;  4AIM A;  2JA9 A;  2PQU A;  2FMR A;  2Z0S A;  2ANN A;  2OPU A;  1ZTG A;  1TUA A;  2CPQ A;  3U1K A;  4AM3 A;  4IFD G;  2E3U A;  2HH3 A;  1ZZI A;  1VIG A;  2MJH A;  1ZZK A; 
#chains in the Genus database with same CATH topology
 1IBK H;  4PDB A;  2VQE H;  4JI3 H;  1S20 A;  2LF0 A;  2ZQE A;  1SEI A;  1N36 H;  1DT4 A;  2LTL A;  1I94 H;  2UUB H;  4LF9 H;  4OCH A;  1WHR A;  2UU9 H;  5IT9 W;  1AN7 A;  2CPM A;  3OSS D;  4WAL A;  4B3T H;  4JYA H;  3OET A;  1V8C A;  4GKJ H;  2UUA H;  2LRR A;  3EZJ A;  5JEA G;  1F0X A;  2CTM A;  1PQX A;  2CWH A;  2PT7 G;  2JEB I;  2CTL A;  3I0P A;  3SB1 A;  4H8A A;  5LMN H;  3FAU A;  4DV0 H;  5LL6 b;  1IBM H;  1DTJ A;  4DV2 H;  4LFB H;  4FJS A;  2BA0 A;  4NZR M;  4NZT M;  2MJH A;  2F4V H;  4LF6 H;  2UXD H;  4OD6 A;  3J81 W;  2D9I A;  4LF7 H;  1HNX H;  4DR6 H;  2Z0S A;  4B8C D;  4DR1 H;  3U1K A;  1VIG A;  1XMO H;  4JI2 H;  4JVH A;  2FPH X;  4DV3 H;  4JI5 H;  5BR8 H;  4DUZ H;  5C0X G;  2JEA I;  1EC6 A;  1X4M A;  2K1H A;  2P2R A;  1N34 H;  4LF8 H;  1V9N A;  2FFM A;  2HH2 A;  4NBQ A;  3KDG A;  4GKK H;  2Y3M A;  1XRH A;  4X62 H;  1HNW H;  5A2Q W;  5K36 G;  3T1H H;  5IWA H;  4JI4 H;  4G08 A;  1WE8 A;  5DT9 A;  1FKA H;  2LTM A;  3V69 A;  3QD7 X;  4B3S H;  1X0A A;  1NXU A;  3UOE A;  4B3R H;  1I6U A;  4DV1 H;  4LF5 H;  2NN6 G;  4OO1 G;  1N33 H;  2CTK A;  4JI0 H;  4AIM A;  2O4C A;  2JA9 A;  2PQU A;  1Z2I A;  5FLX W;  4LFC H;  3RF2 A;  4JV5 H;  2OPU A;  1FJG H;  1ZTG A;  2CPQ A;  4IFD G;  1J5E H;  4DR3 H;  4AM3 A;  4X64 H;  4JI1 H;  2M6Q A;  4X65 H;  1XMQ H;  1KHM A;  2X06 A;  2JZX A;  4DUY H;  3JAM W;  4LFA H;  4JVY A;  4AQY H;  4DR5 H;  4NXM H;  4DR4 H;  1WVN A;  3NCV A;  2QND A;  1ZZJ A;  4B8T A;  2YQR A;  4BA2 I;  4JI8 H;  1S03 G;  2UXC H;  4QMF B;  1ODH A;  4DV5 H;  1J5K A;  2VKC A;  1X9Z A;  2M8W A;  4YY3 H;  4DV6 H;  2VQF H;  4FJU A;  2FMR A;  1HR0 H;  2UUC H;  1TUA A;  1N32 H;  1ZZI A;  1UG8 A;  2CTF A;  1XNQ H;  4DV7 H;  1MSZ A;  3J7A K;  2HHH H;  2G8Y A;  2ZM6 H;  4LIJ A;  3OTO H;  4DV4 H;  2CWF A;  2UXB H;  4LF4 H;  4B3M H;  4JI7 H;  4KHP H;  2PY9 A;  1X4N A;  2OPV A;  4BA1 I;  2A1S A;  1WTJ A;  4DR7 H;  2E5L H;  2CTJ A;  4EC5 A;  4NXN H;  1VIH A;  3L7Z C;  2JE6 I;  2BL5 A;  2DGR A;  2JVZ A;  4E9J A;  4K0K H;  3AEV B;  2CTE A;  3GKU A;  2AXY A;  4DR2 H;  4YHH H;  5LMU H;  2ANR A;  3J80 W;  1K1G A;  4WAN A;  3GR5 A;  1J4W A;  3VKE A;  1HNZ H;  1XNR H;  3GAB A;  2ANN A;  3T1Y H;  4JI6 H;  4OX9 H;  1VBI A;  4X66 H;  2E3U A;  2HH3 A;  1IBL H;  3KDK A;  1ZZK A; 
#chains in the Genus database with same CATH homology
 4JVH A;  2CTF A;  1DT4 A;  1KHM A;  1EC6 A;  2JZX A;  4LIJ A;  5C0X G;  2JEA I;  1X4M A;  4JVY A;  4WAL A;  2P2R A;  2PY9 A;  1X4N A;  2HH2 A;  2OPV A;  4NBQ A;  4BA1 I;  1WVN A;  2CTJ A;  5JEA G;  1VIH A;  2CTM A;  2JE6 I;  2BL5 A;  2DGR A;  2JVZ A;  3L7Z C;  2JEB I;  2CTL A;  5K36 G;  2QND A;  1ZZJ A;  1WE8 A;  3AEV B;  3V69 A;  4B8T A;  2CTE A;  2YQR A;  2AXY A;  4BA2 I;  2ANR A;  4QMF B;  1DTJ A;  1J5K A;  1K1G A;  4WAN A;  1J4W A;  3VKE A;  2BA0 A;  2NN6 G;  4OO1 G;  2CTK A;  4AIM A;  2JA9 A;  2PQU A;  2FMR A;  2Z0S A;  2ANN A;  2OPU A;  1ZTG A;  1TUA A;  2CPQ A;  3U1K A;  4AM3 A;  4IFD G;  2E3U A;  2HH3 A;  1ZZI A;  1VIG A;  2MJH A;  1ZZK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...