2JEBI

Structure of a 9-subunit archaeal exosome bound to mn ions
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
214
structure length
197
Chain Sequence
KIVLQPRSIVVPGELLAEGEFQIPWSPYILKINSKYYSTVVGLFDVKDTQFEVIPLEGSFYYPKINDIVIGLVEDVEIYGWVVDIKAPYKAYLPASNLLGRSINVGEDLRRYLDVGDYVIARIENFDDPVLSVKGKDLGRVSNGIVIDIMPVKVPRVIGKNKSMYETLTSKFVANNGRIWAILIEAIRKIENESHIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title RNA Channelling by the Archaeal Exosome.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Hydrolase
molecule keywords EXOSOME COMPLEX EXONUCLEASE 2
total genus 40
structure length 197
sequence length 214
ec nomenclature
pdb deposition date 2007-01-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2jebI01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2jebI02
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 2jebI03
4A3BG 4WANA 1B9MA 1OXTA 3I2ZA 1YHQA 2UUCQ 1TU2B 4XIGS 1VQFA 3J81i 4POGA 4UY8C 4BY7H 4DNIA 4WJ4A 4AM3A 1CTMA 2ID0A 4RG1A 4OWWB 1FJGL 1MJEA 1X54A 4GLXA 2F1MA 3HKZE 1O7IA 1J4WA 2L5TA 5JEAH 1KHIA 4DV4Q 4JI3Q 3UDXA 4AIMA 3PUYA 2UUBL 4NXNQ 3AEVA 4LNQA 1H9SA 1VF7A 1GD7A 4LK1C 1SFOH 4L5RC 2E5LQ 2ATWA 2F4VQ 1UE1A 5C0XJ 4QQBX 4YCVA 3KJOA 5H1SE 1V9PA 3I56A 4KLKA 1VQKA 2ES2A 4HIDA 2WFWA 4LF6L 1N32Q 1YVCA 4GOPC 4GN4B 1XNQL 1HZ9A 1JJ2A 3GTPH 3S1NH 3HGBA 1C9OA 2BL5A 1EYGA 3MFYA 1XPUA 1YHAA 5FLMH 1GM5A 4NB3A 2VS1A 3ULPA 5BR8Q 2JA6H 3UDGA 1VCIA 1K3RA 1Q7YC 4GLAC 3JC66 3I4LA 1CKOA 1CKNA 2B3GA 2E76C 2Q2HA 5C44G 1B7YB 2IHEA 5BN5A 5LMNQ 4YWLA 4A3KG 2OWOA 4EQ5A 2B63H 4A3IH 3MXNB 4JK1C 3K7AH 5M5YH 2YU9H 4LF9Q 2R7ZG 2A69C 1ZKOA 1VQJA 4B3ML 4DR3L 4MNOA 4R4TA 2ZJPA 4OGQC 3CCVA 4BY1H 3DM3A 1B70B 2GN5A 4JI2Q 5C0XI 1UWVA 2ZM6Q 1IBKQ 4IFDG 2D5DA 3P20A 3CQZH 3G71A 5IYCH 4DV7L 3I73A 1Q81C 4B3TL 2MQHA 1QUQB 2V1CC 4AQYQ 1HZCA 4NXNL 2HHHQ 4JBKA 4A3BH 4NXML 3A8IE 1SMXA 1HZAA 1MKHA 2JXMB 2P2RA 2CTMA 3KYHC 3NBHB 4TQUS 3E9HA 4JOIA 3T53B 4JI4Q 4BBSG 4GKJQ 4DV2L 4A75A 1FL0A 2A6EC 3D31A 1YNJC 1N34L 1GKHA 3KF8B 1PH1A 1K73C 3KOJA 3STBD 1GUTA 1IBLL 1E24A 2QF7A 1TWFH 3PSIA 4X64Q 2QEXA 1GVPA 3S1RH 4JI4L 2MNAA 1KAWA 1HNXL 4YY3Q 1KQSA 1K0RA 3PIOA 5GAHC 2OTJA 2ANNA 1E7ZA 1V1QA 2JA9A 3E0EA 4UP7A 1N33L 3BU2A 1IL2A 3H3VH 2CPQA 5BN4A 5IP9H 1YJ9A 3AFQA 3GO5A 4DV7Q 3TS0A 4LFBL 2E2HH 3F2BA 4BA2I 2ZM6L 1HJPA 1PH9A 1L2FA 1LYLA 3EN2A 3M7NA 1I5FA 1IW7C 3I7FA 2K50A 3JAMc 5LMNW 3RN5A 1XPRA 2I5LX 1M90C 2R7ZH 2O5JC 2ZTEA 3U4VA 2PCFB 3OOCA 5AJ3L 4JI8Q 2B8FA 1PV4A 3HOVG 1KRTA 5GAGC 3Q8DA 4NBQA 1YZ6A 2VQFL 3U1KA 1E3PA 2UU9L 1Y8OB 3PUZA 3QIAA 1K83H 1MIUA 3ND8A 4R4IA 1VQ8A 2PMZE 2Q2TA 2ZTCA 5IT9c 1BBWA 1YJNA 1QVCA 1I94L 4H13C 1JMCA 4HIMA 3BJUA 4JOIC 2V4DA 3I72A 1XJVA 1OTCA 5M3FH 3ICEA 2BE5C 2JE6I 3S24A 1HH2P 2AKWB 3AB9A 1PH4A 1CUKA 4HIOA 2IX1A 1A6XA 4DV1Q 4HJ9A 1DCZA 5GAEC 3SDZA 2UUBQ 1H9SB 1ZTGA 1LACA 1QJOA 1VQPA 3GTQH 1KD1C 2UXBL 1JT8A 1NBWA 1VQDA 4AYBE 4OWTB 3M4QA 4QIWE 4IPCA 1N36L 3GTLH 1FGUA 2EVBA 1I50H 3NELA 2Q8IB 4P75A 1GO3E 2E2JH 1X3FA 2IT1A 1VDZA 2EJGC 5DLQE 3CD6A 3DXJC 1VS0A 5C4XG 4JI1L 4QMFB 3HOWG 2DNCA 1L0WA 4P71A 1H9MA 2EIFA 3CXCA 4A3IG 1I3QH 4KI0A 4DPGA 3K7UC 1E2WA 2Z6KC 3VR6A 3K81C 1Y1VH 4WALA 2AXYA 3TZUA 4RMFA 1QZGA 2DN8A 2OTLA 1VIHA 2CCZA 4DR7L 4MZ9A 4IFDI 5JJIA 2DGRA 2WB1E 1VQ6A 4P73A 2VQEQ 3PCOB 1TKWB 1J6QA 3KDFA 4BA1I 3ULJA 3T1YL 2HHHL 1N33Q 2NVTH 3S1MH 3TS2A 1HNWL 3CCEA 2NN6H 2ASBA 4KHPL 1TWCH 4JI5L 3OW2A 1FJGQ 3VR2A 3BZKA 1KIXA 2A1AA 3TRZA 3CPFA 3HOWH 2UXDL 1GJXA 3F2DA 3RLOA 2NN6I 4NPSA 4HJAA 2OCEA 1YITA 4IPGA 1CI3M 1Y8PB 3OTOL 3CP0A 3HKSA 2JA8G 1DT4A 2CTEA 2OQ0A 1VQ7A 2PQAB 5FJ8G 1SN8A 2WAQE 4LFAL 1BBUA 1HR0Q 4A3CH 4H0LC 3CCLA 2K4KA 4DNTB 3PO2G 3PO3H 5IWAQ 3HOYG 4X62L 2LXJA 1VQLA 4HJ7A 4KKTA 4LF5Q 4JYAQ 4DAMA 4B3RQ 4PG3A 5C3EG 4DV5Q 1WYDA 1EQRA 4DR5Q 2EXDA 5GQOA 1Z6HA 3F8TA 4PZ6A 2Z0SA 3TREA 3S17H 1BKBA 5K36G 1TWGH 5KNDA 4DV1L 4DR3Q 5IWAL 1G291 2PI2A 2BH2A 5IYDH 4H02A 2IY5B 1V8QA 2AHOB 2QGQA 2XTIA 3AYHB 3T1HQ 1K8MA 2RHQB 1Q46A 3L7ZC 2K5HA 2K33A 4A76A 3VDYA 3K0XA 1AH9A 3CCQA 1P16A 1IXRA 5BR8L 3KLRA 2LMCB 2WB1G 4OX9Q 2C35B 4A3FG 2NN6G 3SE0A 2R7FA 1EWHA 2A19A 1WJJA 5C44H 5M3FG 4GNXA 1T5EA 4QL5A 4A3KH 4LF8L 3RZOH 5IYBH 2D0OA 2GVAA 1T9HA 1XTDA 2UUAQ 4JI2L 1K1GA 1B8AA 3S14H 2PPBC 3I55A 2I0QA 4KN4C 2Q2IA 3KLWA 3FKIG 1Y8NB 1GHKA 4A3JG 5JJLA 1EWIA 3H15A 3OPOA 3NEMA 4A3EH 4JI7L 1CSQA 4BXXH 3RNUA 2OPUA 4HR7B 4Y7NH 4DV5L 1PFSA 2HIVA 4UPAA 1Q82C 1HNZQ 4L5SA 4IFDJ 1WE8A 2MJHA 3GTMH 2YV5A 3FPPA 3GTJH 2A6ED 4X62Q 3I4NG 1HCZA 3M85A 3D4RA 4OWXB 4KN7C 1P8LA 2CWPA 3U50C 3M4YA 5C3EH 2ZTDA 4B3SQ 1VQ9A 1HQMC 1TUAA 5K36H 1U0LA 1N34Q 3RR5A 3CAMA 2A8VA 1Q8KA 1X55A 3UE0A 1M1KC 4A3GG 4B3SL 1A8VA 4JI8L 5IYDG 3A8JE 1HNWQ 2E74C 1UE7A 1XNQQ 1VQAA 1D7QA 1X3EA 3ULLA 5IP7G 2RCNA 5LMUQ 1N36Q 1HNZL 2ZT9C 3AFPA 4JCVE 4O2DA 1KHMA 3NE5B 3JAMi 1ZZIA 3AEVB 4GOPB 4A3FH 1OXSC 1PH8A 1HR0W 3CCUA 3CCMA 4R4OA 1IBML 3U4ZA 2ALYB 4A3DG 2CTFA 4YWMA 1UEBA 1UE6A 4DR4Q 4DR7Q 5LMUL 5M3MG 3S2HH 2K5VA 4DNRB 3H0GH 1N32L 2CW0C 4KMUC 1MJCA 1HR0L 1RIPA 3DLLA 4TKOB 2JEAI 3WWVA 1C0AA 1R9TH 4LIJA 1IBLQ 5KNBA 4PV1C 3G6EA 4GNXB 3W5OA 2HT1A 4BXXG 4OO1G 4DV3Q 1VQGA 4G7HC 2E8GA 4DR1Q 1SLJA 3I4MG 5KNCA 4LUZA 2JK8A 4J15A 5FJ8H 4G7OC 2Y0SG 4GN3B 2AUJD 2K7VA 2MO1A 3N6RA 2UXDQ 4A3CG 1EOVA 3HOXH 3HKZG 1VQ5A 2A6HC 3HOYH 1PHJA 3U9SA 2F3IA 1GHJA 3CRKC 1NY4A 3BDOA 4KKSA 2HIXA 4DK0A 2PI2E 1NTGA 4O0AA 2JJQA 1ONLA 3HOZG 4BBSH 4JBWA 4GNXC 3QG1A 3ND9A 4DR6L 5M5XH 4IJLA 1KC8C 3KDFB 1QVGA 1DD2A 1NE3A 1PH5A 2OPVA 2FMRA 2YYZA 3CCJA 1AE3A 1E22A 2CFMA 2N78A 4FDBA 3B6YA 4JI0L 1CKMA 2H5XA 2BH8A 2K14A 2E2IH 1LM0A 3LNNA 3T51B 3W3AA 3QJYA 3UDFA 3ERSX 3J7ZC 2QA4A 2D2CC 1WVNA 1NMFA 2KCMA 1Q12A 4DUYQ 4OO1I 1EQQA 4LJZC 3UE1A 3CC2A 2N49A 3H0GG 1WFQA 4QY7A 4A3MG 3UDIA 2JA7G 4JVYA 4DUZL 1K8AC 2R92G 2ZJRA 2QNDA 1FYCA 3A0JA 1KRSA 4YCWA 3J80c 3CCSA 3FKIH 1LTLA 2JA5H 1YNNC 4DKAC 1DGSA 2AWNA 4GS3A 2BE5D 1PYBA 1UE5A 4MTNA 2Z6KA 3OW7A 4JI3L 4DV4L 1XNRL 1VQHA 2MFIA 3MEFA 2HH2A 4X65L 1Q1BA 2EJMA 2AWOA 4B3MQ 2PNHA 3I4MH 3PUXA 2VY3A 1Y69U 1SROA 3KF6B 2B8GA 5JEAJ 1QZHA 1HNXQ 1H95A 4LWCA 2OQKA 1O78A 4KHZA 1SE8A 4OX9L 1JJGA 4R4CA 4GN5A 2JEBI 3IKJA 2N3SA 1ASZA 1VQBA 1J5EQ 2A69D 4QGUA 4L8JA 4GOPA 4DV3L 4A3GH 3VR5A 4DV2Q 4P74A 3EQLC 4JG2A 4UP8A 5HGQA 4LF6Q 3V69A 4JVHA 2YTVA 1VF5C 3CPWA 2XGTA 3RZDH 1H9RA 3PO2H 1G6PA 3PF4A 4BBRG 2JQOA 1N8RC 4X65Q 5FLMG 3S1QH 4K0KL 1DTJA 5E7NA 2NVYH 4LUVA 3VKEA 1E2ZA 4DR2L 2A6HD 2R7DA 4DR5L 1HZBA 5C0XG 3A8KE 4B3RL 3EIVA 1EC6A 3A7AB 3MXUA 3S2DH 4PZ8A 3BG3A 1WCMH 2RHSB 4DV6Q 3NENA 1XMQL 4GLVB 3PUWA 1AE2A 2KA7A 2BA0A 4X64L 2CQOA 1OXVA 2AMCB 1QVFA 4A3LH 2WAQG 2A68D 1HPCA 2KHJA 3K8AA 1YIJA 1G51A 1OXXK 2E3UA 1PH7A 4IOCA 3RLFA 1VQOA 4X6AH 1VQMA 2MO0A 5JJKA 5BN3A 1YHBA 1PH2A 1X9NA 3CCRA 5EAYA 4LW1A 4LFCL 4JI0Q 1C7YA 4KHPQ 4G7ZC 5GADC 2CKZB 3VR4A 3FP9A 5IYBG 3CW2C 4JI6L 3HOZH 1SR3A 5JEAG 4OONA 4UP9A 4XTCS 1WI5A 3PUVA 1CSPA 2R93H 1Y14B 2F4VL 4C3IH 4KKUA 1Q90A 5J3BA 4JI7Q 1FVIA 1EIYB 1X3GA 1IZ6A 1B9NA 2CWAA 2PNRC 2K52A 4DK1A 1EIFA 4YWKA 2VUMH 4HJ5A 1GUSA 3M3YH 3GQBA 4JBMA 4LFCQ 4Y52H 3TEHB 1TWAH 4LFAQ 3PO3G 1D8LA 4DUZQ 1TWHH 4X66Q 4JC0A 1PMRA 1IYUA 4IQZA 4GZYC 1IYJB 1PYSB 1Q86C 2CTLA 3A5UA 2JA6G 2JVZA 5A35A 3GD7A 2YTYA 3H3VI 4H44C 2VNUD 1H9JA 1Q1EA 1YI2A 1GUNA 1ZZJA 1VQIA 2HQLA 3E9IA 4GKJL 1Z7TA 3W1BA 4A3MH 2UU9Q 3OYYA 2JA7H 3CC7A 4A3DH 5IY0A 1A63A 2WP8J 2VW9A 4AH6A 1V43A 1WOCA 1XMOL 1XMQQ 5AJ3Q 3J81j 2YTXA 3TQYA 3G48A 3K80C 2UXCQ 2UXBQ 1NMGA 4POFA 1Y1WH 1IBMQ 3IFTA 5IP7H 1HTPA 5IYCG 4AQYL 3KFUA 1K8OA 1SRUA 4C2MH 2N8NA 4DAYB 2Q2UA 1QUQA 4B3TQ 3M4PA 2FXQA 2EJFC 3ER0A 1A62A 4R1JA 4DR6Q 4IO9A 1S40A 4JYAL 5ELOA 3S16H 3LWUA 2O5IC 1VQEA 1YEZA 5ELNA 4A3LG 1KL9A 5M3MH 4LF4L 1EUJA 2LXKA 4YY3L 1XPOA 4YHHL 2B29A 3L0OA 4DV0L 4PZ7A 4RCNA 2R93G 1ASYA 1J5EL 1I6HH 1BVSA 4DUYL 2KHIA 2E75C 2VUMG 3BZCA 4ALPA 1E1OA 1W3SA 2VQFQ 1X65A 1SMYC 3GTGH 4LF4Q 1JB7A 4X66L 3STBC 3U58A 2LSSA 3W1GA 1OXUA 1N9WA 5C4XH 3VA7A 1KXLA 2NVQH 2BDOA 5IP9G 4DR4L 3I4OA 2EQSA 5C0XH 1A0IA 2NZHA 4A93G 4IPHA 3I4NH 1JE5A 4ME3A 5GROA 1K8GA 2ZJQA 4LUOA 1WCMG 1Z47A 3A5ZB 3RLNA 1NJIC 3VR3A 1S3OA 2CTKA 1IW7D 3EBEA 3J81c 2ANRA 1O7LA 2BA1A 2K32A 1U5KA 1X4MA 2PQUA 3HFZB 3CF5A 3RN2A 1Y1WG 2GVBA 2Y0SE 4GKKQ 2YQRA 3F1ZA 1BDOA 4LF7Q 4EX5A 2KCCA 5LMNL 1CFMA 2NVXH 1LABA 3D0FA 3ZJYC 3FHWA 2AUKA 3PIPA 2RF4A 3S15H 3PV0A 1L1OA 1YJWA 2KENA 3T1HL 3A7LA 1VIGA 5HY6A 2HH3A 2B63G 2IHFA 3KF6A 4GKKL 3J80i 4YHHQ 4R4QA 4DV0Q 3LGJA 2IX0A 4IPDA 3FMCA 2NZOA 1PH3A 4B8TA 2R92H 4L5TA 4DV6L 4BY1G 4DK6C 3KJPA 2A68C 2KCTA 2JA5G 3J7A5 4QJFA 5M5WH 2I5MX 1CKNB 2E5LL 4LFBQ 2JA8H 3CMEA 4YCUA 3H94A 4OO1H 1Z9FA 3AQQA 2DUDA 1IBKL 1XNRQ 4LF5L 1FR3A 4P72A 4JV5Q 2UXCL 2PY9A 4APVA 5C4JH 4JI6Q 4IOAA 4JBJA 3HOUH 2EDGA 4K0KQ 3HOXG 2DNEA 1XMOQ 1ZZKA 1PA6A 4IJHA 3PGZA 1PVOA 2UUCL 4BY7G 2PQAA 4LF8Q 1PH6A 3SGIA 4AYBG 4C3JH 4A93H 2VZAA 1VQCA 3M4OH 1I94Q 4WJ3M 2K75A 4JV5L 2JZXA 4PMWA 1RL2A 5IE8A 1DXMA 3A74A 2K5NA 2KBNA 4A4IA 1TXYA 2F52A 1Y1VG 1X56A 4TVAB 4DK3C 1LUZA 3L2PA 3CMAA 4A3JH 4JI5Q 1EFWA 3WDNA 1JJCB 4NXMQ 4BBRH 3GDEA 1L1OC 1E2VA 3F2CA 3T1YQ 2DGYA 3CC4A 2VQEL 4DR2Q 1S72A 4C3HH 1X6OA 5FLXc 1VQNA 2VL6A 2D0PA 1YBYA 1GUOA 1J5KA 4I7ZC 1E1TA 1K9MC 4DR1L 4LF9L 2I5HA 2R6GA 2UUAL 1VQ4A 3T56B 2CTJA 3GTKH 1ZYRC 2D62A 4OXPA 2L15A 3IRBA 3HOVH 1L1OB 1X4NA 4A3EG 4L5QA 4HIKA 1H9KA 3PF5A 1IYVA 4IFDH 4JI1Q 3M9BA 3OTOQ 3G4SA 4HJ8A 4LF7L 1GUGA 3CRLC 3GTOH 1W2BA 1YNXA 3HOUG 1I6VC
chains in the Genus database with same CATH superfamily
1B9MA 4FXKC 2UUCQ 1TU2B 3J81i 4BY7H 4DNIA 4WJ4A 3HKZE 1BCPB 5CYUA 5A2QW 4AIMA 4NXNQ 2K5QA 4NMZA 4LNQA 1H9SA 2EYOA 2EYFA 3QR8A 3NSWA 1V9NA 1VQKA 1V9PA 2WFWA 1N32Q 3WOEA 1C9OA 3GV3A 2F3VA 4R8NA 1XPUA 5FLMH 1GM5A 4NB3A 3ULPA 5BR8Q 2JA6H 1Q7YC 2VUMB 1STAA 5C44G 2E76C 3HOWH 4A3KG 1EOTA 2B63H 5BN5A 4WJ3M 1BO0A 4EQ5A 4LF9Q 1I3QB 1U4RA 4DR3L 5C3XA 5C0XI 1PTOC 3VYSA 4FXDA 1IBKQ 2D5DA 4OIJA 5E3FA 1I4GA 5IYCH 4A3LG 3I73A 2MQHA 4NXNL 3I4MB 1PDQA 4A3BH 1F77A 1PRTB 3A8IE 5I6YA 1SMXA 1HZAA 2F0EA 1AP0A 1MKHA 2RA4A 1SYGA 3KYHC 2HUGA 4JI4Q 4BBSG 4A75A 3I3CA 3TP5A 1FL0A 4LFAH 4J1MA 1N34L 1PH1A 4YHHH 4DV0H 2K04A 1K73C 3KUPA 5FLXL 1IBLL 4X64Q 2QF7A 1TWFH 3PSIA 1PRTC 3S1RH 4JI4L 4LF4H 2MNAA 1JOKA 3PIOA 4H8AA 2L4NA 5NUCA 1V1QA 1LTRD 2JA9A 3BU2A 3H3VH 3MZ5A 1YJ9A 4LFBL 3TS0A 1VMPA 3H6MA 2A5HA 4JI2L 1IBMH 1L2FA 1LYLA 3EN2A 3V96A 3JAMc 2FINB 3U4VA 2PCFB 1PV4A 2J4XA 1KRTA 5GAGC 3U1KA 2HCIA 4NBQA 3MAQA 1E3PA 1Y8OB 4HAEA 1K83H 4B3SH 1SE4A 2ZTCA 1I94L 5ISRA 4JOIC 2V4DA 2BE5C 3S24A 3GTLB 1HH2P 3QWNA 5CBAE 4HIOA 4IZ8A 2IX1A 4HJ9A 5GAEC 2MHVA 3SDZA 2UUBQ 3UOEA 2F0VA 4HCSA 1HXYD 1KD1C 2UXBL 1TWAB 1NBWA 5EKIA 4WFN3 4WJWA 3M4QA 3BS1A 1N36L 1FGUA 1I50H 2EVBA 5FKAC 2E2JH 2IT1A 2EJGC 1EY5A 1EYCA 2N88A 1VS0A 1STEA 4DXFA 1DOKA 1L0WA 1JOQA 5C5MA 1Y1WB 4WALA 4FO2A 2CH4A 1QZGA 2DN8A 3Q24A 2Z1CA 2CCZA 2OTLA 4DR7L 4DR2H 2AQ1B 2VQEQ 4DV1H 1TKWB 3KDFA 4N9TA 1EYDA 1N33Q 2NVTH 2L9HA 2ASBA 3QO2A 2UXDL 4NZRM 2RDGA 4HJAA 2NN6I 4NPSA 1YITA 2OCEA 4IPGA 1CI3M 2NTSA 4IN3A 1EIHA 2QEJC 1SN8A 2K01A 1BBUA 1HR0Q 3HOYG 4X62L 3K5NA 4HJ7A 1CQFA 3S17H 2EXDA 4AYBB 1Z6HA 4PZ6A 2Z0SA 4B9XA 5K36G 3KDGA 5KNDA 1PTOF 1DM0B 5IWAL 5CV4A 2PI2A 1BBXC 1YNJD 2MPMA 4A3JG 4B8CD 1AH9A 3CCQA 2F03A 1XX8A 5JPMC 2LMCB 3D4DA 2NN6G 4FXGC 3J80W 4A3JB 4A3KH 1J5EH 1R4PB 1BNZA 2J7ZA 5A2QL 1XTDA 4DGZA 2HQEA 2K28A 2EY1A 4LF6H 1Y8NB 1GHKA 4K5WA 2EY5A 3OPOA 3NEMA 3DM1A 2KVMA 3OWFA 2KCNA 3RNUA 1HNZQ 4DV5L 2HIVA 2M6QA 2MJHA 4L5SA 4ABNA 5C4XB 3GTJH 4X62Q 3HOVB 3M85A 3D4RA 4OWXB 1ICWA 1VQ9A 5K36H 1WTVA 4I65A 1WCMB 1Q8KA 2R61A 2AQ3B 1M1KC 1S5ED 2E74C 1UE7A 1VQAA 1X3EA 2RCNA 5LMUQ 2ZT9C 1K0SA 1B44D 5DAUA 1ZZIA 5FO7B 3S16B 5DEHA 5EJWA 2ALYB 2XSCA 3MC0B 3ZYYX 4YWMA 4DR4Q 1UE6A 1SE3A 2CTFA 3TP7A 4CDCC 5M3MG 3T16A 1KLGD 1W6KA 4KMUC 1C0AA 3PO3B 1J8IA 1IBLQ 5KNBA 1KDCA 2Q8RE 4G7HC 1CA6A 1ILQA 4K2KA 4DR1Q 4EVOA 3M4OB 4G7OC 4GN3B 2PYKA 1XXGA 1G2SA 1EY8A 2F3IA 3BDOA 4KKSA 4BBSH 1XMQH 4QB4A 4R8IA 5K5PA 4IJLA 4ZUIA 1HFNA 1QVGA 1PH5A 2OPVA 2YYZA 2N78A 4FDBA 4RFBA 5I4DA 4DV7H 1CKMA 3LNNA 3T51B 4ZKCB 5KYLA 3UDFA 3QJYA 3NHHA 2IPKD 4DUYQ 1STNA 4LJZC 3CC2A 1ML0D 4QY7A 4JVYA 4DUZL 2R92G 2OTJA 3CCSA 3FKIH 4KK7A 2AWNA 3V05A 4HMIA 4JI3L 3OW7A 4DV4L 5I9PA 4ZQ3A 2UUBH 2D9IA 1VBIA 4QMGA 5C3WA 2VY3A 1SROA 4KD4A 2XWBB 1H95A 2B2VC 1TWHB 1SE8A 2SNSA 3NQTA 3OMGA 4CJ1B 4F7XA 2JEBI 5CGKA 4CGYB 2A69D 4A3GH 4GOPA 4DV3L 2Z6BA 4K8IA 4A3EB 4JI0H 4P74A 3EQLC 1DJRD 1XTCD 1VF5C 3CPWA 1H9RA 1EY7A 3HOUB 2LRRA 4X65Q 4M1UB 1SSOA 5E7NA 1E2ZA 3TP6A 2A6HD 1HZBA 5C44B 4B3RL 3A7AB 3D8GA 3S2DH 2B2TA 4PZ8A 1WCMH 3NENA 1AE2A 4EGVA 4JI6H 2KA7A 3P75A 1OXVA 2JA8B 2I46A 2A68D 2E3UA 4EC5A 3HKZB 1UEAB 5BN3A 4K6LA 3HP3A 4KV6A 3GTJB 2OF1A 1F9QA 4ZKBB 1S4ZA 5C3EB 1C7YA 3H3VC 3HOZH 2CKZB 1WTOA 1SR3A 1ODHA 1WI5A 2RBMA 1CSPA 3OSOA 4ZCKA 4C3IH 1STYA 1ESRA 1FVIA 3MTSA 1IZ6A 1B9NA 2X6GA 5IT9L 1EL0A 3HOZB 1MSHA 3GV6A 5IT9W 4GZYC 4IQZA 2CTLA 1WTQA 3A5UA 3M7GA 1I6UA 2QDLA 2IWHA 1GUNA 2HQLA 5HGTA 3W1BA 2UU9Q 5IY0A 2WP8J 3A55A 2VW9A 1XMOL 5AJ3Q 1WTXA 3J81j 4CJ2C 3TQYA 1KDBA 2UXBQ 1RD9D 1Y1VB 4POFA 1V1PA 2MP1A 5IGDA 5IGBA 4RGNA 2MJ8A 4FF3A 3KFUA 4J8QA 3ER0A 3L3OC 4YIJA 5LL6S 4IO9A 2O5IC 1YEZA 1KL9A 5M3MH 1PRTF 3L0OA 4KJNA 2K1BA 3K5OA 1TT2A 1ASYA 4X66H 4A3GB 2NWGA 3A56A 1KLUD 2KHIA 2E75C 3BZCA 4KY7A 1W3SA 1SEBD 5DM73 3TBIB 1WTWA 4LF4Q 2RDHA 4IUNA 1N9WA 4RHRA 4XQNA 2E2DC 5GROA 2Q8TA 2CTKA 3EBEA 3J81c 1BF4A 2Y3MA 1O7LA 3HFZB 3O13A 4LF8H 4LMQD 1R9TB 1CFMA 4F8MA 2RF4A 2B2WA 3PV0A 4RKLA 4KD3A 1SMYD 2IHFA 4GKKL 3FMCA 4L5TA 3MXNA 3T1YH 1MHWC 2A68C 1BCPD 3KF8A 2I5MX 1SNDA 2JA8H 3CMEA 3AQQA 3H94A 4JV5Q 2DUDA 3RF2A 4P72A 4B3MH 4APVA 5C4JH 4JI6Q 4IOAA 4JBJA 3NUCA 1SEIA 3MFGA 2EDGA 1B4OA 1TVXA 2DNEA 1ILPA 1ZZKA 2F0MA 1PA6A 1ICFB 1MSZA 4KJOA 1PVOA 2SOBA 1JE4A 3RMHA 3OIPA 2PQAA 3L9AX 1IKMA 4AYBG 1X9ZA 4A93H 2VZAA 3M4OH 4C1NK 2K75A 2JZXA 5FO8B 3A74A 2B2YA 4RKBA 4DK3C 4ZAIA 5L37A 2FJ2A 3GDEA 3S14B 1EZ6A 1YBYA 1J5KA 4I7ZC 1AN8A 4S3SA 2DY8A 3HS0C 4FVMA 2L15A 1X4NA 1H9KA 3FKIB 4LF7L 2X06A 3CRLC 1N8RC 2UUAH 2WIIB 1D5XC 1D6EC 1OXTA 2KEEA 4KY5A 1CTMA 3QB3A 4OWWB 1MJEA 1X54A 2F1MA 1J4WA 1O7YA 1KHIA 5JEAH 4DV4Q 4JI3Q 4XXEA 3AEVA 2UUBL 2WKDA 4LK1C 2CW0D 2F4VQ 2E5LQ 2ATWA 1RJTA 3HOWB 4X3KA 4YCVA 5H1SE 3KJOA 3GTQB 2ES2A 4HIDA 4LF6L 3D6WA 4K5XA 1YVCA 1AW7A 3AU7A 1HZ9A 3S1NH 3GR5A 3HGBA 3SHLA 1N34H 1PTOB 4RGMA 4B9WA 2VS1A 3UDGA 3JC66 1CKOA 1CKNA 2B3GA 2Q2HA 1XJVA 3OTOH 5M3MB 2OWOA 3S9WA 3K7AH 4FJUA 4FJSA 1VQJA 4BY1H 4R4TA 4OGQC 4JI2Q 2GN5A 1UWVA 4JV5L 5ELEA 3CQZH 4DR4H 4CDDC 4KHPH 1C48A 3AEVB 4JBKA 1HZCA 1RDPD 2G5DA 2F0QA 2WKCA 3NWTA 3KLSA 2JXMB 4BY1B 1PZID 3ERQA 2CTMA 2P2RA 3DWQA 4DV3H 2FFMA 1PYWD 4U673 1YNJC 1GKHA 4ZRZA 2QEXA 1MBYA 1GVPA 3RD4A 1KQSA 2NTTA 3E0EA 4C3IB 1IL2A 1SFOB 1AZPA 2DY7A 4DV7Q 1PH9A 4BA2I 3M7NA 2R7ZH 3RN5A 3J7AF 2I5LX 2HDMA 2F0DA 3OOCA 4BS9A 1F9RA 3Q8DA 5EBDA 4DUYH 2L12A 3PUZA 1MIUA 2Q2TA 2PMZE 3I8ZA 5IT9c 3I91A 1QVCA 1D2BA 1OTCA 5M3FH 2JE6I 2WACA 1G8ZD 1PH4A 2FFKB 1A6XA 2LKVA 4IUTA 2R92B 3HG9A 1QJOA 1VQPA 2EE1A 1VQDA 4AYBE 4OWTB 1QNKA 4IPCA 4K5VA 3GTLH 3E3XA 5CMDA 3Q6SA 1VDZA 2XIWA 2E2JB 5KEEA 1LTGD 4O1NA 4QMFB 4A93B 2EIFA 3CXCA 4CJ0B 3SR1A 1F9PA 1IHZA 2XNAC 3TZUA 2NVQB 1VIHA 4LF5H 4MZ9A 2WB1E 4P73A 3PCOB 3S1MH 2HHHL 4DV6H 2K6AA 3NTIA 1AFPA 4LFBH 2NN6H 3QOLA 1TWCH 3C1EA 5F2DA 4JI5L 4JV5H 4IALA 3QD7X 1ZXTA 2A1AA 5E4XA 1K83B 4OX9H 1I4RA 2JA8G 3K57A 2CTEA 4NZTM 5CBEE 5FJ8G 4JPBW 3J81L 4H0LC 3PO3H 2K4KA 3DHQA 3EJIA 5IWAQ 2RVLA 1GXDC 4LF5Q 4JYAQ 3LWEA 5C3EG 4B3RQ 2AQ2B 1WYDA 5GQOA 4QF4A 2BOSA 4DUZH 1S5CD 2BH2A 4H02A 4F88A 1V8QA 1LT4D 2A8VA 3K59A 1JCKB 1Q46A 3L7ZC 3J80L 3GTKB 1P16A 1HUNA 3BVZA 3KLRA 2WB1G 5I6WA 3FEWX 5LHY1 1EWHA 1WJJA 1T5EA 2MUYA 3NQIA 4KN4C 1FNVA 2Q2IA 3WOFA 2Z9HA 1EWIA 1Q8IA 1EY9A 3NPPA 3H15A 3Q0AA 1CSQA 4JI7L 4UPAA 3GTOB 2LTMA 2ZXPA 1C8CA 5FLXE 2CPMA 2A6ED 3D3RA 1HCZA 2D9UA 3U50C 4KN7C 1P8LA 3Q23A 3X3NA 1TUAA 3CAMA 5C4ZA 4A3GG 4B3SL 1A8VA 1HNWQ 1S20A 3I70A 1TWFB 4BWGB 3EZJA 1STHA 5IP7G 1KHMA 3AFPA 1F2LA 1EQTA 1OXSC 3OSSD 2LF0A 1IBML 3U4ZA 4Y7NB 4HSVA 5CV8A 3S1QB 2EYLA 3K7AB 4G4KA 4ZK9B 4GNXB 1G91A 2HDLA 5E4WC 4BXXG 2SEBD 1SLJA 2JK8A 5FJ8H 5FOBB 1EOVA 1EYAA 2A6HC 4IUUA 1EEID 2SDFA 4O0AA 3SK6A 4JW0A 4JBWA 3CHBD 2IX3A 1NE3A 2FMRA 3VYUA 2RSNA 3CCJA 2CFMA 4B3TH 2L11A 1NAPA 4IURA 1KABA 3A54A 5EKKA 4ZLTF 2E2IB 4XYQA 3W3AA 1S5DD 3ERSX 2D2CC 4PNYA 5CORA 1Q12A 3UE1A 3C46A 4H7BA 3UDIA 4DN4M 2VKCA 2ZJRA 1PFBA 1KRSA 1YNNC 1DGSA 4GS3A 1F2ZA 3D6CA 2HH2A 3NTKA 2IL8A 2L55A 4R9WA 3NBHA 3KF6B 2B8GA 5JEAJ 1F2YA 4LWCA 3CQZB 1DOMA 4EQNA 3DWAA 4KHZA 2JN4A 4C1NI 1JJGA 1AZQA 1LT3D 4GN5A 4DFAA 4L8JA 5LL6X 1QG7A 4MHEA 4DV2Q 4JG2A 3SK4A 1PLFA 5EPJA 4LF6Q 3RZDH 1BR9A 2PZWA 2JQOA 3S1QH 3W2DA 1DTJA 4LUVA 5T1GA 1LT5D 3VKEA 4DR2L 2R7DA 3J81W 3A8KE 3EIVA 4A3IB 1EC6A 2EZVA 4DR3H 3BG3A 4DV6Q 3S2DB 4CDEC 1QVFA 4A3LH 1HPCA 2TSSA 1G51A 3RLFA 1EY6A 3NK9A 2MO0A 1YHBA 2PZUA 5EAYA 4JI0Q 2UXBH 4KHPQ 5GADC 5IYBG 2RDFA 3UI2A 1UG8A 2HHHH 4OONA 3JAMW 4XTCS 4KKUA 1X3GA 2K52A 4YWKA 2PNRC 4PDBA 1EIFA 5ELBA 4DR5H 1GUSA 3GQBA 1MGSA 1TWAH 3PO3G 1D8LA 4DUZQ 1Q86C 1HRJA 2KECA 5IGEA 1V8CA 1IYJB 1RODA 1NSNS 2VXWA 2YTYA 5A35A 5CV5A 3H3VI 2LTLA 3T1HH 3CKIB 2VNUD 1H9JA 1M4VA 1Q1EA 4XT3B 1YI2A 4DR1H 1ZZJA 4GKJL 1EY0A 3OYYA 2KQ3A 2YTXA 3G48A 2UXCQ 5I2XA 4AQYL 4B3TQ 2R93B 3KDKA 4A3FB 1S5BD 4FNFA 1VQEA 1ENAA 2B2WC 1XPOA 2R93G 4RCNA 1HA5A 4QIWB 1I6HH 3R3OA 4CDFC 2FMCA 2EXZA 1EFID 5BR8H 1SMYC 3GTGH 1PRTD 4O42A 3U58A 3PQIA 2EYMA 1YNND 2LSSA 3W1GA 1OXUA 3H09A 3VA7A 5JAVA 2BDOA 5IP9G 5C0XH 1A0IA 2NZHA 4A93G 1A3UA 1NJIC 1Z47A 3A5ZB 4HMJA 1J9OA 4A3KB 2K32A 1U5KA 2QDBA 1EY4A 1Y1WG 3RN2A 2Y0SE 3FAUA 1BDOA 4DV2H 3D0FA 3PIPA 4TRDA 2KENA 3T1HL 2HH3A 5AFWA 5HY6A 2B63G 4JI5H 3KF6A 3LGJA 1KNAA 3KJPA 3J7A5 2WINB 5M5WH 2E5LL 4LFBQ 1IBKL 1SXTA 1TS4A 4K0KQ 1XMOQ 4IJHA 3PGZA 3HOYB 1S03G 4CKEA 4LF8Q 4JI1H 4C3JH 1VQCA 2LFNA 4PMWA 2Y0SB 1RL2A 4FF2A 5M9OA 2F52A 1Y1VG 2N55A 4A3JH 1LUZA 3NTHA 1B2TA 4QUFA 1WTRA 4RA8A 1QNUA 5C4HA 1E2VA 3F2CA 4XYOA 2G8YA 4C3HH 4K8JA 2NB0A 1VQNA 1E1TA 4KHVA 1K9MC 1X3PA 4NP5A 4LF9L 4DXGA 3T56B 2XWJB 3IRBA 1SJHD 1L1OB 3PF5A 4HIKA 2PZTA 4JI1Q 3GTOH 2NYZD 1I6VC 3H0GB 1RTNA 4WANA 1YHQA 1QOHA 4POGA 4XIGS 1VQFA 2ZM6H 2ID0A 1WTPA 1IBKH 4Q5VA 3J7YW 3I4NG 3PUYA 1SFOH 5CC4A 4L5RC 2A74C 4KLKA 1ET9A 4GOPC 4GN4B 2ICIA 2BL5A 3GTPH 5CV7A 3X3MA 1EYGA 3MFYA 1YHAA 3FVQA 3MXPA 3K6OA 5IGGA 4DR1L 2PQUA 2IHEA 2PO4A 2IW3A 4YWLA 3JAML 4JK1C 5M5YH 2A69C 4B3ML 5ELCA 2BDNA 4MNOA 3CCVA 2ZJPA 2NVYB 4IUQA 1LV9A 4X3SA 2LS01 4I7AA 4PQXA 2ZM6Q 2F0OA 1JT8A 3P20A 3I4MH 2XN9C 4B3TL 1LTTD 1QUQB 2V1CC 2HHHQ 1I4PA 2PQEA 3ITPA 4TQUS 1QILA 4GKJQ 1SNCA 2X69A 1IL8A 1CA5A 3KOJA 3STBD 3HOXB 1E24A 4EQPA 5J22A 1WVLA 1U4PA 2RKSA 4NKLA 1KAWA 3VYTA 5IODA 1HNXL 1K0RA 1N36H 2CPQA 1NXUA 3AFQA 3BVMA 5LMNW 1I5FA 2K50A 1C4QA 3BDLA 1XPRA 1M90C 2XRSD 2ZTEA 2O5JC 2ICEC 2M2LA 5AJ3L 1HNZH 4JI8Q 4LF7H 1DYQA 2JA6B 2WV6D 2UU9L 1LTAD 4MN3A 3LX0A 4XQJA 4WORA 1YJNA 4H13C 4HIMA 2PT7G 1LTID 2AKWB 1DCZA 2LY7A 1LACA 1PQXA 2ZQEA 3DEOA 3EA6A 1L0XB 1XMOH 2Q8IB 3DXJC 1UNSA 5J1ZA 1QE6A 1IBLH 2DNCA 2UUCH 4K2LA 1I3QH 1SYEA 1MSGA 4KI0A 4DPGA 2Z6KC 3K81C 2JSOA 1Y1VH 2CQAA 2C9OA 2DGRA 1U9RA 2DJFC 2PW7A 1J6QA 1JR0D 2K03A 3ULJA 3T1YL 3MVVA 4HN7A 5DM63 4C3HB 3CCEA 4Q0FA 4TSSA 3VR2A 1AN7A 1GJXA 4OD6A 4XT1B 5DT9A 5LMNH 2R3ZA 1Y8PB 3HKSA 2OQ0A 1VQ7A 1SYBA 3CCLA 3AMUA 4JI7H 3Q22A 4DAMA 4FYDA 5EPKA 4DR5Q 3F8TA 4NXMH 2EOTA 5ELDA 2K5WA 4DR3Q 1G291 1SNQA 2IY5B 2QGQA 5M3FB 3AYHB 1HNWL 2B2YC 4A76A 5DNFA 2NVXB 3S17B 1G6ZA 1IXRA 5BR8L 1KNEA 4P2CB 2C35B 4A3FG 1F2MA 5JVH3 3I90A 4GNXA 5C44H 3RZOH 5M3FG 1STGA 5IYBH 2D0OA 2GVAA 1T9HA 4N8FA 5G3LD 1K1GA 1B8AA 4DR6H 3KLWA 4A3EH 2C5CA 4Y7NH 1PZKD 1PFSA 1Q82C 4IFDJ 1WE8A 2F0JA 3GTMH 2FMMA 3FPPA 4FF4A 4V190 5FLXW 4QQBX 2X6LA 5C3EH 2ZTDA 2OXPA 1SE2A 1N34Q 4F87A 5CR3A 5E1FA 2GA4B 3UE0A 3GTGB 4JI8L 3A8JE 1BQQT 4PMBA 1B3AA 1XNQQ 1FKAH 2VB2X 3ULLA 1N36Q 3NE5B 1MD2D 1A2UA 3JAMi 4A3FH 5IGFA 1PH8A 3CCMA 4R4OA 1NR4A 1O7ZA 5LMUL 3S2HH 3PIP3 2K5VA 4DNRB 1XRHA 1RCVD 4OHJA 3DLLA 2CH4W 4TKOB 2JEAI 4LIJA 3G6EA 3W5OA 4OO1G 4MTKA 5C4JB 5KNCA 3BZDB 3I4MG 1K3BC 2Y0SG 2AUJD 2MO1A 3S1MB 3FPUB 3HOXH 1PHJA 1K28A 4BBSB 1GHJA 4X3UA 2KEDA 2CWFA 2HIXA 3HOZG 2PI2E 3PIO3 2JJQA 1A2TA 3J80E 1KC8C 5JOBA 3KDFB 1LO5D 1DD2A 3NP8A 3B6YA 4JI0L 3SVMA 3U9OA 1LM0A 1ZEQX 3IFDA 3NCVA 3S15B 4GKKH 3J7ZC 4JVZA 1A3TA 2KCMA 3KBXA 3E0JA 5M5YB 4OO1I 3H91A 3H0GG 1WFQA 4A3MG 2JA7G 2KUMA 1K8AC 3OWEB 4DV5H 3R2IA 2JYOA 1FYCA 4YCWA 3SXHA 2CWHA 1I4QA 1JORA 4DKAC 1LTSD 3BYYB 4HSPA 1PYBA 1UE5A 2Z6KA 1XNRL 3MXGA 4N8X1 3MEFA 3T4AC 1L0YB 1Q1BA 3PUXA 1HNXQ 3RZDB 5CV9A 2F0SA 4OX9L 3SEBA 2N3SA 3KBGA 1VQBA 4QGUA 3VR5A 4JVHA 4UP8A 1SYDA 5KIXA 3PF4A 4BBRG 1G6PA 4K6DA 1QB5D 2NVYH 1DZ1A 2XRQD 1U4MA 4DR5L 5C0XG 4ODGA 2RHSB 3DWPA 4GLVB 3VA5A 4X64L 2CQOA 5KYIA 2AMCB 2PW5A 2WAQG 2RCFA 2KHJA 1F9SA 1YIJA 3TMEA 2QKIC 1PH7A 1VQOA 4DAVA 1VQMA 1X0AA 1XNQH 1RHPA 4IUPA 4LFCL 4G7ZC 3VR4A 4C3JB 2L1BA 1CQVA 1HR0H 4UP9A 5M5XB 1HFGA 1Q90A 5J3BA 1RKNA 1EIYB 2F3WA 1R4QB 4DK1A 3M3YH 1JWUD 4JBMA 5I9OA 3TEHB 1Z2IA 1TS5A 3OETA 1IYUA 1PYSB 2JA6G 5FO9B 2VQFH 4OELB 3CC7A 1WOCA 3K80C 1NMGA 1Y1WH 5IP7H 1HTPA 1K8OA 4C2MH 2N8NA 1QUQA 3M4PA 1WTJA 4HTHA 4JYAL 3BYTB 1EUJA 2LXKA 4YY3L 4PZ7A 4C2MB 4CKBA 1BVSA 2CHBD 2B2UC 2VUMG 1E1OA 2VQFQ 2L0CA 2F0KA 2NUCA 3SK5A 4X66L 1PTOH 2O4XA 1WD0A 4ME5A 4YY3H 2F0IA 4FP5D 3EROA 4DR4L 2EYJA 1ZYRD 1NCVA 1U4LA 1JE5A 4IPHA 3I4NH 1K8GA 2NVTB 2ZJQA 2QILA 3VR3A 4C56C 2VB3X 1X4MA 3JAME 4G57A 1EQVA 3CF5A 2YQRA 2GVBA 4GKKQ 3F1ZA 3I0PA 1KDAA 2KCCA 5LMNL 2EY2A 4EQOA 3K0YA 1D1KA 3FHWA 4C3HG 3S15H 3KK7A 1CHQD 1VIGA 3K58A 3J80i 4YHHQ 4DV0Q 3S1NB 2H4OA 2NZOA 1PH3A 3GABA 2K5DA 3TP8A 4BY1G 2KCTA 3SK8A 1MI2A 4QJFA 4G08A 4YCUA 3S1RB 1XNRQ 1FJGH 5C6AA 3NXWA 2PY9A 2QW7A 5TSSA 3HOUH 1ET6A 2A1SA 1CHPD 1JICA 1RTOA 1A3VA 2UUCL 4BY7G 4J6HA 5KRUA 2G9HD 3SGIA 1EEFD 2RSOA 5G3LF 1DXMA 1LT6D 2K5NA 2KBNA 3HZXA 4A4IA 4K14A 1X56A 2Z4IA 4TVAB 4JYAH 4JI5Q 1EFWA 3WDNA 2B2UA 3URYA 4NXMQ 4BBRH 1L1OC 3T1YQ 2DGYA 4RH6A 5IIFA 3CC4A 1X6OA 4RHSA 2O2LD 1TWCB 2D0PA 1GUOA 2ZXRA 1ENCA 1HA6A 1VMCA 2I5HA 4DF7A 3PMFA 1VQ4A 1ESFA 3R8BA 5EKLA 3GTKH 3HOVH 4PMCA 1BCPC 1TIID 4L5QA 5C5LA 1IYVA 1QCBD 3OTOQ 3G4SA 4HJ8A 1GUGA 4UAIA 3TSSA 1W2BA 2HD3A 1ZTGA 4OIKA 4A3BG 3J7AK 3I2ZA 3G6JB 4UY8C 4AM3A 4Z9CB 1EWCA 3E5SA 4JI2H 1JQYD 4RG1A 1FJGL 4GLXA 2O4CA 1O7IA 3QOJA 2L5TA 3UDXA 4ULLA 4A3BB 1GD7A 1VF7A 4CHTB 2M9VA 2K1HA 4LFCH 1UE1A 5C0XJ 3I56A 1N33H 1XNQL 1JJ2A 1XYIA 2K05A 3GTPB 2B63B 1K3RA 1VCIA 3K5MA 4GLAC 4LF8L 3I4LA 4A3DH 1A63A 1BXTA 2ANNA 1B7YB 3TZDA 5LMNQ 1PZJD 4A3IH 3MXNB 2YU9H 2R7ZG 1ZKOA 3DM3A 1B70B 1ENFA 5IWAH 4DV7L 1Q81C 3G71A 4IFDG 4AQYQ 4OL7A 4NXML 2R7ZB 1B1ZA 3RZOB 3NBHB 1OO9B 3E9HA 4JOIA 4HCEA 3T53B 4X62H 1M8AA 3NWSA 3KLSX 5FK9C 4DV2L 2A6EC 4V0BA 3D31A 3KF8B 4U68A 1D5ZC 4KTAA 1GUTA 1I4XA 3IL8A 5JVG3 4YY3Q 3M3YB 2F0PA 5GAHC 1E7ZA 1XNRH 4UP7A 2OEOA 1N33L 5LMUH 5BN4A 5IP9H 3GO5A 1TQOA 2E2HH 3F2BA 2ZM6L 1HJPA 2EY6A 1IW7C 3I7FA 2WB1B 4OCHA 5IOCA 4NW2A 3R2TA 1S5FD 4DR7H 3V2TA 3HOVG 2B8FA 2F0NA 1YZ6A 2VQFL 5A2QE 3OIQA 1B53A 1PFNA 1EU4A 1SBBB 3QIAA 3ND8A 4R4IA 1VQ8A 4RGOS 1JMCA 1BBWA 3BJUA 3I72A 3ICEA 2MGSA 5CV6A 3AB9A 1HHVA 1CUKA 4DV1Q 2VQEH 1Q3LA 1E0BA 1H9SB 3GTQH 4QIWE 3NELA 4P75A 1GO3E 1X3FA 5DLQE 3CD6A 2WAQB 5C4XG 4JI1L 2EYPA 2F0TA 3MWYW 3HOWG 4P71A 1H9MA 4A3IG 1LLRD 2FPHX 5D65A 3K7UC 1E2WA 3VR6A 2AXYA 2DJGC 4RMFA 4OEMB 4B3RH 4IFDI 5JJIA 1JOOA 1VQ6A 2NBFA 1O80A 4BBRB 4FF1A 4BA1I 3EVQA 3TS2A 4DAPA 4KHPL 4LAAA 3OW2A 1FJGQ 3BZKA 4XQQA 3E6ZX 1KIXA 1I6HB 3TRZA 3CPFA 3NBIA 2P5ZX 2Z4HA 1NR2A 1HNXH 3F2DA 3RLOA 3DUZA 3CP0A 3OTOL 1DT4A 2PQAB 2WAQE 4LFAL 4A3CH 1BOSA 1SNOA 4DNTB 3PO2G 1PTOD 2B2TC 2LXJA 4L6TB 1VQLA 5LL6b 4DV4H 2RQXA 4KKTA 4JI3H 4PG3A 4DV5Q 1EQRA 4UHVA 3FRPB 3TREA 4C3JG 1BKBA 1TWGH 2QCPX 4DV1L 5IYDH 2AHOB 2XTIA 4DU9A 1K8MA 2RHQB 3T1HQ 2K5HA 2K33A 3VDYA 2A73B 1X32A 3K0XA 2EYHA 1NUCA 4OX9Q 1NNXA 3SE0A 1HNWH 2R7FA 2A19A 4QL5A 1SYFA 2UUAQ 2I07B 3S14H 1W6JA 2PPBC 3I55A 2I0QA 3EFXD 3FKIG 5JJLA 1STBA 4BXXH 3MEHA 2OPUA 1TS3A 4HR7B 2F0WA 4DAYA 2YV5A 3GP7A 4B3SQ 1CZWA 2CWPA 3M4YA 1HQMC 1U0LA 3RR5A 1TY0A 1X55A 1WD1A 1PFMA 3GTMB 5IYDG 5HURA 2TMPA 2UU9H 2CVRA 1D7QA 1RF2D 1HNZL 4JCVE 4LF9H 5EBCA 4O2DA 1F0XA 4GOPB 1HR0W 3CCUA 2XVSA 4A3DG 2M8WA 1V1PB 1UEBA 5IGCA 4DR7Q 3H0GH 2CW0C 1HR0L 1MJCA 1RIPA 1I4HA 3WWVA 2YU9B 1R9TH 4BY7B 1FGBD 4PV1C 2G9DA 2HT1A 5EGTA 5ELFA 4N9PA 4DV3Q 1VQGA 2E8GA 4A3DB 4JI4H 4LUZA 4J15A 5KGUA 2K7VA 4B08A 3N6RA 2UXDQ 4A3CG 1VQ5A 3HKZG 2H1EA 2HCCA 3HOYH 3U9SA 5EPLA 3CRKC 3HEJA 4X64H 1NY4A 4DK0A 1NTGA 1ONLA 3GKUA 4GNXC 3QG1A 3ND9A 4DR6L 5M5XH 2UXCH 4K0KH 4QUCA 1AE3A 1E22A 1JC7A 2H5XA 2BH8A 4UDUC 2K14A 1UUPA 2E2IH 1AEXA 3MHBA 2QA4A 1WVNA 1NMFA 3VYRA 1EQQA 3C1FA 1TS2A 2N49A 2KHSA 4CBVA 1II3A 4X65H 2QNDA 3A0JA 4M8AA 2JA5H 1FNUA 3J80c 1LTLA 4IUVA 2F0LA 5T1IA 2BE5D 1KTKA 1DOLA 4MTNA 1VQHA 2MFIA 4X65L 2EJMA 2AWOA 4B3MQ 2PNHA 4QCLA 1HTLD 1Y69U 1EU3A 3N52A 1QZHA 1SDFA 1FNWA 5EQ0A 2EPBA 3RUZA 2OQKA 1O78A 3CU7A 4R4CA 1ASZA 3IKJA 1J5EQ 1CZGA 2BCOA 5HGQA 3V69A 2YTVA 2XGTA 3PO2H 4NXNH 5J39A 4K0KL 5FLMG 1I50B 2E2HB 2JP1A 3J81E 1TR5A 3MXUA 2IJ0A 2KJXA 3C3LA 1A15A 1XMQL 3PUWA 2KOLA 1PXUA 2BA0A 4L63B 5JJZA 3K8AA 3BVGA 1OXXK 1BUVT 2M00A 4IOCA 5JJKA 4X6AH 1PH2A 1X9NA 1TY2A 3CCRA 1HUMA 4LW1A 3OHXC 1N32L 3S2HB 3FP9A 4HEDA 3CW2C 3IAYA 4JI6L 5JEAG 4ID6A 2R93H 3PUVA 1Y14B 2F4VL 1KAAA 1EIGA 4JI7Q 1D5MC 2CWAA 2VUMH 4HJ5A 2F4VH 4X3TA 4Y52H 2E5LH 4LFCQ 1FD7D 4LFAQ 1N32H 1TWHH 4X66Q 4JC0A 1PMRA 1JWMD 1X3QA 2JVZA 3GD7A 3T13A 4H44C 4A3MB 2JA7B 1BCPF 1VQIA 3E9IA 1Z7TA 1SJED 4A3MH 2JA7H 1WHRA 1CM9A 3HRZC 1V43A 3TDQA 4AH6A 1XMQQ 4ILWA 1B3QA 1UAPA 2F0GA 2F0UA 1IBMQ 3IFTA 5IYCG 1SRUA 4DAYB 2Q2UA 3C2PA 2FXQA 2EJFC 4R1JA 1A62A 1WTHA 4DR6Q 1IKLA 1D1IA 2B39A 4CKCA 4DA2A 1S40A 5ELOA 3K5LA 3LWUA 3S16H 5ELNA 4LF4L 1G2TA 3ONAB 4YHHL 2B29A 4DV0L 4E9JA 1J5EL 2Z8LA 2J0TD 4DUYL 1SAPA 2ZXOA 4ALPA 3I4NB 1X65A 3DEPA 1JB7A 3STBC 1JB3A 3F2UA 1B50A 2F4IA 4RGTA 5C4XH 1KXLA 2NVQH 2PMZB 1TWGB 1HQRD 2EQSA 3I4OA 3TN2A 1DONA 4ME3A 1T5XD 3DMUA 3G7LA 3MA2B 4LUOA 1WCMG 3RLNA 1S3OA 1GUWA 1IW7D 4AQYH 5COYA 5D3DA 2ANRA 2BA1A 5D14A 3OMCA 3R93A 4LF7Q 4EX5A 1CT1D 4ZUJA 1LABA 2NVXH 3J7AV 3ZJYC 4GKJH 2AUKA 1L1OA 2F0HA 1YJWA 3A7LA 1QWYA 1XWEA 3P1HA 5IT9E 4R4QA 4B8TA 2IX0A 4IPDA 2UXDH 2R92H 2F0FA 4DV6L 4DK6C 4XDXA 2JA5G 4C3IG 1CKNB 4NDXA 4OO1H 1Z9FA 1JWSD 5M5WB 1FR3A 4LF5L 2UXCL 4RCOA 5D3IB 3PO2B 3HOXG 3BDCA 2JA5B 4MIUA 2ENBA 1SNPA 1EZ8A 4E6IA 1PH6A 4KY6A 4JI8H 1GOZA 1I94Q 5IE8A 5JPNC 2NZ1D 4RAUC 1TXYA 3L2PA 3CMAA 2FHTA 3D4WA 1JJCB 1V1OA 1SNMA 2VQEL 4DR2Q 1S72A 4RWSC 4WRDA 5FLXc 2B2VA 4ZYSA 2VL6A 3SB1A 2R6GA 2UUAL 2CTJA 1ZYRC 2D62A 2OT2A 3FDTA 4OXPA 1CK1A 5I2YA 4A3EG 2SNMA 1SYCA 3P7JA 4IFDH 3M9BA 1LTBD 1I94H 1YNXA 3HOUG
chains in the Genus database with same CATH topology
1B9MA 4FXKC 2UUCQ 1TU2B 3J81i 4BY7H 4DNIA 4WJ4A 3HKZE 1BCPB 5CYUA 4AIMA 4NXNQ 2K5QA 4NMZA 4LNQA 1H9SA 2EYOA 2EYFA 3NSWA 1VQKA 1V9PA 2WFWA 1N32Q 3WOEA 1C9OA 3GV3A 2F3VA 4R8NA 1XPUA 5FLMH 1GM5A 4NB3A 3ULPA 5BR8Q 2JA6H 1Q7YC 2VUMB 1STAA 5C44G 2E76C 3HOWH 4A3KG 1EOTA 2B63H 5BN5A 4WJ3M 1BO0A 4EQ5A 4LF9Q 1I3QB 1U4RA 4DR3L 5C3XA 5C0XI 1PTOC 3VYSA 4FXDA 1IBKQ 2D5DA 4OIJA 5E3FA 1I4GA 5IYCH 4A3LG 3I73A 2MQHA 4NXNL 3I4MB 1PDQA 4A3BH 1F77A 1PRTB 3A8IE 5I6YA 1SMXA 2F0EA 1AP0A 1HZAA 1MKHA 2RA4A 1SYGA 3KYHC 2HUGA 4JI4Q 4BBSG 4A75A 3I3CA 3TP5A 1FL0A 4J1MA 1N34L 1PH1A 2K04A 1K73C 3KUPA 5FLXL 1IBLL 4X64Q 2QF7A 1TWFH 3PSIA 1PRTC 3S1RH 4JI4L 2MNAA 1JOKA 3PIOA 2L4NA 5NUCA 1V1QA 1LTRD 2JA9A 3BU2A 3H3VH 3MZ5A 1YJ9A 4LFBL 3TS0A 1VMPA 3H6MA 2A5HA 4JI2L 3V96A 1L2FA 1LYLA 3EN2A 3JAMc 2FINB 3U4VA 2PCFB 1PV4A 2J4XA 1KRTA 5GAGC 3U1KA 2HCIA 4NBQA 3MAQA 1E3PA 1Y8OB 4HAEA 1K83H 1SE4A 2ZTCA 1I94L 5ISRA 4JOIC 2V4DA 2BE5C 3S24A 3GTLB 1HH2P 3QWNA 5CBAE 4HIOA 4IZ8A 2IX1A 4HJ9A 5GAEC 2MHVA 3SDZA 2UUBQ 2F0VA 4HCSA 1HXYD 1KD1C 2UXBL 1TWAB 5EKIA 4WFN3 1NBWA 4WJWA 3M4QA 3BS1A 1N36L 1FGUA 2EVBA 1I50H 5FKAC 2E2JH 2IT1A 2EJGC 1EY5A 1EYCA 2N88A 1VS0A 1STEA 4DXFA 1DOKA 1L0WA 1JOQA 5C5MA 1Y1WB 4WALA 4FO2A 1QZGA 2DN8A 3Q24A 2Z1CA 2CCZA 2OTLA 4DR7L 2AQ1B 2VQEQ 1TKWB 3KDFA 4N9TA 1EYDA 1N33Q 2NVTH 2L9HA 2ASBA 3QO2A 2UXDL 2RDGA 4HJAA 2NN6I 4NPSA 1YITA 2OCEA 4IPGA 1CI3M 2NTSA 4IN3A 1EIHA 2QEJC 1SN8A 2K01A 1BBUA 1HR0Q 3HOYG 4X62L 3K5NA 4HJ7A 1CQFA 3S17H 2EXDA 4AYBB 1Z6HA 4PZ6A 2Z0SA 4B9XA 5K36G 5KNDA 1PTOF 1DM0B 5IWAL 5CV4A 2PI2A 1BBXC 1YNJD 2MPMA 4A3JG 1AH9A 3CCQA 2F03A 1XX8A 5JPMC 2LMCB 3D4DA 2NN6G 4FXGC 4A3JB 4A3KH 1R4PB 1BNZA 2J7ZA 5A2QL 1XTDA 4DGZA 2HQEA 2K28A 2EY1A 1Y8NB 1GHKA 4K5WA 2EY5A 3OPOA 3NEMA 3DM1A 2KVMA 3OWFA 2KCNA 3RNUA 1HNZQ 4DV5L 2HIVA 2MJHA 4L5SA 4ABNA 5C4XB 3GTJH 4X62Q 3HOVB 3M85A 3D4RA 4OWXB 1ICWA 1VQ9A 5K36H 1WTVA 4I65A 1WCMB 1Q8KA 2R61A 2AQ3B 1M1KC 1S5ED 2E74C 1UE7A 1VQAA 1X3EA 2RCNA 5LMUQ 2ZT9C 1B44D 5DAUA 1ZZIA 5FO7B 3S16B 5DEHA 5EJWA 3ZYYX 2XSCA 3MC0B 2ALYB 4YWMA 4DR4Q 1UE6A 1SE3A 2CTFA 3TP7A 5M3MG 3T16A 1KLGD 1W6KA 4KMUC 1C0AA 3PO3B 1J8IA 1IBLQ 5KNBA 1KDCA 2Q8RE 4G7HC 1CA6A 1ILQA 4K2KA 4DR1Q 4EVOA 3M4OB 4G7OC 4GN3B 2PYKA 1XXGA 1G2SA 1EY8A 2F3IA 3BDOA 4KKSA 4BBSH 4QB4A 4R8IA 5K5PA 4IJLA 4ZUIA 1HFNA 1QVGA 1PH5A 2OPVA 2YYZA 2N78A 4FDBA 4RFBA 5I4DA 1CKMA 3LNNA 3T51B 4ZKCB 5KYLA 3UDFA 3QJYA 3NHHA 2IPKD 4DUYQ 1STNA 4LJZC 3CC2A 1ML0D 4QY7A 4JVYA 4DUZL 2R92G 2OTJA 3CCSA 3FKIH 4KK7A 2AWNA 3V05A 4HMIA 4JI3L 3OW7A 4DV4L 5I9PA 4ZQ3A 4QMGA 5C3WA 2VY3A 1SROA 4KD4A 2XWBB 1H95A 2B2VC 1TWHB 1SE8A 2SNSA 3NQTA 4CJ1B 3OMGA 4F7XA 2JEBI 5CGKA 4CGYB 2A69D 4A3GH 4GOPA 4DV3L 4K8IA 4A3EB 4P74A 3EQLC 1DJRD 1XTCD 1VF5C 3CPWA 1H9RA 1EY7A 3HOUB 4X65Q 4M1UB 1SSOA 5E7NA 1E2ZA 3TP6A 2A6HD 5C44B 1HZBA 4B3RL 3A7AB 3D8GA 3S2DH 2B2TA 4PZ8A 1WCMH 3NENA 1AE2A 4EGVA 2KA7A 3P75A 1OXVA 2JA8B 2I46A 2A68D 2E3UA 3HKZB 1UEAB 5BN3A 4K6LA 3HP3A 4KV6A 3GTJB 2OF1A 1F9QA 4ZKBB 1S4ZA 5C3EB 1C7YA 3H3VC 3HOZH 2CKZB 1WTOA 1SR3A 3OSOA 2RBMA 1CSPA 1WI5A 4C3IH 1STYA 1ESRA 1FVIA 2X6GA 1B9NA 3MTSA 5IT9L 1EL0A 1IZ6A 3HOZB 1MSHA 3GV6A 4GZYC 4IQZA 2CTLA 1WTQA 3A5UA 3M7GA 2IWHA 1GUNA 2HQLA 5HGTA 3W1BA 2UU9Q 5IY0A 2WP8J 3A55A 2VW9A 1XMOL 1WTXA 5AJ3Q 3J81j 4CJ2C 3TQYA 1KDBA 2UXBQ 1RD9D 1Y1VB 4FF3A 5IGDA 1V1PA 2MP1A 5IGBA 4RGNA 2MJ8A 4POFA 3KFUA 4J8QA 3ER0A 3L3OC 4YIJA 5LL6S 4IO9A 2O5IC 1YEZA 1KL9A 5M3MH 1PRTF 3L0OA 4KJNA 2K1BA 3K5OA 1TT2A 1ASYA 4A3GB 2NWGA 3A56A 1KLUD 2KHIA 2E75C 4KY7A 3BZCA 1W3SA 1SEBD 5DM73 3TBIB 1WTWA 4LF4Q 2RDHA 4IUNA 1N9WA 4RHRA 4XQNA 2E2DC 5GROA 2Q8TA 2CTKA 3EBEA 3J81c 1BF4A 1O7LA 3O13A 3HFZB 4LMQD 1R9TB 1CFMA 4F8MA 4RKLA 2B2WA 3PV0A 2RF4A 4KD3A 1SMYD 2IHFA 4GKKL 3FMCA 4L5TA 3MXNA 2A68C 1BCPD 3KF8A 2I5MX 1SNDA 2JA8H 3CMEA 3H94A 3AQQA 4JV5Q 2DUDA 4P72A 4APVA 5C4JH 4JI6Q 4IOAA 4JBJA 3NUCA 3MFGA 2EDGA 1B4OA 1TVXA 2DNEA 1ILPA 1ZZKA 2F0MA 1PA6A 4KJOA 1PVOA 2SOBA 1JE4A 3RMHA 3OIPA 1IKMA 3L9AX 2PQAA 4AYBG 4A93H 2VZAA 3M4OH 4C1NK 2K75A 2JZXA 5FO8B 3A74A 2B2YA 4RKBA 4DK3C 4ZAIA 2FJ2A 3S14B 3GDEA 1EZ6A 1YBYA 1J5KA 4I7ZC 1AN8A 4S3SA 2DY8A 3HS0C 4FVMA 2L15A 1X4NA 1H9KA 3FKIB 4LF7L 3CRLC 1N8RC 2WIIB 1D5XC 1D6EC 1OXTA 2KEEA 4KY5A 1CTMA 3QB3A 4OWWB 1MJEA 1X54A 2F1MA 1J4WA 1O7YA 5JEAH 1KHIA 4DV4Q 4JI3Q 4XXEA 3AEVA 2UUBL 2WKDA 4LK1C 2CW0D 2F4VQ 2E5LQ 2ATWA 1RJTA 3HOWB 4X3KA 4YCVA 5H1SE 3KJOA 3GTQB 2ES2A 4HIDA 4LF6L 3D6WA 4K5XA 1YVCA 1AW7A 3AU7A 1HZ9A 3S1NH 3HGBA 3SHLA 1PTOB 4RGMA 4B9WA 2VS1A 3UDGA 3JC66 1CKOA 1CKNA 2B3GA 2Q2HA 1XJVA 5M3MB 2OWOA 3S9WA 3K7AH 1VQJA 4BY1H 4R4TA 4OGQC 4JI2Q 2GN5A 1UWVA 4JV5L 5ELEA 3CQZH 1C48A 3AEVB 4JBKA 1HZCA 1RDPD 3NWTA 2F0QA 2WKCA 3KLSA 2JXMB 4BY1B 1PZID 3ERQA 2CTMA 2P2RA 3DWQA 1PYWD 4U673 1YNJC 1GKHA 4ZRZA 2QEXA 1MBYA 1GVPA 3RD4A 1KQSA 2NTTA 3E0EA 4C3IB 1IL2A 1SFOB 1AZPA 2DY7A 4DV7Q 1PH9A 4BA2I 3M7NA 2R7ZH 3RN5A 3J7AF 2I5LX 2HDMA 2F0DA 3OOCA 4BS9A 1F9RA 3Q8DA 5EBDA 2L12A 3PUZA 1MIUA 2Q2TA 3I8ZA 2PMZE 5IT9c 3I91A 1QVCA 1D2BA 1OTCA 5M3FH 2JE6I 2WACA 1G8ZD 1PH4A 2FFKB 1A6XA 2LKVA 4IUTA 2R92B 3HG9A 1QJOA 1VQPA 2EE1A 1VQDA 4AYBE 4OWTB 1QNKA 4IPCA 4K5VA 3GTLH 5CMDA 3Q6SA 1VDZA 2XIWA 2E2JB 5KEEA 1LTGD 4O1NA 4QMFB 4A93B 2EIFA 3CXCA 4CJ0B 3SR1A 1F9PA 1IHZA 2XNAC 3TZUA 2NVQB 1VIHA 4MZ9A 2WB1E 4P73A 3PCOB 3S1MH 2HHHL 2K6AA 3NTIA 1AFPA 2NN6H 3QOLA 3C1EA 5F2DA 1TWCH 4JI5L 4IALA 1ZXTA 2A1AA 5E4XA 1K83B 1I4RA 2JA8G 3K57A 2CTEA 5CBEE 5FJ8G 3J81L 4H0LC 3PO3H 2K4KA 3DHQA 3EJIA 5IWAQ 2RVLA 1GXDC 4LF5Q 4JYAQ 3LWEA 5C3EG 4B3RQ 2AQ2B 1WYDA 5GQOA 4QF4A 2BOSA 1S5CD 2BH2A 4H02A 4F88A 1V8QA 1LT4D 2A8VA 3K59A 1JCKB 3L7ZC 1Q46A 3J80L 3GTKB 1P16A 1HUNA 3BVZA 3KLRA 2WB1G 5I6WA 3FEWX 5LHY1 1EWHA 1WJJA 1T5EA 2MUYA 3NQIA 4KN4C 1FNVA 2Q2IA 3WOFA 3Q0AA 1Q8IA 1EY9A 3NPPA 1EWIA 3H15A 1CSQA 4JI7L 4UPAA 3GTOB 2ZXPA 1C8CA 5FLXE 2A6ED 3D3RA 1HCZA 2D9UA 3U50C 4KN7C 1P8LA 3Q23A 3X3NA 1TUAA 3CAMA 5C4ZA 4A3GG 4B3SL 1A8VA 1HNWQ 3I70A 1TWFB 4BWGB 1STHA 5IP7G 1KHMA 3AFPA 1F2LA 1EQTA 1OXSC 1IBML 3U4ZA 4Y7NB 4HSVA 5CV8A 3S1QB 2EYLA 3K7AB 4G4KA 4ZK9B 1G91A 4GNXB 2HDLA 5E4WC 4BXXG 2SEBD 1SLJA 2JK8A 5FJ8H 5FOBB 1EOVA 1EYAA 2A6HC 4IUUA 1EEID 2SDFA 3SK6A 4O0AA 4JBWA 3CHBD 2IX3A 1NE3A 2FMRA 3VYUA 2RSNA 3CCJA 2CFMA 2L11A 1NAPA 4IURA 1KABA 3A54A 5EKKA 4ZLTF 2E2IB 4XYQA 3W3AA 1S5DD 3ERSX 2D2CC 4PNYA 5CORA 1Q12A 3C46A 3UE1A 4H7BA 3UDIA 4DN4M 2ZJRA 1PFBA 1KRSA 1YNNC 1DGSA 4GS3A 1F2ZA 3D6CA 2HH2A 3NTKA 2IL8A 2L55A 4R9WA 3NBHA 3KF6B 2B8GA 5JEAJ 1F2YA 4LWCA 3CQZB 4EQNA 1DOMA 3DWAA 4KHZA 4C1NI 1JJGA 1AZQA 1LT3D 4GN5A 4DFAA 4L8JA 5LL6X 1QG7A 4MHEA 4DV2Q 4JG2A 3SK4A 1PLFA 5EPJA 4LF6Q 3RZDH 1BR9A 2PZWA 2JQOA 3S1QH 3W2DA 1DTJA 4LUVA 5T1GA 1LT5D 3VKEA 4DR2L 2R7DA 3A8KE 4A3IB 3EIVA 1EC6A 2EZVA 3BG3A 4DV6Q 3S2DB 1QVFA 4A3LH 1HPCA 2TSSA 1G51A 3RLFA 1EY6A 3NK9A 2MO0A 1YHBA 2PZUA 5EAYA 4JI0Q 4KHPQ 5GADC 5IYBG 2RDFA 3UI2A 4OONA 4XTCS 4KKUA 1X3GA 2K52A 4YWKA 2PNRC 1EIFA 5ELBA 1GUSA 3GQBA 1MGSA 1TWAH 3PO3G 1D8LA 4DUZQ 1Q86C 1HRJA 2KECA 5IGEA 1IYJB 1RODA 1NSNS 2VXWA 5A35A 2YTYA 5CV5A 3H3VI 3CKIB 2VNUD 1H9JA 1M4VA 1Q1EA 4XT3B 1YI2A 1ZZJA 4GKJL 1EY0A 3OYYA 2KQ3A 2YTXA 3G48A 2UXCQ 5I2XA 4AQYL 4B3TQ 2R93B 4A3FB 1S5BD 4FNFA 1VQEA 1ENAA 2B2WC 1XPOA 2R93G 4RCNA 1HA5A 4QIWB 1I6HH 3R3OA 2FMCA 2EXZA 1EFID 1SMYC 3GTGH 1PRTD 4O42A 3U58A 2EYMA 1YNND 2LSSA 3W1GA 1OXUA 3H09A 3VA7A 5JAVA 2BDOA 5IP9G 5C0XH 1A0IA 2NZHA 4A93G 1A3UA 1NJIC 1Z47A 3A5ZB 4HMJA 1J9OA 4A3KB 2K32A 1U5KA 2QDBA 1EY4A 1Y1WG 3RN2A 2Y0SE 1BDOA 3D0FA 3PIPA 4TRDA 2KENA 3T1HL 2HH3A 5AFWA 5HY6A 2B63G 3KF6A 3LGJA 1KNAA 3KJPA 3J7A5 2WINB 5M5WH 2E5LL 4LFBQ 1IBKL 1SXTA 1TS4A 4K0KQ 1XMOQ 4IJHA 3HOYB 3PGZA 4CKEA 4LF8Q 4C3JH 1VQCA 2LFNA 4PMWA 2Y0SB 1RL2A 4FF2A 5M9OA 2F52A 1Y1VG 2N55A 4A3JH 1LUZA 3NTHA 1B2TA 4QUFA 1WTRA 4RA8A 1QNUA 5C4HA 1E2VA 3F2CA 4XYOA 4C3HH 4K8JA 2NB0A 1VQNA 4KHVA 1E1TA 1K9MC 1X3PA 4NP5A 4LF9L 4DXGA 3T56B 2XWJB 3IRBA 1SJHD 1L1OB 3PF5A 4HIKA 2PZTA 4JI1Q 3GTOH 2NYZD 1I6VC 3H0GB 1RTNA 4WANA 1YHQA 1QOHA 4POGA 4XIGS 1VQFA 2ID0A 1WTPA 4Q5VA 3J7YW 3I4NG 3PUYA 1SFOH 5CC4A 4L5RC 2A74C 4KLKA 1ET9A 4GOPC 4GN4B 2ICIA 2BL5A 3GTPH 5CV7A 3X3MA 1EYGA 3MFYA 3FVQA 1YHAA 3MXPA 3K6OA 5IGGA 4DR1L 2PQUA 2IHEA 2PO4A 2IW3A 3JAML 4YWLA 4JK1C 5M5YH 2A69C 4B3ML 5ELCA 2BDNA 4MNOA 3CCVA 2ZJPA 2NVYB 4IUQA 1LV9A 4X3SA 2LS01 4PQXA 2ZM6Q 2F0OA 1JT8A 3P20A 3I4MH 2XN9C 4B3TL 1LTTD 1QUQB 2V1CC 2HHHQ 1I4PA 2PQEA 3ITPA 4TQUS 1QILA 4GKJQ 1SNCA 2X69A 1IL8A 1CA5A 3KOJA 3STBD 3HOXB 1E24A 4EQPA 5J22A 1WVLA 1U4PA 2RKSA 4NKLA 5IODA 3VYTA 1KAWA 1HNXL 1K0RA 2CPQA 3AFQA 3BVMA 5LMNW 1I5FA 3BDLA 1C4QA 2K50A 1XPRA 1M90C 2XRSD 2O5JC 2ZTEA 2ICEC 2M2LA 5AJ3L 4JI8Q 1DYQA 2JA6B 2WV6D 2UU9L 1LTAD 4MN3A 3LX0A 4XQJA 4WORA 1YJNA 4H13C 4HIMA 1LTID 2AKWB 1DCZA 2LY7A 1LACA 3DEOA 3EA6A 1L0XB 2Q8IB 3DXJC 1UNSA 5J1ZA 1QE6A 2DNCA 4K2LA 1I3QH 1SYEA 1MSGA 4KI0A 4DPGA 2Z6KC 3K81C 2JSOA 1Y1VH 2CQAA 2C9OA 2DGRA 1U9RA 2PW7A 1J6QA 1JR0D 2K03A 3ULJA 3T1YL 3MVVA 4HN7A 5DM63 4C3HB 3CCEA 4Q0FA 4TSSA 3VR2A 1GJXA 4XT1B 2R3ZA 1Y8PB 3HKSA 2OQ0A 1VQ7A 1SYBA 3CCLA 3AMUA 3Q22A 4DAMA 4FYDA 5EPKA 4DR5Q 3F8TA 2EOTA 5ELDA 2K5WA 4DR3Q 1G291 1SNQA 2IY5B 5M3FB 2QGQA 3AYHB 1HNWL 2B2YC 4A76A 5DNFA 2NVXB 3S17B 1G6ZA 1IXRA 5BR8L 1KNEA 4P2CB 2C35B 4A3FG 1F2MA 5JVH3 3I90A 4GNXA 5C44H 3RZOH 5M3FG 1STGA 5IYBH 2D0OA 2GVAA 1T9HA 5G3LD 1K1GA 1B8AA 3KLWA 4A3EH 2C5CA 4Y7NH 1PZKD 1PFSA 1Q82C 4IFDJ 1WE8A 2F0JA 3GTMH 2FMMA 3FPPA 4FF4A 4V190 4QQBX 2X6LA 5C3EH 2ZTDA 2OXPA 1SE2A 1N34Q 4F87A 5CR3A 5E1FA 2GA4B 3GTGB 3UE0A 4JI8L 3A8JE 1BQQT 4PMBA 1B3AA 1XNQQ 2VB2X 3ULLA 1N36Q 3NE5B 1MD2D 1A2UA 3JAMi 4A3FH 5IGFA 1PH8A 3CCMA 4R4OA 1NR4A 1O7ZA 5LMUL 3S2HH 3PIP3 2K5VA 4DNRB 1RCVD 4OHJA 3DLLA 4TKOB 2JEAI 4LIJA 3G6EA 3W5OA 4OO1G 5C4JB 5KNCA 3BZDB 3I4MG 2Y0SG 2AUJD 2MO1A 3S1MB 3FPUB 3HOXH 1PHJA 4BBSB 1GHJA 4X3UA 2KEDA 2HIXA 3HOZG 2PI2E 3PIO3 2JJQA 1A2TA 3J80E 1KC8C 5JOBA 3KDFB 1LO5D 1DD2A 3NP8A 3B6YA 4JI0L 3SVMA 3U9OA 1LM0A 1ZEQX 3IFDA 3S15B 3J7ZC 1A3TA 3KBXA 2KCMA 3E0JA 5M5YB 4OO1I 3H91A 3H0GG 1WFQA 4A3MG 2JA7G 2KUMA 1K8AC 3OWEB 3R2IA 2JYOA 1FYCA 3SXHA 4YCWA 1I4QA 1JORA 4DKAC 1LTSD 3BYYB 4HSPA 1PYBA 1UE5A 2Z6KA 1XNRL 3MXGA 3T4AC 3MEFA 1L0YB 1Q1BA 3PUXA 1HNXQ 3RZDB 5CV9A 2F0SA 4OX9L 3SEBA 3KBGA 2N3SA 1VQBA 4QGUA 3VR5A 4JVHA 4UP8A 1SYDA 5KIXA 3PF4A 4BBRG 1G6PA 4K6DA 1QB5D 2NVYH 1DZ1A 2XRQD 1U4MA 4DR5L 5C0XG 4ODGA 2RHSB 3DWPA 4GLVB 3VA5A 4X64L 5KYIA 2CQOA 2PW5A 2AMCB 2WAQG 2KHJA 1F9SA 1YIJA 3TMEA 2QKIC 1PH7A 1VQOA 4DAVA 1VQMA 1RHPA 4IUPA 4LFCL 4G7ZC 3VR4A 4C3JB 2L1BA 1CQVA 4UP9A 5M5XB 1HFGA 1Q90A 5J3BA 1RKNA 1EIYB 2F3WA 1R4QB 4DK1A 3M3YH 1JWUD 4JBMA 5I9OA 3TEHB 1TS5A 1IYUA 1PYSB 2JA6G 5FO9B 3CC7A 1WOCA 3K80C 1NMGA 1Y1WH 5IP7H 1HTPA 1K8OA 4C2MH 2N8NA 1QUQA 3M4PA 4HTHA 4JYAL 3BYTB 1EUJA 2LXKA 4YY3L 4PZ7A 4C2MB 4CKBA 1BVSA 2CHBD 2B2UC 2VUMG 1E1OA 2VQFQ 2L0CA 2F0KA 2NUCA 3SK5A 4X66L 1PTOH 2O4XA 1WD0A 4ME5A 2F0IA 4FP5D 3EROA 4DR4L 2EYJA 1ZYRD 1NCVA 1U4LA 1JE5A 4IPHA 3I4NH 1K8GA 2NVTB 2ZJQA 2QILA 3VR3A 4C56C 2VB3X 1X4MA 3JAME 4G57A 1EQVA 3CF5A 2YQRA 2GVBA 4GKKQ 3F1ZA 1KDAA 2KCCA 5LMNL 2EY2A 4EQOA 3K0YA 1D1KA 4C3HG 3FHWA 3S15H 3KK7A 1CHQD 1VIGA 3K58A 3S1NB 3J80i 4YHHQ 4DV0Q 2H4OA 2NZOA 1PH3A 2K5DA 3TP8A 4BY1G 2KCTA 3SK8A 1MI2A 4QJFA 4YCUA 3S1RB 1XNRQ 5C6AA 3NXWA 2PY9A 5TSSA 3HOUH 1ET6A 1CHPD 1JICA 1RTOA 1A3VA 2UUCL 4BY7G 4J6HA 5KRUA 2G9HD 3SGIA 1EEFD 2RSOA 5G3LF 1DXMA 1LT6D 3HZXA 2K5NA 2KBNA 4A4IA 4K14A 1X56A 2Z4IA 4TVAB 4JI5Q 1EFWA 3WDNA 2B2UA 3URYA 4NXMQ 4BBRH 1L1OC 3T1YQ 5IIFA 4RH6A 2DGYA 3CC4A 1X6OA 4RHSA 2O2LD 1TWCB 2D0PA 1GUOA 2ZXRA 1ENCA 1HA6A 1VMCA 4DF7A 2I5HA 3PMFA 1VQ4A 1ESFA 3R8BA 5EKLA 3GTKH 3HOVH 4PMCA 1BCPC 1TIID 5C5LA 4L5QA 1IYVA 1QCBD 3OTOQ 3G4SA 4HJ8A 1GUGA 4UAIA 3TSSA 1W2BA 1ZTGA 4OIKA 4A3BG 3I2ZA 3G6JB 4UY8C 4AM3A 4Z9CB 1EWCA 3E5SA 1JQYD 4RG1A 1FJGL 4GLXA 3QOJA 1O7IA 2L5TA 3UDXA 4ULLA 4A3BB 1VF7A 4CHTB 1GD7A 2M9VA 1UE1A 5C0XJ 3I56A 1XNQL 1JJ2A 1XYIA 2K05A 3GTPB 2B63B 1VCIA 3K5MA 1K3RA 4GLAC 4LF8L 3I4LA 4A3DH 1A63A 1BXTA 2ANNA 1B7YB 3TZDA 5LMNQ 1PZJD 4A3IH 3MXNB 2YU9H 2R7ZG 1ZKOA 3DM3A 1ENFA 1B70B 4IFDG 4DV7L 3G71A 1Q81C 4AQYQ 4OL7A 2R7ZB 4NXML 1B1ZA 3RZOB 3NBHB 1OO9B 3E9HA 4JOIA 4HCEA 3T53B 1M8AA 3NWSA 3KLSX 5FK9C 4DV2L 2A6EC 4V0BA 3D31A 3KF8B 4U68A 1D5ZC 4KTAA 1GUTA 1I4XA 3IL8A 5JVG3 4YY3Q 3M3YB 2F0PA 5GAHC 1E7ZA 4UP7A 2OEOA 1N33L 5BN4A 5IP9H 3GO5A 1TQOA 2E2HH 3F2BA 2ZM6L 1HJPA 2EY6A 1IW7C 3I7FA 2WB1B 5IOCA 4NW2A 3R2TA 1S5FD 3V2TA 3HOVG 2B8FA 2F0NA 1YZ6A 2VQFL 5A2QE 3OIQA 1B53A 1PFNA 1EU4A 1SBBB 3QIAA 3ND8A 4R4IA 1VQ8A 4RGOS 1JMCA 1BBWA 3BJUA 3I72A 3ICEA 2MGSA 5CV6A 3AB9A 1HHVA 1CUKA 4DV1Q 1Q3LA 1E0BA 1H9SB 3GTQH 4QIWE 3NELA 4P75A 1GO3E 1X3FA 5DLQE 3CD6A 2WAQB 5C4XG 4JI1L 2EYPA 2F0TA 3MWYW 3HOWG 4P71A 1H9MA 4A3IG 1LLRD 5D65A 3K7UC 1E2WA 3VR6A 2AXYA 4RMFA 4IFDI 5JJIA 1JOOA 1VQ6A 2NBFA 1O80A 4BBRB 4FF1A 4BA1I 3EVQA 3TS2A 4DAPA 4KHPL 4LAAA 3OW2A 1FJGQ 3BZKA 4XQQA 3E6ZX 1I6HB 1KIXA 3TRZA 3CPFA 3NBIA 2Z4HA 1NR2A 3F2DA 3RLOA 3DUZA 3CP0A 3OTOL 1DT4A 2PQAB 2WAQE 4LFAL 4A3CH 1BOSA 1SNOA 4DNTB 3PO2G 1PTOD 2B2TC 2LXJA 4L6TB 1VQLA 2RQXA 4KKTA 4PG3A 4DV5Q 1EQRA 3FRPB 3TREA 4C3JG 1BKBA 1TWGH 2QCPX 4DV1L 5IYDH 2AHOB 2XTIA 4DU9A 1K8MA 2RHQB 3T1HQ 2K5HA 2K33A 3VDYA 2A73B 1X32A 3K0XA 2EYHA 1NUCA 4OX9Q 3SE0A 2R7FA 2A19A 4QL5A 1SYFA 2UUAQ 2I07B 3S14H 1W6JA 2PPBC 3I55A 2I0QA 3EFXD 3FKIG 5JJLA 1STBA 4BXXH 3MEHA 2OPUA 1TS3A 4HR7B 2F0WA 4DAYA 2YV5A 3GP7A 4B3SQ 1CZWA 2CWPA 3M4YA 1HQMC 1U0LA 3RR5A 1TY0A 1WD1A 1X55A 1PFMA 3GTMB 5IYDG 5HURA 2TMPA 2CVRA 1D7QA 1RF2D 1HNZL 4JCVE 5EBCA 4O2DA 4GOPB 1HR0W 3CCUA 2XVSA 4A3DG 1V1PB 1UEBA 5IGCA 4DR7Q 3H0GH 2CW0C 1HR0L 1MJCA 1RIPA 1I4HA 2YU9B 3WWVA 1R9TH 4BY7B 1FGBD 4PV1C 2G9DA 2HT1A 5EGTA 5ELFA 4N9PA 4DV3Q 1VQGA 4A3DB 2E8GA 4LUZA 4J15A 5KGUA 2K7VA 4B08A 3N6RA 2UXDQ 4A3CG 1VQ5A 3HKZG 2H1EA 2HCCA 3HOYH 3U9SA 5EPLA 3CRKC 3HEJA 1NY4A 4DK0A 1NTGA 1ONLA 4GNXC 3QG1A 3ND9A 4DR6L 5M5XH 4QUCA 1AE3A 1E22A 1JC7A 2H5XA 2BH8A 4UDUC 2K14A 1UUPA 2E2IH 1AEXA 3MHBA 2QA4A 1WVNA 1NMFA 3VYRA 1EQQA 3C1FA 1TS2A 4CBVA 2KHSA 2N49A 1II3A 2QNDA 4M8AA 3A0JA 2JA5H 1FNUA 3J80c 1LTLA 4IUVA 2F0LA 5T1IA 2BE5D 1KTKA 1DOLA 4MTNA 1VQHA 2MFIA 4X65L 2EJMA 2AWOA 4B3MQ 2PNHA 4QCLA 1HTLD 1Y69U 1EU3A 3N52A 1QZHA 1SDFA 1FNWA 5EQ0A 2EPBA 3RUZA 2OQKA