2JEBI

Structure of a 9-subunit archaeal exosome bound to mn ions
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
214
structure length
197
Chain Sequence
KIVLQPRSIVVPGELLAEGEFQIPWSPYILKINSKYYSTVVGLFDVKDTQFEVIPLEGSFYYPKINDIVIGLVEDVEIYGWVVDIKAPYKAYLPASNLLGRSINVGEDLRRYLDVGDYVIARIENFDDPVLSVKGKDLGRVSNGIVIDIMPVKVPRVIGKNKSMYETLTSKFVANNGRIWAILIEAIRKIENESHIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title RNA Channelling by the Archaeal Exosome.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Hydrolase
molecule keywords EXOSOME COMPLEX EXONUCLEASE 2
total genus 40
structure length 197
sequence length 214
ec nomenclature
pdb deposition date 2007-01-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2jebI01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2jebI02
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 2jebI03
1T5EA 1IXRA 2DN8A 2WB1G 4BY1G 3RR5A 3GDEA 2R6GA 3STBC 1HNZQ 4DUZQ 3H15A 3K7AH 1S40A 4JI5Q 2R7ZH 1J5EQ 3HKZE 3S1QH 4GN3B 1FVIA 3A5UA 4HJ5A 1R9TH 2KENA 4JI0Q 4KN7C 2A6ED 3CD6A 1A62A 4X6AH 5KNBA 5C44H 4LF7L 2JA7G 2KHJA 4IOAA 1HH2P 4LFAL 2ZTDA 1VQ9A 1XNQL 2DUDA 2XGTA 1Z9FA 4YY3Q 1SRUA 1H9SA 1UE1A 4JCVE 5C4JH 4DR1L 3OW2A 5IP9H 2B63H 3HOWG 5IP7G 1KHMA 1MJEA 2CQOA 4PZ7A 4DV1Q 3LWUA 1V8QA 3T1HL 1X3FA 4I7ZC 3FHWA 2A1AA 2NVYH 4B3SL 4LF4L 2NN6G 4TQUS 1HNXL 3I4NH 1FGUA 1XTDA 3AYHB 4GLVB 1HNWQ 5IYCG 3M4YA 5IYDH 2K5NA 3TREA 4HIOA 3IKJA 1O7IA 1VS0A 4RCNA 4R1JA 1QVGA 2H5XA 5IYDG 1YIJA 3PF5A 4RMFA 3A5ZB 3W1BA 4EX5A 4LF6Q 1C0AA 1UE5A 1XNRQ 3PUZA 1Q1EA 1KIXA 2VNUD 3CMAA 4HR7B 3CCLA 4DR1Q 3CMEA 2F4VQ 1Z6HA 3H94A 5M5XH 1CTMA 3K7UC 3ULPA 3H3VH 3HOWH 2WB1E 4JI8L 1VDZA 4A3EH 1ASZA 2E5LL 2AXYA 1LABA 1Y8OB 3NELA 3GTJH 4QQBX 5H1SE 4BA1I 4BA2I 3J81c 1M1KC 2A8VA 3KF6B 3WWVA 4A3DH 1EWHA 1G291 1QVCA 1Q90A 2Q2HA 3BZCA 4JOIA 4A76A 2Q8IB 5IP7H 1W3SA 3AB9A 3EQLC 4IFDG 1VQCA 1VQEA 5C0XI 3MFYA 1IBKQ 4P75A 3K81C 5JEAG 2PQAA 5LMNL 3S14H 4LUOA 3OYYA 2CCZA 1TWCH 1L1OC 2XTIA 1CKOA 3J81i 4DV7Q 4JBKA 1PMRA 2QF7A 5JEAJ 3OTOL 1KHIA 2UUAQ 3TEHB 2ALYB 3CCMA 5M3MH 2CTFA 4IFDJ 2IX0A 2HT1A 3P20A 1YVCA 5ELOA 4DV0L 5GROA 1H9MA 2A6HD 2KCMA 4HJ8A 1HNXQ 1E22A 3G48A 2VW9A 4LNQA 5LMUL 2JE6I 1O7LA 4DV5Q 3D4RA 1EIFA 2F4VL 3U58A 1PH9A 5BN4A 1NBWA 3J80i 2NVXH 2BE5C 1VQ6A 1E1TA 1M90C 4LFBQ 2EVBA 3VR4A 4A3JH 1W2BA 1CKMA 3ND9A 4POFA 4HJ9A 2ZJRA 3CXCA 1XMOQ 4OO1I 1KRSA 3CP0A 4JK1C 4A3MH 3VR6A 1Y1VG 4IJHA 4PMWA 2JA6H 1BBWA 3GTGH 2PPBC 1VQ7A 2K50A 4Y7NH 2A69D 4IPCA 1X55A 4QIWE 4J15A 4HIDA 3T1YQ 4L5QA 3PUWA 1TWHH 3FKIH 4LFCL 5IT9c 4DV1L 2R7ZG 3T1YL 4GNXA 1CUKA 1KQSA 1H9JA 3M3YH 3PO2H 4DR7Q 1EUJA 2N8NA 4A3IG 2BH8A 4A3BH 4A3LG 3AFQA 5C0XH 1VQDA 1VQBA 5BR8Q 1LTLA 3KLWA 1AE2A 3HOVH 3S1RH 5LMNQ 1YNJC 2DGRA 3RN2A 4R4QA 2AKWB 1XMOL 1ZYRC 1E2WA 3UDIA 2UXCL 2VUMG 1S72A 1KD1C 1JJ2A 1XNQQ 4X66L 1EQQA 2IY5B 4LFCQ 1MJCA 2EJFC 3DM3A 5FJ8H 2ZM6L 2R7DA 3TS0A 3A7AB 1V9PA 4KKTA 4JBMA 3H0GH 1OXSC 4OGQC 1XMQL 4A3BG 4QJFA 1T9HA 4DR3L 1KXLA 2OCEA 3UDGA 2UUBQ 1BDOA 3ZJYC 1V1QA 5C0XJ 4JI6L 5JJLA 3I2ZA 1E2VA 2AWNA 1UWVA 4NB3A 1PHJA 1IBML 4LFBL 4GLXA 2K14A 1A6XA 3CAMA 4L5RC 2JA7H 3U4VA 3W3AA 1PH1A 2ES2A 1HZ9A 4P72A 4P73A 2IHEA 1S3OA 2VQFL 1K1GA 2D0PA 4RG1A 2MO0A 2CWAA 3GTLH 2A6EC 1EWIA 2K5VA 3PCOB 4A3EG 4DNIA 2Q2TA 2AUJD 1K8AC 1OXVA 4KHPL 2KHIA 3HOYH 1Q12A 3UDXA 3W5OA 3PUXA 2K5HA 4MNOA 2BL5A 2D62A 1ZZKA 4H13C 1Y8PB 3BDOA 3WDNA 2Z6KC 2ZT9C 5AJ3Q 3RLOA 2JVZA 1K3RA 3DXJC 3M4QA 3T56B 4A3IH 1X4NA 2K7VA 2RHSB 2CTMA 1LUZA 1PFSA 1GO3E 4JBJA 4NXML 2R93H 1NMGA 2BA0A 1SR3A 2DGYA 4KKUA 1LYLA 4DK6C 3TS2A 4NXNL 5K36G 4BY7H 3U50C 2O5IC 1GKHA 4LF6L 3GO5A 4A3KG 2UUCQ 5IY0A 4A3GH 1HQMC 4JI1Q 3CQZH 3CCJA 3HOUH 5JEAH 3RN5A 3I55A 5C4XH 3KJPA 4HIMA 4B3SQ 4B3TQ 4IFDH 2JK8A 4L5SA 1VQHA 2V4DA 4DV2L 3T1HQ 1B9MA 1VQFA 1GJXA 2BDOA 3CF5A 4LF4Q 3S2DH 1MKHA 1IW7D 1K8OA 4ME3A 4DR6Q 1ZTGA 5FJ8G 4JI3Q 3VDYA 2CPQA 1E24A 4A3MG 2Q2UA 1N34L 1I6VC 2JXMB 5IWAL 1D7QA 1A0IA 1V43A 2QEXA 1A63A 4KHZA 4C3IH 4LF7Q 2BE5D 4BXXH 3I4LA 1IL2A 4LJZC 2HH3A 2R93G 3FPPA 4DV4L 2PNRC 3BG3A 1TWFH 4JV5L 4B8TA 2UXBQ 1IBKL 2PMZE 1Q81C 4YWMA 3I7FA 1L2FA 1I6HH 4IPGA 2GVBA 3A74A 1RL2A 2K75A 1ASYA 1KAWA 1N33Q 3IRBA 4GN4B 4JI7Q 1HTPA 1IBLQ 3K80C 1X4MA 5GAEC 2ANNA 1IBLL 2EDGA 2LXKA 2KBNA 4DR7L 1EFWA 4Y52H 4AYBG 1J5EL 5IP9G 4AQYQ 1Y1WH 4YWKA 1Q7YC 3F1ZA 1Z7TA 3TZUA 2EXDA 4NXNQ 4B3RQ 3PUVA 2LSSA 1PH8A 1EOVA 1LM0A 3KDFB 3GTMH 1ONLA 2K4KA 3A8IE 3NENA 1VQGA 3Q8DA 1PA6A 1C9OA 1YBYA 3NBHB 5KNCA 2PI2E 2HQLA 3CCQA 4DV0Q 1P8LA 3OOCA 4KHPQ 1FL0A 3KOJA 3S24A 3ULLA 4OX9L 2LMCB 1DGSA 1NE3A 4A93H 4NPSA 3CCEA 4LIJA 2HH2A 4UP9A 5M3FG 3GTQH 2JA5H 4L8JA 1DT4A 2HIVA 1RIPA 1QUQB 4X62Q 3FP9A 1U0LA 5LMUQ 4DV5L 2NZOA 3M85A 3VR3A 2HHHQ 4NXMQ 3F2DA 1TXYA 2VQFQ 4MZ9A 4C2MH 4WJ3M 1YHBA 4LF8L 4A75A 2CKZB 2Y0SE 1GUGA 1YHAA 2VS1A 4XTCS 1PV4A 1YNXA 4IQZA 3RLFA 2E8GA 3PGZA 1PYSB 5C3EH 1C7YA 3MXNB 1J5KA 4H02A 3HOZH 4BBSH 2N78A 2ZM6Q 2I0QA 4HIKA 1VQKA 2QA4A 3E9IA 3I4OA 4GS3A 4IPDA 1ZKOA 3D0FA 5LMNW 4NBQA 2EJGC 2CTKA 2I5HA 4X62L 4GLAC 1NJIC 2E2IH 1CSPA 1GVPA 3AQQA 2ASBA 2UXBL 1YI2A 3CW2C 1Q86C 1H9SB 2ID0A 3M4PA 4B3MQ 1TWAH 3L0OA 1SE8A 2ZJQA 4LF9L 2E2JH 1H95A 1KRTA 2CTJA 4R4TA 1K73C 3HGBA 3PIOA 1X9NA 4X66Q 1XNRL 2AWOA 1SROA 1Q82C 2ZTCA 3JAMc 1CSQA 4G7ZC 1GHKA 1CKNA 1WYDA 1X3GA 1X6OA 2MNAA 1SFOH 3B6YA 4DUYL 2UU9L 4JVHA 2UUBL 2UXCQ 3TRZA 1E7ZA 2F3IA 2JA8G 4DR3Q 1IBMQ 2DNEA 3KLRA 1DCZA 2IT1A 1HNWL 3LNNA 1IW7C 5DLQE 5BR8L 4HJ7A 4JI4L 2BH2A 3GTPH 1VF7A 1QUQA 5C4XG 3KYHC 4JI0L 2DNCA 1N34Q 1N32L 2AUKA 4AH6A 1K0RA 4APVA 1Y69U 4QGUA 5GADC 4GOPB 3A7LA 1N36L 4K0KL 4IPHA 2VQEQ 4GZYC 3NE5B 4BBRH 1VQ4A 1SN8A 3RZDH 5A35A 4B3TL 1YZ6A 3KF6A 3STBD 3L2PA 1BBUA 3RLNA 4DAYB 1QZGA 4DNTB 1CI3M 1JJCB 1N8RC 1XJVA 2EIFA 3HKSA 1IZ6A 3M9BA 2NVQH 1U5KA 4JI7L 4OO1H 3KFUA 4JI4Q 4LUZA 1N33L 3UE0A 2PQAB 4JI5L 5IWAQ 2JEAI 2Y0SG 3JC66 2VUMH 1WCMH 4A3CG 2GN5A 1N36Q 2PY9A 2LXJA 4LK1C 4PZ8A 4R4OA 4PV1C 1QZHA 1TU2B 2MFIA 1OXUA 2RF4A 2E2HH 3PO3H 4JI1L 4GKJQ 2IHFA 2JEBI 2UXDQ 1VF5C 4JV5Q 3ER0A 1DXMA 3HKZG 4YWLA 1CFMA 3ND8A 2V1CC 4DAMA 3RNUA 1YJ9A 1PH6A 1L1OA 4IO9A 1VQOA 1VQMA 3FMCA 1I50H 5HGQA 3J7ZC 2R92H 3BU2A 4DUYQ 1H9RA 1HR0L 3PSIA 1L0WA 1X56A 2YTYA 2AMCB 4P74A 2I5MX 4BBRG 1KC8C 1I3QH 1Z47A 5FLMH 1EC6A 2F52A 1YITA 4JI3L 1X65A 1GM5A 2E3UA 1WOCA 3HOXH 2YQRA 4LF5Q 4P71A 1NY4A 1KL9A 2WAQE 4AM3A 2Z6KA 3ICEA 5IYBG 3K0XA 3CCRA 2K33A 4IJLA 4JOIC 3EBEA 3S16H 1FR3A 4DV6L 4DV7L 4DR4Q 2YV5A 4R4CA 3ULJA 3U9SA 4LF9Q 4WALA 5M3MG 1HZAA 1SMXA 2EQSA 4LWCA 4LF8Q 4GNXB 1FYCA 2OTJA 4A3FH 1UE7A 4JI2Q 4IFDI 2A19A 5GAHC 4JI8Q 4H44C 3OPOA 1K8GA 2K32A 3H3VI 1YHQA 1ZZIA 2VL6A 3SDZA 2OPVA 2OQ0A 1HJPA 3CCUA 5AJ3L 2OWOA 1K83H 2PQUA 3E0EA 4PG3A 1HZBA 3L7ZC 1Y1WG 3A8JE 4QMFB 2CWPA 4H0LC 4DK1A 2JA9A 3S15H 2JJQA 4A3LH 4JYAL 4JC0A 1K9MC 4O2DA 1XPRA 4DR4L 3HOZG 1GUOA 4BBSG 1Y1VH 2JA6G 5BN3A 4IOCA 3HOVG 3HOUG 4GKJL 3I73A 5C3EG 1GHJA 3F2CA 3I4MG 1B70B 3TQYA 2BA1A 3G6EA 4AIMA 1OTCA 2HIXA 3UE1A 2YTVA 4KLKA 2CTEA 3I4MH 4LUVA 4WANA 1HPCA 4QL5A 4YCUA 2R92G 3S1NH 4TKOB 4OWTB 4YY3L 3BZKA 3M4OH 1H9KA 1L1OB 4DV3L 1EQRA 2HHHL 5JJIA 3AEVB 3EN2A 1WJJA 4FDBA 1PVOA 3VR5A 4UP7A 1PH2A 1MIUA 2E76C 1VQ8A 2JA5G 2RHQB 3ERSX 4DKAC 4KI0A 4DUZL 2E74C 1Q46A 3AEVA 4B3RL 1BVSA 2A69C 1B9NA 3CPFA 3KF8B 3MEFA 1IYJB 2WP8J 3MXUA 2VQEL 1K8MA 1OXXK 1J4WA 4X65Q 4UP8A 1Y8NB 5M3FH 3U1KA 3GD7A 2B8FA 4DV4Q 2NN6I 1I5FA 5IYCH 4OWWB 2A6HC 2UUCL 1XPUA 3VKEA 5BN5A 5J3BA 1N9WA 2ZJPA 2NN6H 1X54A 2AHOB 4DV3Q 2OQKA 4DR5L 4O0AA 1I94L 2VY3A 4DR5Q 1I94Q 5C44G 2FMRA 2JZXA 1WFQA 1WI5A 1J6QA 5KNDA 2L15A 2R7FA 3UDFA 4YHHL 4GOPC 3I72A 4X64Q 3CRKC 3K8AA 4XIGS 3LGJA 4YCVA 2PNHA 5M5WH 4UY8C 2B63G 4X64L 2N49A 3HFZB 3S2HH 3NEMA 3CC4A 4BY1H 4A3JG 2PCFB 4DR6L 2ANRA 5EAYA 1JB7A 1JT8A 5IE8A 3PV0A 2VZAA 3KDFA 3D31A 2B29A 2MQHA 4DK0A 4L5TA 4AQYL 2F1MA 3F2BA 1YJWA 1TUAA 1HZCA 2OPUA 1LACA 2JA8H 1DTJA 3T53B 1D8LA 2L5TA 5K36H 1NMFA 2B3GA 1SLJA 2Q2IA 3QJYA 4KMUC 4G7HC 3A0JA 2UUAL 3AFPA 5M5YH 2JQOA 2NZHA 2E5LQ 1VQ5A 1O78A 4MTNA 3G4SA 4YCWA 2ATWA 2MO1A 3CCSA 4KN4C 5E7NA 1Y14B 4AYBE 2CFMA 3F8TA 1HCZA 4DK3C 2D2CC 5IYBH 2OTLA 2UU9Q 1GUSA 4G7OC 1VCIA 4R4IA 3U4ZA 1E2ZA 3OW7A 3HOXG 4DV2Q 4A3FG 1VQPA 2A68D 4PZ6A 5JJKA 1JJGA 1VIHA 2E75C 1AH9A 1UEBA 2O5JC 4TVAB 3N6RA 2K52A 4C3HH 3KJOA 4DR2Q 1E3PA 1FJGL 1YJNA 2EJMA 4BY7G 2CTLA 2FXQA 4B3ML 1QJOA 3GTOH 4LW1A 3FKIG 1X3EA 3PUYA 3PF4A 3OTOQ 2YU9H 4DV6Q 1XPOA 1B8AA 1VQNA 2QGQA 1G6PA 4JVYA 1VIGA 3G71A 2YYZA 1PH7A 1ZZJA 2NVTH 1NTGA 2YTXA 1HR0W 3PO3G 4GN5A 4JI2L 4DNRB 4KKSA 2A68C 3SGIA 1WCMG 2C35B 4A3KH 2N3SA 4HJAA 5ELNA 4QY7A 1FJGQ 4JI6Q 1YNNC 4OO1G 4EQ5A 3CPWA 1AE3A 4JYAQ 3DLLA 4OWXB 3J81j 4BXXG 3VR2A 3CCVA 3BJUA 4DR2L 3V69A 1OXTA 2D5DA 4JBWA 1EIYB 3IFTA 1QVFA 3S1MH 1JE5A 4OXPA 3PO2G 1WE8A 2GVAA 1YEZA 2UXDL 1PH4A 4JG2A 1GUTA 4LFAQ 3GTKH 3J7A5 3T51B 1A8VA 1CKNB 1DD2A 1PYBA 4OONA 2RCNA 5GAGC 1EYGA 1G51A 1UE6A 1HR0Q 3RZOH 3VA7A 4A93G 3HOYG 1SMYC 5FLXc 5FLMG 5GQOA 1WVNA 1TWGH 4GKKL 1E1OA 3CRLC 2KCTA 2QNDA 3A8KE 3M7NA 1Q8KA 1PH5A 2KCCA 4LF5L 1JMCA 4POGA 2WFWA 1HNZL 3CC7A 3S17H 1TKWB 4GOPA 1BKBA 4ALPA 3GQBA 3SE0A 4A4IA 1Q1BA 4A3DG 5HY6A 3W1GA 1VQAA 2IX1A 3QIAA 2B8GA 4GNXC 3JAMi 1N32Q 4WJ4A 3J80c 4UPAA 1VQLA 3CC2A 4K0KQ 1VQJA 4C3JH 4A3CH 1GUNA 2MJHA 2Z0SA 1VQIA 2WAQG 2PI2A 3E9HA 1B7YB 2CW0C 3QG1A 3H0GG 1IYUA 4OX9Q 4GKKQ 1PH3A 4X65L 3I56A 2ZTEA 2I5LX 1XMQQ 4A3GG 2P2RA 4DPGA 1P16A 1IYVA 5C0XG 1GD7A 3EIVA 3I4NG 3PIPA 4YHHQ 2D0OA 2KA7A
chains in the Genus database with same CATH superfamily
4DXGA 2DN8A 2WB1G 4IUVA 5EKKA 3S1QH 1JCKB 4U673 1YNJD 3HKZE 4QF4A 1FVIA 4JI0Q 3PO3B 1A62A 4C1NI 4LF7L 2ICEC 1HH2P 4LFAL 2ZTDA 1QNUA 5C4JH 2B63H 1MJEA 4DV1Q 3T1HL 1X3FA 4I7ZC 4LF4L 3I4NH 5EJWA 5IGBA 5IYDH 4R1JA 2F3WA 3PF5A 4JW0A 3Q24A 4ZUJA 1UE5A 3PUZA 2AQ2B 4DR1Q 3K7UC 1F0XA 2WB1E 2AXYA 2O2LD 4DF7A 4LF4H 2A8VA 2Z4IA 4Z9CB 4BA2I 1G291 4A76A 3BZCA 2UUBH 1VQEA 2DY7A 3T16A 1X0AA 5JEAG 2PQAA 1EL0A 1L1OC 2QF7A 1KHIA 3TEHB 3S16B 2HT1A 4C3IG 1LTID 1U9RA 2F0IA 1HFNA 3G48A 2EXZA 5G3LF 4LNQA 1PH9A 2NVXH 1VQ6A 1RF2D 2F0FA 3VR4A 2F3VA 5C6AA 1CKMA 3ND9A 5ELFA 4JK1C 1BBWA 3TSSA 3QOLA 5I2YA 4LFCL 2R7ZG 3T1YL 1CUKA 2K03A 3HKZB 1ILQA 5JPNC 4A3LG 2F0DA 4ODGA 1LTLA 5LMUH 1AE2A 5J22A 2FHTA 2DGRA 1LT3D 4R4QA 2AKWB 3UDIA 2D9UA 4X66L 1PZJD 1EQQA 2R61A 2IY5B 3VA5A 1JORA 4K5WA 2R7DA 4GKJH 3TS0A 1JR0D 3NWTA 1D5MC 2RVLA 4DR3L 1KXLA 3UDGA 3DEOA 1PHJA 2JA7H 1UAPA 4ZQ3A 2M2LA 4P72A 4P73A 1C4QA 2CWAA 5KYLA 5EGTA 3KF8A 2AUJD 1K8AC 2B2VC 2KHIA 2F4IA 3UDXA 2BL5A 2K5HA 1IL8A 3J80L 2Z6KC 3BDOA 3WDNA 2QKIC 3RLOA 1PZID 2K7VA 1LUZA 1NMGA 2BA0A 3ONAB 4MTKA 4DK6C 1WTVA 2F0PA 4RGOS 4LF6L 4A3KG 3NSWA 1JWMD 4DV2H 1NNXA 3CQZH 3CCJA 1R4PB 5JEAH 3T4AC 4BY1B 2JK8A 4L5SA 1BQQT 1MKHA 1ZTGA 4JI3Q 1E24A 4A3MG 2JXMB 4HTHA 5CV6A 2J0TD 3A55A 4NDXA 3G7LA 4BXXH 4ZUIA 4JV5L 1F9RA 5M5YB 3SB1A 2PMZE 4YWMA 1LLRD 1ASYA 1KAWA 4GN4B 4JI7Q 4EVOA 1IBLL 2EDGA 2LXKA 2ENBA 2KBNA 1EFWA 2BDNA 1J5EL 3I90A 5IP9G 4AQYQ 1Y1WH 4B3RQ 3F1ZA 3K58A 2PZTA 2LSSA 3KDFB 2UXBL 2K4KA 4DXFA 3A8IE 1VQGA 1YBYA 1X3PA 2PI2E 2HQLA 5KNCA 4LIJA 3S24A 3ULLA 4A93H 1RD9D 4RAUC 2JA5H 2L9HA 1BCPC 1RIPA 3FP9A 1X9ZA 2XWBB 4A3JB 1FKAH 4A75A 2F0QA 2EE1A 1J5KA 1PYSB 1C7YA 1DOKA 2NTTA 4BBSH 1JOOA 3I4OA 1FGBD 2K6AA 1CA6A 2EJGC 2I5HA 2E2IH 1II3A 1SEBD 5JVG3 1I4RA 4OELB 1JWUD 1M4VA 2ID0A 1VMCA 3M4PA 3JAMW 2EPBA 4B3MQ 2K1HA 2ZJQA 1BCPB 1H95A 5COYA 4R4TA 1LTAD 5I9OA 1CSQA 1CKNA 3CCLA 1DT4A 4HN7A 3KK7A 3Q23A 3B6YA 2RA4A 3S1MB 4JVHA 4DR1H 1IBMQ 1QG7A 3D8GA 2DNEA 1DCZA 2IT1A 4HJ7A 1RHPA 4DV5H 4J1MA 4X3KA 2DNCA 3OTOH 1N32L 2AUKA 1Y69U 3OHXC 3A7LA 3NE5B 5EPJA 5FKAC 2CWHA 1KTKA 3KF6A 3STBD 4DNTB 1CI3M 5HURA 1XJVA 1BO0A 2EIFA 3HKSA 1G8ZD 4OO1H 1N33L 2LKVA 4A3FB 1CK1A 2VUMH 3C1EA 3SK8A 4A3CG 1XX8A 1N36Q 4PMCA 2XWJB 4LK1C 3I3CA 4PZ8A 4R4OA 4PV1C 2RF4A 1OXUA 5JJZA 4JI1L 3DWQA 2G9HD 1DXMA 3HKZG 1YJ9A 3ND8A 5C4XB 4NZTM 1PH6A 3CQZB 1B53A 5HGQA 3PSIA 3OSOA 2L4NA 1KLUD 1EC6A 1EYAA 1BBXC 4ZKBB 1F77A 2F52A 1YITA 1SEIA 1PRTD 1GM5A 2YQRA 1CQFA 4WFN3 1NY4A 1KL9A 2WAQE 3MTSA 3ICEA 4DV7L 4DR4Q 2JA8B 3BDLA 4LF9Q 5M3MG 1SMXA 3K6OA 1EEID 1FYCA 1UE7A 4CHTB 4K8JA 3PMFA 1KNEA 5AJ3L 2OWOA 2HCIA 1HZBA 3L7ZC 4NXMH 2B39A 2JA9A 3H3VC 2AQ3B 4P2CB 3S15H 4JC0A 4O2DA 4BBSG 1GUOA 1JC7A 2ZXOA 4FF4A 3HOVG 4IOCA 1D6EC 3F2CA 1GHJA 1B70B 3G6EA 2BA1A 2UUAH 3UE1A 2F0HA 2M00A 4WANA 3PQIA 4DN4M 2EYLA 2NVYB 1H9KA 4DV3L 3EN2A 5IWAH 1PVOA 3VR5A 1VQ8A 1MIUA 5KGUA 2RHQB 4DUZL 4DR4H 3P1HA 1TY0A 4CJ0B 5M3FH 4OWWB 4DV4Q 3R2TA 5IYCH 1L0XB 2G9DA 1RCVD 4ZKCB 2ZJPA 1N9WA 2AHOB 2NN6H 2HHHQ 3HOVH 3HOUG 2XN9C 1EOTA 2FMRA 1I94Q 5C44G 5FO8B 2R7FA 4GOPC 3UDFA 1F2ZA 3I72A 3CRKC 2Z4HA 3K8AA 2R93G 3CC4A 2ANRA 1LTSD 1JT8A 3KDFA 1ZXTA 1D5ZC 2OPUA 1TUAA 2PMZB 2G8YA 5K36H 2K05A 3AFPA 5M5YH 2JQOA 2E5LQ 3P75A 2ATWA 2MGSA 5I6WA 3CF5A 3S1RB 1HCZA 1WTQA 1VCIA 1EWCA 1IBMH 1JJGA 4NKLA 1K83B 1AH9A 4DR2Q 3G6JB 1ZYRD 4BBSB 5CC4A 2EJMA 2UXDH 4S3SA 3QOJA 2VB2X 3FKIG 1G6ZA 1B3AA 3OTOQ 1XPOA 1B8AA 4RGMA 4OIKA 2MPMA 3E3XA 3JAME 1HR0W 3K5MA 3NQTA 4JI2L 4DNRB 3FVQA 2F03A 2K5DA 3TMEA 1WCMG 2C35B 4N8FA 1I4GA 2FINB 3Q22A 3DLLA 5CORA 4OWXB 3VR2A 3CCVA 3BJUA 2SDFA 2TMPA 1OXTA 1SXTA 2Z8LA 3LX0A 3V69A 1K3BC 4JBWA 3JAML 1RTOA 1WE8A 3QD7X 3PO2G 4HAEA 3GTKH 1PYBA 1CKNB 1JQYD 1DD2A 1QOHA 4A93G 1UE6A 4DUZH 5FLXc 5GQOA 1WTWA 2Z6BA 5FO9B 1E1OA 2L11A 4PDBA 2VXWA 4RCOA 3M7NA 1PH5A 4POGA 1JMCA 4OD6A 3CC7A 2JSOA 1DZ1A 4HCSA 4B8TA 3SE0A 5C4ZA 4PMBA 1N32H 3BVZA 1VQJA 1D1KA 3I56A 2G5DA 3RMHA 1PRTB 3AU7A 3PIPA 1SNCA 1T5EA 3STBC 3GDEA 4ABNA 4DUZQ 3H15A 1EQTA 4GN3B 3J80E 3IFDA 4TRDA 2KHJA 3X3MA 1XNQL 1X4NA 1H9SA 4JCVE 3HOWG 3OW2A 1V8QA 5CBEE 3FHWA 2NVYH 4B3SL 4TQUS 1FGUA 1MSGA 2A74C 4L63B 3TREA 1A3TA 2SNSA 1QVGA 1X3QA 4RMFA 2K01A 3A5ZB 1C0AA 2SNMA 1KLGD 1KIXA 2VNUD 3CMAA 4HR7B 4I65A 1QE6A 3ULPA 3H3VH 2EYHA 3HOWH 4RGTA 1LABA 1Y8OB 3NELA 1A2TA 4A3DH 3OMGA 1EWHA 1QVCA 2RBMA 5IGEA 4JOIA 3AB9A 2B2TA 1VQCA 5C0XI 3MFYA 5IT9L 4P75A 3OYYA 1IKMA 5K5PA 3J81i 2E2JB 2BCOA 2F0OA 2B2UA 3C2PA 3OTOL 4ULLA 5M3MH 4IFDJ 2RCFA 1STYA 5GROA 2KCMA 2A6HD 3MVVA 1HQRD 2QDBA 4QIWB 5I9PA 2Y3MA 5LMUL 1SFOB 1EIFA 2F4VL 3BZDB 3HOWB 3J80i 1B4OA 2X6GA 5M5XB 4JI5H 1I4HA 1TS3A 3VYUA 4HJ9A 2E2HB 4RGNA 3CXCA 1E0BA 1Y1VG 4PMWA 3VR6A 3GTGH 2B2WC 2FFMA 2K50A 4R9WA 4Y7NH 4IPCA 4J15A 5E3FA 2MP1A 3M3YH 1H9JA 3PO2H 3K57A 2N8NA 4A3IG 4A3BH 3AFQA 5EBDA 1QILA 1VQDA 3CHBD 3KLWA 2RDGA 3MZ5A 4JI2H 3S9WA 2JYOA 4X62H 1E2WA 3N52A 1JJ2A 1KD1C 5BR8H 4LFCQ 4KD4A 5FJ8H 2XSCA 1O7ZA 2F0TA 4JBMA 1XMQL 3H6MA 4K5XA 3ZJYC 2YU9B 5HGTA 1E2VA 1UWVA 1IBML 4C3HG 4DUYH 4L5RC 4ZK9B 2IHEA 2VQFL 5EPKA 2HCCA 1EY8A 5ELEA 3H91A 2HUGA 3GTLH 2M8WA 3GKUA 2K5VA 4A3EG 2Q2TA 3HOYH 1N36H 5J39A 3J81E 1Y8PB 5L37A 2JVZA 1K3RA 3DXJC 3T56B 4JYAH 2CH4W 4NXML 4A3EB 2DGYA 3TS2A 5K36G 1NUCA 4ME5A 4KD3A 5IY0A 3HOUH 2QCPX 5C4XH 1K0SA 5IIFA 4HIMA 1S5ED 3NQIA 3T1HQ 1I3QB 4DV2L 1GJXA 4LF4Q 1DJRD 4ME3A 5FJ8G 3T13A 1N34L 4XQQA 5IWAL 2NYZD 1A0IA 1V43A 5IT9W 1ENAA 4KHZA 4C3IH 2P5ZX 4LF7Q 1IL2A 3MXGA 5ELBA 1TWFH 2WACA 3OWFA 4DGZA 2UXBQ 1AP0A 1I6HH 3I7FA 1L2FA 3CU7A 4B9WA 4X3TA 3A74A 1ICWA 1RL2A 1I4XA 1JB3A 2K75A 4CDDC 1KDCA 3IRBA 1HTPA 1IBLQ 1X32A 1X4MA 5GAEC 4YHHH 4DR7L 1BCPD 4AYBG 3HEJA 2CTLA 5D65A 1UUPA 1PH8A 4YIJA 1ONLA 3Q8DA 1PA6A 2K5QA 4DV0Q 4RFBA 4B9XA 3KOJA 1STGA 1DGSA 4EQNA 2HH2A 4UP9A 3GTQH 2NB0A 4UDUC 1QUQB 3FRPB 4X62Q 1G2TA 4DV5L 1MI2A 4NZRM 4XYOA 3M85A 3KBGA 3VR3A 3F2DA 1EY6A 4MZ9A 1HR0H 2CKZB 5T1GA 1GUGA 1YHAA 2VS1A 2E8GA 2AQ1B 1WTPA 3GABA 1EIHA 2N78A 2QA4A 3E9IA 2IPKD 3W2DA 2CQAA 4GLAC 1GVPA 3AQQA 5E1FA 1YI2A 1PYWD 3CW2C 5M3MB 4ZAIA 1SMYD 5FK9C 2VKCA 1MD2D 4EC5A 1NCVA 1FNVA 3H09A 2E2JH 3A54A 1STAA 1A3VA 3MA2B 1S5CD 4X66Q 1XNRL 3RZOB 4JI6H 2Y0SB 3JAMc 4NMZA 1SFOH 1GHKA 4FO2A 5IT9E 3E0JA 4DUYL 4A3IB 2F3IA 5JOBA 2JA8G 4DR3Q 3OIPA 2ZQEA 1U4LA 1SNPA 4JI4L 5C4XG 1VF7A 3KYHC 1N34Q 1V1PA 3EFXD 4APVA 1N36L 4CKBA 1BOSA 4GZYC 4F7XA 5D3IB 3RZDH 2PO4A 4A3BB 5A35A 4F88A 3HRZC 1JJCB 3OSSD 4KY5A 1IZ6A 1U5KA 2N88A 5IGFA 5IWAQ 2PQAB 4JI5L 1JOQA 2GN5A 2LXJA 1ENCA 3PO3H 2MFIA 3EVQA 2E2HH 4GKJQ 2RSOA 4UAIA 1XYIA 3S1QB 2PYKA 2C9OA 2QW7A 2LF0A 3GTKB 1CFMA 2V1CC 3RNUA 2ZXPA 4A3LH 4IO9A 1VQMA 1I50H 4DR6H 1EZ6A 4NW2A 3V2TA 1H9RA 1L0WA 1SNOA 4DFAA 1D1IA 1Z47A 3RD4A 4B3SH 3Q0AA 1Q8IA 4JI3L 1TY2A 1HTLD 4LF5Q 2Z6KA 1IKLA 4IJLA 3S16H 1FR3A 5KEEA 4DV6L 4LFCH 4KJOA 4IURA 2O4XA 3ULJA 3U9SA 2RDHA 1V8CA 1HZAA 4LWCA 4GNXB 4QUCA 4IFDI 4JI8Q 2J7ZA 4H44C 1K8GA 4RKLA 3H3VI 1KDAA 3SDZA 2OQ0A 4M8AA 1B2TA 3RUZA 4LMQD 1K83H 2EYJA 3A8JE 4QMFB 2CWPA 4H0LC 5ELCA 5G3LD 4DK1A 2VQFH 4JYAL 4DR4L 1XPRA 1Y1VH 4GKJL 3I73A 5C3EG 5I2XA 4AIMA 4KLKA 3GV3A 4FNFA 3R2IA 2KEDA 1HPCA 1SE3A 2LS01 1L1OB 4HEDA 2RQXA 1ILPA 5JJIA 1WTJA 2IL8A 1WJJA 3Q6SA 1PH2A 4IN3A 4JVZA 2Z1CA 4KTAA 2KJXA 2OXPA 4KI0A 1QCBD 4B3RL 3KF8B 1B9NA 2F0EA 3D4DA 2HDLA 3J80W 2WP8J 2CW0D 1K8MA 4CBVA 3U1KA 3GD7A 2PQUA 5JVH3 3S15B 1PTOB 4CJ1B 4DR5L 1X54A 2EZVA 3I4NG 3GTPB 2VY3A 4HMIA 1V1OA 5KNDA 4AQYH 4X64Q 4YCVA 2PNHA 4BBRB 4UY8C 3S2HH 3HFZB 4DR6L 3PV0A 4L5TA 3D31A 2B29A 3I70A 1PTOF 3F2BA 4CKCA 2CPMA 1LACA 2JA8H 2Q2IA 2B3GA 1SLJA 3QJYA 3J81L 3A0JA 1WD0A 1D5XC 1WCMB 1O78A 4MTNA 5E7NA 3F8TA 4H7BA 2OTLA 2DY8A 2UU9Q 2LY7A 3U4ZA 1VIHA 2A68D 1XTCD 1I6HB 1UEBA 3SEBA 3N6RA 2K52A 3KJOA 4CDEC 4X64H 4KK7A 5KYIA 3PF4A 1N34H 4DV6Q 2QGQA 4FXGC 2PZWA 2PZUA 1I94H 3G71A 2YYZA 3RZDB 1ZZJA 1KNAA 4JI4H 2YTXA 3GR5A 1ENFA 2A68C 1NR4A 5DNFA 3QR8A 2N3SA 5ELNA 1AE3A 4JYAQ 3MAQA 2K5WA 2WV6D 4QCLA 1EIYB 2Q8TA 1F2MA 4JG2A 3R8BA 1PH4A 3J7A5 1CHQD 2IWHA 3RZOH 4LFAH 1WTHA 1SMYC 3EJIA 5FLMG 4FF2A 4IUTA 4X65H 1I4PA 4N9TA 1S5FD 3OWEB 4RWSC 4G4KA 1EU3A 2KEEA 4CDCC 2QNDA 2HQEA 1WTRA 2FFKB 1DYQA 1K28A 5CV7A 1MSHA 2XRSD 4GOPA 2EY2A 1R4QB 1VQAA 3W1GA 4WJ4A 2BOSA 1VQLA 2MJHA 4C3JH 4A3CH 1GUNA 1VQIA 2CW0C 1IYUA 1PFMA 1PH3A 4X65L 3C3LA 4FVMA 1SE2A 3R3OA 3CCQA 2KA7A 3RR5A 2F4VQ 4JI5Q 1HNZQ 1S40A 5M3FB 1J5EQ 4HJ5A 3A5UA 2KENA 4FJSA 2B2UC 4X6AH 4A3MB 1J9OA 2JA7G 1CA5A 1HA5A 2F0UA 4IOAA 1PRTF 3K5OA 1VQ9A 4DR1L 2XGTA 1Z9FA 5IP9H 1EU4A 2WIIB 3PO2B 1HNXL 3J7AK 1HNWQ 1EYDA 1XTDA 3AYHB 4GLVB 2C5CA 2N55A 3M4YA 4A93B 2K5NA 4U68A 4EQPA 1O7IA 1VS0A 2H5XA 5IYDG 3K5NA 4EX5A 4LF6Q 1MBYA 5AFWA 1LTRD 1XNRQ 1Q1EA 1Z6HA 3H94A 5M5XH 1CTMA 4JI8L 4A3EH 1EQVA 5KIXA 3GTJH 4ID6A 1M1KC 2B2VA 4DU9A 4C3HB 2D9IA 2Q2HA 3NXWA 4OL7A 1W3SA 3FKIB 1HNWH 1I6UA 1NXUA 2CCZA 2XTIA 1PTOD 4DAPA 4DV7Q 4JBKA 5JEAJ 4QB4A 3NHHA 4K2LA 3RF2A 2ALYB 4X66H 2F0LA 2IX0A 1XNRH 1YVCA 5ELOA 1HRJA 4DV0L 3UOEA 2OT2A 4HJ8A 1HNXQ 1E22A 4B3MH 3DHQA 4DV5Q 1O7LA 3D4RA 1FNUA 1TWFB 3U58A 5BN4A 2PQEA 3C46A 1E1TA 1LT6D 2EVBA 4A3JH 1W2BA 1RODA 1S20A 3GTOB 1PRTC 2CHBD 4POFA 4MHEA 1TQOA 4OO1I 1KRSA 4DV1H 1XWEA 4IJHA 1AN7A 4HSPA 1VQ7A 1IBKQ 2A69D 4QIWE 1X55A 4C1NK 4E6IA 4HIDA 4L5QA 3PUWA 1A15A 3FKIH 5IT9c 3R93A 4KY7A 4GNXA 1KQSA 1SJHD 1EUJA 2JP1A 1EY7A 5C0XH 4FF3A 5BR8Q 4IZ8A 2MJ8A 1YNJC 1ZYRC 1S72A 4DV7H 1MJCA 3DM3A 3DWAA 3A7AB 3TP8A 2A5HA 4OGQC 4QJFA 3HZXA 1V1QA 3VYTA 5CV8A 2AWNA 4NB3A 1SYBA 2K14A 3CAMA 1A6XA 3U4VA 1PH1A 1HZ9A 4TSSA 1S3OA 1K1GA 1S03G 2MO0A 2K28A 2A6EC 1EIGA 2CH4A 3PCOB 1SDFA 5CV9A 3PUXA 4MNOA 1PFBA 3TZDA 1ZZKA 5AJ3Q 1BXTA 3M4QA 4A3IH 2RHSB 2CTMA 1PFSA 1GO3E 2QILA 4V190 2F0MA 3SR1A 1SR3A 4JV5H 4KKUA 1LYLA 4NXNL 3U50C 1N33H 3T1HH 2EYMA 1RTNA 3I55A 3KJPA 2KHSA 1FNWA 4B3SQ 1KDBA 3DUZA 1VQHA 2V4DA 1T5XD 1VQFA 4LF7H 2BDOA 4J6HA 4DR6Q 4F87A 3I4NB 1ESFA 5FLXW 3VDYA 2PT7G 1STEA 1D7QA 1A2UA 1A63A 1HA6A 4PQXA 1EEFD 2NUCA 1D2BA 4LF6H 3FDTA 3V05A 3FPPA 1GOZA 4DV4L 2PNRC 4HCEA 4L6TB 2LTLA 1IBKL 1QNKA 3URYA 3MFGA 1UG8A 4JI0H 2GVBA 5EKIA 1N33Q 5DAUA 1W6KA 1S4ZA 1DOMA 3K80C 2B2YA 5M5WB 4B08A 4Y52H 2RKSA 5KRUA 3NWSA 4JPBW 4FP5D 5ELDA 2XIWA 4NXNQ 4YWKA 1Q7YC 2EXDA 3SK4A 3TZUA 2HD3A 1EOVA 5C5MA 2ZXRA 3GTMH 3NENA 2L12A 3NBHB 3TBIB 1ESRA 4RH6A 1P8LA 2KQ3A 3OOCA 4KHPQ 1FL0A 3PIO3 4OX9L 4NPSA 4X3UA 5M3FG 2QDLA 2HIVA 1HUMA 1IBLH 3SVMA 1U0LA 3K59A 5LMUQ 1V1PB 4NXMQ 1F9SA 1ODHA 4C2MH 4OCHA 1YHBA 4KY6A 4LF8L 2UXBH 2Y0SE 2JA6B 4XTCS 3BS1A 1PV4A 4IQZA 4RKBA 3EZJA 1EZ8A 4H02A 1ET9A 3HOZH 4WORA 2KECA 4OEMB 5CMDA 2I0QA 1S5DD 5LMNW 3D3RA 3IL8A 3D0FA 1S5BD 3DWPA 3OETA 3PIP3 2CTKA 4K14A 1NJIC 1CHPD 1CSPA 4LF5H 4DR7H 5EPLA 1H9SB 1TWAH 3L0OA 1SE8A 1WTXA 1KRTA 2CTJA 1K73C 4K6LA 4JI8H 3HGBA 4ZYSA 3K5LA 1X9NA 1TVXA 2AWOA 1Q82C 2ZTCA 4G7ZC 1WYDA 1X6OA 2MNAA 2UU9L 4KV6A 2UUBL 3TRZA 5F2DA 2NVXB 1HNWL 3LNNA 1IW7C 5C3EB 2WINB 2O4CA 3GTPH 1QUQA 1PXUA 4BY7B 4JI0L 4O42A 4DV6H 1ICFB 4AH6A 4QGUA 3GTLB 2VQEQ 1G2SA 4BBRH 1BF4A 3S2HB 3D4WA 3L2PA 3I0PA 1PQXA 3RLNA 4H8AA 2MHVA 3M9BA 2NVQH 1M8AA 3LWEA 1UEAB 4JI7L 3KFUA 4JI4Q 3V96A 3UE0A 2Y0SG 2JEAI 3I91A 1WCMH 2I07B 5LL6X 2PY9A 1C48A 4EQOA 3QO2A 2JEBI 3CKIB 2UXDQ 3GP7A 1AZPA 3TN2A 4JV5Q 1LTTD 4MIUA 2Z9HA 4K5VA 4DAMA 2L0CA 1B3QA 2L1BA 1L1OA 1VQOA 3FMCA 3J7ZC 3BU2A 1JE4A 1YNND 1EFID 2YTYA 2AMCB 4BBRG 5CGKA 4Q0FA 1KC8C 5FLMH 1X65A 2E3UA 1WOCA 1B50A 4P71A 4AM3A 4XYQA 3K0XA 3CCRA 3EBEA 1ET6A 5LHY1 4V0BA 5IGCA 4R4CA 1Z2IA 3GV6A 4WALA 4LF8Q 4CJ2C 1XMQH 4JI2Q 2A19A 3FPUB 1BR9A 3OPOA 2L55A 2VL6A 2KUMA 4LFBH 3CCUA 3KLSA 2EY1A 4DV3H 1XNQH 2RSNA 2NWGA 1TS4A 2I46A 1I50B 3E5SA 3HOZG 3KBXA 5BN3A 1HUNA 3I4MG 2YTVA 2TSSA 4QL5A 3S1NH 4TKOB 4OWTB 3BZKA 4E9JA 1MGSA 2WB1B 1EQRA 3AEVB 4FDBA 4UP7A 2JA5G 3ERSX 1XXGA 3AEVA 1EYCA 1BVSA 2A69C 4JI7H 1IYJB 1EY0A 3MXUA 2VQEL 4UP8A 1Y8NB 2B2WA 3VKEA 1I5FA 2NN6I 1XPUA 2UUCL 5BN5A 5J3BA 1VBIA 5ISRA 3ERQA 4DR5Q 2JZXA 1WFQA 1WI5A 2L15A 5CV5A 4YHHL 1SJED 5DT9A 4XIGS 1BUVT 5M5WH 4X64L 4WRDA 4Y7NB 3NEMA 4BY1H 2PCFB 4K8IA 5EAYA 1JB7A 2VZAA 3DM1A 2MQHA 4DK0A 4AQYL 2F1MA 1YJWA 1DTJA 2UU9H 1NMFA 3T53B 4A3GH 4A3GB 4LAAA 5NUCA 3BVGA 4YCWA 2MO1A 4KN4C 4DK3C 1Y14B 2CFMA 2D2CC 1AW7A 1GUSA 4G7OC 1HNZH 1VQPA 1E2ZA 2UUCH 5C4HA 1HFGA 4IALA 4PZ6A 1SYFA 4TVAB 2R92B 4C3HH 4I7AA 4IUQA 3HOZB 1YJNA 3GTJB 3X3NA 5D14A 3GTOH 3J7AV 1X3EA 3PUYA 2YU9H 3HP3A 1VQNA 1J8IA 1SSOA 5EBCA 3HOXB 4JVYA 1VIGA 1TT2A 1PH7A 2NVTH 1NTGA 4GN5A 3WOEA 3NUCA 4K2KA 3SXHA 4A3KH 2Q8RE 4RHRA 5DM73 4QY7A 3OMCA 1RDPD 1F9PA 3CPWA 4EQ5A 1FJGQ 4OO1G 3SK5A 5FOBB 4DR2L 3IFTA 1QVFA 3S1MH 4OXPA 1YEZA 5IGDA 4N8X1 1XNQQ 4OONA 2R93B 1EYGA 3KDGA 2XNAC 1HR0Q 3VA7A 2R7ZB 2K04A 1TWGH 4GKKL 5LL6b 5C44B 2KCTA 3A8KE 4LF5L 1WTOA 3J81W 4HSVA 4YY3H 1TKWB 1BKBA 3GQBA 3NCVA 1Q1BA 5HY6A 4K0KH 1N32Q 3CC2A 2Z0SA 2PI2A 1AZQA 4OX9Q 3QG1A 3HG9A 4C3IB 2HDMA 2F4VH 1AFPA 2ZTEA 2E2DC 1XMQQ 4A3GG 4LF8H 5J1ZA 4DPGA 1P16A 3EIVA 5C0XG 1IYVA 4YHHQ 2RDFA 4GNXC 1IXRA 2UXCL 4BY1G 1AEXA 4ZRZA 2R6GA 1SBBB 3K7AH 2R7ZH 2WKDA 1R9TH 3CD6A 4KN7C 2A6ED 2VB3X 2EOTA 5KNBA 5C44H 2WKCA 5IOCA 1TR5A 4JI1H 4O1NA 2DUDA 4YY3Q 1SRUA 5C5LA 1UE1A 3DMUA 1KHMA 4C56C 5IP7G 2CQOA 4PZ7A 3LWUA 4N9PA 2A1AA 4FF1A 2NN6G 3HS0C 4WJWA 5IYCG 4HIOA 1LO5D 3IKJA 4RCNA 1YIJA 1GUWA 3W1BA 3K0YA 3CMEA 3BYTB 4BWGB 2NTSA 1VDZA 1ASZA 2E5LL 2F0NA 4FJUA 4QQBX 5H1SE 4BA1I 2SOBA 3J81c 3KF6B 3WWVA 1Q90A 1RKNA 2Q8IB 1IHZA 5IP7H 3EQLC 5CV4A 4IFDG 1ML0D 3D6CA 3K81C 5LMNL 2H4OA 3S14H 4LUOA 4CGYB 1TWCH 2OEOA 1CKOA 1PMRA 1AN8A 2UUAQ 4BS9A 4JI3H 3CCMA 2X06A 3MHBA 3P20A 4ZCKA 1H9MA 1HHVA 2VW9A 3NPPA 2ICIA 2JE6I 5C3WA 1NBWA 4DV4H 2BE5C 4LFBQ 1M90C 4B8CD 2FJ2A 2M6QA 3L3OC 4G57A 2ZJRA 1XMOQ 2LRRA 3CP0A 4A3MH 2B2YC 2JA6H 2PPBC 2JA7B 1CM9A 1SYDA 4HMJA 3KDKA 2ZM6H 5FO7B 3T1YQ 1TWHH 5IGGA 4DV1L 4DR7Q 1SAPA 4A3KB 5EQ0A 2DJGC 2BH8A 1WVLA 2X6LA 2E2IB 2FPHX 1B44D 1VQBA 4R8NA 5DEHA 4K6DA 1TS5A 1CQVA 3S1RH 3ZYYX 5LMNQ 5I4DA 2EYOA 5CYUA 3RN2A 1SYCA 1XMOL 2VUMG 3F2UA 2EJFC 5M9OA 2ZM6L 1DM0B 3O13A 4XDXA 1V9PA 4KKTA 2F0SA 3H0GH 1OXSC 4A3BG 1T9HA 1Q3LA 4C3JG 1HXYD 2OCEA 2UUBQ 1BDOA 3T1YH 5C0XJ 4JI6L 5JJLA 3I2ZA 4IUUA 2EYPA 4NXNH 4LFBL 4GLXA 3TP6A 3W3AA 2ES2A 3M3YB 3MWYW 2D0PA 4RG1A 2NBFA 1WHRA 1EWIA 4DNIA 4KHPL 1OXVA 2F0GA 1Q12A 3W5OA 1MSZA 2D62A 4H13C 2ZT9C 2H1EA 4UHVA 2XRQD 4DR3H 1JWSD 4RA8A 4JBJA 2R93H 3U9OA 5CR3A 1XMOH 4C2MB 4BY7H 3NBHA 2O5IC 1GKHA 3GO5A 2UUCQ 4FYDA 1HQMC 3QB3A 4JI1Q 5A2QE 3RN5A 3KLSX 3IAYA 4B3TQ 4XT3B 1Y1VB 5DM63 4IFDH 1O80A 1F2YA 4KJNA 3S2DB 1B9MA 3S2DH 4OIJA 1A3UA 1IW7D 1K8OA 2CPQA 2Q2UA 1I6VC 1RJTA 3NK9A 1SYGA 2QEXA 3TDQA 1ZEQX 2BE5D 3E6ZX 5JAVA 2R3ZA 3I4LA 4LJZC 2HH3A 2F0VA 3BG3A 2VUMB 1Q81C 4FXDA 4IPGA 1J5EH 2EYFA 2ANNA 3WOFA 1NAPA 3UI2A 3EA6A 1LTGD 1Z7TA 4OX9H 3PUVA 1CZWA 1LM0A 3QWNA 1C9OA 1NR2A 3FAUA 4XXEA 4BY7G 4OHJA 1DOLA 2XVSA 1WD1A 1NE3A 2LMCB 2NVQB 4B3RH 1TWAB 1MHWC 3CCEA 2UXCH 5E4WC 1CZGA 2IJ0A 1STBA 4L8JA 3TP7A 4LF9H 2NZOA 1EY5A 2B2TC 3OIQA 5LL6S 1TXYA 3MXNA 2VQFQ 3BDCA 4WJ3M 1GXDC 2FMCA 5D3DA 1U4RA 1YNXA 3RLFA 1FD7D 3PGZA 4AYBB 5C3EH 1R9TB 3MXNB 2F0KA 1PTOC 3DEPA 3J7YW 2ZM6Q 4HIKA 1VQKA 2X69A 4GS3A 4NP5A 4IPDA 1LT4D 1ZKOA 2QEJC 4CDFC 4NBQA 3VYSA 4X62L 3S17B 1TWCB 4GKKH 3S1NB 2EY6A 2ASBA 2NZ1D 4XQJA 1Q86C 1SNMA 2A73B 2IW3A 4X3SA 3GTQB 2CWFA 4LF9L 1JOKA 3EROA 4ZLTF 1PZKD 1HNXH 3PIOA 1SROA 2M9VA 1X3GA 2LFNA 4Q5VA 2UXCQ 3H0GB 1E7ZA 4DA2A 2WAQB 1SE4A 3KLRA 2VQEH 1SYEA 2GA4B 5DLQE 5BR8L 2BH2A 3HOVB 4KHVA 1K0RA 4M1UB 4GOPB 5GADC 1EY4A 4DAYA 4K0KL 4IPHA 5A2QW 1O7YA 1VQ4A 1SN8A 4EGVA 3J7AF 1FJGH 4DAVA 4B3TL 1YZ6A 2MUYA 1BBUA 3NTKA 1QZGA 4DAYB 1N8RC 3BYYB 3HOYB 2KOLA 1EY9A 1BNZA 4LUZA 3JC66 2E5LH 4QUFA 3FEWX 1QZHA 1TU2B 2IHFA 1I4QA 2PW5A 2KVMA 1VF5C 2PW7A 3ER0A 4YWLA 2R92H 2KCNA 1QB5D 1Y1WB 4DUYQ 1HR0L 1X56A 3L9AX 4P74A 2I5MX 5CBAE 1I3QH 4B3TH 4XT1B 3I4MB 3HOXH 4ILWA 1B1ZA 1TWHB 3SK6A 5IYBG 1CT1D 1XRHA 3C1FA 2K33A 4JOIC 1UNSA 5EKLA 2YV5A 4FXKC 2EQSA 2OTJA 4A3FH 5LMNH 5GAHC 1G91A 2K32A 1VMPA 1YHQA 1ZZIA 4KHPH 2OPVA 1OO9B 1KABA 1HJPA 2HHHH 5IODA 3D6WA 3E0EA 5A2QL 4R8IA 4PG3A 1Y1WG 1C8CA 1STNA 1V9NA 2JJQA 1TWGB 1K9MC 2JA6G 1OTCA 3TQYA 5FLXL 2HIXA 3HOUB 2CTEA 3I4MH 1STHA 4LUVA 5I6YA 2OF1A 2R92G 4YCUA 1F2LA 1U4PA 4YY3L 3M4OH 1BCPF 2HHHL 2K1BA 2E76C 4DKAC 3BVMA 2E74C 1LT5D 1Q46A 2J4XA 3NTIA 1PFNA 3CPFA 1KAAA 3MEFA 3P7JA 4PNYA 1OXXK 1J4WA 4X65Q 3K7AB 4RHSA 2B8FA 4XQNA 1LTBD 2A6HC 2LTMA 4IUPA 1I94L 4DV3Q 2OQKA 4O0AA 1J6QA 2F0JA 4A3DB 3NBIA 3LGJA 2B63G 2N49A 4A3JG 5IE8A 1F9QA 3M4OB 1HZCA 3S14B 1D8LA 2F0WA 2L5TA 4KMUC 4G7HC 2UUAL 3VYRA 1LV9A 1U4MA 2NZHA 5C3XA 2IX3A 1VQ5A 1TS2A 1SNQA 1W6JA 3NTHA 3G4SA 1QWYA 3CCSA 4AYBE 5IYBH 4A3FG 4R4IA 4DV2Q 3OW7A 3MC0B 3HOXG 5JJKA 4DR2H 4F8MA 2E75C 2O5JC 5TSSA 1E3PA 1PTOH 1FJGL 3MXPA 2FXQA 4B3ML 1QJOA 5JPMC 1JICA 4LW1A 4CKEA 1DONA 3GTGB 1G6PA 4DR5H 4J8QA 5E4XA 3MEHA 2FMMA 3PO3G 5FLXE 2DJFC 4KKSA 3NP8A 2A1SA 3SGIA 4HJAA 4C3JB 4JI6Q 1YNNC 3J81j 4BXXG 1PDQA 3A56A 2D5DA 3I8ZA 1JE5A 3SHLA 2GVAA 2UXDL 4LFAQ 1GUTA 3ITPA 3T51B 1A8VA 2CTFA 5GAGC 2RCNA 1G51A 4G08A 3HOYG 2SEBD 2EY5A 1WVNA 3CRLC 1IBKH 3TP5A 2CVRA 1Q8KA 2KCCA 2WFWA 1HNZL 3S17H 1L0YB 1NSNS 5C4JB 4ALPA 2B63B 2NVTB 4A4IA 4A3DG 2IX1A 3KUPA 2B8GA 3QIAA 4MN3A 2JN4A 5T1IA 3JAMi 3AMUA 3J80c 4DV0H 3M7GA 4UPAA 1TIID 4K0KQ 3GTMB 1SNDA 2WAQG 3E9HA 1B7YB 3H0GG 4GKKQ 1PLFA 2I5LX 2P2RA 4QMGA 1GD7A 2JA5B 4IUNA 2D0OA
chains in the Genus database with same CATH topology
4DXGA 2DN8A 2WB1G 4IUVA 5EKKA 3S1QH 1JCKB 4U673 1YNJD 3HKZE 4QF4A 1FVIA 4JI0Q 3PO3B 4C1NI 1A62A 4LF7L 2ICEC 1HH2P 4LFAL 2ZTDA 1QNUA 5C4JH 2B63H 1MJEA 4DV1Q 3T1HL 1X3FA 4I7ZC 4LF4L 3I4NH 5EJWA 5IGBA 5IYDH 4R1JA 2F3WA 3PF5A 3Q24A 4ZUJA 1UE5A 3PUZA 2AQ2B 4DR1Q 3K7UC 2WB1E 2AXYA 2O2LD 4DF7A 2A8VA 2Z4IA 4Z9CB 4BA2I 1G291 4A76A 3BZCA 3T16A 2DY7A 1VQEA 5JEAG 2PQAA 1EL0A 1L1OC 2QF7A 1KHIA 3TEHB 3S16B 2HT1A 4C3IG 1LTID 1U9RA 2F0IA 1HFNA 3G48A 2EXZA 5G3LF 4LNQA 1PH9A 2NVXH 1VQ6A 1RF2D 2F0FA 3VR4A 2F3VA 5C6AA 1CKMA 3ND9A 5ELFA 4JK1C 3TSSA 1BBWA 3QOLA 5I2YA 4LFCL 2R7ZG 3T1YL 1CUKA 2K03A 3HKZB 1ILQA 5JPNC 4A3LG 2F0DA 4ODGA 1LTLA 1AE2A 5J22A 2FHTA 2DGRA 1LT3D 4R4QA 2AKWB 3UDIA 2D9UA 4X66L 1PZJD 1EQQA 2R61A 2IY5B 3VA5A 1JORA 4K5WA 2R7DA 3TS0A 1JR0D 3NWTA 1D5MC 2RVLA 4DR3L 1KXLA 3UDGA 3DEOA 1PHJA 2JA7H 1UAPA 4ZQ3A 2M2LA 4P72A 4P73A 1C4QA 2CWAA 5KYLA 5EGTA 3KF8A 2AUJD 1K8AC 2B2VC 2KHIA 2F4IA 3UDXA 2BL5A 2K5HA 1IL8A 3J80L 3BDOA 3WDNA 2Z6KC 2QKIC 3RLOA 1PZID 2K7VA 1LUZA 1NMGA 2BA0A 3ONAB 4DK6C 1WTVA 2F0PA 4RGOS 4LF6L 4A3KG 3NSWA 1JWMD 3CQZH 3CCJA 1R4PB 5JEAH 3T4AC 4BY1B 2JK8A 4L5SA 1BQQT 1MKHA 1ZTGA 4JI3Q 1E24A 4A3MG 2JXMB 4HTHA 5CV6A 2J0TD 3A55A 4NDXA 3G7LA 4BXXH 4ZUIA 5M5YB 1F9RA 4JV5L 2PMZE 4YWMA 1LLRD 1ASYA 1KAWA 4GN4B 4JI7Q 4EVOA 1IBLL 2EDGA 2LXKA 2ENBA 2KBNA 1EFWA 2BDNA 1J5EL 3I90A 5IP9G 4AQYQ 1Y1WH 4B3RQ 3F1ZA 3K58A 2PZTA 2LSSA 3KDFB 2UXBL 4DXFA 2K4KA 3A8IE 1VQGA 1YBYA 1X3PA 5KNCA 2HQLA 2PI2E 4LIJA 3S24A 3ULLA 4A93H 1RD9D 4RAUC 2JA5H 2L9HA 1BCPC 1RIPA 3FP9A 2XWBB 4A3JB 4A75A 2F0QA 2EE1A 1J5KA 1PYSB 1C7YA 1DOKA 2NTTA 4BBSH 1JOOA 3I4OA 1FGBD 2K6AA 1CA6A 2EJGC 2I5HA 2E2IH 1II3A 1SEBD 5JVG3 1I4RA 1JWUD 1M4VA 2ID0A 1VMCA 3M4PA 2EPBA 4B3MQ 2ZJQA 1BCPB 1H95A 5COYA 4R4TA 1LTAD 5I9OA 1CSQA 1CKNA 3CCLA 1DT4A 4HN7A 3KK7A 3Q23A 3B6YA 2RA4A 3S1MB 4JVHA 1IBMQ 1QG7A 3D8GA 2DNEA 1DCZA 2IT1A 4HJ7A 1RHPA 4J1MA 4X3KA 2DNCA 1N32L 2AUKA 1Y69U 3OHXC 3A7LA 3NE5B 5EPJA 5FKAC 1KTKA 3KF6A 3STBD 4DNTB 1CI3M 5HURA 1XJVA 1BO0A 2EIFA 3HKSA 1G8ZD 4OO1H 1N33L 2LKVA 4A3FB 1CK1A 2VUMH 3C1EA 3SK8A 4A3CG 1XX8A 1N36Q 4PMCA 2XWJB 4LK1C 3I3CA 4PZ8A 4R4OA 4PV1C 2RF4A 1OXUA 5JJZA 4JI1L 3DWQA 2G9HD 1DXMA 3HKZG 5C4XB 3ND8A 1YJ9A 1PH6A 3CQZB 1B53A 5HGQA 3PSIA 3OSOA 2L4NA 1KLUD 1EC6A 1EYAA 1BBXC 4ZKBB 1F77A 2F52A 1YITA 1PRTD 1GM5A 2YQRA 1CQFA 4WFN3 1NY4A 1KL9A 2WAQE 3MTSA 3ICEA 4DV7L 4DR4Q 2JA8B 3BDLA 4LF9Q 5M3MG 1SMXA 3K6OA 1EEID 1FYCA 1UE7A 4CHTB 4K8JA 3PMFA 1KNEA 5AJ3L 2OWOA 2HCIA 1HZBA 3L7ZC 2B39A 3H3VC 2JA9A 2AQ3B 4P2CB 3S15H 4JC0A 4O2DA 4BBSG 1GUOA 1JC7A 2ZXOA 4FF4A 3HOVG 4IOCA 1D6EC 3F2CA 1GHJA 1B70B 3G6EA 2BA1A 3UE1A 2F0HA 2M00A 4WANA 4DN4M 2EYLA 2NVYB 1H9KA 4DV3L 3EN2A 1PVOA 3VR5A 1VQ8A 5KGUA 1MIUA 2RHQB 4DUZL 3P1HA 1TY0A 4CJ0B 5M3FH 4OWWB 4DV4Q 3R2TA 5IYCH 1L0XB 2G9DA 1RCVD 4ZKCB 2ZJPA 1N9WA 2NN6H 2AHOB 2HHHQ 3HOVH 3HOUG 2XN9C 1EOTA 2FMRA 1I94Q 5C44G 5FO8B 2R7FA 4GOPC 3UDFA 1F2ZA 3I72A 3CRKC 2Z4HA 3K8AA 2R93G 3CC4A 2ANRA 1LTSD 1JT8A 3KDFA 1ZXTA 1D5ZC 2OPUA 1TUAA 2PMZB 5K36H 2K05A 3AFPA 5M5YH 2JQOA 2E5LQ 3P75A 2ATWA 2MGSA 5I6WA 3S1RB 3CF5A 1HCZA 1WTQA 1VCIA 1EWCA 1JJGA 4NKLA 1K83B 1AH9A 4DR2Q 3G6JB 1ZYRD 4BBSB 5CC4A 2EJMA 4S3SA 3QOJA 2VB2X 3FKIG 1G6ZA 1B3AA 3OTOQ 1XPOA 4RGMA 1B8AA 4OIKA 2MPMA 3JAME 1HR0W 3K5MA 3NQTA 4JI2L 4DNRB 3FVQA 2F03A 2K5DA 3TMEA 1WCMG 2C35B 1I4GA 2FINB 3Q22A 3DLLA 5CORA 4OWXB 3VR2A 3CCVA 3BJUA 2SDFA 2TMPA 1OXTA 1SXTA 2Z8LA 3LX0A 3V69A 4JBWA 3JAML 1RTOA 1WE8A 3PO2G 4HAEA 3GTKH 1PYBA 1JQYD 1DD2A 1CKNB 1QOHA 4A93G 1UE6A 5FLXc 1WTWA 5GQOA 5FO9B 2L11A 1E1OA 2VXWA 4RCOA 3M7NA 1PH5A 4POGA 1JMCA 3CC7A 2JSOA 1DZ1A 4HCSA 4B8TA 3SE0A 5C4ZA 4PMBA 3BVZA 1VQJA 1D1KA 3I56A 3RMHA 1PRTB 3AU7A 3PIPA 1SNCA 1T5EA 3STBC 3GDEA 4ABNA 4DUZQ 3H15A 1EQTA 4GN3B 3J80E 3IFDA 4TRDA 2KHJA 3X3MA 1XNQL 1X4NA 1H9SA 4JCVE 3HOWG 3OW2A 1V8QA 5CBEE 3FHWA 2NVYH 4B3SL 4TQUS 1FGUA 1MSGA 2A74C 4L63B 3TREA 1A3TA 2SNSA 1QVGA 1X3QA 4RMFA 2K01A 3A5ZB 1C0AA 2SNMA 1KLGD 1KIXA 2VNUD 3CMAA 4HR7B 4I65A 1QE6A 3ULPA 3H3VH 2EYHA 3HOWH 4RGTA 1LABA 1Y8OB 3NELA 1A2TA 4A3DH 3OMGA 1EWHA 1QVCA 2RBMA 5IGEA 4JOIA 3AB9A 2B2TA 1VQCA 5C0XI 3MFYA 5IT9L 4P75A 3OYYA 1IKMA 5K5PA 3J81i 2E2JB 2BCOA 2F0OA 2B2UA 3C2PA 3OTOL 4ULLA 5M3MH 4IFDJ 1STYA 5GROA 3MVVA 2A6HD 2KCMA 1HQRD 2QDBA 4QIWB 5I9PA 5LMUL 1SFOB 1EIFA 2F4VL 3BZDB 3HOWB 3J80i 1B4OA 2X6GA 5M5XB 1I4HA 1TS3A 3VYUA 4HJ9A 2E2HB 4RGNA 3CXCA 1E0BA 3VR6A 4PMWA 1Y1VG 3GTGH 2B2WC 2K50A 4R9WA 4Y7NH 4IPCA 4J15A 5E3FA 2MP1A 3M3YH 1H9JA 3PO2H 3K57A 2N8NA 4A3IG 4A3BH 3AFQA 5EBDA 1QILA 1VQDA 3CHBD 3KLWA 2RDGA 3MZ5A 3S9WA 2JYOA 1E2WA 3N52A 1JJ2A 1KD1C 4LFCQ 4KD4A 5FJ8H 2XSCA 1O7ZA 2F0TA 4JBMA 1XMQL 3H6MA 4K5XA 3ZJYC 2YU9B 5HGTA 1E2VA 1UWVA 1IBML 4C3HG 4L5RC 4ZK9B 2IHEA 2VQFL 5EPKA 2HCCA 1EY8A 5ELEA 3H91A 2HUGA 3GTLH 2K5VA 4A3EG 2Q2TA 3HOYH 5J39A 3J81E 1Y8PB 2JVZA 1K3RA 3DXJC 3T56B 4NXML 4A3EB 2DGYA 3TS2A 5K36G 1NUCA 4ME5A 4KD3A 5IY0A 3HOUH 2QCPX 5C4XH 5IIFA 4HIMA 1S5ED 3NQIA 3T1HQ 1I3QB 4DV2L 1GJXA 4LF4Q 1DJRD 4ME3A 5FJ8G 3T13A 1N34L 4XQQA 5IWAL 2NYZD 1A0IA 1V43A 1ENAA 4KHZA 4C3IH 4LF7Q 1IL2A 3MXGA 5ELBA 1TWFH 2WACA 3OWFA 4DGZA 1AP0A 2UXBQ 1I6HH 3I7FA 4B9WA 3CU7A 1L2FA 4X3TA 3A74A 1ICWA 1RL2A 1I4XA 1JB3A 2K75A 1KDCA 3IRBA 1HTPA 1IBLQ 1X32A 1X4MA 5GAEC 4DR7L 1BCPD 4AYBG 3HEJA 2CTLA 5D65A 1UUPA 1PH8A 4YIJA 1ONLA 3Q8DA 1PA6A 2K5QA 4DV0Q 4RFBA 4B9XA 3KOJA 1STGA 1DGSA 4EQNA 2HH2A 4UP9A 3GTQH 2NB0A 4UDUC 3FRPB 1QUQB 1G2TA 4X62Q 4DV5L 1MI2A 4XYOA 3M85A 3KBGA 3VR3A 3F2DA 1EY6A 4MZ9A 2CKZB 5T1GA 1GUGA 1YHAA 2VS1A 2E8GA 2AQ1B 1WTPA 1EIHA 2N78A 2QA4A 3E9IA 2IPKD 3W2DA 2CQAA 4GLAC 1GVPA 3AQQA 5E1FA 1YI2A 1PYWD 3CW2C 5M3MB 4ZAIA 1SMYD 5FK9C 1MD2D 1NCVA 1FNVA 3H09A 2E2JH 3A54A 1STAA 1A3VA 3MA2B 1S5CD 4X66Q 3RZOB 1XNRL 2Y0SB 3JAMc 4NMZA 1SFOH 1GHKA 4FO2A 5IT9E 3E0JA 4DUYL 4A3IB 2F3IA 5JOBA 2JA8G 4DR3Q 3OIPA 1U4LA 1SNPA 4JI4L 5C4XG 1VF7A 3KYHC 1N34Q 1V1PA 3EFXD 4APVA 1N36L 4CKBA 1BOSA 4GZYC 4F7XA 5D3IB 3RZDH 2PO4A 4A3BB 5A35A 4F88A 3HRZC 1JJCB 4KY5A 1IZ6A 1U5KA 2N88A 5IGFA 5IWAQ 2PQAB 4JI5L 1JOQA 2GN5A 2LXJA 1ENCA 3PO3H 3EVQA 2MFIA 2E2HH 4GKJQ 2RSOA 4UAIA 1XYIA 3S1QB 2PYKA 2C9OA 3GTKB 1CFMA 2V1CC 3RNUA 2ZXPA 4A3LH 4IO9A 1VQMA 1I50H 1EZ6A 4NW2A 3V2TA 1H9RA 1L0WA 1SNOA 4DFAA 1D1IA 1Z47A 3RD4A 3Q0AA 1Q8IA 4JI3L 1TY2A 1HTLD 4LF5Q 2Z6KA 1IKLA 4IJLA 3S16H 1FR3A 5KEEA 4DV6L 4KJOA 4IURA 2O4XA 3ULJA 3U9SA 2RDHA 1HZAA 4LWCA 4GNXB 4QUCA 4IFDI 4JI8Q 2J7ZA 4H44C 1K8GA 4RKLA 3H3VI 1KDAA 3SDZA 4M8AA 2OQ0A 1B2TA 3RUZA 4LMQD 1K83H 2EYJA 3A8JE 4QMFB 5ELCA 4H0LC 5G3LD 4DK1A 2CWPA 4JYAL 4DR4L 1XPRA 1Y1VH 4GKJL 3I73A 5C3EG 5I2XA 4AIMA 4KLKA 3GV3A 4FNFA 3R2IA 2KEDA 1HPCA 1SE3A 2LS01 1L1OB 4HEDA 2RQXA 1ILPA 5JJIA 2IL8A 3Q6SA 1WJJA 1PH2A 4IN3A 2Z1CA 2KJXA 4KTAA 2OXPA 4KI0A 1QCBD 4B3RL 3KF8B 1B9NA 2F0EA 3D4DA 2HDLA 2WP8J 2CW0D 1K8MA 4CBVA 3U1KA 3GD7A 2PQUA 5JVH3 3S15B 1PTOB 4CJ1B 4DR5L 2EZVA 3GTPB 1X54A 3I4NG 2VY3A 4HMIA 1V1OA 5KNDA 4X64Q 4YCVA 4BBRB 2PNHA 4UY8C 3S2HH 3HFZB 4DR6L 3PV0A 4L5TA 3D31A 3I70A 2B29A 1PTOF 3F2BA 4CKCA 1LACA 2JA8H 2Q2IA 2B3GA 1SLJA 3QJYA 3J81L 1WD0A 3A0JA 1D5XC 1WCMB 1O78A 4MTNA 5E7NA 3F8TA 4H7BA 2OTLA 2DY8A 2UU9Q 2LY7A 3U4ZA 1VIHA 2A68D 1XTCD 1I6HB 1UEBA 3SEBA 3N6RA 2K52A 3KJOA 4KK7A 5KYIA 3PF4A 4DV6Q 4FXGC 2QGQA 2PZWA 2PZUA 3RZDB 2YYZA 3G71A 1ZZJA 1KNAA 2YTXA 1ENFA 2A68C 1NR4A 5DNFA 2N3SA 5ELNA 1AE3A 4JYAQ 3MAQA 2K5WA 2WV6D 4QCLA 1EIYB 2Q8TA 1F2MA 3R8BA 4JG2A 1PH4A 3J7A5 1CHQD 2IWHA 3RZOH 1SMYC 3EJIA 5FLMG 4FF2A 4IUTA 1I4PA 1S5FD 4N9TA 3OWEB 4RWSC 4G4KA 1EU3A 2KEEA 2QNDA 2HQEA 1WTRA 2FFKB 1DYQA 5CV7A 1MSHA 2XRSD 4GOPA 2EY2A 1R4QB 1VQAA 3W1GA 4WJ4A 2BOSA 1VQLA 2MJHA 4C3JH 4A3CH 1GUNA 1VQIA 2CW0C 1IYUA 1PFMA 3C3LA 4X65L 1PH3A 4FVMA 1SE2A 3R3OA 3CCQA 2KA7A 3RR5A 2F4VQ 4JI5Q 1HNZQ 1S40A 5M3FB 1J5EQ 4HJ5A 3A5UA 2KENA 2B2UC 4X6AH 4A3MB 1J9OA 2JA7G 1CA5A 1HA5A 2F0UA 4IOAA 1PRTF 3K5OA 1VQ9A 4DR1L 2XGTA 1Z9FA 5IP9H 1EU4A 2WIIB 3PO2B 1HNXL 1HNWQ 1EYDA 1XTDA 3AYHB 4GLVB 2C5CA 2N55A 3M4YA 4A93B 4EQPA 4U68A 2K5NA 1O7IA 1VS0A 2H5XA 5IYDG 3K5NA 4EX5A 4LF6Q 1MBYA 5AFWA 1LTRD 1XNRQ 1Q1EA 1Z6HA 3H94A 5M5XH 1CTMA 4JI8L 4A3EH 1EQVA 5KIXA 3GTJH 4ID6A 1M1KC 2B2VA 4DU9A 4C3HB 2Q2HA 3NXWA 4OL7A 1W3SA 3FKIB 2CCZA 2XTIA 1PTOD 4DAPA 4DV7Q 4JBKA 5JEAJ 4QB4A 3NHHA 4K2LA 2ALYB 2F0LA 2IX0A 1YVCA 5ELOA 1HRJA 4DV0L 2OT2A 4HJ8A 1HNXQ 1E22A 3DHQA 4DV5Q 1O7LA 3D4RA 1FNUA 1TWFB 3U58A 5BN4A 2PQEA 3C46A 1LT6D 1E1TA 2EVBA 4A3JH 1W2BA 1RODA 3GTOB 1PRTC 2CHBD 4POFA 4MHEA 1TQOA 4OO1I 1KRSA 1XWEA 4IJHA 4HSPA 1VQ7A 1IBKQ 2A69D 4C1NK 4E6IA 1X55A 4QIWE 4HIDA 4L5QA 3PUWA 1A15A 3FKIH 5IT9c 3R93A 4KY7A 4GNXA 1KQSA 1SJHD 1EUJA 2JP1A 1EY7A 5C0XH 4FF3A 5BR8Q 4IZ8A 2MJ8A 1YNJC 1ZYRC 1S72A 1MJCA 3DM3A 3DWAA 3A7AB 3TP8A 2A5HA 4OGQC 4QJFA 3HZXA 1V1QA 3VYTA 5CV8A 2AWNA 4NB3A 1SYBA 2K14A 1A6XA 3CAMA 3U4VA 1PH1A 1HZ9A 4TSSA 1S3OA 1K1GA 2MO0A 2K28A 2A6EC 1EIGA 3PCOB 1SDFA 5CV9A 3PUXA 4MNOA 1PFBA 3TZDA 1ZZKA 5AJ3Q 1BXTA 3M4QA 4A3IH 2RHSB 2CTMA 1PFSA 2QILA 4V190 1GO3E 2F0MA 3SR1A 1SR3A 4KKUA 1LYLA 4NXNL 3U50C 2EYMA 1RTNA 3I55A 3KJPA 2KHSA 1FNWA 4B3SQ 1KDBA 3DUZA 1VQHA 2V4DA 1T5XD 1VQFA 2BDOA 4J6HA 4DR6Q 4F87A 3I4NB 1ESFA 3VDYA 1STEA 1D7QA 1A2UA 1A63A 1HA6A 4PQXA 1EEFD 2NUCA 1D2BA 3FDTA 3V05A 3FPPA 1GOZA 4DV4L 2PNRC 4HCEA 4L6TB 1IBKL 1QNKA 3URYA 3MFGA 2GVBA 5EKIA 1N33Q 5DAUA 1W6KA 1S4ZA 1DOMA 3K80C 2B2YA 5M5WB 4B08A 4Y52H 2RKSA 5KRUA 3NWSA 4FP5D 5ELDA 2XIWA 4NXNQ 4YWKA 1Q7YC 2EXDA 3SK4A 3TZUA 5C5MA 1EOVA 2ZXRA 3GTMH 3NENA 2L12A 3NBHB 3TBIB 1ESRA 4RH6A 1P8LA 2KQ3A 3OOCA 4KHPQ 3PIO3 1FL0A 4OX9L 4NPSA 4X3UA 5M3FG 2HIVA 1HUMA 3SVMA 3K59A 1U0LA 5LMUQ 1V1PB 4NXMQ 1F9SA 4C2MH 4KY6A 1YHBA 4LF8L 2JA6B 2Y0SE 4XTCS 3BS1A 1PV4A 4IQZA 4RKBA 1EZ8A 4H02A 1ET9A 3HOZH 4WORA 2KECA 5CMDA 2I0QA 1S5DD 5LMNW 3D3RA 3IL8A 3D0FA 1S5BD 3DWPA 3PIP3 2CTKA 4K14A 1NJIC 1CHPD 1CSPA 5EPLA 1H9SB 1TWAH 3L0OA 1SE8A 1WTXA 1KRTA 2CTJA 1K73C 4K6LA 3HGBA 4ZYSA 3K5LA 1X9NA 1TVXA 2AWOA 1Q82C 2ZTCA 4G7ZC 1WYDA 1X6OA 2MNAA 2UU9L 4KV6A 2UUBL 3TRZA 5F2DA 2NVXB 1HNWL 3LNNA 1IW7C 5C3EB 2WINB 3GTPH 4BY7B 1PXUA 1QUQA 4JI0L 4O42A 4AH6A 4QGUA 3GTLB 2VQEQ 1G2SA 1BF4A 3S2HB 4BBRH 3D4WA 3L2PA 3RLNA 2MHVA 3M9BA 2NVQH 1M8AA 3LWEA 1UEAB 4JI7L 3KFUA 4JI4Q 3V96A 3UE0A 2JEAI 2Y0SG 3I91A 1WCMH 2I07B 5LL6X 2PY9A 1C48A 4EQOA 3QO2A 2JEBI 3CKIB 2UXDQ 3GP7A 1AZPA 3TN2A 4JV5Q 1LTTD 4MIUA 4K5VA 4DAMA 2L0CA 2L1BA 1L1OA 1VQOA 3FMCA 3J7ZC 3BU2A 1JE4A 1YNND 1EFID 2YTYA 2AMCB 5CGKA 4BBRG 4Q0FA 1KC8C 5FLMH 1X65A 2E3UA 1WOCA 1B50A 4P71A 4AM3A 4XYQA 3K0XA 3CCRA 3EBEA 1ET6A 5LHY1 4V0BA 5IGCA 4R4CA 3GV6A 4WALA 4LF8Q 4CJ2C 4JI2Q 2A19A 3FPUB 1BR9A 3OPOA 2L55A 2VL6A 2KUMA 3CCUA 3KLSA 2EY1A 2RSNA 2NWGA 1TS4A 2I46A 1I50B 3E5SA 3HOZG 3KBXA 5BN3A 1HUNA 3I4MG 2YTVA 2TSSA 4QL5A 3S1NH 4TKOB 4OWTB 3BZKA 1MGSA 2WB1B 1EQRA 3AEVB 4FDBA 4UP7A 2JA5G 3ERSX 1XXGA 3AEVA 1EYCA 1BVSA 2A69C 1IYJB 1EY0A 3MXUA 2VQEL 4UP8A 1Y8NB 2B2WA 3VKEA 2NN6I 1I5FA 1XPUA 2UUCL 5BN5A 5J3BA 5ISRA 3ERQA 4DR5Q 2JZXA 1WFQA 5CV5A 1WI5A 2L15A 4YHHL 1SJED 4XIGS 1BUVT 5M5WH 4X64L 4WRDA 4Y7NB 3NEMA 4BY1H 2PCFB 4K8IA 5EAYA 1JB7A 2VZAA 3DM1A 2MQHA 4DK0A 4AQYL 2F1MA 1YJWA 1DTJA 3T53B 1NMFA 4A3GH 4A3GB 4LAAA 5NUCA 3BVGA 4YCWA 2MO1A 4KN4C 4DK3C 1Y14B 2CFMA 2D2CC 1AW7A 1GUSA 4G7OC 1VQPA 1E2ZA 5C4HA 1HFGA 4IALA 4PZ6A 1SYFA 4TVAB 2R92B 4C3HH 4IUQA 3HOZB 1YJNA 3GTJB 3X3NA 5D14A 3GTOH 3J7AV 1X3EA 3PUYA 1J8IA 3HP3A 2YU9H 1VQNA 1SSOA 5EBCA 3HOXB 4JVYA 1VIGA 1TT2A 1PH7A 2NVTH 1NTGA 3WOEA 4GN5A 3NUCA 4K2KA 3SXHA 4A3KH 2Q8RE 4RHRA 5DM73 4QY7A 3OMCA 1RDPD 1F9PA 4OO1G 4EQ5A 3CPWA 1FJGQ 3SK5A 5FOBB 4DR2L 3IFTA 1QVFA 3S1MH 4OXPA 1YEZA 5IGDA 1XNQQ 4OONA 2R93B 1EYGA 2XNAC 2R7ZB 3VA7A 1HR0Q 2K04A 1TWGH 4GKKL 5C44B 2KCTA 3A8KE 4LF5L 1WTOA 4HSVA 1TKWB 1BKBA 3GQBA 1Q1BA 5HY6A 1N32Q 3CC2A 2Z0SA 1AZQA 2PI2A 4OX9Q 3QG1A 3HG9A 4C3IB 2HDMA 1AFPA 2ZTEA 2E2DC 1XMQQ 4A3GG 5J1ZA 4DPGA 1P16A 1IYVA 5C0XG 3EIVA 4YHHQ 2RDFA 4GNXC 1IXRA 2UXCL 4BY1G 1AEXA 4ZRZA 2R6GA 1SBBB 3K7AH 2R7ZH 2WKDA 1R9TH 3CD6A 4KN7C 2A6ED 2VB3X 2EOTA 5KNBA 5C44H 2WKCA 5IOCA 1TR5A 4O1NA 2DUDA 4YY3Q 5C5LA 1SRUA 1UE1A 3DMUA 1KHMA 4C56C 5IP7G 2CQOA 4PZ7A 3LWUA 4N9PA 2A1AA 4FF1A 2NN6G 3HS0C 4WJWA 5IYCG 4HIOA 1LO5D 3IKJA 4RCNA 1YIJA 1GUWA 3W1BA 3K0YA 3CMEA 3BYTB 4BWGB 2NTSA 1VDZA 1ASZA 2E5LL 2F0NA 4QQBX 5H1SE 4BA1I 2SOBA 3J81c 3KF6B 3WWVA 1Q90A 1RKNA 2Q8IB 1IHZA 5IP7H 3EQLC 5CV4A 4IFDG 1ML0D 3D6CA 3K81C 5LMNL 2H4OA 3S14H 4LUOA 4CGYB 1TWCH 2OEOA 1CKOA 1PMRA 1AN8A 2UUAQ 4BS9A 3CCMA 3MHBA 3P20A 1H9MA 1HHVA 2VW9A 3NPPA 2ICIA 2JE6I 5C3WA 1NBWA 2BE5C 4LFBQ 1M90C 2FJ2A 3L3OC 4G57A 2ZJRA 1XMOQ 3CP0A 4A3MH 2B2YC 2JA6H 2PPBC 2JA7B 1CM9A 1SYDA 4HMJA 5FO7B 3T1YQ 1TWHH 5IGGA 4DV1L 4DR7Q 1SAPA 4A3KB 5EQ0A 1WVLA 2BH8A 2X6LA 2E2IB 1B44D 1VQBA 4R8NA 5DEHA 4K6DA 1TS5A 1CQVA 3S1RH 3ZYYX 5LMNQ 5I4DA 2EYOA 5CYUA 3RN2A 1SYCA 1XMOL 2VUMG 3F2UA 2EJFC 5M9OA 2ZM6L 1DM0B 3O13A 4XDXA 1V9PA 4KKTA 2F0SA 3H0GH 1OXSC 4A3BG 1T9HA 1Q3LA 4C3JG 1HXYD 2OCEA 2UUBQ 1BDOA 5C0XJ 4JI6L 5JJLA 3I2ZA 4IUUA 2EYPA 4LFBL 4GLXA 3TP6A 3W3AA 2ES2A 3M3YB 3MWYW 2D0PA 4RG1A 2NBFA 1EWIA 4DNIA 4KHPL 1OXVA 2F0GA 1Q12A 3W5OA 2D62A 4H13C 2ZT9C 2H1EA 2XRQD 1JWSD 4RA8A 4JBJA 2R93H 3U9OA 5CR3A 4C2MB 4BY7H 3NBHA 2O5IC 1GKHA 3GO5A 2UUCQ 4FYDA 1HQMC 3QB3A 4JI1Q 5A2QE 3RN5A 3KLSX 3IAYA 4B3TQ 4XT3B 1Y1VB 5DM63 4IFDH 1O80A 1F2YA 4KJNA 3S2DB 1B9MA 3S2DH 4OIJA 1A3UA 1IW7D 1K8OA 2CPQA 2Q2UA 1I6VC 1RJTA 3NK9A 1SYGA 2QEXA 3TDQA 1ZEQX 2BE5D 3E6ZX 5JAVA 2R3ZA 3I4LA 4LJZC 2HH3A 2F0VA 3BG3A 2VUMB 1Q81C 4FXDA 4IPGA 2EYFA 2ANNA 3WOFA 1NAPA 3UI2A 3EA6A 1LTGD 1Z7TA 3PUVA 1CZWA 1LM0A 3QWNA 1C9OA 1NR2A 4XXEA 4BY7G 4OHJA 1DOLA 2XVSA 1WD1A 2LMCB 2NVQB 1NE3A 1TWAB 3CCEA 5E4WC 1CZGA 2IJ0A 1STBA 4L8JA 3TP7A 2NZOA 1EY5A 2B2TC 3OIQA 5LL6S 1TXYA 3MXNA 2VQFQ 3BDCA 4WJ3M 1GXDC 2FMCA 5D3DA 1U4RA 1YNXA 3RLFA 1FD7D 4AYBB 3PGZA 1R9TB 5C3EH 3MXNB 3J7YW 2F0KA 1PTOC 3DEPA 2ZM6Q 4HIKA 1VQKA 2X69A 4GS3A 4NP5A 4IPDA 1LT4D 1ZKOA 2QEJC 4NBQA 3VYSA 4X62L 3S17B 1TWCB 3S1NB 2EY6A 2ASBA 2NZ1D 4XQJA 1Q86C 1SNMA 2A73B 2IW3A 4X3SA 3GTQB 4LF9L 1JOKA 3EROA 4ZLTF 1PZKD 3PIOA 1SROA 2M9VA 1X3GA 2LFNA 4Q5VA 2UXCQ 3H0GB 1E7ZA 4DA2A 2WAQB 1SE4A 3KLRA 1SYEA 2GA4B 5DLQE 5BR8L 2BH2A 3HOVB 4KHVA 4M1UB 1K0RA 4GOPB 5GADC 1EY4A 4DAYA 4K0KL 4IPHA 1O7YA 1VQ4A 1SN8A 4EGVA 3J7AF 4DAVA 4B3TL