2JEBI

Structure of a 9-subunit archaeal exosome bound to mn ions
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
214
structure length
197
Chain Sequence
b'KIVLQPRSIVVPGELLAEGEFQIPWSPYILKINSKYYSTVVGLFDVKDTQFEVIPLEGSFYYPKINDIVIGLVEDVEIYGWVVDIKAPYKAYLPASNLLGRSINVGEDLRRYLDVGDYVIARIENFDDPVLSVKGKDLGRVSNGIVIDIMPVKVPRVIGKNKSMYETLTSKFVANNGRIWAILIEAIRKIENESHIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EXOSOME COMPLEX EXONUCLEASE 2
publication title RNA Channelling by the Archaeal Exosome.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Hydrolase
total genus 40
structure length 197
sequence length 214
ec nomenclature
pdb deposition date 2007-01-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2jebI01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2jebI02
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 2jebI03
4DV2L 1TWAH 2JXMB 1IYVA 4JBJA 4YWMA 3A7AB 2OTJA 1W2BA 2ZM6Q 3KLWA 2JQOA 4JI1Q 1CKNB 3AEVB 4MZ9A 5M5WH 3I7FA 5K36H 3M9BA 3A5ZB 4DNRB 1T5EA 1O7IA 3PUYA 3L0OA 3AEVA 1VF7A 1FYCA 3CCVA 4A3JH 1XJVA 4DR6Q 1G51A 5IY0A 3I4LA 3M7NA 1QVFA 3WWVA 3CCSA 2JZXA 3CRKC 3PF5A 2Z0SA 1GHJA 3HOUH 3OTOQ 4LFCL 1Q1EA 2LXKA 3VR6A 3KLRA 4NXML 1Y1VH 5KNBA 3HOWH 4JV5Q 1J4WA 1X3FA 2E8GA 1PA6A 1DCZA 3E9HA 2JA8G 2CTFA 2E5LL 1CTMA 4GKJL 3B6YA 1SMYC 3UE0A 2PI2E 2Q2UA 1QVGA 2A69C 2F52A 1MIUA 4R1JA 1ASYA 1EC6A 5HGQA 4JI6L 3M4QA 3W1BA 4DV2Q 2A6EC 3ER0A 3PO3G 5BN3A 1Q12A 1V1QA 3CP0A 4C3HH 2LMCB 3BG3A 1Z47A 4A93H 2JE6I 1CKOA 2K75A 2OTLA 3CC7A 1K8MA 4YCUA 4GKKL 4GOPB 3GTGH 2CTMA 1H9RA 5JEAJ 3CQZH 4X6AH 4L5TA 4IO9A 3GTPH 1ZZIA 1VQEA 3K8AA 3NENA 2A6HD 2MNAA 3PUWA 4LFCQ 4A3GH 3QIAA 1VDZA 4NXMQ 1Q1BA 3KOJA 2Q2HA 4DR1L 2JA7G 4YHHL 4KHPL 1GUOA 1Y1WG 2E5LQ 4GKJQ 3FHWA 1X65A 2VZAA 4UPAA 1X4MA 3LWUA 1PH3A 3CCEA 2ASBA 4JI6Q 1WI5A 2XGTA 2GN5A 5LMNL 4JK1C 4JI7L 5IYDG 1L1OB 1CSQA 2YTYA 4GLAC 1P16A 1UEBA 1K73C 4A3EH 2R93H 1PYBA 4R4IA 1EQQA 2RCNA 2EVBA 4QY7A 4C3IH 2HT1A 1YHBA 1OXSC 2HHHL 4GKKQ 1EOVA 1ZKOA 2EIFA 2CTKA 1KXLA 2K14A 3D0FA 3OW2A 3OYYA 4HIOA 1XMOL 2AXYA 3T1YL 2PNHA 3NE5B 3VKEA 1Y1WH 5GAHC 4H44C 3SGIA 2PNRC 2DNEA 2K50A 4DV1L 4LF5L 4A75A 4DV3L 1XPUA 2BDOA 3BJUA 1Q46A 2ZJQA 1I6HH 2O5IC 2I5MX 3W1GA 1EQRA 2UUBL 1PMRA 4YY3L 3V69A 1VQKA 4P73A 3E0EA 4DR1Q 2A8VA 4YHHQ 1CFMA 4HIMA 4KHPQ 1A63A 4HIDA 2ZJRA 4G7ZC 4JI4L 3ND9A 4A3BG 1HQMC 4GZYC 1Q82C 3KF6B 3CCUA 4PMWA 4IOCA 3HOXG 4RMFA 3KF8B 2I5LX 3I73A 4OWTB 5LMNQ 1VQDA 4JI7Q 3U50C 2A68D 3CCLA 1C9OA 3LNNA 1U5KA 1E2VA 3JC66 1T9HA 1BBWA 4A3KH 3SDZA 1NMGA 1PV4A 3PSIA 3JAMi 4OWWB 2HHHQ 3F2BA 2DN8A 1X55A 1QZHA 4IQZA 2PQAB 2E2JH 1BBUA 4UP7A 4IJHA 1XMOQ 4HR7B 3T1YQ 1H9MA 1E1TA 1TKWB 4YWKA 3HKZE 1QUQB 1A6XA 4R4CA 1DTJA 4KN4C 4A3BH 1X6OA 2E74C 4DV1Q 4LF5Q 4DV3Q 2CTJA 3T51B 2JA6H 2UUBQ 3H0GG 1QUQA 2MO1A 4YY3Q 3H3VH 2B3GA 1VQ6A 3CPFA 4UY8C 4JI5L 4JI4Q 4L5SA 2LSSA 1AH9A 3RN5A 1VQ8A 1ONLA 3EIVA 2D0PA 3F1ZA 4XIGS 4UP9A 1TUAA 3HOZG 1HTPA 4LUVA 4A3IH 3KJPA 1TWHH 4P74A 4A76A 3FP9A 3GTMH 3A0JA 3M85A 1SMXA 5IYBG 1VQMA 1DD2A 3DXJC 1P8LA 1VQJA 4A3CH 3K7UC 5AJ3L 1O7LA 2HIVA 2K52A 4TKOB 3CMEA 1HR0L 1YEZA 4YCWA 1GVPA 1XNQL 3HOVH 4EQ5A 4LF9L 3NEMA 5M3MG 1VQOA 1L2FA 1XPRA 1XNRL 4B3TL 3S16H 3UDIA 4P71A 4B3SL 3RZDH 1IW7D 3H0GH 4DUYL 2K5VA 2E2HH 5IE8A 2E3UA 1O78A 1K0RA 4A3MG 4X66L 2K33A 1TU2B 4JOIA 4HJ5A 2OQKA 1ZZKA 3ERSX 1S40A 1VQ5A 4AQYL 2NVYH 4JG2A 4HIKA 5ELOA 1YJ9A 5C3EG 1QJOA 3RZOH 2OPVA 3L7ZC 4JI5Q 2F3IA 1Q81C 3S24A 5IYCG 4LW1A 4X65L 1TWCH 3MXNB 3T56B 1NE3A 1YNJC 1WJJA 3H94A 4OX9L 4KLKA 3GTQH 4LUOA 2JVZA 3KYHC 1GO3E 2AHOB 4BA1I 3PUZA 2BA0A 1CKMA 1FJGL 2UXDL 2ZT9C 2B63H 1E22A 5AJ3Q 5K36G 2IX0A 1HR0Q 1OTCA 1XNQQ 1IBLL 2IHEA 4LF9Q 1Z9FA 1XTDA 1B70B 2UU9L 4DK0A 1XNRQ 4B3TQ 3FMCA 4B3SQ 4A3JG 3TQYA 4DUYQ 3EN2A 1OXXK 3S2HH 2YV5A 3N6RA 2KHJA 4JBWA 4X66Q 4BXXH 3U58A 4IPDA 4AQYQ 3HOUG 2VNUD 1PH1A 1Z6HA 2ATWA 2OQ0A 2CFMA 1Y1VG 3HOWG 5JJIA 1Q90A 3DM3A 3HGBA 3I2ZA 1KHIA 4X65Q 3I56A 1PVOA 2DGYA 1UE5A 5IP9H 3NELA 2NZHA 4AH6A 3GDEA 1EYGA 4IFDH 2KENA 4PG3A 2E75C 4OX9Q 1GUTA 3PO2H 1H9KA 2JEAI 3ND8A 1VQLA 4MTNA 1YNXA 1PH7A 1LYLA 4LFAL 4JI8L 4JC0A 3MEFA 4KKUA 1FJGQ 2VQFL 2RF4A 2UXDQ 4A93G 3S15H 3PGZA 2LXJA 4LK1C 1MKHA 1IBLQ 4JCVE 2K7VA 4QMFB 1JT8A 1N8RC 1YVCA 2UU9Q 3HKSA 4ME3A 1L0WA 3CCJA 4A3FG 1IBKL 4JI3L 5JJLA 1VQHA 3W3AA 3ULLA 1Y8PB 1EIFA 3I4MH 2AKWB 1IZ6A 1YIJA 1OXVA 2CCZA 4A3GG 1N9WA 3UDXA 1KC8C 3S1NH 2CPQA 1ZTGA 3VR5A 4IOAA 2CTEA 4GNXC 1GUSA 1NTGA 1M1KC 3TZUA 1H9SA 1IYUA 4QGUA 3P20A 2Z6KC 5EAYA 4OONA 4IFDI 2UXCL 1LUZA 1I94L 4JYAL 4LFAQ 3AFQA 4JI8Q 1I3QH 1UE7A 3I4OA 2F1MA 2ID0A 4DK6C 2VQFQ 2WAQG 4A3FH 4DKAC 4YCVA 4A3EG 2R93G 2NVXH 1BDOA 4LJZC 3STBD 3VDYA 2L5TA 1Q8KA 4NBQA 2BA1A 1J5EL 1IBKQ 2EJFC 4JI3Q 3GTLH 1Y69U 2IY5B 3K7AH 2QNDA 4MNOA 3CC2A 1HCZA 4DK1A 1V9PA 2C35B 3S1RH 3OPOA 1A62A 4JI0L 3CCRA 3J81i 1MJEA 1KD1C 4TQUS 2UUAL 2I5HA 1HPCA 1SRUA 3HOYG 4R4OA 1PH9A 2BL5A 4BY1H 1WVNA 5J3BA 4P72A 4B3RL 2D0OA 2ANRA 1KRSA 2ZJPA 2PQUA 3GQBA 2UXCQ 4JVYA 2WAQE 2DUDA 5KNCA 1KQSA 1YJWA 3KDFB 1I94Q 4JYAQ 3U9SA 5KNDA 1OXTA 1WFQA 1NY4A 4NB3A 3KDFA 4A3KG 4OO1H 2A69D 5GADC 3G6EA 3WDNA 4KKTA 5C4XH 2CQOA 3D4RA 3CMAA 1J5EQ 2K32A 2A6ED 4PZ7A 2JEBI 1FL0A 1SN8A 1KRTA 5IP7H 1K8AC 2R92H 3GTJH 1SR3A 3HOYH 1AE2A 4LF8L 4JI0Q 4A3LH 3A74A 2JA6G 2UUAQ 4AIMA 4IPCA 2QF7A 1JB7A 4DR5L 3PCOB 3TS2A 5BR8L 4A4IA 4X64L 4K0KL 2AUKA 1VQGA 1PH2A 3VR3A 4B3RQ 2Q8IB 3RR5A 2CWPA 4A3IG 1CUKA 1EIYB 3CPWA 1LACA 1DT4A 2GVAA 1XMQL 1SFOH 5M5YH 1TWGH 3TEHB 4OO1I 5BN5A 5GAGC 4A3CG 3RLNA 4LF4L 2Q2IA 2Y0SG 4DUZL 1N33L 1GHKA 1I5FA 1E2WA 4HJAA 3J81c 3HOVG 3CC4A 5C0XH 2NN6H 3DLLA 2HQLA 2HH2A 2AUJD 4A3DH 4LFBL 1VS0A 1C0AA 1I6VC 2CWAA 2D2CC 2PCFB 1PFSA 2OCEA 3T1HL 2YQRA 4LF8Q 1VQCA 2VUMG 2L15A 4BBRH 2KHIA 3A7LA 1GUGA 2JA5H 3FKIH 2D62A 4DR5Q 4IPHA 1W3SA 5BR8Q 2MJHA 4HJ7A 3VR4A 4X64Q 4BBSH 4K0KQ 1FGUA 4G7HC 3ICEA 1J5KA 1S3OA 2Z6KA 2R6GA 1D8LA 1VF5C 1I50H 3IRBA 2FXQA 4OGQC 1A0IA 5C44H 4LNQA 2ANNA 2Y0SE 3PIPA 2NZOA 1PYSB 1G291 1XMQQ 3MXUA 1HZAA 4JVHA 2MFIA 3J80i 1E1OA 1N34L 4J15A 2B63G 1R9TH 4LF4Q 2OPUA 1SROA 4DV6L 4GOPC 4GN4B 2XTIA 4DUZQ 1VQ4A 1N33Q 3PF4A 3A8KE 5C0XI 4RCNA 2NN6I 2BH2A 2IT1A 5A35A 4O0AA 4QIWE 2VUMH 4O2DA 2A1AA 3G48A 2HH3A 3CXCA 4LFBQ 4LWCA 2V1CC 3ZJYC 2FMRA 1YHQA 1E2ZA 1V43A 3T1HQ 2PPBC 3GO5A 4BXXG 5GQOA 3PUVA 4DNTB 2MQHA 3EQLC 1K3RA 3JAMc 1YI2A 1HR0W 2AMCB 4FDBA 3BZCA 3AQQA 2YTXA 1HNWL 4DV7L 4X62L 3CF5A 1PH4A 3D31A 1D7QA 2A19A 1WCMH 2QEXA 3CAMA 3F2CA 1X9NA 5IP9G 3KFUA 2PY9A 2AWNA 2CW0C 4IFDG 1L1OC 3CD6A 5JEAH 2DNCA 2QGQA 3PO2G 4DAYB 1JMCA 3UE1A 1N34Q 1HZCA 5ELNA 5FLMH 1VQAA 3ULPA 1HZBA 1VQIA 2ES2A 5M3FH 4DV6Q 1Q7YC 1E3PA 1GKHA 1EFWA 4L5RC 2KCCA 1IL2A 1BVSA 2YU9H 3H15A 3QJYA 1HH2P 2AWOA 3I4MG 3TRZA 1KHMA 2K4KA 3VR2A 1VQBA 1WYDA 2WFWA 1EUJA 1RIPA 1VQ7A 1HNWQ 3KJOA 3Q8DA 4DV7Q 2A6HC 3BU2A 2RHSB 3G71A 4X62Q 3J80c 1IYJB 1HJPA 1VCIA 3U4VA 1HNXL 2OWOA 3K80C 4POGA 1EWHA 4GN3B 2EQSA 1OXUA 2EXDA 1CKNA 1UWVA 3UDFA 2R7DA 1Y8NB 1X4NA 5IWAL 4WALA 3M4YA 4YWLA 3S1MH 2JA9A 4DPGA 4LF6L 3NBHB 3CW2C 2E76C 1IBML 1Z7TA 4BY7H 1KIXA 2B8GA 1H9SB 3QG1A 4QL5A 3M4PA 3W5OA 1KL9A 3E9IA 1WE8A 4NXNL 4JBMA 3BZKA 4DR3L 1CI3M 3RLFA 2IHFA 2ZTCA 2I0QA 5GROA 3A8JE 4JI2L 3CCQA 2BE5C 5E7NA 4H0LC 3UDGA 4BY1G 1B9MA 1HNXQ 4Y52H 2CTLA 2H5XA 1Y14B 3F8TA 1UE1A 3PUXA 1VQPA 1V8QA 4R4QA 2VL6A 4DR4L 5LMUL 4WJ4A 4C3JH 2KBNA 2EJGC 5IWAQ 1MJCA 4OO1G 4GOPA 4LF6Q 1PH6A 5IT9c 4ALPA 2A68C 4LF7L 1VQFA 2JA8H 5C4XG 4GLVB 4JOIC 3AYHB 2N3SA 1IBMQ 4GLXA 4KN7C 1LTLA 1CSPA 2KCTA 2WB1G 1H95A 4PV1C 5IP7G 3AB9A 5JJKA 4EX5A 2R92G 1YNNC 1E7ZA 1Q86C 3I55A 4NXNQ 3J7ZC 4DR3Q 2N49A 3PO3H 2UXBL 1H9JA 2ZTEA 5M5XH 4DV0L 4A3LG 1QZGA 2CKZB 4BA2I 1HNZL 4DR7L 4JI2Q 1DXMA 4WJ3M 3GD7A 2VS1A 1YBYA 4HJ9A 4IPGA 2KCMA 2NVTH 1X3GA 1VIHA 4LIJA 4IFDJ 2VW9A 3RN2A 1L1OA 1NJIC 4WANA 2EDGA 2E2IH 1HZ9A 2JJQA 1J6QA 4GN5A 4DV5L 4DR4Q 5LMUQ 2UUCL 4KI0A 2VY3A 4DV4L 5LMNW 2N8NA 2GVBA 1NBWA 2WB1E 2JA7H 4LF7Q 1VQ9A 2BE5D 3K81C 3OOCA 5C0XG 3A5UA 2NN6G 3CRLC 4P75A 3BDOA 4APVA 1C7YA 1LM0A 3HKZG 4H02A 4A3DG 2R7FA 3J7A5 3IFTA 1JJGA 3PV0A 2UXBQ 2BH8A 3S2DH 2K5HA 5IYDH 1IW7C 4DV0Q 2F4VL 1HNZQ 4BBRG 4DR7Q 4HJ8A 2EJMA 4L5QA 5HY6A 2JA5G 3FKIG 3GTKH 2DGRA 1JJ2A 4KKSA 3SE0A 4DR2L 4POFA 4BBSG 3KF6A 4I7ZC 3GTOH 3I4NG 3HFZB 4KHZA 3RLOA 3LGJA 1S72A 2B29A 3F2DA 3TREA 2VQEL 3FPPA 1TWFH 4C2MH 3A8IE 5C44G 1YJNA 4PZ8A 4Y7NH 4RG1A 4DV5Q 4OWXB 1QVCA 2K5NA 4DNIA 2UUCQ 2YTVA 4DV4Q 1BKBA 1XPOA 1ZYRC 2D5DA 2PQAA 2Q2TA 1VIGA 4GNXB 2RHQB 4AYBG 2IX1A 3HOXH 1X56A 2O5JC 2ALYB 1N32L 4GNXA 1ZZJA 1JJCB 1GM5A 1GJXA 4TVAB 3I4NH 1FVIA 2F4VQ 1N36L 5BN4A 4NPSA 1VQNA 2PI2A 1UE6A 1E24A 3G4SA 4H13C 1SE8A 1YITA 4DR2Q 2R7ZG 1JE5A 4QJFA 5C4JH 2KA7A 4AM3A 1WCMG 2NVQH 1PH5A 1YZ6A 5FJ8G 1ASZA 2VQEQ 3J81j 3RNUA 3TS0A 1GUNA 1GD7A 5JEAG 3S14H 1B9NA 3CCMA 3M3YH 5FLMG 1LABA 5M3FG 1NMFA 4OXPA 3ULJA 2B8FA 4AYBE 4DK3C 1K83H 1B7YB 5FLXc 5DLQE 3VA7A 3L2PA 4R4TA 1M90C 3H3VI 3HOZH 1RL2A 3S1QH 3EBEA 3M4OH 4IJLA 4G7OC 1YHAA 2MO0A 4B3ML 1SLJA 1N32Q 2V4DA 2R7ZH 5IYBH 1PHJA 3PIOA 1KAWA 1K8OA 5H1SE 1N36Q 3K0XA 2ZM6L 4JI1L 1WOCA 2QA4A 1EWIA 5FJ8H 4LUZA 2ZTDA 5M3MH 3S17H 1DGSA 4QQBX 1K8GA 4DR6L 1Y8OB 4KMUC 3IKJA 1K1GA 1K9MC 3I72A 2N78A 4DAMA 5GAEC 4A3MH 3OW7A 1G6PA 4GS3A 3OTOL 1B8AA 1X3EA 2PMZE 2HIXA 2JK8A 4L8JA 1IXRA 4UP8A 5C3EH 5C0XJ 3T53B 3AFPA 4XTCS 4PZ6A 4JV5L 1FR3A 3U1KA 1X54A 4JBKA 1PH8A 5IYCH 1A8VA 4BY7G 2P2RA 3U4ZA 1AE3A 3MFYA 1TXYA 3STBC 2WP8J 4B8TA 4B3MQ 1U0LA 2YYZA
chains in the Genus database with same CATH superfamily
4DV2L 1TWAH 4U68A 5CV9A 2JXMB 1IYVA 3RF2A 4JBJA 4YWMA 3IAYA 3A7AB 2OTJA 1W2BA 3J7AV 2ZM6Q 3KLWA 2JQOA 1BCPF 4JI1Q 1CKNB 3AEVB 4MZ9A 5M5WH 3I7FA 5K36H 4CDFC 3QWNA 3M9BA 1X0AA 2PT7G 3JAME 4OX9H 3QO2A 1G91A 3A5ZB 5ISRA 3OSOA 4DNRB 1O7IA 1T5EA 3PUYA 3L0OA 5FOBB 1G6ZA 3KDKA 1U4PA 1FJGH 3AEVA 1VF7A 1FYCA 3CCVA 1JOQA 1SFOB 5M5YB 2UXDH 4A3JH 1XJVA 4DR6Q 1G51A 1S5CD 5IY0A 1TWGB 3I4LA 1I4PA 3M7NA 3EROA 2F0UA 1TWFB 1QVFA 3MC0B 3WWVA 3CCSA 1MHWC 1B2TA 2UU9H 1EWCA 2JZXA 2B2VA 3CRKC 1EEID 3PF5A 2A5HA 2Z0SA 4G4KA 1GHJA 3HOUH 3OTOQ 4LFCL 1Q1EA 2LXKA 4C3JG 3VR6A 4ZRZA 3KLRA 3HKZB 4NXML 4A3DB 1Y1VH 2NTSA 5KNBA 4QUCA 3HOWH 4JV5Q 1J4WA 1X3FA 1K0SA 2CW0D 3LWEA 2E8GA 5EKLA 1PA6A 1DCZA 3E9HA 2JA8G 2N88A 2CTFA 2E5LL 1CTMA 4GKJL 3B6YA 1SMYC 1EY6A 3UE0A 2PI2E 2Q2UA 5JJZA 1QVGA 2F0KA 2A69C 3D6CA 2F52A 1MIUA 4R1JA 1ASYA 1EC6A 2JA5B 3FKIB 5HGQA 4JI6L 4F88A 3M4QA 4MN3A 1SNMA 3KUPA 1F2ZA 3W1BA 3HOXB 1RKNA 4F87A 3VYSA 4DV2Q 3Q22A 2KUMA 2A6EC 3ER0A 4BBSB 3PO3G 5BN3A 1Q12A 2MP1A 4F7XA 1V1QA 3I4NB 3CP0A 4C3HH 4FO2A 2CH4W 2LMCB 3BG3A 1Z47A 1IL8A 5A2QW 4A93H 2K6AA 2JE6I 1CKOA 2K75A 1DOMA 4UAIA 1I50B 2I07B 3E6ZX 2B2YA 2OTLA 4OHJA 5C44B 3CC7A 1K8MA 4YCUA 4GKKL 4GOPB 1KAAA 3UI2A 1O7YA 5G3LF 1HNXH 2VQFH 3GTGH 2CTMA 1V1PA 1H9RA 3J80E 5JEAJ 3CQZH 4X6AH 1CHPD 5E4XA 3R3OA 2KVMA 1R9TB 3TBIB 4L5TA 1STHA 4IO9A 3GTPH 1ZZIA 2L1BA 1ICFB 4DU9A 4C3IG 1SNQA 1VQEA 3K8AA 3NENA 2A6HD 2MNAA 5CV4A 5EGTA 1F0XA 3PUWA 4RGNA 4LFCQ 1ENFA 5FO9B 4A3GH 3QIAA 5IWAH 1D5MC 4B08A 1SJHD 1VDZA 2Z4HA 4AYBB 1IHZA 4NXMQ 1Q1BA 3URYA 3KOJA 1M4VA 1JOKA 2KCNA 2Q2HA 2RA4A 3TSSA 2XSCA 4QUFA 3FEWX 4DR1L 1GUWA 2JA7G 4YHHL 4KHPL 1GUOA 1K83B 1G2TA 1SNCA 1Y1WG 2E5LQ 4GKJQ 3FHWA 1PFMA 5DM73 2K1HA 1X65A 4TRDA 3E3XA 5IODA 2VZAA 4UPAA 1U4LA 3RMHA 3MEHA 1X4MA 3LWUA 1STNA 1PH3A 4HCSA 3CCEA 2ASBA 1PRTB 4JI6Q 1WI5A 3KBXA 4N8FA 1ZXTA 2XGTA 2GN5A 3PIP3 3U9OA 5LMNL 2R7ZB 4JK1C 3I3CA 4JI7L 2RBMA 5IYDG 1L1OB 1CSQA 1WCMB 2KEEA 1I4HA 2YTYA 4GLAC 1P16A 1VBIA 1UEBA 1K73C 4WJWA 4QCLA 4A3EH 1A3VA 2R93H 1PYBA 4R4IA 1EQQA 1JWMD 2B39A 3D3RA 2RCNA 4CJ2C 2EVBA 4M1UB 4QY7A 4C3IH 1I94H 4JYAH 2HT1A 1YHBA 1WTRA 1OXSC 2HHHL 2L4NA 1EIGA 4GKKQ 1EOVA 1ZKOA 2EIFA 4CJ0B 5EPLA 2CTKA 1LT5D 4OD6A 1HUMA 1SNDA 1KXLA 4ODGA 2K14A 4IURA 3D0FA 3OW2A 3OYYA 4HIOA 2EY1A 1XMOL 2AXYA 1CZWA 2AQ1B 3DWPA 1TY0A 5M3FB 1UUPA 1HA5A 3T1YL 3NBIA 2PNHA 3NE5B 1D5XC 3VKEA 5DM63 4HMIA 2A74C 1Y1WH 5GAHC 4H44C 3NSWA 3SGIA 1EYCA 1II3A 2PNRC 4DR4H 3D4WA 5LMUH 2DNEA 2K50A 1J5EH 1SJED 4DV1L 4LF5L 4A75A 4ZLTF 4DV3L 3IFDA 4ME5A 1XPUA 2BDOA 3BJUA 2EY2A 5IGEA 1Q46A 2ZJQA 1I6HH 2I5MX 2O5IC 1X9ZA 3W1GA 1EQRA 2UUBL 1PMRA 4RGMA 4YY3L 3V69A 1VQKA 4P73A 3E0EA 4DR1Q 1RHPA 3C3LA 4YHHQ 1CFMA 3P1HA 4HIMA 2A8VA 4KY7A 4KHPQ 1A63A 4HIDA 2ZJRA 4G7ZC 4JI4L 3OETA 4EQPA 4NZRM 3ND9A 3V2TA 4A3BG 4JI0H 1HQMC 4LAAA 1RCVD 4BWGB 5CV6A 3TDQA 4GZYC 4R8NA 2K03A 1PTOH 4DA2A 2R3ZA 5IT9E 2UUAH 1UEAB 2F0LA 5ELBA 3KF6B 3CCUA 1Q82C 2BCOA 4PMWA 2SOBA 4IOCA 3HOXG 3RUZA 4RMFA 3KF8B 2I5LX 2XRQD 3I73A 4OWTB 4PMBA 5LMNQ 1TWAB 1VQDA 4JI7Q 3R2IA 1PTOC 2F0DA 3U50C 1AN7A 1QOHA 4B3RH 1C9OA 1U5KA 2A68D 3LNNA 3CCLA 1E2VA 3JC66 2WACA 2RVLA 4DR7H 5E4WC 5KGUA 1RJTA 4FF1A 1T9HA 2TSSA 1BBWA 4NDXA 4A3KH 1NMGA 2AQ3B 3SDZA 1PV4A 3PSIA 3JAMi 1B3AA 4OWWB 5CYUA 2HHHQ 1YNND 5C3WA 4KV6A 3F2BA 2DN8A 1X55A 1QZHA 2SEBD 5CBAE 4IQZA 2PQAB 3TZDA 3WOFA 4ZYSA 4C1NI 1DOKA 2E2JH 1BBUA 2K1BA 1EU3A 4XDXA 4UP7A 4IJHA 4A3JB 1XMOQ 2KHSA 1LV9A 4HR7B 2NZ1D 3T1YQ 1H9MA 1E1TA 1W6KA 3K5OA 1QNKA 3S1MB 1TKWB 4YWKA 4FJUA 3J7AF 2B2WA 3HKZE 1QUQB 2EY6A 1A6XA 4R4CA 1DTJA 4KN4C 4A3BH 1X6OA 4LMQD 2E74C 1LTAD 3J81L 4DV1Q 4LF5Q 4XT3B 4DV3Q 2CTJA 4BY7B 3T51B 2JA6H 1S4ZA 2K04A 2UUBQ 3I8ZA 1BXTA 3H0GG 1QUQA 4WRDA 2MO1A 4YY3Q 4XQNA 3H3VH 3QD7X 1F9SA 1LT6D 2O4CA 1HUNA 2B3GA 1IKMA 3DHQA 1VQ6A 4O42A 3CPFA 4UY8C 4PMCA 1G8ZD 1DM0B 4LF8H 4JI5L 5ELCA 4JI4Q 4L5SA 3SHLA 2CWFA 2LSSA 1AH9A 3RN5A 1VQ8A 1ONLA 5C5MA 3EIVA 3I70A 2D0PA 3F1ZA 4XIGS 2MHVA 4UP9A 1JR0D 1E0BA 1TUAA 3HOZG 2EYMA 1JORA 1HTPA 4LUVA 4KD4A 4DR5H 4CBVA 3NQIA 4A3IH 4EGVA 3KJPA 4OELB 1TWHH 1DZ1A 5BR8H 1SSOA 4P74A 1C48A 4A76A 3FP9A 4X64H 1JB3A 1Z2IA 1M8AA 4K0KH 3T4AC 4DF7A 3A0JA 3GTMH 1SMXA 3M85A 5LL6X 1LT4D 5J39A 5KIXA 5IYBG 2F4VH 1D2BA 3OSSD 4C3HB 1VQMA 1STEA 1DD2A 1LTID 3DXJC 1P8LA 1VQJA 4A3CH 2KEDA 3K7UC 3NTHA 5AJ3L 2M6QA 1O7LA 2HIVA 2K52A 4TKOB 3CMEA 1HR0L 1YEZA 3NK9A 4YCWA 3OWFA 1GVPA 1XNQL 3HOVH 3R2TA 2M9VA 4EQ5A 4LF9L 1SE4A 3NEMA 5M3MG 2NYZD 1VQOA 4PQXA 2RCFA 1NCVA 1L2FA 1AFPA 1XPRA 2RSOA 3GTGB 1XNRL 2G8YA 4B3TL 3S16H 3UDIA 4P71A 4B3SL 3RZDH 4C3JB 1IW7D 3H0GH 1U4MA 1O7ZA 4DUZH 4DUYL 2K5VA 1F2LA 2E2HH 5F2DA 5IE8A 2E3UA 1SXTA 1B50A 4KTAA 2G9DA 2WINB 1O78A 2JA8B 1K0RA 4A3MG 4X66L 2K33A 1TU2B 1EFID 4JOIA 4HJ5A 1QE6A 2OQKA 1ZZKA 3ERSX 3OMCA 1S40A 1VQ5A 1KNEA 4AQYL 1I4QA 1ET6A 2NVYH 2LTMA 1PTOD 4JG2A 3SVMA 4HIKA 1MI2A 2F0GA 3J81E 5ELOA 1ILPA 1YJ9A 3PQIA 5C3EG 4L63B 2DJFC 1AZQA 1BCPC 1QJOA 2LFNA 5CC4A 3RZOH 2OPVA 3L7ZC 4JI5Q 2F3IA 1B1ZA 1Q81C 3S24A 3PO3B 5IYCG 4LW1A 4X65L 2IX3A 1TWCH 2F4IA 3MXNB 5M5XB 2NTTA 5IGBA 1X3PA 5I6YA 3T56B 3EJIA 4RHRA 1AP0A 3J7AK 1NE3A 1YNJC 1FNUA 1WJJA 1U4RA 3H94A 3OWEB 4EQOA 4OX9L 4KLKA 2QW7A 3GTQH 1ZYRD 4LUOA 2JVZA 3KYHC 1PZJD 4CKEA 5FO8B 1GO3E 2AHOB 4BA1I 3PUZA 1ESFA 1PRTC 2PW7A 1FKAH 4KJNA 2BA0A 1CKMA 1FJGL 3SEBA 1WVLA 5KYLA 2UXDL 2ZT9C 2B63H 1E22A 5AJ3Q 4NMZA 5K36G 2IX0A 1HR0Q 2X6LA 2FFMA 4TSSA 1OTCA 4O1NA 4K14A 1XNQQ 1IBLL 3TP7A 4C3IB 1DYQA 2IHEA 1KDBA 4LF9Q 5TSSA 3ERQA 1Z9FA 2E2IB 1XTDA 1S5BD 1B70B 2UU9L 1S5ED 4DK0A 1R4PB 5E3FA 1XNRQ 4B3TQ 3H09A 1SYDA 2ZXOA 2PZWA 3FMCA 4B3SQ 2B2TC 5JAVA 5CMDA 4A3JG 4N8X1 3TQYA 4R9WA 4DV6H 3OIQA 3HRZC 4DUYQ 3EN2A 1OXXK 3S2HH 2YV5A 1JICA 3N6RA 1KDAA 2KHJA 1NXUA 1L0YB 2JA7B 4JBWA 5FKAC 4X66Q 2Z8LA 1Y1WB 4BXXH 1F77A 3U58A 4IPDA 4AQYQ 3HOUG 2VNUD 1SEIA 1PH1A 1Z6HA 1EY8A 4L6TB 2ATWA 2OQ0A 4IUTA 5EPKA 1WTHA 2CFMA 4CKBA 1Y1VG 3HOWG 5JJIA 3I91A 1Q90A 4QB4A 3DM3A 2X6GA 3HGBA 3QOJA 4K6DA 3I2ZA 3S2DB 1KHIA 4X65Q 2CHBD 2K01A 3I56A 1PVOA 2DGYA 1UE5A 5IP9H 1LO5D 1SNOA 3NELA 1TS2A 2DJGC 1MD2D 2NZHA 2EYLA 4AH6A 4ABNA 5FLXE 1HNWH 3GDEA 5JVH3 1EYGA 4DV7H 3GTKB 1WTVA 1DJRD 2KENA 4IFDH 4PG3A 4RGTA 2E75C 4X62H 4OX9Q 1GUTA 3PO2H 1H9KA 2JEAI 2KQ3A 3ND8A 4ULLA 3X3MA 3MA2B 1VQLA 4MTNA 1YNXA 1PH7A 1LYLA 4LFAL 3MWYW 4JI8L 2F0EA 2MUYA 4FXKC 3J80L 3GTOB 4JC0A 3H91A 3MEFA 3VYRA 4KKUA 2ZM6H 1FJGQ 4C3HG 3F2UA 2VQFL 4JI1H 1EOTA 2RF4A 2UXDQ 4A93G 5E1FA 4DAPA 3S15H 1I4XA 4DAVA 3PGZA 2LXJA 4U673 4LK1C 1NR2A 4HN7A 1MKHA 1PRTF 1IBLQ 4JCVE 4C2MB 2K7VA 4QMFB 1JT8A 5K5PA 1N8RC 1YVCA 4FF2A 2VKCA 5CGKA 2F0IA 4Y7NB 3HKSA 2UU9Q 4ME3A 1F9PA 1L0WA 1V9NA 3CCJA 4DR6H 2VQEH 4A3FG 1IBKL 4JI3L 5JJLA 3K6OA 1VQHA 3W3AA 2PZUA 3ULLA 1Y8PB 1EIFA 3I4MH 2J4XA 2AKWB 2EYJA 1IZ6A 2SNMA 1YIJA 1AEXA 1QWYA 1CA5A 3EZJA 2QDLA 4A3BB 2SNSA 3OTOH 1OXVA 2CCZA 4A3GG 1N9WA 3UDXA 1JWSD 2NUCA 4FXGC 3D8GA 1I4GA 4KHVA 1KC8C 2KOLA 3S1NH 2CPQA 4JV5H 1ZTGA 3VR5A 5IGDA 4IOAA 2L55A 2CTEA 3NPPA 4GNXC 3SK8A 1GUSA 1LLRD 4N9TA 1NTGA 1M1KC 3TZUA 1H9SA 2FMMA 3M7GA 1IYUA 4QGUA 2WV6D 3P20A 1EQVA 2Z6KC 3OMGA 3C2PA 4X3SA 3N52A 5EAYA 1CZGA 4OONA 4IFDI 4HSPA 2UXCL 1S20A 1V1PB 2G9HD 1MBYA 4DV2H 1RD9D 1LUZA 3GKUA 5JPMC 1I94L 1B3QA 4JYAL 4K5XA 4LFAQ 3AFQA 4JI8Q 1I3QH 1UE7A 3I4OA 2F1MA 5C4JB 2ID0A 1D1IA 4DK6C 2VQFQ 2WAQG 2MPMA 4A3FH 2NVQB 5KYIA 4JW0A 4DKAC 4YCVA 4A3EG 3HZXA 1QG7A 2R93G 2NVXH 1BDOA 2C9OA 4LJZC 2XIWA 3S14B 3STBD 3VDYA 4HCEA 2L5TA 1MSGA 1Q8KA 1F2YA 3MZ5A 2F3VA 4FF3A 4NBQA 2BA1A 1J5EL 1IBKQ 4IUUA 2EJFC 4JI3Q 3M3YB 3RZDB 1BNZA 3H0GB 4RH6A 3GTLH 1Y69U 2IY5B 4LF6H 3K7AH 2QNDA 4MNOA 4CDCC 3CC2A 1HCZA 5CV7A 3GV3A 5G3LD 5I4DA 1PDQA 4DK1A 4ILWA 1V9PA 1IBMH 2C35B 3O13A 3S1RH 1HFGA 5A2QE 5IT9L 2K05A 1A62A 3OPOA 4LFCH 4JI0L 1LTTD 1SE3A 3CCRA 3J81i 1MJEA 1KD1C 4TQUS 1CQVA 2UUAL 3HOZB 1NR4A 3S1QB 4R8IA 2I5HA 3M4OB 3HP3A 1SYCA 3G7LA 1HPCA 1SRUA 4NXNH 1KLUD 5JPNC 3HOYG 2ZXRA 3SK6A 2LTLA 1PZID 5HGTA 4DR3H 4R4OA 4GKJH 3RZOB 1PH9A 2BL5A 5KRUA 4BY1H 4NZTM 2LS01 1WVNA 5J3BA 4P72A 4DFAA 1TWCB 4B3RL 2D0OA 2EOTA 2SDFA 2ANRA 1KRSA 3DUZA 2ZJPA 1SYBA 4JI2H 2WKDA 2PQUA 1BR9A 4JI6H 3GQBA 1FD7D 2RSNA 2WAQE 2UXCQ 2DUDA 4JVYA 2R61A 5KNCA 1TY2A 1KQSA 1YJWA 4XT1B 1C8CA 3KDFB 1I94Q 4JYAQ 1EEFD 2PO4A 4HMJA 3GTQB 5M3MB 2EXZA 3I0PA 3S17B 2AQ2B 3U9SA 2F0QA 5KNDA 3CU7A 1OXTA 2CWHA 1WFQA 1SMYD 4G57A 1NY4A 4NB3A 4J8QA 3KDFA 4A3KG 4OO1H 2A69D 5GADC 3G6EA 3WDNA 3ONAB 4KKTA 5C4XH 2CQOA 4A3MB 5COYA 3D4RA 3CMAA 2QCPX 4ZKCB 1J5EQ 1JE4A 2K32A 2A6ED 4PZ7A 2JEBI 2B2TA 1FL0A 1SN8A 1KRTA 5IP7H 2PW5A 3NTKA 1K8AC 2R92H 3BZDB 3GTJH 3C1FA 5C3EB 3S2HB 4LF7H 1SR3A 3HOYH 1Q8IA 3BYTB 2J7ZA 1AE2A 3TP8A 3PIO3 3GV6A 4LF8L 1HA6A 4JI0Q 4A3LH 3MTSA 2QILA 3A74A 3EFXD 3OIPA 2JA6G 3GR5A 2UUAQ 2B2UA 4AIMA 4IPCA 1B4OA 2QF7A 4XXEA 1JB7A 3T16A 4YHHH 4DR5L 3PCOB 3TS2A 1LTGD 3NWSA 1ILQA 5BR8L 1WTQA 4A4IA 2UXBH 4X64L 4K0KL 1V8CA 1TS5A 2AUKA 1VQGA 3HS0C 1ZEQX 1PH2A 4DV0H 3VR3A 4B3RQ 1HNZH 2Q8IB 1NUCA 3RR5A 2CWPA 5M5WB 2VB2X 2TMPA 4A3IG 1CUKA 5J22A 3NWTA 5C3XA 1EIYB 4IUNA 3CPWA 2MJ8A 1LACA 1DT4A 3FAUA 4JI7H 2IW3A 3PO2B 2EZVA 2GVAA 3BVGA 3FRPB 1A3TA 1XMQL 1SFOH 5M5YH 1UAPA 1TWGH 3TEHB 1AW7A 4OO1I 5BN5A 4EVOA 2D9UA 5GAGC 4A3CG 3RLNA 4LF4L 2Q2IA 2Y0SG 4IZ8A 4FYDA 4DUZL 1V1OA 4RKBA 2K5QA 1N33L 1GHKA 4RKLA 1I5FA 1E2WA 4HJAA 3J81c 3HOVG 1STBA 1ENCA 4Q0FA 3CC4A 2B2VC 5C0XH 5I2XA 4DV5H 4P2CB 4ID6A 2NN6H 4ZUIA 3KK7A 3DLLA 3HOUB 2UUCH 2HQLA 2HH2A 5IGCA 2FJ2A 2I46A 4DV4H 1FNWA 2AUJD 4A3DH 4LFBL 1VS0A 1C0AA 1X3QA 1Y1VB 1EZ6A 1I6VC 2CWAA 2D2CC 3MXGA 1EY0A 3HOWB 4QMGA 2PCFB 1PFSA 2OCEA 4Z9CB 3T1HL 2YQRA 1JC7A 1TVXA 4LF8Q 1VQCA 1XXGA 2RDGA 2VUMG 4DV3H 2EPBA 2L15A 4BBRH 2KHIA 2UUBH 3A7LA 1GUGA 4YY3H 3QR8A 3NQTA 2JA5H 3FKIH 2D62A 1K3BC 4DR5Q 4IPHA 1KTKA 1W3SA 3UOEA 5J1ZA 1OO9B 5BR8Q 3K0YA 2MJHA 1NAPA 4HJ7A 3VR4A 1MSZA 4X64Q 1WD0A 4BBSH 4K0KQ 1FGUA 1VMPA 4G7HC 5KEEA 2OT2A 3ICEA 1DONA 1J5KA 1S3OA 2Z6KA 3K59A 2EYOA 2R6GA 1BQQT 5EPJA 4A93B 1D8LA 3P75A 1VF5C 1I50H 1PYWD 3IRBA 2FXQA 4K5VA 2B2YC 4OGQC 1A0IA 2FFKB 5LL6S 5C44H 5EKIA 4LNQA 4DR2H 2ENBA 3CKIB 1NSNS 3FDTA 4OIKA 2A1SA 1DOLA 2ANNA 2Y0SE 3OHXC 3PIPA 2NZOA 3E5SA 1PYSB 1G291 1XMQQ 1HZAA 3MXUA 4K8JA 4JVHA 2MFIA 1C4QA 2IWHA 2K28A 3R8BA 1JQYD 3J80i 3HG9A 4A3FB 1E1OA 1N34L 3CQZB 4J15A 2B63G 5C4HA 2XWJB 1R9TH 1QB5D 4LF4Q 2OPUA 1SROA 4DV6L 4GOPC 4GN4B 2XTIA 1XYIA 2DY7A 2XWBB 4DUZQ 1WTWA 1VQ4A 1A2UA 1N33Q 4RAUC 3PF4A 4XQQA 3A8KE 5C0XI 1S5DD 3GTPB 4RCNA 5T1GA 2NN6I 2EYFA 2BH2A 2IT1A 2DY8A 5A35A 1LTBD 2HCIA 4F8MA 4O0AA 4QIWE 2VUMH 4O2DA 5NUCA 2NB0A 2OEOA 2A1AA 2NBFA 3G48A 2HH3A 4A3GB 1ET9A 1S5FD 1CA6A 3CXCA 4LFBQ 4JPBW 4KY5A 4LWCA 2V1CC 3ZJYC 3K7AB 4V0BA 2FMRA 1YHQA 5C6AA 1E2ZA 1RDPD 1V43A 3T1HQ 5IOCA 1TR5A 2KJXA 3GO5A 2PPBC 4BXXG 1EZ8A 5GQOA 3PUVA 2MQHA 4DNTB 1K3RA 3EQLC 3VA5A 3E0JA 3JAMc 3V05A 2CH4A 5FLXL 2WKCA 4IALA 1YI2A 1HR0W 1PXUA 1WTJA 2AMCB 4CKCA 4FDBA 4QF4A 2HQEA 3BZCA 3AQQA 2YTXA 1HNWL 4DV7L 1N32H 4JI5H 3A55A 4X62L 2N55A 3CF5A 1PH4A 3D31A 2O2LD 1D7QA 3P7JA 2RDFA 1EYDA 2JYOA 1HFNA 2A19A 1SNPA 1WCMH 4HSVA 2QEXA 1N36H 3D6WA 2WAQB 3CAMA 3F2CA 1X9NA 5IP9G 3KFUA 2PY9A 2AWNA 2CW0C 4A3EB 2R93B 2LKVA 1FNVA 4IFDG 1PQXA 1L1OC 3CD6A 5JEAH 4RGOS 2DNCA 2QGQA 3PO2G 1O80A 4DAYB 1JMCA 3UE1A 3VYUA 2J0TD 3SB1A 4C1NK 1N34Q 1J8IA 1HZCA 5ELNA 5FLMH 1VQAA 3ULPA 1JOOA 1HR0H 1HZBA 1VQIA 3BYYB 2Q8TA 5M3FH 2ES2A 4DV6Q 1Q7YC 3J7YW 4WFN3 1XNQH 1QNUA 1E3PA 4DAYA 4DXGA 1GKHA 1EFWA 5EKKA 2XN9C 4IUVA 4L5RC 2KCCA 1EY7A 1WTXA 1STYA 1BVSA 1IL2A 3KLSX 3JAMW 2YU9H 3H15A 1PLFA 4B3SH 5C4ZA 2JSOA 3QJYA 3TMEA 4UHVA 1HH2P 2AWOA 1I6HB 1MSHA 2A73B 3NHHA 5LL6b 3I4MG 4H7BA 3GTJB 3TRZA 1KHMA 4YIJA 2K4KA 5JVG3 3HOYB 3BDCA 3VR2A 3NUCA 5CV5A 1VQBA 1WYDA 1EY5A 1STAA 1CQFA 5IGGA 2WFWA 1PTOB 1EUJA 1RIPA 3DEOA 1VQ7A 2ICIA 3DM1A 1LTRD 2EYHA 1HNWQ 1BUVT 3KJOA 3Q8DA 4DV7Q 2JN4A 4B3MH 2A6HC 3PMFA 3BU2A 2RHSB 5IIFA 3G71A 4X62Q 3J80c 1IYJB 2ICEC 4FF4A 4X65H 1HJPA 2HD3A 1VCIA 2XVSA 3U4VA 2E2DC 1HNXL 2OWOA 3SK4A 3K80C 4RCOA 2OXPA 3K57A 1PZKD 3MAQA 4MHEA 4B8CD 4A3KB 1STGA 1WD1A 4EC5A 4POGA 2O4XA 5FO7B 2Q8RE 1EWHA 4GN3B 2EQSA 1OXUA 1W6JA 2EXDA 2FMCA 1A15A 1XX8A 3K5NA 1CKNA 1BCPD 1UWVA 2F0OA 2X06A 3EA6A 1SBBB 3UDFA 1ENAA 2E2JB 1SEBD 2R7DA 1Y8NB 4KY6A 1X4NA 5IWAL 4WALA 2F3WA 2ZXPA 3M4YA 4K5WA 4YWLA 3S1MH 2JA9A 4DPGA 1IBLH 4LF6L 1KLGD 3NBHB 5A2QL 2B2WC 5M9OA 2H1EA 3CW2C 1YNJD 2E76C 2IJ0A 3BDLA 1IBML 1Z7TA 2C5CA 3ITPA 2PZTA 3D4DA 4BY7H 4CHTB 1EL0A 1KIXA 2B8GA 1S03G 2ZQEA 1H9SB 3QG1A 2JA6B 3NBHA 4QL5A 3M4PA 1PRTD 3W5OA 4CDEC 2HUGA 3A56A 1KL9A 3E9IA 1BF4A 1D6EC 3J80W 1WE8A 3TP6A 3SR1A 2Z4IA 3BS1A 4FVMA 4NXNL 4JBMA 3BZKA 4DR3L 1CI3M 3RLFA 1BO0A 2IHFA 3KBGA 2ZTCA 1EU4A 3NXWA 4OEMB 5D3DA 3T13A 5GROA 2I0QA 4IUPA 3HEJA 4BBRB 3A8JE 2F0VA 4JI2L 3CCQA 2BE5C 4EQNA 5E7NA 4A3IB 4H0LC 1TWHB 3UDGA 1B44D 5CV8A 1A2TA 3GTMB 1SYFA 4BY1G 2F0MA 1B9MA 4NW2A 1HNXQ 1CHQD 1F9QA 4Y52H 2Z9HA 1AZPA 2K5DA 2CTLA 2H5XA 1Y14B 4K8IA 1WHRA 3F8TA 2Y0SB 1UE1A 3K5MA 5T1IA 5JOBA 3PUXA 3HOVB 4LFAH 1VQPA 4JI8H 1V8QA 4NKLA 1I4RA 1VMCA 4R4QA 2VL6A 4DR4L 5LMUL 4WJ4A 2M8WA 4C3JH 3S16B 1L0XB 2KBNA 3NTIA 2EJGC 5IWAQ 4ZUJA 1MJCA 3ZYYX 4OO1G 4DGZA 4ZCKA 4GOPA 4LF6Q 1PH6A 4QIWB 2E2HB 5IT9c 1KABA 2QKIC 4J6HA 2A68C 4ALPA 4LF7L 1VQFA 2JA8H 5C4XG 2D9IA 4GLVB 3CHBD 4JOIC 3AYHB 2N3SA 1MGSA 3QB3A 3TN2A 1IBMQ 4GLXA 3G6JB 4KN7C 2VUMB 1BCPB 1IBKH 1F2MA 4JI3H 1LTLA 1CSPA 2KCTA 2NVYB 2WB1G 4PDBA 2Z6BA 1H95A 4PV1C 1JCKB 4NXMH 2CVRA 3AB9A 5IP7G 5DNFA 5JJKA 4EX5A 1WTOA 1YNNC 4RFBA 2R92G 1E7ZA 1Q86C 2JP1A 3MHBA 3I55A 4NXNQ 3J7ZC 4KK7A 5DT9A 2E5LH 4DR3Q 2N49A 2G5DA 3PO3H 2UXBL 4K2LA 4S3SA 1H9JA 3KLSA 2ZTEA 5M5XH 2M2LA 4DV0L 4A3LG 4XYOA 3X3NA 5I9PA 2F0PA 3H6MA 2CKZB 1QZGA 4BA2I 1HNZL 4B9XA 1JWUD 4DR7L 5D65A 4JI2Q 4HAEA 3EVQA 1KDCA 1DXMA 3MFGA 3DEPA 4WJ3M 2L9HA 3GD7A 2VS1A 3KDGA 1ICWA 1YBYA 2FINB 4HJ9A 4IPGA 2VXWA 2KCMA 2F0FA 2NVTH 1X3GA 1VIHA 2FPHX 4LIJA 3FPUB 1EY9A 4X3TA 3I90A 4IFDJ 2NWGA 1RTOA 2UXCH 2B63B 2VW9A 3RN2A 5IT9W 4ZKBB 1L1OA 1CM9A 2KECA 1NJIC 1HRJA 4WANA 4GKKH 2EDGA 3DWQA 2E2IH 1HZ9A 4J1MA 4X3KA 2JJQA 1A3UA 1J6QA 4GN5A 3W2DA 4KD3A 4DV5L 1EQTA 4DR4Q 5LMUQ 3QOLA 2UUCL 4KI0A 2X69A 1I6UA 2VY3A 1ESRA 4DV4L 5LMNW 1J9OA 2N8NA 2GVBA 1NBWA 2WB1E 2JA7H 4Q5VA 4LF7Q 1VQ9A 2BE5D 5D3IB 3K81C 3OOCA 1HHVA 5C0XG 2PQEA 3RD4A 3A5UA 3Q23A 2PMZB 2NN6G 3CRLC 4P75A 4PNYA 2YU9B 3BDOA 1UNSA 3C1EA 4APVA 1GXDC 1C7YA 1LM0A 3HKZG 4H02A 4A3DG 1SDFA 2R7FA 1ML0D 3J7A5 4DR1H 4KHPH 1LT3D 2L0CA 3IFTA 1EIHA 5DEHA 3K58A 1JJGA 2XRSD 4RHSA 4M8AA 3PV0A 4CDDC 5I9OA 1ODHA 2UXBQ 1EYAA 2BH8A 3S2DH 4CJ1B 2K5HA 1SE2A 5IYDH 1IW7C 1CT1D 1HXYD 4DV0Q 5D14A 2F4VL 4X3UA 1HNZQ 3GABA 4BBRG 1CK1A 4DR7Q 4HJ8A 2EJMA 4L5QA 4WORA 5HY6A 2JA5G 3FKIG 4MIUA 3GTKH 1SYEA 2DGRA 1JJ2A 4KKSA 4MTKA 5LMNH 3SE0A 4DR2L 4POFA 4BBSG 2QEJC 5EBDA 3KF6A 4I7ZC 3GTOH 3I4NG 2RKSA 3HFZB 3GP7A 1BBXC 5C5LA 2HDMA 5I2YA 1FGBD 2F0JA 4KHZA 3KF8A 3RLOA 3LGJA 1S72A 3S15B 2B29A 3F2DA 2RQXA 5DAUA 3TREA 2VQEL 3FPPA 1TWFH 4C2MH 2HHHH 3A8IE 5C44G 1YJNA 4PZ8A 4Y7NH 2Y3MA 2M00A 4RG1A 4DV5Q 4G08A 4OWXB 4I7AA 1QVCA 2K5NA 4DNIA 4E9JA 2UUCQ 1XMOH 3MXPA 1RF2D 2YTVA 4DV4Q 1BKBA 3Q24A 3T1YH 3NP8A 1XPOA 1ZYRC 3I4MB 2D5DA 5ELEA 2PQAA 4XYQA 1G2SA 2Q2TA 4DV1H 2CQAA 4LF5H 1VIGA 2LY7A 2QDBA 4GNXB 2RHQB 1TT2A 1EY4A 4ZAIA 4FNFA 2FHTA 4AYBG 3Q6SA 2HCCA 2IX1A 4FXDA 3HOXH 3FVQA 2L12A 3S1NB 1X56A 2O5JC 2ALYB 1N32L 4GNXA 1ZZJA 1JJCB 1GM5A 1GJXA 4JI4H 1KNAA 2EE1A 4NP5A 4TVAB 3DWAA 1HQRD 1T5XD 3I4NH 1FVIA 3C46A 4UDUC 5EBCA 4H8AA 3H3VC 2F0TA 2F4VQ 4FP5D 4JVZA 1N36L 5BN4A 3A54A 3L3OC 4NPSA 1VQNA 2PI2A 1UE6A 5EJWA 1XWEA 2LF0A 1PFBA 1E24A 3G4SA 4HTHA 1SE8A 4H13C 1BOSA 3J81W 1YITA 3DMUA 4DR2Q 2R7ZG 2F0HA 1R4QB 1JE5A 4QJFA 5C4JH 2KA7A 4AM3A 1I3QB 3BVZA 1WCMG 4B9WA 2NVQH 1Q3LA 4K2KA 2EYPA 1PH5A 1HTLD 4I65A 1YZ6A 1TS4A 1U9RA 1PTOF 2IL8A 5FJ8G 1ASZA 2VQEQ 3J81j 3RNUA 3TS0A 1GUNA 2Z1CA 2NVXB 1GD7A 5JEAG 3S14H 1B9NA 2L11A 3V96A 5CR3A 3CCMA 1XMQH 2F03A 5I6WA 3M3YH 5FLMG 4LF4H 1TQOA 3R93A 3AMUA 1LABA 2GA4B 5ELFA 5M3FG 1N33H 3SK5A 3GTLB 1NMFA 4OXPA 3ULJA 2B8FA 5IGFA 4AYBE 4DK3C 1K83H 4IN3A 1B7YB 5FLXc 5DLQE 3VA7A 3S1RB 2LRRA 4DXFA 3L2PA 1AN8A 4HEDA 4R4TA 2PYKA 4C56C 1M90C 3IL8A 4LFBH 3H3VI 2EY5A 3HOZH 1RL2A 3S1QH 3EBEA 3M4OH 1NNXA 4N9PA 5FK9C 4IJLA 1LTSD 5AFWA 1YHAA 2MO0A 4B3ML 1SLJA 1N32Q 4G7OC 3T1HH 2V4DA 1F9RA 2R7ZH 2OF1A 1GOZA 3TP5A 5IYBH 1PHJA 4ZK9B 2BDNA 5ELDA 5EQ0A 3PIOA 4BY1B 4V190 1KAWA 5H1SE 1K8OA 1N36Q 2MGSA 3K0XA 2ZM6L 2F0NA 2XNAC 4JI1L 1WOCA 3JAML 4OCHA 2CPMA 2QA4A 1EWIA 2P5ZX 4DN4M 4ZQ3A 5FJ8H 2H4OA 4RA8A 4OL7A 4LUZA 3MXNA 1SYGA 2ZTDA 5M3MH 1RODA 2NVTB 3S17H 2F0WA 4E6IA 5CBEE 3BVMA 1DGSA 4QQBX 1UG8A 4CGYB 1K8GA 4OIJA 4XQJA 1D5ZC 4DR6L 4IUQA 4FJSA 3VYTA 3Q0AA 1RTNA 2VB3X 1Y8OB 4KMUC 3IKJA 2F0SA 3S9WA 1K1GA 1K9MC 3I72A 2N78A 1XTCD 4DAMA 1D1KA 5FLXW 4LF9H 5GAEC 4KJOA 4A3MH 5C4XB 3OW7A 5L37A 5LHY1 2RDHA 3WOEA 1G6PA 1XNRH 4B3TH 2WIIB 4GS3A 3OTOL 1QILA 1B8AA 1N34H 1X32A 2WB1B 1K28A 1QCBD 1X3EA 2PMZE 2HIXA 2JK8A 4DUYH 4L8JA 1IXRA 4UP8A 5C3EH 5C0XJ 2R92B 3T53B 1XRHA 3AFPA 4XTCS 3AU7A 2BOSA 4PZ6A 4JV5L 1FR3A 3U1KA 4X66H 1X54A 4JBKA 1B53A 1IKLA 1SAPA 4RWSC 1PH8A 2K5WA 3L9AX 1A8VA 5IYCH 4AQYH 3SXHA 3NCVA 4BY7G 2P2RA 3MVVA 2HDLA 5HURA 1TIID 2B2UC 4BS9A 1TS3A 4K6LA 1AE3A 3U4ZA 2IPKD 1WTPA 3MFYA 1TXYA 3STBC 2WP8J 3LX0A 4B8TA 5CORA 4B3MQ 1PFNA 3K5LA 1U0LA 2YYZA
chains in the Genus database with same CATH topology
4DV2L 1TWAH 4U68A 5CV9A 2JXMB 1IYVA 4JBJA 4YWMA 3IAYA 3A7AB 2OTJA 1W2BA 3J7AV 2ZM6Q 3KLWA 2JQOA 1BCPF 4JI1Q 1CKNB 3AEVB 4MZ9A 5M5WH 3I7FA 5K36H 3QWNA 3M9BA 3JAME 3QO2A 1G91A 3A5ZB 5ISRA 3OSOA 4DNRB 1T5EA 1O7IA 3PUYA 3L0OA 5FOBB 1G6ZA 1U4PA 3AEVA 1VF7A 1FYCA 3CCVA 1JOQA 1SFOB 5M5YB 4A3JH 1XJVA 4DR6Q 1S5CD 1G51A 5IY0A 1TWGB 3I4LA 1I4PA 3M7NA 3EROA 2F0UA 1TWFB 1QVFA 3MC0B 3WWVA 3CCSA 1B2TA 1EWCA 2JZXA 2B2VA 3CRKC 1EEID 3PF5A 2A5HA 2Z0SA 4G4KA 1GHJA 3HOUH 3OTOQ 4LFCL 1Q1EA 2LXKA 4C3JG 3VR6A 4ZRZA 3KLRA 3HKZB 4NXML 4A3DB 1Y1VH 2NTSA 5KNBA 4QUCA 3HOWH 4JV5Q 1J4WA 1X3FA 2CW0D 3LWEA 5EKLA 2E8GA 1PA6A 1DCZA 3E9HA 2JA8G 2N88A 2CTFA 2E5LL 1CTMA 4GKJL 3B6YA 1SMYC 1EY6A 3UE0A 2PI2E 2Q2UA 5JJZA 1QVGA 2F0KA 2A69C 3D6CA 2F52A 1MIUA 4R1JA 1ASYA 1EC6A 2JA5B 3FKIB 5HGQA 4JI6L 4F88A 4MN3A 3HOXB 1SNMA 3KUPA 1F2ZA 3M4QA 3W1BA 1RKNA 4F87A 3VYSA 4DV2Q 3Q22A 2KUMA 2A6EC 3ER0A 4BBSB 3PO3G 5BN3A 1Q12A 2MP1A 4F7XA 1V1QA 3I4NB 3CP0A 4C3HH 4FO2A 2LMCB 3BG3A 1Z47A 1IL8A 4A93H 2K6AA 2JE6I 1CKOA 2K75A 1DOMA 4UAIA 1I50B 2I07B 3E6ZX 2B2YA 2OTLA 4OHJA 5C44B 3CC7A 1K8MA 4YCUA 4GKKL 4GOPB 1KAAA 3UI2A 1O7YA 5G3LF 3GTGH 2CTMA 1V1PA 1H9RA 3J80E 5JEAJ 3CQZH 4X6AH 1CHPD 5E4XA 3R3OA 2KVMA 1R9TB 3TBIB 4L5TA 1STHA 4IO9A 3GTPH 1ZZIA 2L1BA 4DU9A 4C3IG 1SNQA 1VQEA 3K8AA 3NENA 2A6HD 2MNAA 5CV4A 5EGTA 3PUWA 4RGNA 4LFCQ 1ENFA 5FO9B 4A3GH 3QIAA 1D5MC 4B08A 1SJHD 1VDZA 2Z4HA 4AYBB 1IHZA 4NXMQ 1Q1BA 3URYA 3KOJA 1M4VA 1JOKA 2KCNA 2Q2HA 2RA4A 3TSSA 4QUFA 2XSCA 3FEWX 1GUWA 4DR1L 2JA7G 4YHHL 4KHPL 1GUOA 1K83B 1G2TA 1SNCA 1Y1WG 2E5LQ 4GKJQ 3FHWA 1PFMA 5DM73 1X65A 4TRDA 5IODA 2VZAA 4UPAA 1U4LA 3RMHA 3MEHA 1X4MA 3LWUA 1STNA 1PH3A 4HCSA 3CCEA 2ASBA 1PRTB 4JI6Q 1WI5A 3KBXA 1ZXTA 2XGTA 2GN5A 3PIP3 3U9OA 2R7ZB 5LMNL 4JK1C 3I3CA 4JI7L 2RBMA 5IYDG 1L1OB 1CSQA 1WCMB 2KEEA 1I4HA 2YTYA 4GLAC 1P16A 1UEBA 1K73C 4WJWA 4QCLA 4A3EH 1A3VA 2R93H 1PYBA 4R4IA 1EQQA 1JWMD 2B39A 3D3RA 4CJ2C 2RCNA 2EVBA 4M1UB 4QY7A 4C3IH 2HT1A 1WTRA 1YHBA 1OXSC 2HHHL 2L4NA 1EIGA 4GKKQ 1EOVA 1ZKOA 4CJ0B 2EIFA 5EPLA 2CTKA 1LT5D 1HUMA 1SNDA 1KXLA 4ODGA 2K14A 4IURA 3D0FA 3OW2A 3OYYA 4HIOA 2EY1A 1XMOL 2AXYA 1CZWA 2AQ1B 3DWPA 1TY0A 5M3FB 1UUPA 1HA5A 3T1YL 3NBIA 2PNHA 3NE5B 1D5XC 3VKEA 5DM63 4HMIA 2A74C 1Y1WH 5GAHC 4H44C 3NSWA 3SGIA 1EYCA 1II3A 2PNRC 3D4WA 2DNEA 2K50A 1SJED 4DV1L 4LF5L 4A75A 4ZLTF 4DV3L 3IFDA 4ME5A 1XPUA 2BDOA 3BJUA 2EY2A 5IGEA 1Q46A 2ZJQA 1I6HH 2O5IC 2I5MX 3W1GA 1EQRA 2UUBL 1PMRA 4RGMA 4YY3L 3V69A 1VQKA 4P73A 3E0EA 4DR1Q 1RHPA 3C3LA 4YHHQ 1CFMA 3P1HA 4HIMA 2A8VA 4KY7A 4KHPQ 1A63A 4HIDA 2ZJRA 4G7ZC 4JI4L 4EQPA 3ND9A 3V2TA 4A3BG 1HQMC 4LAAA 1RCVD 4BWGB 5CV6A 3TDQA 4GZYC 4R8NA 2K03A 1PTOH 4DA2A 2R3ZA 5IT9E 1UEAB 2F0LA 5ELBA 3KF6B 3CCUA 1Q82C 2BCOA 4PMWA 2SOBA 4IOCA 3HOXG 3RUZA 4RMFA 3KF8B 2XRQD 2I5LX 3I73A 4PMBA 4OWTB 5LMNQ 1TWAB 1VQDA 4JI7Q 3R2IA 1PTOC 2F0DA 3U50C 1QOHA 2A68D 1C9OA 3LNNA 1U5KA 3CCLA 1E2VA 3JC66 2WACA 2RVLA 5E4WC 5KGUA 1RJTA 4FF1A 1T9HA 2TSSA 1BBWA 4NDXA 4A3KH 3SDZA 2AQ3B 1NMGA 1PV4A 3PSIA 3JAMi 1B3AA 4OWWB 5CYUA 2HHHQ 1YNND 5C3WA 4KV6A 3F2BA 2DN8A 1X55A 1QZHA 2SEBD 5CBAE 4IQZA 2PQAB 3TZDA 3WOFA 4ZYSA 4C1NI 1DOKA 2E2JH 2K1BA 1BBUA 1EU3A 4XDXA 4UP7A 4IJHA 4A3JB 1XMOQ 2KHSA 1LV9A 4HR7B 2NZ1D 3T1YQ 1H9MA 1W6KA 3K5OA 1E1TA 1QNKA 3S1MB 1TKWB 4YWKA 3J7AF 2B2WA 3HKZE 1QUQB 2EY6A 1A6XA 4R4CA 1DTJA 4KN4C 4A3BH 1X6OA 4LMQD 2E74C 1LTAD 3J81L 4DV1Q 4LF5Q 4XT3B 4DV3Q 2CTJA 4BY7B 3T51B 2JA6H 1S4ZA 2K04A 2UUBQ 3I8ZA 1BXTA 3H0GG 4WRDA 1QUQA 2MO1A 4XQNA 4YY3Q 3H3VH 1F9SA 1LT6D 1HUNA 1IKMA 2B3GA 3DHQA 1VQ6A 4O42A 3CPFA 4UY8C 4PMCA 1G8ZD 1DM0B 4JI5L 5ELCA 4JI4Q 4L5SA 3SHLA 2LSSA 1AH9A 3RN5A 1VQ8A 1ONLA 5C5MA 3EIVA 3I70A 2D0PA 3F1ZA 4XIGS 2MHVA 4UP9A 1JR0D 1E0BA 1TUAA 3HOZG 2EYMA 1JORA 1HTPA 4LUVA 4KD4A 4CBVA 3NQIA 4A3IH 4EGVA 3KJPA 1TWHH 1DZ1A 1SSOA 4P74A 1C48A 4A76A 3FP9A 1JB3A 1M8AA 3T4AC 4DF7A 3A0JA 3GTMH 3M85A 1SMXA 5LL6X 1LT4D 5J39A 5KIXA 5IYBG 1D2BA 4C3HB 1VQMA 1STEA 1DD2A 1LTID 3DXJC 1P8LA 1VQJA 4A3CH 2KEDA 3K7UC 3NTHA 5AJ3L 1O7LA 2HIVA 2K52A 4TKOB 3CMEA 1HR0L 1YEZA 3NK9A 4YCWA 3OWFA 1GVPA 1XNQL 3HOVH 3R2TA 2M9VA 4EQ5A 4LF9L 1SE4A 3NEMA 5M3MG 2NYZD 1VQOA 4PQXA 1NCVA 1AFPA 1L2FA 1XPRA 2RSOA 3GTGB 1XNRL 4B3TL 3S16H 3UDIA 4P71A 4B3SL 3RZDH 4C3JB 1IW7D 3H0GH 1U4MA 1O7ZA 4DUYL 2K5VA 1F2LA 2E2HH 5F2DA 5IE8A 2E3UA 1SXTA 1B50A 4KTAA 2G9DA 2WINB 1O78A 2JA8B 1K0RA 4A3MG 4X66L 2K33A 1TU2B 1EFID 4JOIA 4HJ5A 1QE6A 2OQKA 1ZZKA 3ERSX 3OMCA 1S40A 1VQ5A 1KNEA 4AQYL 1I4QA 1ET6A 2NVYH 1PTOD 4JG2A 3SVMA 4HIKA 1MI2A 2F0GA 3J81E 5ELOA 1ILPA 1YJ9A 5C3EG 4L63B 1AZQA 1BCPC 1QJOA 2LFNA 5CC4A 3RZOH 2OPVA 3L7ZC 4JI5Q 2F3IA 1B1ZA 1Q81C 3S24A 3PO3B 5IYCG 4LW1A 4X65L 2IX3A 2F4IA 1TWCH 3MXNB 5M5XB 2NTTA 5IGBA 1X3PA 5I6YA 3T56B 3EJIA 4RHRA 1AP0A 1NE3A 1YNJC 1FNUA 1WJJA 1U4RA 3H94A 3OWEB 4EQOA 4OX9L 4KLKA 3GTQH 1ZYRD 4LUOA 2JVZA 3KYHC 1PZJD 4CKEA 5FO8B 1GO3E 2AHOB 4BA1I 3PUZA 1ESFA 1PRTC 2PW7A 4KJNA 2BA0A 1CKMA 1FJGL 3SEBA 1WVLA 5KYLA 2UXDL 2ZT9C 2B63H 1E22A 5AJ3Q 4NMZA 5K36G 2IX0A 1HR0Q 2X6LA 4TSSA 1OTCA 4O1NA 4K14A 1XNQQ 1IBLL 3TP7A 4C3IB 1DYQA 2IHEA 1KDBA 4LF9Q 5TSSA 3ERQA 2E2IB 1Z9FA 1XTDA 1S5BD 1B70B 2UU9L 1S5ED 4DK0A 1R4PB 5E3FA 1XNRQ 4B3TQ 3H09A 1SYDA 2ZXOA 2PZWA 3FMCA 4B3SQ 2B2TC 5JAVA 5CMDA 4A3JG 3TQYA 4R9WA 3OIQA 3HRZC 4DUYQ 3EN2A 1OXXK 3S2HH 2YV5A 1JICA 3N6RA 1KDAA 2KHJA 1L0YB 2JA7B 4JBWA 5FKAC 4X66Q 2Z8LA 1Y1WB 4BXXH 1F77A 3U58A 4IPDA 4AQYQ 3HOUG 2VNUD 1PH1A 1Z6HA 1EY8A 4L6TB 2ATWA 2OQ0A 4IUTA 5EPKA 2CFMA 4CKBA 1Y1VG 3HOWG 5JJIA 3I91A 1Q90A 4QB4A 3DM3A 2X6GA 3HGBA 3QOJA 4K6DA 3I2ZA 3S2DB 1KHIA 4X65Q 2CHBD 2K01A 3I56A 1PVOA 2DGYA 1UE5A 5IP9H 1LO5D 1SNOA 3NELA 1TS2A 1MD2D 2NZHA 2EYLA 4AH6A 4ABNA 5FLXE 3GDEA 5JVH3 1EYGA 3GTKB 1WTVA 1DJRD 4IFDH 2KENA 4PG3A 4RGTA 2E75C 4OX9Q 1GUTA 3PO2H 1H9KA 2JEAI 2KQ3A 3ND8A 4ULLA 3X3MA 3MA2B 1VQLA 4MTNA 1YNXA 1PH7A 1LYLA 4LFAL 3MWYW 4JI8L 2F0EA 2MUYA 4FXKC 3J80L 3GTOB 4JC0A 3H91A 3MEFA 3VYRA 4KKUA 1FJGQ 4C3HG 3F2UA 2VQFL 1EOTA 2RF4A 2UXDQ 4A93G 5E1FA 4DAPA 3S15H 1I4XA 4DAVA 3PGZA 4U673 2LXJA 4LK1C 1NR2A 4HN7A 1MKHA 1PRTF 1IBLQ 4C2MB 4JCVE 2K7VA 4QMFB 1JT8A 5K5PA 1N8RC 1YVCA 4FF2A 5CGKA 2F0IA 4Y7NB 3HKSA 2UU9Q 4ME3A 1F9PA 1L0WA 3CCJA 4A3FG 1IBKL 4JI3L 5JJLA 3K6OA 1VQHA 3W3AA 2PZUA 3ULLA 1Y8PB 1EIFA 3I4MH 2J4XA 2AKWB 2EYJA 1IZ6A 2SNMA 1YIJA 1AEXA 1QWYA 1CA5A 4A3BB 2SNSA 1OXVA 2CCZA 4A3GG 1N9WA 3UDXA 1JWSD 2NUCA 4FXGC 3D8GA 1I4GA 4KHVA 1KC8C 2KOLA 3S1NH 2CPQA 1ZTGA 3VR5A 5IGDA 4IOAA 2L55A 2CTEA 3NPPA 4GNXC 3SK8A 1GUSA 1LLRD 4N9TA 1NTGA 1M1KC 3TZUA 1H9SA 2FMMA 3M7GA 1IYUA 4QGUA 2WV6D 3P20A 1EQVA 2Z6KC 3OMGA 3C2PA 4X3SA 3N52A 5EAYA 1CZGA 4OONA 4IFDI 4HSPA 2UXCL 1V1PB 2G9HD 1MBYA 1RD9D 1LUZA 5JPMC 1I94L 4JYAL 4K5XA 4LFAQ 3AFQA 4JI8Q 1I3QH 1UE7A 3I4OA 2F1MA 5C4JB 2ID0A 1D1IA 4DK6C 2VQFQ 2WAQG 2MPMA 4A3FH 2NVQB 5KYIA 4DKAC 4YCVA 4A3EG 3HZXA 1QG7A 2R93G 2NVXH 1BDOA 2C9OA 4LJZC 2XIWA 3S14B 3STBD 3VDYA 4HCEA 2L5TA 1MSGA 3MZ5A 1F2YA 1Q8KA 2F3VA 4FF3A 4NBQA 2BA1A 1J5EL 1IBKQ 4IUUA 2EJFC 4JI3Q 3M3YB 3RZDB 1BNZA 3H0GB 4RH6A 3GTLH 1Y69U 2IY5B 3K7AH 2QNDA 4MNOA 3CC2A 1HCZA 5CV7A 3GV3A 5G3LD 5I4DA 1PDQA 4DK1A 4ILWA 1V9PA 3O13A 2C35B 3S1RH 1HFGA 5A2QE 5IT9L 2K05A 3OPOA 1A62A 4JI0L 1LTTD 1SE3A 3CCRA 3J81i 1MJEA 1KD1C 4TQUS 1CQVA 3HOZB 2UUAL 1NR4A 3S1QB 4R8IA 2I5HA 3M4OB 3HP3A 1SYCA 3G7LA 1HPCA 1SRUA 1KLUD 5JPNC 3HOYG 2ZXRA 3SK6A 1PZID 5HGTA 4R4OA 3RZOB 1PH9A 2BL5A 5KRUA 4BY1H 2LS01 1WVNA 5J3BA 4P72A 4DFAA 1TWCB 4B3RL 2D0OA 2EOTA 2SDFA 2ANRA 1KRSA 3DUZA 2ZJPA 1SYBA 2WKDA 2PQUA 1BR9A 3GQBA 1FD7D 2RSNA 2WAQE 2UXCQ 2DUDA 4JVYA 2R61A 5KNCA 1TY2A 1KQSA 1YJWA 4XT1B 1C8CA 3KDFB 1I94Q 4JYAQ 1EEFD 2PO4A 4HMJA 3GTQB 5M3MB 2EXZA 3S17B 2AQ2B 3U9SA 2F0QA 5KNDA 3CU7A 1OXTA 1WFQA 1SMYD 4G57A 1NY4A 4NB3A 4J8QA 3KDFA 4A3KG 4OO1H 2A69D 5GADC 3G6EA 3WDNA 3ONAB 4KKTA 5C4XH 2CQOA 4A3MB 5COYA 3D4RA 3CMAA 2QCPX 4ZKCB 1J5EQ 1JE4A 2K32A 2A6ED 4PZ7A 2JEBI 2B2TA 1FL0A 1SN8A 1KRTA 5IP7H 2PW5A 3NTKA 1K8AC 2R92H 3BZDB 3GTJH 3C1FA 5C3EB 3S2HB 1SR3A 3HOYH 1Q8IA 3BYTB 2J7ZA 3TP8A 1AE2A 3PIO3 3GV6A 4LF8L 1HA6A 4JI0Q 4A3LH 3MTSA 2QILA 3EFXD 3A74A 3OIPA 2JA6G 2UUAQ 2B2UA 4AIMA 4IPCA 1B4OA 2QF7A 4XXEA 1JB7A 3T16A 4DR5L 3PCOB 3TS2A 1LTGD 3NWSA 1ILQA 5BR8L 1WTQA 4A4IA 4X64L 4K0KL 1TS5A 2AUKA 1VQGA 3HS0C 1ZEQX 1PH2A 3VR3A 4B3RQ 2Q8IB 1NUCA 3RR5A 2CWPA 5M5WB 2VB2X 2TMPA 4A3IG 1CUKA 5J22A 3NWTA 5C3XA 1EIYB 4IUNA 3CPWA 2MJ8A 1LACA 1DT4A 2IW3A 3PO2B 2EZVA 2GVAA 3BVGA 3FRPB 1A3TA 1XMQL 1SFOH 5M5YH 1UAPA 1TWGH 3TEHB 1AW7A 4OO1I 5BN5A 4EVOA 2D9UA 5GAGC 4A3CG 3RLNA 4LF4L 2Q2IA 2Y0SG 4IZ8A 4FYDA 4DUZL 1V1OA 4RKBA 2K5QA 1N33L 1GHKA 4RKLA 1I5FA 1E2WA 4HJAA 3J81c 3HOVG 1STBA 1ENCA 4Q0FA 3CC4A 2B2VC 5C0XH 5I2XA 4P2CB 4ID6A 2NN6H 4ZUIA 3KK7A 3DLLA 3HOUB 2HQLA 2HH2A 5IGCA 2FJ2A 2I46A 1FNWA 2AUJD 4A3DH 4LFBL 1VS0A 1C0AA 1X3QA 1Y1VB 1EZ6A 1I6VC 2CWAA 2D2CC 3MXGA 1EY0A 3HOWB 4QMGA 2PCFB 1PFSA 2OCEA 4Z9CB 3T1HL 2YQRA 1JC7A 1TVXA 4LF8Q 1VQCA 1XXGA 2RDGA 2VUMG 2EPBA 2L15A 4BBRH 2KHIA 3A7LA 1GUGA 3NQTA 2JA5H 3FKIH 2D62A 4DR5Q 4IPHA 1KTKA 1W3SA 5J1ZA 1OO9B 5BR8Q 3K0YA 2MJHA 1NAPA 4HJ7A 3VR4A 1WD0A 4X64Q 4BBSH 4K0KQ 1VMPA 1FGUA 4G7HC 5KEEA 2OT2A 1DONA 3ICEA 1J5KA 1S3OA 3K59A 2Z6KA 2EYOA 2R6GA 1BQQT 5EPJA 4A93B 3P75A 1D8LA 1VF5C 1I50H 1PYWD 3IRBA 2FXQA 4K5VA 2B2YC 4OGQC 1A0IA 2FFKB 5LL6S 5C44H 5EKIA 4LNQA 2ENBA 3CKIB 1NSNS 3FDTA 4OIKA 1DOLA 2ANNA 2Y0SE 3OHXC 3PIPA 2NZOA 3E5SA 1PYSB 1G291 1XMQQ 3MXUA 4K8JA 1HZAA 4JVHA 2IWHA 1C4QA 2MFIA 2K28A 3R8BA 1JQYD 4A3FB 3HG9A 3J80i 1E1OA 1N34L 3CQZB 4J15A 2B63G 5C4HA 2XWJB 1R9TH 1QB5D 4LF4Q 2OPUA 1SROA 4DV6L 4GOPC 4GN4B 2XTIA 1XYIA 2DY7A 2XWBB 1WTWA 4DUZQ 1VQ4A 1A2UA 1N33Q 4RAUC 3PF4A 4XQQA 3A8KE 5C0XI 1S5DD 3GTPB 4RCNA 5T1GA 2NN6I 2EYFA 2BH2A 2IT1A 2DY8A 5A35A 1LTBD 2HCIA 4F8MA 4O0AA 4QIWE 2VUMH 5NUCA 4O2DA 2NB0A 2OEOA 2A1AA 2NBFA 3G48A 2HH3A 4A3GB 1ET9A 1S5FD 1CA6A 3CXCA 4LFBQ 4KY5A 4LWCA 2V1CC 3ZJYC 3K7AB 4V0BA 2FMRA 1YHQA 5C6AA 1E2ZA 1RDPD 1V43A 3T1HQ 5IOCA 1TR5A 2KJXA 3GO5A 2PPBC 4BXXG 1EZ8A 5GQOA 3PUVA 4DNTB 2MQHA 3EQLC 3VA5A 1K3RA 3E0JA 3JAMc 3V05A 5FLXL 2WKCA 4IALA 1YI2A 1HR0W 1PXUA 4CKCA 2AMCB 4FDBA 4QF4A 2HQEA 3BZCA 3AQQA 2YTXA 1HNWL 4DV7L 3A55A 4X62L 2N55A 3CF5A 1PH4A 3D31A 2O2LD 1D7QA 3P7JA 2RDFA 1EYDA 2JYOA 1HFNA 2A19A 1SNPA 1WCMH 4HSVA 2QEXA 3D6WA 2WAQB 3CAMA 3F2CA 1X9NA 5IP9G 3KFUA 2PY9A 2AWNA 2CW0C 4A3EB 2R93B 2LKVA 1FNVA 4IFDG 1L1OC 3CD6A 5JEAH 4RGOS 2DNCA 2QGQA 3PO2G 1O80A 4DAYB 1JMCA 3UE1A 3VYUA 2J0TD 4C1NK 1N34Q 1J8IA 1HZCA 5ELNA 5FLMH 1VQAA 3ULPA 1JOOA 1HZBA 2Q8TA 3BYYB 1VQIA 5M3FH 2ES2A 4DV6Q 1Q7YC 3J7YW 4WFN3 1QNUA 1E3PA 4DAYA 4DXGA 1GKHA 1EFWA 5EKKA 2XN9C 4IUVA 4L5RC 2KCCA 1EY7A 1WTXA 1STYA 1BVSA 1IL2A 3KLSX 2YU9H 3H15A 1PLFA 5C4ZA 2JSOA 3QJYA 3TMEA 1HH2P 2AWOA 1I6HB 1MSHA 2A73B 3NHHA 3I4MG 4H7BA 3GTJB 3TRZA 1KHMA 4YIJA 2K4KA 5JVG3 3HOYB 3BDCA 3VR2A 3NUCA 5CV5A 1VQBA 1WYDA 1EY5A 1STAA 1CQFA 5IGGA 2WFWA 1PTOB 1EUJA 1RIPA 3DEOA 1VQ7A 2ICIA 3DM1A 1LTRD 2EYHA 1HNWQ 1BUVT 3KJOA 3Q8DA 4DV7Q 2A6HC 3PMFA 3BU2A 2RHSB 5IIFA 3G71A 4X62Q 3J80c 1IYJB 2ICEC 4FF4A 1HJPA 1VCIA 2XVSA 3U4VA 2E2DC 1HNXL 2OWOA 3SK4A 3K80C 4RCOA 2OXPA 3K57A 1PZKD 3MAQA 4MHEA 4A3KB 1STGA 1WD1A 4POGA 2O4XA 5FO7B 2Q8RE 1EWHA 4GN3B 2EQSA 1OXUA 1W6JA 2EXDA 2FMCA 1A15A 1XX8A 3K5NA 1CKNA 1BCPD 2F0OA 1UWVA 3EA6A 1SBBB 3UDFA 1ENAA 2E2JB 1SEBD 2R7DA 1Y8NB 4KY6A 1X4NA 5IWAL 4WALA 2F3WA 2ZXPA 3M4YA 4K5WA 4YWLA 3S1MH 2JA9A 4DPGA 4LF6L 1KLGD 3NBHB 5A2QL 2B2WC 5M9OA 2H1EA 3CW2C 1YNJD 2E76C 2IJ0A 3BDLA 1IBML 1Z7TA 2C5CA 3ITPA 2PZTA 3D4DA 4BY7H 4CHTB 1EL0A 1KIXA 2B8GA 1H9SB 3QG1A 2JA6B 3NBHA 4QL5A 3M4PA 1PRTD 3W5OA 2HUGA 3A56A 1KL9A 3E9IA 1BF4A 1D6EC 1WE8A 3TP6A 3SR1A 2Z4IA 3BS1A 4FVMA 4NXNL 4JBMA 3BZKA 4DR3L 1CI3M 3RLFA 1BO0A 3KBGA 2IHFA 3T13A 1EU4A 3NXWA 5D3DA 2ZTCA 2I0QA 5GROA 4IUPA 3HEJA 4BBRB 3A8JE 2F0VA 4JI2L 3CCQA 2BE5C 4EQNA 5E7NA 4A3IB 4H0LC 1TWHB 3UDGA 1B44D 5CV8A 1A2TA 3GTMB 1SYFA 4BY1G 2F0MA 1B9MA 4NW2A 1HNXQ 1CHQD 1F9QA 4Y52H 1AZPA 2K5DA 2CTLA 4K8IA 1Y14B 2H5XA 3F8TA 2Y0SB 1UE1A 3K5MA 5T1IA 5JOBA 3PUXA 3HOVB 1VQPA 1V8QA 4NKLA 1I4RA 1VMCA 4R4QA 2VL6A 4DR4L 5LMUL 4WJ4A 3S16B 4C3JH 1L0XB 3NTIA 2KBNA 2EJGC 5IWAQ 4ZUJA 1MJCA 3ZYYX 4OO1G 4DGZA 4GOPA 4LF6Q 1PH6A 4QIWB 2E2HB 5IT9c 1KABA 2QKIC 4J6HA 2A68C 4ALPA 4LF7L 1VQFA 2JA8H 5C4XG 4GLVB 3CHBD 4JOIC 3AYHB 2N3SA 1MGSA 3QB3A 3TN2A 1IBMQ 4GLXA 3G6JB 4KN7C 2VUMB 1BCPB 1F2MA 1LTLA 1CSPA 2KCTA 2NVYB 2WB1G 1H95A 4PV1C 1JCKB 2CVRA 3AB9A 5IP7G 5DNFA 5JJKA 4EX5A 1WTOA 1YNNC 4RFBA 2R92G 1E7ZA 1Q86C 2JP1A 3MHBA 3I55A 4NXNQ 3J7ZC 4KK7A 4DR3Q 2N49A 3PO3H 2UXBL 4K2LA 4S3SA 1H9JA 3KLSA 2ZTEA 5M5XH 2M2LA 4DV0L 4A3LG 4XYOA 3X3NA 5I9PA 2F0PA 3H6MA 2CKZB 4BA2I 1QZGA 1HNZL 4B9XA 1JWUD 4DR7L 5D65A 4JI2Q 4HAEA 3EVQA 1KDCA 1DXMA 3MFGA 3DEPA 4WJ3M 2L9HA 3GD7A 2VS1A 1ICWA 1YBYA 2FINB 4HJ9A 4IPGA 2VXWA 2KCMA 2F0FA 2NVTH 1X3GA 1VIHA 4LIJA 3FPUB 1EY9A 4X3TA 3I90A 4IFDJ 2NWGA 1RTOA 2B63B 2VW9A 3RN2A 4ZKBB 2KECA 1CM9A 1L1OA 1NJIC 1HRJA 4WANA 2EDGA 3DWQA 2E2IH 1HZ9A 4J1MA 4X3KA 2JJQA 1A3UA 1J6QA 4GN5A 3W2DA 4KD3A 4DV5L 1EQTA 4DR4Q 5LMUQ 3QOLA 2UUCL 4KI0A 2X69A 2VY3A 1ESRA 4DV4L 5LMNW 1J9OA 2N8NA 2GVBA 1NBWA 2WB1E 2JA7H 4Q5VA 4LF7Q 1VQ9A 2BE5D 5D3IB 3K81C 3OOCA 1HHVA 5C0XG 2PQEA 3RD4A 3A5UA 3Q23A 2PMZB 2NN6G 3CRLC 4P75A 4PNYA 2YU9B 3BDOA 1UNSA 3C1EA 4APVA 1GXDC 1C7YA 1LM0A 3HKZG 4H02A 4A3DG 1SDFA 2R7FA 1ML0D 3J7A5 1LT3D 2L0CA 3IFTA 1EIHA 5DEHA 3K58A 1JJGA 2XRSD 4RHSA 4M8AA 3PV0A 5I9OA 2UXBQ 1EYAA 2BH8A 3S2DH 4CJ1B 2K5HA 1SE2A 5IYDH 1IW7C 1CT1D 1HXYD 4DV0Q 5D14A 2F4VL 4X3UA 1HNZQ 4BBRG 1CK1A 4DR7Q 4HJ8A 2EJMA 4L5QA 4WORA 5HY6A 2JA5G 3FKIG 4MIUA 3GTKH 1SYEA 2DGRA 1JJ2A 4KKSA 3SE0A 4DR2L 4POFA 4BBSG 2QEJC 5EBDA 3KF6A 4I7ZC 3GTOH 3I4NG 2RKSA 3HFZB 3GP7A 1BBXC 5C5LA 2HDMA 5I2YA 1FGBD 2F0JA 4KHZA 3KF8A 3RLOA 3LGJA 1S72A 3S15B 2B29A 3F2DA 2RQXA 5DAUA 3TREA 2VQEL 3FPPA 1TWFH 4C2MH 3A8IE 5C44G 1YJNA 4PZ8A 4Y7NH 2M00A 4RG1A 4DV5Q 4OWXB 1QVCA 2K5NA 4DNIA 2UUCQ 3MXPA 1RF2D 2YTVA 4DV4Q 1BKBA 3Q24A 3NP8A 1XPOA 1ZYRC 3I4MB 2D5DA 5ELEA 2PQAA 4XYQA 1G2SA 2Q2TA 2CQAA 1VIGA 2LY7A 2QDBA 4GNXB 2RHQB 1TT2A 1EY4A 4ZAIA 4FNFA 2FHTA 4AYBG 3Q6SA 2HCCA 2IX1A 4FXDA 3HOXH 3FVQA 2L12A 3S1NB 1X56A 2O5JC 2ALYB 1N32L 4GNXA 1ZZJA 1JJCB 1GM5A 1GJXA 1KNAA 2EE1A 4NP5A 4TVAB 3DWAA 1HQRD 1T5XD 3I4NH 1FVIA