2JEBI

Structure of a 9-subunit archaeal exosome bound to mn ions
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
214
structure length
197
Chain Sequence
KIVLQPRSIVVPGELLAEGEFQIPWSPYILKINSKYYSTVVGLFDVKDTQFEVIPLEGSFYYPKINDIVIGLVEDVEIYGWVVDIKAPYKAYLPASNLLGRSINVGEDLRRYLDVGDYVIARIENFDDPVLSVKGKDLGRVSNGIVIDIMPVKVPRVIGKNKSMYETLTSKFVANNGRIWAILIEAIRKIENESHIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EXOSOME COMPLEX EXONUCLEASE 2
publication title RNA Channelling by the Archaeal Exosome.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Hydrolase
total genus 40
structure length 197
sequence length 214
ec nomenclature
pdb deposition date 2007-01-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2jebI01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2jebI02
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 2jebI03
5IWAL 2YU9H 5LMNL 1I5FA 3STBD 3ULJA 2DUDA 2JEBI 1E3PA 1A6XA 3CRKC 1CKNB 4A75A 4LF7Q 1GVPA 3KF8B 2HT1A 2UXBQ 3CCQA 2K7VA 3K0XA 4UP7A 3SGIA 4MTNA 1D8LA 1IBKL 4YHHL 1PH3A 3I7FA 1YHQA 1MJEA 1U5KA 2A6ED 3I72A 2QA4A 4AQYQ 2JVZA 1RIPA 1C7YA 4DUYL 2XTIA 3I2ZA 3L0OA 2NVTH 3I4NG 1LACA 1PH5A 2UUAL 4C3IH 4GNXA 3PUVA 3GTOH 1PVOA 2CWPA 2WB1G 3CC7A 4JOIA 4TKOB 3G48A 1GUOA 1Y1WH 3HOVH 1A8VA 4OGQC 5FLXc 4GKJQ 3UE1A 4LFAL 1T9HA 5FJ8G 3G6EA 2EDGA 1HNZQ 1VIGA 4JK1C 1X3EA 3JAMi 1WYDA 1SROA 4JI5Q 3DLLA 2I5HA 5IE8A 1V1QA 4JI6L 1J4WA 4UPAA 4IFDJ 3OOCA 4GKKL 4AM3A 1R9TH 2DNCA 3P20A 3S1NH 4A3BG 4DK1A 3JAMc 3CCEA 4HIOA 1CSPA 2QEXA 1VQ6A 3M85A 1M1KC 2HHHQ 4LFBL 1HNXL 3HOUG 1S3OA 3AB9A 4NXNQ 2FMRA 3FPPA 1PYSB 4BBRH 3HOWH 1VQKA 3M3YH 1VQBA 1VQIA 1W3SA 2P2RA 3CF5A 2YYZA 2E8GA 3J81c 4JI3L 2OQKA 1K8AC 4LF6L 3LNNA 3CMEA 4ME3A 1SN8A 1YEZA 4JI4Q 4HJ5A 1SMXA 1DCZA 4QGUA 2A69D 5GQOA 1DGSA 2MQHA 4B3MQ 4PZ6A 4YY3Q 1A0IA 2F3IA 3M4QA 2ALYB 3KF6A 3ND8A 2OTJA 4QIWE 2DGYA 2K75A 5GAHC 4EQ5A 2QF7A 2OQ0A 4OO1I 2AKWB 4A3GH 2GN5A 3HGBA 1WE8A 4KKUA 3K8AA 4H02A 1OXSC 2E3UA 4P73A 1X3GA 3H3VI 3L7ZC 4L8JA 4X66Q 1CI3M 4A3IG 2ZT9C 4B3RL 3AFQA 1J5EL 5IYBG 1I6VC 5M5XH 1DXMA 4DNTB 4LW1A 2EQSA 3EBEA 4R4QA 5IP9G 4OWWB 3HOYH 1Y1WG 3HOVG 4IJHA 3CC2A 2BE5C 3DM3A 4R1JA 4DAMA 3PO3G 2EIFA 1ZKOA 4QL5A 4H44C 1X6OA 5IYCH 3CD6A 5DLQE 4A3MG 1AE2A 5ELOA 4O0AA 5GAEC 3ULPA 1EOVA 1LABA 3Q8DA 1Z7TA 3VR2A 2A8VA 1N8RC 2HH3A 2AUKA 1FGUA 2VQEQ 3MEFA 1XNQQ 1KQSA 3RNUA 5JEAG 3CQZH 4X65L 3CAMA 2RF4A 3UDFA 1H9SA 4BBRG 4A3LG 4JVHA 4HJ8A 3TS2A 3M9BA 1Q82C 4HJ7A 4A3CG 5BR8Q 4DR2L 1IBLL 1VQ8A 4AIMA 4GOPA 1KHMA 1LUZA 2ZJRA 4JV5Q 3U50C 2R92H 2A68C 1GD7A 2BA1A 2I0QA 2K5VA 3RN5A 4DR5L 2GVBA 4DR3Q 4GN5A 4B8TA 2JZXA 3OTOL 1XMQQ 2UU9L 1I50H 2VQFL 4JI8Q 4WALA 2E5LQ 1OXTA 3OYYA 2CTJA 4DR6L 3J7A5 1Q1BA 4DKAC 3U4ZA 2NN6H 4GN4B 3E9HA 1QVCA 4X64Q 4JI1Q 3L2PA 2JA7G 1QVGA 4BA1I 3VR6A 2KCMA 4PZ7A 4KHPL 1FJGQ 1ASZA 3FKIG 3GQBA 4YWLA 3HOYG 1A62A 4DR4Q 1I94L 4QQBX 1X56A 4KN7C 4KKTA 2LXKA 4HIKA 1Q8KA 1E2VA 1XPUA 3KFUA 2EVBA 1WJJA 1EWIA 2E2HH 3KYHC 3DXJC 5IYCG 1NY4A 3RLNA 1SFOH 2R93H 1MKHA 1VQGA 1JMCA 3F2CA 3I56A 1BBWA 1X55A 4DV0Q 4K0KQ 3FMCA 2V1CC 1HZBA 4JVYA 3EN2A 2IX0A 1E2ZA 3IFTA 1H9SB 3KLWA 1VQCA 1KRSA 4LF4L 5IP7H 2ZJPA 2F4VQ 1PH6A 4HJ9A 3T53B 1ZZKA 1VQNA 1HNWQ 4BBSG 3NELA 4DR1Q 1H9KA 3HOXH 2V4DA 1NE3A 2LSSA 3S17H 2UXDQ 1K3RA 1CSQA 4JI2L 4OO1H 3S16H 4LF8Q 3CW2C 2CTLA 2FXQA 5C0XH 2IHEA 5LMNQ 2CTEA 1PH4A 4JBMA 4GNXC 3PIOA 1PV4A 1L1OA 4IO9A 4JOIC 5E7NA 3GTMH 4DUZL 5FLMG 1Q12A 1IBKQ 1X4NA 4YHHQ 5BN5A 2JA5G 3H0GH 3ULLA 4IPHA 1UE5A 4JC0A 4DUYQ 1NBWA 3AEVB 5JEAJ 1VQHA 3F8TA 3KDFA 1N32L 2UUAQ 2B3GA 3G71A 4IOCA 4L5SA 2IX1A 2JA8H 4BXXH 2YQRA 2A68D 4DV2L 3LGJA 3M7NA 4GLAC 1KXLA 1J6QA 3J80i 4DV4L 1XPRA 4A3EG 4DNIA 4BY1H 2E76C 2UUBL 1IYUA 3I4MG 1H9MA 4LF5L 2N78A 1A63A 1AE3A 3VDYA 4C3HH 4DV5L 3S1QH 2MJHA 3CRLC 4DV6L 2CWAA 3RZDH 1YNJC 3MFYA 4JI6Q 1I3QH 4A3FH 1TWFH 3GDEA 4A3KG 1VQ5A 3PUYA 2R93G 3CP0A 5C4XH 4AYBE 1CTMA 2MO0A 4BY7G 4LK1C 1EYGA 2A6HC 1HZAA 1XJVA 1Y69U 4LFBQ 1HNXQ 1JT8A 2KBNA 3GTKH 1SLJA 2E75C 1PYBA 4A3DH 2VUMH 3M4YA 2B63H 1SMYC 3AQQA 3OPOA 1C9OA 2XGTA 5M3FG 4P74A 2VY3A 2L5TA 4XTCS 3NENA 4LF6Q 3J81j 4OO1G 3PCOB 1V9PA 1JJ2A 2OTLA 4H13C 2PNRC 1FVIA 1WFQA 4DV7L 5M5WH 2UXCL 1IW7C 2ZM6L 2QGQA 4P71A 5C3EH 2Q2UA 1GUGA 2ID0A 3ERSX 4DV1L 1ZZIA 2NN6I 3K7AH 3PO2G 4G7ZC 4DV3Q 4L5QA 3A7AB 1HTPA 1V8QA 4B3TL 3D0FA 2Q2HA 1Y14B 1B70B 4TVAB 3KJPA 2NVXH 3WWVA 2CFMA 1IYVA 1JB7A 4PZ8A 3HOZG 1B9NA 1TKWB 1N36L 4LWCA 2R7ZG 1X3FA 3W1BA 1J5EQ 3J81i 1PH7A 3CCUA 1BVSA 3PUXA 4GZYC 1HPCA 3ICEA 1DTJA 5HY6A 3A8IE 4OXPA 2D62A 4X62L 1D7QA 3PIPA 3G4SA 1YI2A 1UE1A 1J5KA 1IL2A 1E7ZA 3K81C 1EC6A 2PNHA 5IYDH 1UEBA 4O2DA 5C44G 2PQAA 4AQYL 4A3FG 3B6YA 4DR7L 2N49A 2ANNA 4GOPC 4NBQA 1ZZJA 3GTJH 1TXYA 5BN3A 1GM5A 3N6RA 2Q2TA 1ZTGA 2ES2A 4I7ZC 1VQAA 4X65Q 1VQFA 3PF4A 1VQDA 4A3DG 5C0XI 4JI0L 2B63G 3I55A 4WJ4A 5GADC 4POGA 1HJPA 1DD2A 4DR2Q 4WANA 4X6AH 1IBLQ 2D2CC 3D4RA 1K83H 2K5HA 4GNXB 2L15A 1O78A 1G6PA 2WP8J 2R6GA 4JI5L 2GVAA 3I4LA 4TQUS 5LMNW 2LXJA 2K52A 1VQEA 1FL0A 4B3SL 1E1OA 4DR5Q 3M4OH 2A6HD 3S1MH 5KNDA 1VCIA 3RLFA 2UU9Q 1HR0W 2VQFQ 5BN4A 2HHHL 4LUZA 1Z6HA 4OX9L 2Z6KC 3GTGH 2JXMB 2HIXA 1N33L 3K80C 5C4JH 4OWXB 1HZCA 2BA0A 3OW2A 2DGRA 3F2DA 1YJNA 1HQMC 4APVA 1IW7D 1IXRA 4KHPQ 4LFCL 1VQJA 4B3ML 3S15H 2JA6H 3QIAA 3HOWG 1B7YB 2MNAA 1I94Q 4YCVA 1T5EA 1OXXK 4JYAL 2NVQH 5C0XJ 2K32A 2IHFA 1VQMA 1S72A 4IPCA 3W1GA 1WCMH 2PI2E 2BL5A 1QUQA 3NEMA 2ZTEA 4KLKA 2VNUD 1YVCA 2NZOA 1KD1C 1GHJA 3ZJYC 3KF6B 3EQLC 4X66L 4WJ3M 3AFPA 1Y1VH 1K8GA 4L5TA 2Y0SE 3HKZE 4BA2I 1CUKA 2KHIA 4GLVB 2KHJA 4AYBG 1XMOL 2ZTCA 2CCZA 4LF4Q 1TWCH 4A3GG 3HKSA 2D0PA 4HIDA 1KL9A 1YHAA 2MFIA 4C3JH 5GAGC 1PH2A 2AUJD 1IYJB 1VIHA 1WOCA 4JI2Q 1X65A 2H5XA 5K36H 2VS1A 3A5ZB 4UP8A 4YWKA 4DPGA 4A93H 1TWAH 4NXML 1Q86C 1B8AA 1UE7A 2VQEL 1WVNA 1CKOA 5GROA 2CKZB 1IBMQ 1XNRQ 4A3JH 2Q8IB 3VKEA 1KIXA 3NE5B 2AXYA 2YTXA 1UWVA 3U9SA 1N32Q 4HR7B 5EAYA 3T56B 4P75A 1ZYRC 1QVFA 5M3MH 4DV2Q 4JV5L 4DV4Q 3GTLH 1PMRA 4NB3A 3ER0A 1RL2A 4IOAA 2JA6G 4QY7A 1VS0A 2Q2IA 1CKNA 1VQLA 4DV5Q 4H0LC 4GOPB 4DV6Q 3WDNA 1Q46A 5IWAQ 2E5LL 1XPOA 1HCZA 3UDXA 4IPGA 1IZ6A 2JA9A 5AJ3L 3CCJA 3I4NH 2R92G 1EIYB 1OTCA 2VL6A 5J3BA 1G51A 4JI7L 2JE6I 4POFA 1Y1VG 1EQRA 1E1TA 1JE5A 3KJOA 5JJLA 3E9IA 5JJKA 1GO3E 1NJIC 3J7ZC 1FJGL 2A19A 3BDOA 3FHWA 5KNCA 1H9RA 2E74C 5FJ8H 2R7DA 3MXNB 3PGZA 3U1KA 1XTDA 2NN6G 3H94A 4LIJA 1C0AA 3T1YL 3H15A 3A8KE 1S40A 3TQYA 1KAWA 2BDOA 3VR3A 2UXCQ 2ZM6Q 4KKSA 4A3BH 1TUAA 3S2HH 4DV1Q 4LFAQ 2WAQE 4K0KL 3E0EA 3VA7A 3HOUH 3BZKA 4R4OA 4MZ9A 5A35A 3CCMA 1YJWA 1PHJA 3GTPH 1X54A 5LMUL 4A3JG 3PF5A 1E2WA 2JJQA 3VR4A 4GKKQ 3KOJA 1HNWL 3NBHB 1SRUA 2UXDL 1N36Q 3PV0A 3KLRA 2CTMA 5M3MG 3T1HL 2QNDA 4LUOA 3S2DH 1W2BA 5IP7G 4KMUC 2PQUA 2MO1A 2A1AA 4X62Q 4C2MH 4JI3Q 1HR0L 1BBUA 1QZGA 3HOXG 4PV1C 1TWHH 1CFMA 3TREA 1K1GA 3I73A 2ASBA 3RN2A 3CPWA 4RG1A 2I5LX 5C0XG 4DR7Q 5JJIA 3PUWA 1N34L 1L1OB 4A3IH 4NPSA 2ANRA 4LF9L 2LMCB 4HJAA 1GJXA 2IY5B 1KC8C 5IYBH 1GUNA 1YITA 1PFSA 2CQOA 2YV5A 5IT9c 2EJGC 3UDGA 5IP9H 2ZTDA 3H0GG 2CTFA 1X4MA 2B8FA 4JI0Q 4JBWA 3PO3H 2Y0SG 3HKZG 3KDFB 3A0JA 2NVYH 2YTYA 4B3RQ 1OXUA 3GO5A 3CPFA 2UUCL 2JA8G 4A3MH 1VQPA 5KNBA 1EIFA 3HFZB 4BXXG 4UY8C 4B3SQ 1EFWA 1KHIA 1VQ7A 1OXVA 2HIVA 3QJYA 2E2JH 2JEAI 4BY1G 4LF7L 2D5DA 2K14A 3M4PA 5HGQA 3D31A 2UXBL 2KA7A 1FYCA 5JEAH 2AWNA 2OPVA 1GUTA 4OX9Q 1EWHA 1N33Q 4DK0A 4A3LH 1Q7YC 4A3CH 4YCUA 3CCSA 3RR5A 3TEHB 5C4XG 1EQQA 1AH9A 1P16A 2EJMA 2DNEA 1BDOA 3GTQH 2YTVA 4LFCQ 2IT1A 1GKHA 4GLXA 4Y7NH 2DN8A 2PI2A 2ATWA 2B29A 3TS0A 2VUMG 1GUSA 2B8GA 2PCFB 1Y8OB 4G7OC 1E24A 4JYAQ 1YNXA 4GKJL 1K9MC 4GN3B 1HNZL 1TWGH 4DV3L 2KCTA 2RCNA 2PMZE 1Q1EA 2F1MA 1LTLA 4YWMA 4KN4C 2AMCB 3BZCA 4A76A 3RZOH 4KHZA 1E22A 1HH2P 5C3EG 4DNRB 3BU2A 2JA7H 1LYLA 5H1SE 3IRBA 4AH6A 2BH8A 3OTOQ 3K7UC 3UE0A 1XMOQ 3EIVA 3FKIH 1ONLA 2HH2A 4NXNL 1L0WA 1YZ6A 4MNOA 1O7IA 3TZUA 2EJFC 3T51B 4DR6Q 4JG2A 1JJCB 4FDBA 2K33A 3BG3A 4R4IA 4JI4L 4Y52H 2PY9A 4JBJA 3IKJA 1UE6A 4R4TA 4RCNA 4DAYB 1H95A 2K50A 2I5MX 2NZHA 1YJ9A 4YY3L 2O5JC 4L5RC 3A8JE 4IFDH 1O7LA 2PPBC 4NXMQ 3S24A 3PUZA 3W5OA 1U0LA 2PQAB 3F1ZA 1SR3A 2WAQG 4PG3A 5IYDG 3I4OA 1LM0A 4BBSH 2WB1E 3QG1A 2K4KA 2KENA 1DT4A 3PSIA 3ND9A 1H9JA 4DK6C 1X9NA 3A5UA 3U4VA 1NMFA 4R4CA 1YNNC 4KI0A 2BH2A 2N8NA 1M90C 1L1OC 3RLOA 1Q90A 1GHKA 2RHSB 5FLMH 4RMFA 2JA5H 2ZJQA 1QZHA 5IY0A 1V43A 3UDIA 4LNQA 3SDZA 3A7LA 3JC66 4HIMA 1VF7A 1Y8PB 2WFWA 4XIGS 5AJ3Q 4JCVE 2CTKA 1Q81C 4J15A 3STBC 3AEVA 1CKMA 4JI7Q 1B9MA 2JK8A 4DUZQ 1K8MA 1XNQL 3SE0A 1YBYA 4A3EH 1FR3A 2D0OA 1BKBA 1MJCA 2A6EC 2OCEA 3FP9A 1K73C 3LWUA 1QJOA 3I4MH 3GD7A 2Z6KA 2E2IH 5BR8L 2HQLA 1VDZA 1WI5A 5M5YH 4JBKA 3TRZA 3S14H 3T1YQ 1K0RA 4A4IA 1L2FA 4A3KH 1PA6A 4BY7H 4OONA 2UUBQ 2EXDA 2AHOB 2JQOA 3CXCA 3CCLA 4DR3L 4LF5Q 2KCCA 4IFDG 1XMQL 1ASYA 1PH1A 3CCVA 1QUQB 1NMGA 2BE5D 5LMUQ 3BJUA 4JI8L 4G7HC 1WCMG 4ALPA 5M3FH 2Z0SA 4IQZA 2RHQB 3S1RH 3OW7A 3CMAA 3U58A 4QMFB 4X64L 1Y8NB 1VQOA 4JI1L 2K5NA 4EX5A 4P72A 5ELNA 2OPUA 2VW9A 3A74A 3T1HQ 1VF5C 1NTGA 1VQ9A 3H3VH 1Z47A 1K8OA 1YIJA 4LUVA 1G291 4DR4L 3CCRA 3PO2H 2F52A 1PH9A 1HR0Q 1TU2B 1JJGA 1IBML 1XNRL 3CC4A 5K36G 1YHBA 3MXUA 4DV7Q 3W3AA 2A69C 2CW0C 1N34Q 3HOZH 1N9WA 2N3SA 4LF9Q 2AWOA 1P8LA 2R7ZH 1Z9FA 1HZ9A 2C35B 4YCWA 4QJFA 1KRTA 2O5IC 1SE8A 1EUJA 4A93G 1PH8A 4DV0L 4LJZC 4OWTB 1VQ4A 3VR5A 2CPQA 4IPDA 3AYHB 4PMWA 3V69A 4UP9A 2OWOA 3F2BA 2F4VL 4B3TQ 4DK3C 1I6HH 4IJLA 2VZAA 4GS3A 4DR1L 1MIUA 3J80c 2R7FA 2UUCQ 4IFDI 5C44H 4LF8L
chains in the Genus database with same CATH superfamily
2CQAA 4FO2A 5IWAL 2YU9H 2J7ZA 4K0KH 2G9HD 2K5WA 5LMNL 1I5FA 3OSOA 3STBD 3ULJA 2J0TD 4K8IA 1JC7A 2DUDA 2JEBI 4AYBB 1E3PA 5HURA 1CA5A 1A6XA 3CRKC 5LMUH 1CKNB 4A75A 4LF7Q 1GVPA 2K03A 3KF8B 3NTHA 5IGDA 2HT1A 2UXBQ 3CCQA 2K7VA 3MHBA 3K0XA 4UP7A 3SGIA 4MTNA 1HNWH 1D8LA 1IBKL 4YHHL 4OIKA 1PH3A 3I7FA 3GR5A 1YHQA 1MJEA 1U5KA 2A6ED 3I72A 2H1EA 3KDGA 2QA4A 5IT9L 4AQYQ 2JVZA 1RIPA 1K83B 1C7YA 4FP5D 4WRDA 2KCNA 3RMHA 2B2UC 4BWGB 4DUYL 1HRJA 2XTIA 1QB5D 4Q5VA 3I2ZA 3L0OA 3NXWA 2NVTH 3I4NG 4PMBA 3NCVA 4IALA 3T1HH 1LACA 5CGKA 1PH5A 1PTOH 4OEMB 4UHVA 2F0MA 2RBMA 2UUAL 2F0VA 1STAA 3K5MA 4C3IH 4GNXA 3PUVA 3GTOH 1PVOA 2FINB 4FJUA 4PDBA 1D6EC 1SJHD 2CWPA 2WB1G 1GOZA 2B2YC 3M4OB 3CC7A 5J39A 3S1MB 4JOIA 4UAIA 4TKOB 4EVOA 1HR0H 1EEID 3G48A 1GUOA 2K5DA 4C56C 1Y1WH 3HOVH 4G4KA 1A8VA 2EYHA 1V1OA 2F0QA 4OGQC 1EY5A 5FLXc 4HEDA 1TS3A 4CKEA 3UE1A 4GKJQ 4RGNA 1T9HA 4LFAL 4N9TA 5FJ8G 3G6EA 2CVRA 2EDGA 1HNZQ 1SSOA 4NMZA 1VIGA 1N34H 4JK1C 3R3OA 1X3EA 3JAMi 1WYDA 4LF9H 1SROA 4JI5Q 1DJRD 3DLLA 2I5HA 5IE8A 1V1QA 4JI6L 2Z4IA 1F77A 4UPAA 5CORA 3OOCA 4IFDJ 1J4WA 2F3VA 4GKKL 3TN2A 3QO2A 5IGFA 4AM3A 1R9TH 4X3KA 2DNCA 3P20A 3S1NH 4A3BG 4KD4A 4DK1A 1X3QA 4HAEA 3JAMc 3CCEA 2QCPX 1BCPF 5JAVA 4HIOA 1CSPA 2QEXA 4B8CD 1NR4A 2Q8RE 1VQ6A 3S15B 4N8FA 1HA6A 2N55A 3M85A 4FF4A 1M1KC 4FXDA 2HHHQ 4LFBL 1HNXL 2JA6B 3HOUG 1S3OA 3AB9A 2H4OA 4NXNQ 2FMRA 3FPPA 2XRQD 4RKLA 2RCFA 5F2DA 1PYSB 1UUPA 4BBRH 3HOWH 2XNAC 2NVQB 3OETA 1VQKA 3M3YH 1VQBA 1VQIA 2B2WA 2UUCH 1W3SA 2MGSA 2LRRA 2P2RA 3CF5A 2YYZA 2E8GA 1JCKB 1VMCA 3J81c 4JI3L 4MTKA 2OQKA 5A2QE 1K8AC 4P2CB 4LF6L 4X3SA 3LNNA 3CMEA 4ME3A 1SN8A 1X32A 1YEZA 4JI4Q 4ME5A 2BCOA 4HJ5A 1SMXA 2R92B 5EPKA 1DCZA 1SE3A 3OIPA 4LF7H 4QGUA 4FF3A 3J80W 2A69D 2CW0D 5GQOA 2UXBH 4FXKC 1S5BD 1DGSA 2MQHA 4B3MQ 1BCPD 4B9XA 1Y1VB 4NP5A 4PZ6A 1CHQD 1MBYA 1PFNA 4YY3Q 1A0IA 2F3IA 2KUMA 2ALYB 3M4QA 1BF4A 3MWYW 3KF6A 3ND8A 3NK9A 2Z1CA 2OTJA 4QIWE 1TWCB 2DGYA 2K75A 3EFXD 4EQ5A 5GAHC 1F9RA 2OQ0A 2QF7A 2X6LA 2EYPA 4OO1I 2AKWB 4QB4A 1KDAA 4A3GH 2GN5A 3HGBA 1LV9A 4KKUA 1WE8A 1D5XC 3K8AA 4J6HA 4H02A 2FJ2A 2L9HA 2JP1A 1IKMA 2PO4A 2K04A 1OXSC 2E3UA 4CKCA 4P73A 1X3GA 1QWYA 3H3VI 3L7ZC 4L8JA 3SK8A 4X66Q 1XX8A 1CI3M 4A3IG 3WOFA 2HDMA 2ZT9C 1NSNS 4B3RL 3AFQA 1J8IA 1MD2D 1J5EL 3LX0A 5IYBG 4GKJH 5JOBA 1CQVA 1I6VC 5M5XH 1DXMA 4DNTB 4LW1A 1HNZH 2EQSA 2AQ2B 1X9ZA 5CC4A 3EBEA 1HUNA 3P7JA 4R4QA 3ZYYX 5IP9G 4OWWB 3HOYH 1Y1WG 3HOVG 4IJHA 3CC2A 2J4XA 4KY7A 3Q22A 3P75A 2BE5C 2CHBD 3DM3A 4CJ1B 4R1JA 1WD0A 4DAMA 2XVSA 3PO3G 2EIFA 2E2HB 1NUCA 4A3JB 2A1SA 1ZKOA 4QL5A 4XXEA 1SFOB 1EY7A 4FNFA 5FLXW 1C48A 1LTID 4H44C 1X6OA 5IYCH 3CD6A 3BVZA 1SXTA 1A3TA 2EYJA 5DLQE 3SK5A 3FEWX 3CKIB 4A3MG 1AE2A 1JOKA 2K1BA 2MPMA 5ELEA 5JPNC 5ELOA 1O80A 4O0AA 5GAEC 3OWFA 1M8AA 4MN3A 3ULPA 1EOVA 2IJ0A 4G57A 3T13A 1LABA 3Q8DA 5M3MB 4NXNH 2M6QA 2K05A 2EPBA 1UAPA 1Z7TA 4CGYB 3VR2A 5CV6A 3GTLB 2A8VA 4IUQA 1N8RC 4KY6A 4DFAA 2HH3A 2AUKA 1FGUA 2VQEQ 3MEFA 1XNQQ 2EY6A 3JAMW 1KQSA 2PZTA 3RNUA 5JEAG 4B08A 4K2LA 3TBIB 1CZWA 3CQZH 4X65L 3CAMA 2RF4A 1I4HA 3UDFA 1H9SA 4HSPA 2QDLA 5D3DA 4BS9A 4BBRG 4JI4H 2XWBB 3E6ZX 3HOXB 4A3LG 2ICIA 4JVHA 4HJ8A 3TS2A 1SE4A 3M9BA 1Q82C 4HJ7A 2VXWA 3J7AF 4A3CG 5EPJA 5BR8Q 4DR2L 3S16B 1IBLL 1RKNA 3NUCA 5C4ZA 1ZEQX 2ZXPA 1VQ8A 5NUCA 3J81W 4AIMA 4GOPA 4YY3H 1KHMA 5T1IA 1LUZA 2ZJRA 1BO0A 2GA4B 4JV5Q 1A3VA 3U50C 1K28A 3A55A 2R92H 2A68C 1GD7A 2OT2A 1S5FD 2BA1A 2K5VA 2I0QA 3GTMB 3GKUA 2I46A 3RN5A 3OIQA 3VYRA 4DR5L 2WV6D 2GVBA 2KEEA 1V1PB 2OF1A 4DR3Q 4GN5A 2F0TA 2JZXA 4B8TA 3H0GB 1CZGA 1FNUA 3OTOL 1HA5A 1XMQQ 2UU9L 2K28A 4MIUA 4IURA 1Z2IA 1I50H 3R8BA 2VQFL 1BOSA 3HKZB 4FF1A 2JSOA 2LKVA 3MVVA 4JI8Q 4WALA 1CT1D 2L1BA 2E5LQ 1OXTA 5DNFA 1ESFA 5I6WA 3PQIA 3OYYA 2CTJA 4DR6L 4K6DA 3J7A5 1Q1BA 4NZRM 1XYIA 4DKAC 2JA8B 3U4ZA 2NN6H 4F8MA 4GN4B 3E9HA 1QVCA 4X64Q 1ZXTA 4RHRA 3MXNA 4JI1Q 3L2PA 4XDXA 1STGA 2B2VC 1B1ZA 2JA7G 1KLUD 5I2YA 1QVGA 4BA1I 4OIJA 4K5XA 3VR6A 2KCMA 2K6AA 1SNQA 4PZ7A 4RKBA 3K57A 2HCCA 5FO8B 4BY1B 3CHBD 4KHPL 2LF0A 1FJGQ 1ASZA 3FKIG 3GQBA 2WIIB 4YWLA 2LY7A 3HOYG 1A62A 3R2IA 4C3HB 4DR4Q 1BQQT 3S1QB 1I94L 2F0HA 4QQBX 1G91A 3FVQA 1X56A 4KN7C 2LXKA 4KKTA 5KYIA 4HIKA 1Q8KA 3GTPB 1E2VA 1LO5D 3RZDB 1XPUA 3KFUA 2EVBA 3L3OC 3Q24A 1WJJA 2KEDA 1EWIA 2E2HH 3KYHC 4KJOA 4NZTM 3DXJC 4RWSC 5IYCG 1NY4A 5C4XB 3RLNA 1SFOH 2Z8LA 1X3PA 2R93H 1MKHA 1VQGA 2KVMA 1TIID 3BZDB 4LAAA 1XNQH 1JMCA 3F2CA 2R3ZA 1MGSA 5TSSA 5C4HA 1SEIA 3I56A 3K5NA 1WTWA 1ML0D 2FMCA 1BBWA 3NBHA 1X55A 2EY5A 3GTKB 1F9SA 4DV0Q 4K0KQ 1LTTD 3FMCA 2V1CC 1HZBA 3MXGA 4M1UB 3H6MA 4XT3B 3EN2A 2IX0A 4JVYA 1E2ZA 3IFTA 1H9SB 1U4MA 3KLWA 5BR8H 1VQCA 1KRSA 4LF4L 5CR3A 1JWMD 4XYOA 3V96A 2WKCA 1HUMA 5IP7H 2ZJPA 2F4VQ 1LT5D 1BBXC 1PH6A 4HJ9A 3T53B 1ZZKA 3DWQA 1VQNA 1KLGD 1HNWQ 4BBSG 3NELA 4DR1Q 1H9KA 3HOXH 2V4DA 1NE3A 2LSSA 2WINB 3S17H 3WOEA 2UXDQ 1K3RA 4Z9CB 1CSQA 3RUZA 4JI2L 4OO1H 1JOQA 3S16H 4LF8Q 5M5WB 3CW2C 2CTLA 2FXQA 5C3EB 4I7AA 4G08A 4DR3H 5C0XH 4RGOS 3HRZC 2IHEA 5LMNQ 1SYGA 2CTEA 1XMQH 1PH4A 4JBMA 3D8GA 4DXGA 4GNXC 3J7AK 3PIOA 1PV4A 4JI8H 1L1OA 1F9QA 5JVG3 4IO9A 4ZCKA 1SYBA 4JOIC 5E7NA 3FAUA 3GTMH 4DUZL 5A2QW 5FLMG 3HG9A 1F2MA 1Q12A 1IBKQ 5LL6X 1X4NA 5E3FA 4YHHQ 5BN5A 1UG8A 1WTQA 2JA5G 3H0GH 4X64H 2NVXB 3GABA 1TS4A 3ULLA 4JW0A 4JI1H 4IPHA 1UE5A 3I8ZA 4JC0A 4DUYQ 4ZLTF 1NBWA 3AEVB 1XWEA 3SEBA 1WD1A 5JEAJ 4KD3A 1VQHA 3F8TA 3KDFA 1N32L 3DMUA 2UUAQ 2B3GA 3G71A 4IOCA 1ODHA 3UOEA 4L5SA 2IX1A 2JA8H 1T5XD 5EJWA 4BXXH 4ZKBB 4DR4H 2YQRA 4CDDC 2A68D 4DV2L 5C6AA 2X06A 3QD7X 3J80L 2IL8A 3LGJA 2E2JB 4GLAC 1BUVT 3M7NA 1KXLA 1J6QA 4O42A 3J80i 4DV4L 1XPRA 5T1GA 3LWEA 4A3EG 3E0JA 4R9WA 4DNIA 4BY1H 1IBMH 2OEOA 1XNRH 2E76C 1D1KA 1PZKD 2UUBL 4EC5A 3R93A 3Q23A 1IYUA 3I4MG 1H9MA 4LF5L 2CH4W 2XIWA 2N78A 1A63A 3K58A 4ODGA 2WAQB 1AE3A 1NCVA 4C3HH 3VDYA 4DV5L 3S1QH 2MJHA 1GUWA 2B2WC 2A74C 4N8X1 5IODA 3CRLC 1ET6A 4DV6L 2CWAA 2RDHA 1YNJC 3RZDH 3MFYA 4JI6Q 1I3QH 4A3FH 1TWFH 3GDEA 4DV0H 3NWSA 4A3KG 2F0EA 2RSOA 3PUYA 1VQ5A 2R93G 3CP0A 1IL8A 5C4XH 4KV6A 4AYBE 1IHZA 1CTMA 1TT2A 2MO0A 4ZUJA 3K6OA 2CPMA 3GTJB 3NWTA 3GTQB 4BY7G 2SNSA 4LK1C 1J9OA 4E6IA 4ZAIA 1EYGA 2DJGC 2F4VH 1LTGD 5IOCA 2A6HC 5IGBA 1HZAA 1XJVA 4U68A 3KBGA 1Y69U 4LFBQ 4UDUC 1HNXQ 2DY7A 1JT8A 2KBNA 2L12A 3GTKH 5EKIA 4NDXA 4K2KA 5CV9A 4DR1H 1SLJA 5AFWA 2E75C 5LL6b 1PYBA 2UXDH 4A3DH 1DOLA 2VUMH 3M4YA 2B63H 1SMYC 3UI2A 3AQQA 3OPOA 1C9OA 4LF8H 1TWGB 2XGTA 5M3FG 2IPKD 5IWAH 1R4PB 2M9VA 4P74A 5LMNH 3NP8A 2VY3A 2L5TA 3NENA 4XTCS 4LF6Q 5FLXL 1HFNA 3NTIA 3J81j 4OO1G 1I4PA 3RZOB 3PCOB 1V9PA 1LLRD 1JJ2A 2OTLA 4H13C 1FVIA 1WFQA 2PNRC 5D3IB 3J7YW 4DV7L 4ILWA 1PRTF 5M5WH 2UXCL 1CHPD 1IW7C 2RA4A 2ZM6L 2QGQA 1IBKH 3SK4A 4P71A 5FOBB 5C3EH 4YHHH 2Q2UA 4CJ0B 1GUGA 2ID0A 3F2UA 1C8CA 3ERSX 4HN7A 1C4QA 3G7LA 4FXGC 4DV1L 1ZZIA 2NN6I 2XRSD 3K7AH 3PO2G 4DUYH 2CWHA 4G7ZC 3GTGB 4DV3Q 3BVGA 3JAML 3KDKA 1SYCA 4L5QA 5JVH3 3A7AB 4EQOA 2UUAH 1HTPA 1V8QA 4KHVA 5C4JB 4B3TL 3D0FA 2Q2HA 1Y14B 1B70B 4TVAB 3KJPA 2NVXH 3WWVA 2CFMA 2TMPA 1RD9D 1IYVA 4TSSA 2KHSA 1JB7A 4PZ8A 3HOZG 1B9NA 1TKWB 1N36L 4LWCA 1PRTD 1JQYD 2R7ZG 1X3FA 3J81L 3W1BA 4B9WA 1PLFA 4QUCA 1J5EQ 1X0AA 1G6ZA 3J81i 4LFAH 3MA2B 1RDPD 3BYTB 1WTOA 1PH7A 1CK1A 3CCUA 3C3LA 1BVSA 1ICFB 3D4DA 3J7AV 3PUXA 1WTHA 4GZYC 1HPCA 3ICEA 1DTJA 3R2TA 5HY6A 3A8IE 4JI6H 4OXPA 1XRHA 1S03G 2SOBA 2D62A 2NB0A 3OHXC 4X62L 2Z9HA 1L0XB 3SVMA 1WCMB 1D7QA 3PIPA 5I9OA 3G4SA 1YI2A 1UE1A 1J5KA 1IL2A 1E7ZA 3NHHA 3TDQA 1G8ZD 3K81C 2O4CA 1EC6A 2PNHA 4PMCA 5IYDH 4IUVA 1O7ZA 1UEBA 1EEFD 2PQAA 4O2DA 5C44G 4AQYL 4A3FG 3B6YA 1HXYD 4TRDA 4LFBH 4DR7L 1HNXH 3OSSD 2N49A 2F0SA 1ENCA 4GOPC 2ANNA 1BXTA 1ESRA 4NBQA 1ZZJA 5CV7A 4RCOA 2BOSA 3GTJH 3M7GA 1TXYA 5BN3A 1GM5A 3N6RA 2PT7G 4HMJA 3U9OA 2Q2TA 1ZTGA 2ES2A 4I7ZC 4JI3H 1VQAA 4X65Q 1VQFA 4LF6H 3PF4A 1EFID 1VQDA 4A3DG 2QDBA 5C0XI 1B53A 4JI0L 5FKAC 4C3JB 3I55A 2B63G 4WJ4A 1PRTB 5GADC 4POGA 1HJPA 1DD2A 3C46A 2WACA 1SYDA 4DR2Q 1RODA 4WANA 4X6AH 1IBLQ 2D2CC 4L63B 3D4RA 1K83H 2B2UA 2K5HA 4RAUC 4GNXB 2L15A 1WHRA 1O78A 1YNJD 2MP1A 1G6PA 2WP8J 2R6GA 4JI5L 2GVAA 3C1EA 4C3IG 4CDCC 2PMZB 3I4LA 2HDLA 4TQUS 1F2YA 1K3BC 1PXUA 3TP8A 5LMNW 3K5OA 2LXJA 2FPHX 4A93B 2K52A 1VQEA 1FL0A 1TWAB 4B3SL 4DV3H 3D6WA 2B2YA 1E1OA 2F03A 4DR5Q 3M4OH 2A6HD 5ELDA 3S1MH 2I07B 5KNDA 2HCIA 3TZDA 5C5MA 2KQ3A 3I0PA 1LT3D 1VCIA 4OL7A 3PIO3 3RLFA 2UU9Q 2M2LA 3ONAB 1HR0W 5ELBA 2VQFQ 5BN4A 2HHHL 4LUZA 2NBFA 1Z6HA 1SMYD 4OX9L 3KBXA 5EBDA 1TY2A 4B3RH 2Z6KC 3GTGH 2JXMB 2HIXA 1N33L 3MC0B 2R61A 1J5EH 3K80C 5M5YB 5C4JH 4OWXB 1DZ1A 1STBA 1JE4A 1HZCA 2BA0A 3HS0C 3OW2A 2DGRA 1STNA 3F2DA 2VB3X 1YJNA 4CKBA 1HQMC 4APVA 2RDGA 1IW7D 2M8WA 5C5LA 1IXRA 4KHPQ 4LFCL 1DOMA 1AFPA 1VQJA 4B3ML 3S15H 1RJTA 1A2TA 2JA6H 1STYA 3QIAA 3HOWG 1B7YB 2MNAA 1I94Q 4YCVA 1T5EA 1OXXK 4HSVA 2KJXA 4JYAL 1I6UA 2NVQH 5C0XJ 2QW7A 1RCVD 2C9OA 1SEBD 3Q6SA 2IHFA 2K32A 5C3XA 4U673 4IPCA 1VQMA 1S72A 3V05A 1TY0A 2MUYA 1I4GA 3W1GA 4E9JA 1WCMH 5EGTA 2PI2E 3I4NB 2BL5A 1QUQA 3NEMA 2ZTEA 2F4IA 4KLKA 3EA6A 5KEEA 2VNUD 5EKKA 2KECA 1YVCA 2NZOA 5EPLA 1KD1C 3NQIA 1FNWA 1EU3A 1GHJA 1SBBB 2WB1B 3ZJYC 1MSZA 3KF6B 5KIXA 4X65H 3EQLC 4X66L 4WJ3M 4I65A 1QE6A 3BYYB 3RD4A 3AFPA 3X3NA 1Y1VH 1K8GA 4H7BA 4L5TA 2Y0SE 4N9PA 3HKZE 1CUKA 2KHIA 4GLVB 4ZRZA 4BA2I 2KHJA 1F9PA 4AYBG 1QOHA 4DR2H 1XMOL 1IBLH 3SK6A 2ZTCA 2CCZA 4LF4Q 1D5ZC 1TWCH 3D4WA 2Q8TA 2VKCA 4RA8A 4A3GG 5IIFA 3BDLA 3HKSA 5JJZA 3MZ5A 2D0PA 4HIDA 3W2DA 1KL9A 3A56A 1YHAA 2MFIA 4C3JH 5GAGC 1PH2A 1MI2A 1IYJB 2AUJD 3D3RA 4WORA 1WOCA 4JI2Q 1VIHA 2HD3A 1JOOA 1X65A 2H5XA 2RKSA 4F7XA 5FO9B 5K36H 4DR5H 5EBCA 2VS1A 4A3BB 3FPUB 2ENBA 3OTOH 2UU9H 2F0DA 4DGZA 3S2HB 1W6JA 2VQFH 3A5ZB 3X3MA 4UP8A 5DT9A 2F0NA 4IUTA 4YWKA 3HOUB 1EQTA 5KYLA 5K5PA 4DPGA 1Q8IA 4XT1B 4A93H 1TWAH 1GXDC 2EYMA 4DR6H 4NXML 1BNZA 2G8YA 1Q86C 1D2BA 1B8AA 1KDBA 1UE7A 2VQEL 1WVNA 1LTBD 1CKOA 5GROA 2P5ZX 2CKZB 1I6HB 2G5DA 3AU7A 1IBMQ 1AZQA 4KK7A 4A3JH 1XNRQ 1U4LA 2SNMA 2Q8IB 1AN7A 3EZJA 1S5CD 4EGVA 3VKEA 1KIXA 4K14A 3NE5B 3KUPA 2AXYA 2YTXA 2LS01 4NKLA 1UWVA 1QCBD 3E3XA 3U9SA 1G2TA 4KHPH 4DF7A 1N32Q 2NVTB 2F0JA 1F2ZA 2YU9B 2M00A 4HR7B 5EAYA 3DEOA 3T56B 1KNEA 2F3WA 1ZYRC 4P75A 1QVFA 5M3MH 1I94H 4DV2Q 1SNDA 3S2DB 4OCHA 4JV5L 3HEJA 4NW2A 5FO7B 4DV4Q 3GTLH 1RHPA 1PMRA 4NB3A 3ER0A 5IGGA 1RL2A 4C2MB 1PFMA 4IOAA 2X69A 2JA6G 4QY7A 1TWHB 1VS0A 1SE2A 2Q2IA 3MAQA 2Z4HA 1CKNA 3DHQA 3KK7A 3HP3A 1VQLA 4DV5Q 3KF8A 4H0LC 4GOPB 1EY0A 4FF2A 3DWPA 5E4XA 2F0UA 4DU9A 1EY6A 3PIP3 4DV6Q 1EY9A 1MSGA 3WDNA 1Q46A 2EY2A 2ZXRA 2TSSA 5IWAQ 2E5LL 5D14A 2L55A 1PRTC 4IZ8A 1XPOA 1HCZA 4K8JA 4IPGA 3UDXA 4A3IB 5IT9E 1IZ6A 2JA9A 1L0YB 1PTOB 5AJ3L 3CCJA 3I4NH 1TQOA 3L9AX 2R92G 1HHVA 1EIYB 1FGBD 3GP7A 2F0WA 4LF4H 1OTCA 1JR0D 2VL6A 5J3BA 1G51A 4JI7L 1OO9B 2JE6I 4POFA 1Y1VG 1Y1WB 3HOVB 1EQRA 1E1TA 1JE5A 3KJOA 5JJLA 3QWNA 3E9IA 5JJKA 1GO3E 1HFGA 3PO3B 1NJIC 3J7ZC 1FJGL 2A19A 4JI2H 1EZ6A 2F0GA 2NVYB 3BDOA 1DYQA 3FHWA 5KNCA 3ITPA 1H9RA 1CQFA 2E74C 1EOTA 3BVMA 5FJ8H 1TS5A 3SR1A 2LTMA 3T4AC 2R7DA 3MXNB 4EQPA 4ZKCB 3PGZA 3U1KA 1XTDA 1NNXA 4A3MB 2NN6G 3H94A 4FYDA 3K0YA 4LIJA 1C0AA 3MXPA 5JPMC 1EU4A 4CHTB 4V190 3T1YL 3H15A 3A8KE 1S40A 1HTLD 3TQYA 1KAWA 2BDOA 2QILA 3VR3A 4DUZH 2UXCQ 2ZM6Q 1I4QA 4KKSA 1B4OA 3KLSX 3QB3A 4A3BH 1KAAA 4F88A 1JICA 1TUAA 3S2HH 1NR2A 5HGTA 4DV1Q 4LFAQ 3DWAA 1WTJA 2WAQE 4K0KL 3E0EA 1TR5A 1B2TA 3VA7A 3HOUH 2B2TA 5C44H 3BZKA 4PQXA 4R4OA 4BBRB 1KABA 3M3YB 2C5CA 4CBVA 4MZ9A 5A35A 3CCMA 1YJWA 1PHJA 1N32H 3GTPH 1FKAH 1X54A 3OWEB 4EQNA 5LMUL 3Q0AA 4A3JG 3PF5A 4R8NA 1E2WA 2JJQA 5E1FA 2FHTA 3VR4A 1EIGA 4GKKQ 4V0BA 4DV2H 1QG7A 3KOJA 4JPBW 1HNWL 3DUZA 3NBHB 4KTAA 1SRUA 4DV4H 1LTSD 2RDFA 2UXDL 1N36Q 5DEHA 3PV0A 5D65A 3KLRA 4IUUA 4LMQD 2UUBH 4Y7NB 3TP6A 2CTMA 5M3MG 3I90A 1FNVA 2FFKB 4LF5H 1CA6A 1QNKA 4OHJA 4DV5H 3T1HL 2EZVA 5CBAE 1EWCA 2QNDA 2A5HA 4LUOA 3S2DH 1W2BA 1ET9A 5IP7G 4KMUC 4DV6H 2PQUA 2JN4A 2MJ8A 2PZWA 4OELB 2MO1A 2A1AA 4X62Q 4C2MH 1UEAB 2F0IA 4A3GB 2RVLA 4JI3Q 3H3VC 1EL0A 1AN8A 1LTAD 1HR0L 1BBUA 1QZGA 3HOXG 2F0FA 4PV1C 1DONA 1TWHH 1CFMA 3TREA 3CU7A 1K1GA 3I73A 2K5QA 2ASBA 1RTNA 1ILPA 3RN2A 3CPWA 4RG1A 2I5LX 1PYWD 5C0XG 4DR7Q 2JA7B 5JJIA 1AP0A 3PUWA 2L4NA 1N34L 1L1OB 2Z6BA 3NQTA 4A3IH 4NPSA 2ANRA 2NWGA 4ZYSA 1ZYRD 4LF9L 2LMCB 4HJAA 1GJXA 5M5XB 3FKIB 2IY5B 1KC8C 5IYBH 1GUNA 1YITA 1PFSA 2CH4A 2CQOA 3HOYB 2YV5A 5IT9c 2EJGC 3UDGA 1PZID 3C1FA 5IP9H 2ZTDA 3H0GG 2CTFA 1X4MA 2B8FA 4J8QA 5IGCA 4JI0Q 4JBWA 3I91A 2BDNA 3PO3H 1EZ8A 2Y0SG 3HKZG 2E2DC 3MEHA 4IN3A 3KDFB 3A0JA 4HCSA 2NVYH 4DV7H 2UXCH 4WJWA 2ZM6H 2EXZA 2YTYA 5G3LF 4B3RQ 1OXUA 3VYSA 3GO5A 3CPFA 2UUCL 5KRUA 2JA8G 4A3MH 1VQPA 3E5SA 1EIFA 1B44D 3HFZB 5KNBA 4BXXG 2L11A 4DV1H 4UY8C 2VB2X 3H09A 3VYTA 4B3SQ 4H8AA 1EFWA 3SXHA 1KHIA 1VQ7A 1OXVA 4DAYA 1PQXA 2HIVA 3QJYA 2E2JH 2K1HA 1F2LA 4BY1G 2NYZD 2JEAI 3S9WA 3IL8A 1RTOA 4LF7L 4B3TH 3KLSA 2D5DA 2K14A 3M4PA 5HGQA 3D31A 2UXBL 1ENAA 3CQZB 2KA7A 4GKKH 1FYCA 5JEAH 2LFNA 2AWNA 3C2PA 1GUTA 4C3HG 2OPVA 4DN4M 4OX9Q 1EWHA 1RF2D 4BBSB 1SJED 1N33Q 1KTKA 3I3CA 4KY5A 4DK0A 4A3LH 1N36H 1QILA 1WTXA 1Q7YC 2PZUA 5G3LD 4A3CH 3IFDA 2WKDA 4QF4A 4YCUA 3CCSA 3RR5A 1TS2A 3TEHB 1SAPA 5C4XG 1EQQA 1MSHA 1AH9A 1P16A 3I70A 5ELFA 1W6KA 2EJMA 4FVMA 2DNEA 1BDOA 2G9DA 3NSWA 5E4WC 3GTQH 1A15A 2YTVA 2EY1A 1II3A 4X62H 1PTOC 4LFCQ 2IT1A 1GKHA 4GLXA 4Y7NH 2DN8A 4X3TA 2PI2A 2ATWA 1PDQA 2B29A 3TS0A 2VUMG 1GUSA 2B8GA 2NUCA 1WTRA 2JA5B 1I50B 1Y8OB 2PCFB 4G7OC 1E24A 4JYAQ 4AQYH 4M8AA 1O7YA 1YNXA 4GKJL 1K9MC 1V1PA 4GN3B 1D5MC 2XWJB 4RH6A 1EYCA 4DR7H 3OMGA 4R8IA 1HNZL 4QIWB 1TWGH 4DV3L 5CMDA 2KCTA 2RCNA 2HUGA 4CDEC 5I2XA 4C1NI 4K6LA 2PMZE 1Q1EA 2F1MA 1LTLA 4YWMA 3N52A 4KN4C 3SHLA 2AMCB 3BZCA 4A76A 2EYLA 3RZOH 5COYA 4KHZA 1EQVA 1SYFA 1E22A 1HH2P 5C3EG 4DNRB 2B39A 3ERQA 3BU2A 4ULLA 2JA7H 1VMPA 5J1ZA 4CDFC 4JI0H 2DY8A 3QOJA 1LYLA 5H1SE 3IRBA 4AH6A 2BH8A 4A3EB 3OTOQ 2F0OA 2D9IA 3G6JB 3K7UC 3UE0A 1XMOQ 3EIVA 1SNCA 3FKIH 2EYOA 1ONLA 2HH2A 1PZJD 4NXNL 1L0WA 1U4PA 1YZ6A 4MNOA 3I4MB 1O7IA 3TZUA 1S20A 2EJFC 2EYFA 2IX3A 2D9UA 5IT9W 3T51B 2E2IB 4DR6Q 4JI5H 2X6GA 2IW3A 1XTCD 4JG2A 4F87A 1JJCB 4FDBA 2K33A 5I9PA 3S14B 3BG3A 3HZXA 4B3SH 1I4XA 2MHVA 1VBIA 5LL6S 1BCPB 4R4IA 4A3KB 1D1IA 2R93B 4JI4L 4Y52H 2PY9A 4JBJA 4BY7B 1UE6A 3IKJA 5DM63 4R4TA 4RCNA 4DAYB 2HHHH 3TP7A 4XQNA 5CV8A 1H95A 4OX9H 2K50A 2I5MX 2NZHA 1YJ9A 4YY3L 2O5JC 4L5RC 1N33H 3A8JE 1EYDA 3EJIA 2PQEA 2LTLA 4IFDH 2NTTA 1O7LA 2PPBC 3EROA 4NXMQ 2RSNA 1NXUA 5A2QL 3IAYA 3S24A 4RGMA 3PUZA 3QR8A 1WTPA 3W5OA 5M3FB 1U0LA 2PQAB 4YIJA 2L0CA 3S1RB 3F1ZA 1SNMA 2KOLA 1NAPA 1SR3A 1ENFA 1SDFA 2WAQG 4IUNA 3O13A 4PG3A 4QMGA 5IYDG 3I4OA 1G2SA 5I6YA 1LM0A 3S17B 1AEXA 4BBSH 1EY8A 2WB1E 3QG1A 2K4KA 4LFCH 1V9NA 4FJSA 4B3MH 3SB1A 2KENA 1V8CA 1DT4A 4CJ2C 1EYAA 5LHY1 3PSIA 1A3UA 3ND9A 1H9JA 3D6CA 4DK6C 5FK9C 5I4DA 3TMEA 5KGUA 1X9NA 3A5UA 3U4VA 4JYAH 4IUPA 3DEPA 1U9RA 1NMFA 4R4CA 1YNNC 3DM1A 4KI0A 3QOLA 4QUFA 2BH2A 4QCLA 2N8NA 1M90C 1L1OC 1PTOF 4Q0FA 3RLOA 3PO2B 2NZ1D 2FFMA 1Q90A 2DJFC 3FRPB 1GHKA 3FDTA 5CYUA 4RGTA 1B3AA 2IWHA 2RHSB 1FD7D 5FLMH 4RMFA 4HMIA 1WVLA 4O1NA 2QEJC 1XXGA 4ZUIA 2JA5H 3P1HA 2ZJQA 2Y0SB 1DOKA 3OMCA 4J1MA 1QZHA 4DAPA 2NTSA 5IY0A 1V43A 2EOTA 1CM9A 3UDIA 4X66H 1KDCA 1S5DD 3SDZA 4LNQA 3A7LA 3JC66 4HIMA 1K0SA 1VF7A 4C1NK 3HOZB 1S4ZA 4KJNA 1PFBA 1Y8PB 2WFWA 4XIGS 1HQRD 5AJ3Q 4JCVE 2R7ZB 2CTKA 3K5LA 3BDCA 1XMOH 1Q81C 4J15A 3STBC 3AEVA 1CKMA 4JI7Q 1B9MA 4ID6A 5ELCA 2JK8A 1Q3LA 4DUZQ 1PTOD 1K8MA 2SEBD 1XNQL 4XQJA 3J80E 5CV4A 3SE0A 1YBYA 4A3EH 1FR3A 4ZQ3A 2D0OA 4S3SA 5CV5A 1I4RA 1BKBA 1MJCA 1LT4D 2A6EC 2OCEA 2B2TC 4OD6A 3FP9A 1K73C 3LWUA 1QJOA 3I4MH 3GD7A 1M4VA 2CWFA 2Z6KA 4XYQA 2E2IH 1SNOA 5BR8L 5C44B 1S5ED 1E0BA 2HQLA 1I3QB 1VDZA 5C3WA 4A3FB 1TWFB 1WI5A 5L37A 5M5YH 4JBKA 3TRZA 3S14H 3T1YQ 1K0RA 3TSSA 4A4IA 1L2FA 2HQEA 2QKIC 5IGEA 4A3KH 1U4RA 4NXMH 1B50A 3PMFA 1PA6A 2O2LD 1SNPA 1JORA 2VQEH 1AW7A 4DAVA 1SYEA 4BY7H 4XQQA 4OONA 1F0XA 5ISRA 2UUBQ 2EXDA 3NBIA 2AHOB 2JQOA 3CXCA 3CCLA 2SDFA 4DR3L 5J22A 4LF5Q 1A2UA 2KCCA 4IFDG 4A3DB 2VUMB 1XMQL 2B63B 4X3UA 1PH1A 1ASYA 1KNAA 1B3QA 2XSCA 2JYOA 3CCVA 1QUQB 1NMGA 2BE5D 2ZXOA 5LMUQ 3BJUA 4JI8L 2PW7A 4G7HC 2FMMA 1WCMG 4ALPA 2F0LA 1WTVA 3BS1A 5M3FH 2Z0SA 2RHQB 4IQZA 3S1RH 3OW7A 3EVQA 4JV5H 3CMAA 1JWSD 4C3IB 3U58A 3GTOB 4ZK9B 4QMFB 4X64L 1Y8NB 1VQOA 4JI1L 5FLXE 2K5NA 2PYKA 4EX5A 1UNSA 4P72A 5CBEE 1LTRD 5ELNA 3A54A 2OPUA 2VW9A 4HCEA 1MHWC 2AQ3B 3A74A 3T1HQ 4K5WA 1VF5C 1NTGA 4DXFA 1VQ9A 3MFGA 1Z47A 3H3VH 1K8OA 3K7AB 5M9OA 1YIJA 4LUVA 3K59A 1G291 3VA5A 2E5LH 4RFBA 2RQXA 1JWUD 4DR4L 3URYA 3CCRA 3PO2H 3VYUA 3GV6A 2F52A 1TVXA 1PH9A 1HR0Q 1STHA 1TU2B 2F0KA 2AQ1B 3NTKA 4C3JG 1JJGA 5DM73 3JAME 1IBML 2N88A 1XNRL 4JI7H 3CC4A 5K36G 1BR9A 1YHBA 1R9TB 2EE1A 2B2VA 3AMUA 3S1NB 2OXPA 3MXUA 4DV7Q 5EKLA 4WFN3 1IKLA 3W3AA 2A69C 2CW0C 1N34Q 3H91A 3MTSA 1JB3A 4ABNA 3HOZH 1N9WA 2ICEC 2N3SA 1BCPC 5DAUA 4LF9Q 3RF2A 1FJGH 3TP5A 2AWOA 1P8LA 1LT6D 1ILQA 1HZ9A 1Z9FA 2C35B 4JVZA 4QJFA 4YCWA 1KRTA 2R7ZH 2O5IC 1SE8A 3NPPA 2Y3MA 1EUJA 4A93G 1EY4A 1PH8A 4DV0L 4LJZC 1STEA 2K01A 4OWTB 2F0PA 1YNND 3J81E 3VR5A 1VQ4A 1AZPA 2ZQEA 3HOWB 1DM0B 2CPQA 3GV3A 4IPDA 3AYHB 4PMWA 2XN9C 3V69A 1EIHA 4UP9A 4HTHA 1ICWA 2OWOA 3T16A 4MHEA 3F2BA 2F4VL 3V2TA 4B3TQ 3T1YH 4DK3C 1I6HH 4RHSA 4IJLA 1R4QB 2VZAA 4K5VA 4GS3A 4DR1L 2A73B 1MIUA 4L6TB 3J80c 2R7FA 4DA2A 1QNUA 2UUCQ 4IFDI 5EQ0A 2PW5A 4PNYA 4LF8L 2O4XA
chains in the Genus database with same CATH topology
2CQAA 4FO2A 5IWAL 2YU9H 2J7ZA 2G9HD 2K5WA 5LMNL 1I5FA 3OSOA 3STBD 3ULJA 2J0TD 4K8IA 1JC7A 2DUDA 2JEBI 4AYBB 1E3PA 5HURA 1CA5A 1A6XA 3CRKC 1CKNB 4A75A 4LF7Q 1GVPA 2K03A 3NTHA 5IGDA 3KF8B 2HT1A 2UXBQ 3CCQA 2K7VA 3MHBA 3K0XA 4UP7A 3SGIA 4MTNA 1D8LA 1IBKL 4YHHL 4OIKA 1PH3A 3I7FA 1YHQA 1MJEA 1U5KA 2A6ED 3I72A 2H1EA 2QA4A 5IT9L 4AQYQ 2JVZA 1RIPA 1K83B 1C7YA 4FP5D 4WRDA 2KCNA 3RMHA 2B2UC 4BWGB 4DUYL 1HRJA 2XTIA 1QB5D 4Q5VA 3I2ZA 3L0OA 3NXWA 2NVTH 3I4NG 4PMBA 4IALA 1LACA 5CGKA 1PH5A 1PTOH 2F0MA 2RBMA 2UUAL 2F0VA 1STAA 3K5MA 4C3IH 4GNXA 3PUVA 3GTOH 1PVOA 2FINB 1D6EC 1SJHD 2CWPA 2WB1G 1GOZA 2B2YC 3M4OB 3CC7A 5J39A 3S1MB 4UAIA 4EVOA 4TKOB 4JOIA 1EEID 3G48A 1GUOA 2K5DA 4C56C 1Y1WH 3HOVH 4G4KA 2EYHA 1A8VA 1V1OA 2F0QA 4OGQC 1EY5A 5FLXc 4HEDA 1TS3A 4CKEA 3UE1A 4GKJQ 4RGNA 1T9HA 4LFAL 4N9TA 5FJ8G 3G6EA 2CVRA 2EDGA 1HNZQ 1SSOA 4NMZA 1VIGA 4JK1C 3R3OA 1X3EA 3JAMi 1WYDA 1SROA 4JI5Q 1DJRD 3DLLA 2I5HA 5IE8A 1V1QA 4JI6L 2Z4IA 1F77A 5CORA 4IFDJ 3OOCA 4UPAA 1J4WA 2F3VA 4GKKL 3TN2A 3QO2A 5IGFA 4AM3A 1R9TH 4X3KA 2DNCA 3P20A 3S1NH 4A3BG 4KD4A 4DK1A 1X3QA 4HAEA 3JAMc 3CCEA 2QCPX 1BCPF 5JAVA 4HIOA 1CSPA 2QEXA 1NR4A 2Q8RE 3S15B 1VQ6A 1HA6A 2N55A 3M85A 4FF4A 4FXDA 1M1KC 2HHHQ 4LFBL 1HNXL 2JA6B 3HOUG 1S3OA 3AB9A 2H4OA 4NXNQ 2FMRA 3FPPA 2XRQD 4RKLA 5F2DA 1PYSB 1UUPA 4BBRH 3HOWH 2XNAC 2NVQB 1VQKA 3M3YH 1VQBA 1VQIA 2B2WA 1W3SA 2MGSA 2P2RA 3CF5A 2YYZA 2E8GA 1JCKB 1VMCA 3J81c 4JI3L 2OQKA 5A2QE 1K8AC 4P2CB 4LF6L 4X3SA 3LNNA 3CMEA 4ME3A 1SN8A 1X32A 1YEZA 4JI4Q 4ME5A 2BCOA 4HJ5A 1SMXA 2R92B 5EPKA 1DCZA 1SE3A 3OIPA 4QGUA 4FF3A 2A69D 2CW0D 5GQOA 4FXKC 1S5BD 1DGSA 2MQHA 4B3MQ 1BCPD 4B9XA 1Y1VB 4NP5A 4PZ6A 1CHQD 1MBYA 1PFNA 4YY3Q 1A0IA 1BF4A 2KUMA 2ALYB 2F3IA 3M4QA 3MWYW 3KF6A 3ND8A 3NK9A 2Z1CA 2OTJA 4QIWE 1TWCB 3EFXD 2DGYA 2K75A 4EQ5A 5GAHC 1F9RA 2QF7A 2OQ0A 2X6LA 2EYPA 4OO1I 2AKWB 4QB4A 1KDAA 4A3GH 2GN5A 3HGBA 1LV9A 4KKUA 1WE8A 1D5XC 4J6HA 3K8AA 4H02A 2FJ2A 2L9HA 2JP1A 1IKMA 2PO4A 2K04A 1OXSC 2E3UA 4CKCA 4P73A 1X3GA 1QWYA 3H3VI 3L7ZC 4L8JA 3SK8A 4X66Q 1XX8A 1CI3M 4A3IG 3WOFA 2HDMA 2ZT9C 1NSNS 4B3RL 3AFQA 1J8IA 1MD2D 1J5EL 3LX0A 5IYBG 5JOBA 1CQVA 1I6VC 5M5XH 1DXMA 4DNTB 4LW1A 2EQSA 2AQ2B 5CC4A 3EBEA 1HUNA 3P7JA 3ZYYX 4R4QA 5IP9G 4OWWB 3HOYH 1Y1WG 3HOVG 4IJHA 3CC2A 2J4XA 4KY7A 3Q22A 3P75A 2BE5C 2CHBD 4CJ1B 3DM3A 4R1JA 1WD0A 4DAMA 2XVSA 3PO3G 2EIFA 2E2HB 1NUCA 4A3JB 1ZKOA 4QL5A 4XXEA 1SFOB 1EY7A 4FNFA 1C48A 1LTID 4H44C 1X6OA 5IYCH 3CD6A 3BVZA 1SXTA 1A3TA 2EYJA 5DLQE 3SK5A 3FEWX 3CKIB 4A3MG 1JOKA 2K1BA 2MPMA 1AE2A 5ELEA 5JPNC 5ELOA 1O80A 4O0AA 5GAEC 3OWFA 1M8AA 4MN3A 3ULPA 1EOVA 2IJ0A 4G57A 3T13A 1LABA 3Q8DA 5M3MB 2K05A 2EPBA 1UAPA 1Z7TA 4CGYB 3VR2A 5CV6A 3GTLB 2A8VA 4IUQA 1N8RC 4KY6A 4DFAA 2HH3A 2AUKA 1FGUA 2VQEQ 3MEFA 1XNQQ 2EY6A 1KQSA 2PZTA 3RNUA 5JEAG 4B08A 4K2LA 3TBIB 1CZWA 3CQZH 4X65L 3CAMA 2RF4A 1I4HA 3UDFA 1H9SA 4HSPA 5D3DA 4BS9A 4BBRG 2XWBB 3E6ZX 3HOXB 4A3LG 2ICIA 4JVHA 4HJ8A 3TS2A 1SE4A 3M9BA 1Q82C 4HJ7A 2VXWA 3J7AF 4A3CG 5EPJA 5BR8Q 4DR2L 3S16B 1IBLL 1RKNA 3NUCA 5C4ZA 1ZEQX 2ZXPA 1VQ8A 5NUCA 4AIMA 4GOPA 1KHMA 5T1IA 1LUZA 2ZJRA 1BO0A 2GA4B 4JV5Q 1A3VA 3U50C 3A55A 2R92H 2A68C 1GD7A 2OT2A 1S5FD 2BA1A 2K5VA 3GTMB 2I0QA 2I46A 3RN5A 3OIQA 3VYRA 4DR5L 2WV6D 2GVBA 2KEEA 1V1PB 2OF1A 4DR3Q 4GN5A 2F0TA 2JZXA 4B8TA 3H0GB 1CZGA 1FNUA 3OTOL 1HA5A 1XMQQ 2UU9L 2K28A 4MIUA 4IURA 1I50H 3R8BA 2VQFL 1BOSA 3HKZB 4FF1A 2JSOA 2LKVA 3MVVA 4JI8Q 4WALA 1CT1D 2L1BA 2E5LQ 1OXTA 5DNFA 1ESFA 5I6WA 3OYYA 2CTJA 4DR6L 4K6DA 3J7A5 1Q1BA 1XYIA 4DKAC 2JA8B 3U4ZA 2NN6H 4F8MA 4GN4B 3E9HA 1QVCA 4X64Q 1ZXTA 4RHRA 3MXNA 4JI1Q 3L2PA 4XDXA 1STGA 2B2VC 1B1ZA 2JA7G 1KLUD 5I2YA 1QVGA 4BA1I 4OIJA 4K5XA 3VR6A 2KCMA 2K6AA 1SNQA 3K57A 4RKBA 4BY1B 2HCCA 5FO8B 4PZ7A 3CHBD 4KHPL 1FJGQ 1ASZA 3FKIG 3GQBA 2WIIB 4YWLA 2LY7A 3HOYG 1A62A 3R2IA 4C3HB 4DR4Q 1BQQT 3S1QB 1G91A 2F0HA 1I94L 4QQBX 3FVQA 1X56A 4KN7C 4KKTA 2LXKA 5KYIA 4HIKA 3GTPB 1Q8KA 1E2VA 1LO5D 3RZDB 1XPUA 3KFUA 2EVBA 3L3OC 3Q24A 1WJJA 2KEDA 1EWIA 2E2HH 3KYHC 4KJOA 3DXJC 4RWSC 5IYCG 5C4XB 1NY4A 3RLNA 1SFOH 2Z8LA 1X3PA 2R93H 1MKHA 2KVMA 1VQGA 1TIID 3BZDB 4LAAA 1JMCA 3F2CA 2R3ZA 1MGSA 5TSSA 5C4HA 3I56A 3K5NA 1WTWA 1ML0D 2FMCA 1BBWA 3NBHA 2EY5A 1X55A 3GTKB 1F9SA 4DV0Q 4K0KQ 1LTTD 3FMCA 2V1CC 1HZBA 3MXGA 4M1UB 3H6MA 4XT3B 3EN2A 2IX0A 4JVYA 1E2ZA 3IFTA 1H9SB 1U4MA 3KLWA 1VQCA 1KRSA 4LF4L 5CR3A 1JWMD 4XYOA 3V96A 2WKCA 1HUMA 5IP7H 2ZJPA 2F4VQ 1LT5D 1BBXC 1PH6A 4HJ9A 3T53B 1ZZKA 3DWQA 1VQNA 1KLGD 1HNWQ 4BBSG 3NELA 4DR1Q 1H9KA 3HOXH 2V4DA 2WINB 1NE3A 2LSSA 3S17H 3WOEA 2UXDQ 1K3RA 4Z9CB 3RUZA 1CSQA 4OO1H 4JI2L 1JOQA 3S16H 4LF8Q 5M5WB 3CW2C 2CTLA 2FXQA 5C3EB 5C0XH 4RGOS 3HRZC 2IHEA 5LMNQ 1SYGA 2CTEA 1PH4A 4JBMA 3D8GA 4DXGA 4GNXC 3PIOA 1PV4A 1L1OA 1F9QA 5JVG3 4IO9A 1SYBA 4JOIC 5E7NA 3GTMH 4DUZL 5FLMG 3HG9A 1F2MA 1Q12A 1IBKQ 5LL6X 1X4NA 5E3FA 4YHHQ 5BN5A 1WTQA 2JA5G 3H0GH 2NVXB 1TS4A 3ULLA 4IPHA 1UE5A 3I8ZA 4JC0A 4DUYQ 4ZLTF 1NBWA 3AEVB 1XWEA 3SEBA 1WD1A 5JEAJ 4KD3A 1VQHA 3F8TA 3KDFA 1N32L 3DMUA 2UUAQ 2B3GA 3G71A 4IOCA 2IX1A 4L5SA 2JA8H 1T5XD 5EJWA 4BXXH 4ZKBB 2YQRA 2A68D 4DV2L 5C6AA 3J80L 2IL8A 3LGJA 2E2JB 3M7NA 1BUVT 4GLAC 1KXLA 1J6QA 4O42A 3J80i 4DV4L 1XPRA 5T1GA 3LWEA 4A3EG 3E0JA 4R9WA 4DNIA 4BY1H 2OEOA 2E76C 1D1KA 1PZKD 2UUBL 3R93A 3Q23A 1IYUA 3I4MG 1H9MA 4LF5L 2XIWA 2N78A 1A63A 3K58A 4ODGA 2WAQB 1AE3A 1NCVA 4C3HH 3VDYA 4DV5L 3S1QH 2MJHA 1GUWA 2B2WC 2A74C 5IODA 3CRLC 1ET6A 4DV6L 2CWAA 2RDHA 1YNJC 3RZDH 3MFYA 4JI6Q 1I3QH 4A3FH 1TWFH 3GDEA 3NWSA 4A3KG 2F0EA 2RSOA 3PUYA 1VQ5A 2R93G 3CP0A 1IL8A 5C4XH 4KV6A 4AYBE 1IHZA 1CTMA 1TT2A 4ZUJA 2MO0A 3K6OA 3GTJB 3NWTA 3GTQB 4BY7G 2SNSA 4LK1C 1J9OA 4E6IA 4ZAIA 1EYGA 1LTGD 5IOCA 2A6HC 5IGBA 1HZAA 1XJVA 4U68A 3KBGA 1Y69U 4LFBQ 4UDUC 1HNXQ 2DY7A 1JT8A 2KBNA 2L12A 3GTKH 5EKIA 4NDXA 4K2KA 5CV9A 1SLJA 5AFWA 2E75C 1PYBA 4A3DH 1DOLA 2VUMH 3M4YA 2B63H 1SMYC 3UI2A 3AQQA 3OPOA 1C9OA 1TWGB 2XGTA 5M3FG 2IPKD 1R4PB 2M9VA 4P74A 3NP8A 2VY3A 2L5TA 4XTCS 3NENA 4LF6Q 5FLXL 1HFNA 3NTIA 3J81j 4OO1G 1I4PA 3RZOB 3PCOB 1V9PA 1LLRD 1JJ2A 2OTLA 4H13C 2PNRC 5D3IB 1FVIA 1WFQA 3J7YW 4DV7L 4ILWA 1PRTF 5M5WH 2UXCL 1CHPD 1IW7C 2RA4A 2ZM6L 2QGQA 3SK4A 4P71A 5FOBB 5C3EH 2Q2UA 4CJ0B 1GUGA 2ID0A 3F2UA 1C8CA 3ERSX 4HN7A 1C4QA 3G7LA 4FXGC 4DV1L 1ZZIA 2NN6I 2XRSD 3K7AH 3PO2G 4G7ZC 3GTGB 4DV3Q 3BVGA 3JAML 1SYCA 5JVH3 4L5QA 3A7AB 4EQOA 1HTPA 1V8QA 4KHVA 5C4JB 4B3TL 3D0FA 2Q2HA 1Y14B 1B70B 4TVAB 3KJPA 2NVXH 3WWVA 2CFMA 2TMPA 1RD9D 1IYVA 4TSSA 2KHSA 1JB7A 4PZ8A 3HOZG 1B9NA 1TKWB 1N36L 4LWCA 1PRTD 1JQYD 2R7ZG 3J81L 1X3FA 3W1BA 4B9WA 1PLFA 4QUCA 1J5EQ 1G6ZA 3J81i 3MA2B 1RDPD 3BYTB 1WTOA 1PH7A 1CK1A 3CCUA 3C3LA 1BVSA 3D4DA 3J7AV 3PUXA 4GZYC 1HPCA 3ICEA 1DTJA 3R2TA 5HY6A 3A8IE 4OXPA 2SOBA 2D62A 2NB0A 3OHXC 4X62L 1L0XB 3SVMA 1WCMB 1D7QA 3PIPA 5I9OA 3G4SA 1YI2A 1UE1A 1J5KA 1IL2A 1E7ZA 3NHHA 3TDQA 1G8ZD 3K81C 1EC6A 2PNHA 4PMCA 5IYDH 4IUVA 1O7ZA 1UEBA 1EEFD 2PQAA 4O2DA 5C44G 4AQYL 4A3FG 3B6YA 1HXYD 4TRDA 4DR7L 2N49A 2F0SA 1ENCA 4GOPC 2ANNA 1BXTA 1ESRA 4NBQA 1ZZJA 5CV7A 4RCOA 2BOSA 3GTJH 3M7GA 1TXYA 5BN3A 1GM5A 3N6RA 4HMJA 3U9OA 2Q2TA 1ZTGA 2ES2A 4I7ZC 1VQAA 4X65Q 1VQFA 3PF4A 1EFID 1VQDA 4A3DG 2QDBA 5C0XI 1B53A 4JI0L 5FKAC 4C3JB 3I55A 2B63G 4WJ4A 1PRTB 5GADC 4POGA 1HJPA 1DD2A 3C46A 2WACA 1SYDA 4DR2Q 1RODA 4WANA 4X6AH 1IBLQ 2D2CC 4L63B 3D4RA 1K83H 2B2UA 2K5HA 4RAUC 4GNXB 2L15A 1O78A 1YNJD 2MP1A 1G6PA 2WP8J 2R6GA 4JI5L 2GVAA 3C1EA 4C3IG 2PMZB 3I4LA 2HDLA 4TQUS 1F2YA 3TP8A 1PXUA 5LMNW 3K5OA 2LXJA 4A93B 2K52A 1VQEA 1FL0A 1TWAB 4B3SL 3D6WA 2B2YA 2F03A 1E1OA 4DR5Q 3M4OH 2A6HD 5ELDA 3S1MH 2I07B 5KNDA 2HCIA 3TZDA 5C5MA 2KQ3A 1LT3D 1VCIA 4OL7A 3PIO3 3RLFA 2UU9Q 2M2LA 3ONAB 1HR0W 5ELBA 2VQFQ 5BN4A 2HHHL 4LUZA 2NBFA 1Z6HA 1SMYD 4OX9L 3KBXA 5EBDA 1TY2A 2Z6KC 3GTGH 2JXMB 2HIXA 1N33L 3MC0B 2R61A 3K80C 5M5YB 5C4JH 1DZ1A 4OWXB 1STBA 1JE4A 1HZCA 2BA0A 3HS0C 3OW2A 2DGRA 1STNA 3F2DA 2VB3X 1YJNA 4CKBA 1HQMC 4APVA 2RDGA 1IW7D 5C5LA 1IXRA 4KHPQ 4LFCL 1DOMA 1AFPA 1VQJA 4B3ML 3S15H 1RJTA 1A2TA 2JA6H 1STYA 3QIAA 3HOWG 1B7YB 2MNAA 1I94Q 4YCVA 1T5EA 1OXXK 4HSVA 2KJXA 4JYAL 2NVQH 5C0XJ 1RCVD 2C9OA 1SEBD 3Q6SA 2K32A 5C3XA 4U673 2IHFA 4IPCA 1VQMA 1S72A 3V05A 1TY0A 2MUYA 1I4GA 3W1GA 1WCMH 5EGTA 3I4NB 2PI2E 2BL5A 1QUQA 3NEMA 2ZTEA 2F4IA 4KLKA 3EA6A 5KEEA 2VNUD 5EKKA 2KECA 1YVCA 2NZOA 5EPLA 1KD1C 3NQIA 1FNWA 1EU3A 1GHJA 1SBBB 2WB1B 3ZJYC 3KF6B 5KIXA 3EQLC 4X66L 4WJ3M 4I65A 1QE6A 3BYYB 3RD4A 3AFPA 3X3NA 1Y1VH 1K8GA 4H7BA 4L5TA 4N9PA 2Y0SE 3HKZE 4ZRZA 4BA2I 1CUKA 2KHIA 4GLVB 2KHJA 1F9PA 4AYBG 1QOHA 1XMOL 3SK6A 2ZTCA 2CCZA 4LF4Q 1D5ZC 3D4WA 1TWCH 2Q8TA 4RA8A 4A3GG 5IIFA 3BDLA 3HKSA 5JJZA 3MZ5A 2D0PA 4HIDA 3W2DA 1KL9A 3A56A 1YHAA 2MFIA 4C3JH 5GAGC 1PH2A 1MI2A 2AUJD 1IYJB 3D3RA 4WORA 1WOCA 4JI2Q 1VIHA 1JOOA 2RKSA 5FO9B 1X65A 4F7XA 5K36H 2H5XA 5EBCA 2VS1A 4A3BB 3FPUB 2ENBA 2F0DA 4DGZA 3S2HB 1W6JA 3A5ZB 3X3MA 4UP8A 2F0NA 4IUTA 4YWKA 3HOUB 1EQTA 5KYLA 5K5PA 4DPGA 1Q8IA 4XT1B 4A93H 1TWAH 1GXDC 2EYMA 4NXML 1BNZA 1Q86C 1D2BA 1B8AA 1KDBA 1UE7A 2VQEL 1WVNA 1LTBD 1CKOA 5GROA 1I6HB 2CKZB 3AU7A 1IBMQ 1AZQA 4KK7A 4A3JH 1XNRQ 1U4LA 2SNMA 2Q8IB 1S5CD 4EGVA 3VKEA 1KIXA 4K14A 3NE5B 3KUPA 2AXYA 2YTXA 2LS01 4NKLA 1UWVA 1QCBD 1G2TA 3U9SA 4DF7A 1N32Q 2NVTB 2F0JA 1F2ZA 2YU9B 2M00A 4HR7B 5EAYA 3DEOA 3T56B 1KNEA 2F3WA 1ZYRC 4P75A 1QVFA 5M3MH 4DV2Q 1SNDA 3S2DB 4JV5L 3HEJA 4NW2A 5FO7B 4DV4Q 3GTLH 1RHPA 1PMRA 4NB3A 5IGGA 3ER0A 4C2MB 1RL2A 1PFMA 4IOAA 2X69A 2JA6G 4QY7A 1TWHB 1VS0A 1SE2A 2Q2IA 3MAQA 2Z4HA 3DHQA 3KK7A 1CKNA 3HP3A 1VQLA 4DV5Q 3KF8A 4H0LC 4GOPB 1EY0A 4FF2A 3DWPA 5E4XA 2F0UA 4DU9A 1EY6A 3PIP3 4DV6Q 1EY9A 1MSGA 3WDNA 2EY2A 1Q46A 2ZXRA 2TSSA 5IWAQ 2E5LL 5D14A 2L55A 1PRTC 4IZ8A 1XPOA 1HCZA 4K8JA 4A3IB 5IT9E 4IPGA 3UDXA 1IZ6A 2JA9A 1L0YB 1PTOB 5AJ3L 3CCJA 3I4NH 1TQOA 3L9AX 2R92G 1HHVA 1EIYB 1FGBD 3GP7A 2F0WA 1OTCA 1JR0D 2VL6A 5J3BA 1G51A 4JI7L 1OO9B 2JE6I 4POFA 1Y1VG 1Y1WB 3HOVB 1EQRA 1E1TA 1JE5A 3KJOA 5JJLA 3QWNA 3E9IA 5JJKA 1HFGA 3PO3B 1GO3E 1NJIC 3J7ZC 1FJGL 2A19A 1EZ6A 2F0GA 2NVYB 3BDOA 1DYQA 3FHWA 5KNCA 3ITPA 1H9RA 1CQFA 2E74C 1EOTA 3BVMA 5FJ8H 1TS5A 3SR1A 3T4AC 2R7DA 3MXNB 4EQPA 4ZKCB 3PGZA 3U1KA 1XTDA 4A3MB 2NN6G 3H94A 4FYDA 3K0YA 4LIJA 1C0AA 3MXPA 5JPMC 1EU4A 4CHTB 4V190 3T1YL 3H15A 3A8KE 1S40A 1HTLD 3TQYA 1KAWA 2BDOA 2QILA 3VR3A 2UXCQ 2ZM6Q 1I4QA 4KKSA 1B4OA 3KLSX 3QB3A 4A3BH 1KAAA 4F88A 1JICA 1TUAA 3S2HH 1NR2A 5HGTA 4DV1Q 4LFAQ 3DWAA 2WAQE 4K0KL 3E0EA 1TR5A 1B2TA 3VA7A 3HOUH 2B2TA 5C44H 4PQXA 4BBRB 3BZKA 4R4OA 1KABA 3M3YB 2C5CA 4CBVA 4MZ9A 5A35A 3CCMA 1YJWA 1PHJA 3GTPH 1X54A 3OWEB 4EQNA 5LMUL 3Q0AA 4A3JG 3PF5A 4R8NA 1E2WA 2JJQA 5E1FA 2FHTA 3VR4A 1EIGA 4GKKQ 4V0BA 1QG7A 3KOJA 1HNWL 3DUZA 3NBHB 4KTAA 1SRUA 1LTSD 2RDFA 2UXDL 1N36Q 5DEHA 3PV0A 5D65A 3KLRA 4IUUA 4LMQD 4Y7NB 3TP6A 2CTMA 5M3MG 3I90A 1FNVA 2FFKB 1CA6A 1QNKA 4OHJA 3T1HL 2EZVA 5CBAE 1EWCA 2QNDA 2A5HA 4LUOA 3S2DH 1W2BA 1ET9A 5IP7G 4KMUC 2PQUA 2MJ8A 2PZWA 2MO1A 2A1AA 4X62Q 4C2MH 1UEAB 2F0IA 4A3GB 2RVLA 4JI3Q 3H3VC 1EL0A 1AN8A 1LTAD 1HR0L 1BBUA 1QZGA 3HOXG 2F0FA 4PV1C 1DONA 1TWHH 1CFMA 3TREA 3CU7A 1K1GA 3I73A 2K5QA 1ILPA 1RTNA 2ASBA 3RN2A 3CPWA 4RG1A 2I5LX 1PYWD 5C0XG 4DR7Q 2JA7B 5JJIA 1AP0A 3PUWA 2L4NA 1N34L 1L1OB 3NQTA 4A3IH 4NPSA 2ANRA 2NWGA 4ZYSA 1ZYRD 4LF9L 2LMCB 4HJAA 1GJXA 5M5XB 3FKIB 2IY5B 1KC8C 5IYBH 1GUNA 1YITA 1PFSA 2CQOA 3HOYB 2YV5A 5IT9c 2EJGC 3UDGA 1PZID 3C1FA 5IP9H 2ZTDA 3H0GG 2CTFA 1X4MA 2B8FA 4J8QA 5IGCA 4JI0Q 4JBWA 3I91A 2BDNA 3PO3H 1EZ8A 3MEHA 2Y0SG 2E2DC 3HKZG 4IN3A 3KDFB 3A0JA 4HCSA 2NVYH 4WJWA 2EXZA 2YTYA 5G3LF 4B3RQ 1OXUA 3VYSA 3GO5A 3CPFA 2UUCL 5KRUA 2JA8G 4A3MH 1VQPA 3E5SA 5KNBA 1B44D 1EIFA 3HFZB 4BXXG 2L11A 4UY8C 2VB2X 3H09A 3VYTA 4B3SQ 1EFWA 3SXHA 1KHIA 1VQ7A 4DAYA 1OXVA 2HIVA 3QJYA 2E2JH 1F2LA 2JEAI 2NYZD 4BY1G 3S9WA 3IL8A 1RTOA 4LF7L 3KLSA 2D5DA 2K14A 3M4PA 5HGQA 3D31A 2UXBL 1ENAA 3CQZB 2KA7A 1FYCA 5JEAH 2LFNA 2AWNA 3C2PA 1GUTA 4C3HG 2OPVA 4DN4M 4OX9Q 1EWHA 1RF2D 4BBSB 1SJED 1N33Q 1KTKA 3I3CA 4KY5A 4DK0A 4A3LH 1QILA 1WTXA 1Q7YC 2PZUA 5G3LD 4A3CH 3IFDA 2WKDA 4QF4A 4YCUA 3CCSA 3RR5A 1TS2A 3TEHB 1SAPA 5C4XG 1EQQA 1MSHA 1AH9A 1P16A 3I70A 5ELFA 1W6KA 2EJMA 4FVMA 2DNEA 1BDOA 2G9DA 3NSWA 5E4WC 3GTQH 1A15A 2YTVA 2EY1A 1II3A 1PTOC 4LFCQ 2IT1A 1GKHA 4GLXA 4Y7NH 2DN8A 4X3TA 2PI2A 2ATWA 1PDQA 2B29A 3TS0A 2VUMG 1GUSA 2B8GA 2NUCA 1WTRA 2JA5B 1I50B 1Y8OB 2PCFB 4G7OC 1E24A 4JYAQ 4M8AA 1O7YA 1YNXA 4GKJL 1K9MC 1V1PA 4GN3B 1D5MC 2XWJB 4RH6A 1EYCA 3OMGA 4R8IA 1HNZL 4QIWB 1TWGH 4DV3L 5CMDA 2KCTA 2RCNA 2HUGA 5I2XA 4C1NI 4K6LA 2PMZE 1Q1EA 2F1MA 1LTLA 4YWMA 3N52A 4KN4C 3SHLA 2AMCB 3BZCA 4A76A 2EYLA 3RZOH 5COYA 4KHZA 1EQVA 1SYFA 1E22A 1HH2P 5C3EG 4DNRB 2B39A 3ERQA 4ULLA 3BU2A 2JA7H 1VMPA 5J1ZA 2DY8A 3QOJA 1LYLA 5H1SE 3IRBA 4AH6A 2BH8A 4A3EB 3OTOQ 2F0OA 3G6JB 3K7UC 3UE0A 1XMOQ 3EIVA 1SNCA 3FKIH 2EYOA 1ONLA 2HH2A 1PZJD 4NXNL 1L0WA 1U4PA 3I4MB 1YZ6A 4MNOA 1O7IA 3TZUA 2EJFC 2EYFA 2IX3A 2D9UA 3T51B 2E2IB 4DR6Q 2X6GA 2IW3A 1XTCD 4JG2A 4F87A 1JJCB 4FDBA 2K33A 5I9PA 3S14B 3BG3A 3HZXA 1I4XA 2MHVA 5LL6S 1BCPB 4A3KB 4R4IA 1D1IA 2R93B 4JI4L 4Y52H 2PY9A 4BY7B 4JBJA 3IKJA 1UE6A 5DM63 4R4TA 4RCNA 4DAYB 3TP7A 4XQNA 5CV8A 1H95A 2K50A 2I5MX 2NZHA 1YJ9A 4YY3L 2O5JC 4L5RC 3A8JE 1EYDA 3EJIA 2PQEA 4IFDH 2NTTA 1O7LA 2PPBC 3EROA 4NXMQ 2RSNA 5A2QL 3IAYA 3S24A 4RGMA 3PUZA 1WTPA 3W5OA 5M3FB 1U0LA 2PQAB 4YIJA 2L0CA 3S1RB 3F1ZA 1SNMA 2KOLA 1NAPA 1SR3A 1ENFA 1SDFA 2WAQG 4IUNA 3O13A 4QMGA 3S17B 4PG3A 3I4OA 1G2SA 5I6YA 1LM0A 5IYDG 1AEXA 4BBSH 1EY8A 2WB1E 3QG1A 2K4KA 2KENA 1DT4A 4CJ2C 1EYAA 5LHY1 3PSIA 1A3UA 3ND9A 1H9JA 3D6CA 5I4DA 5FK9C 4DK6C 3TMEA 5KGUA 1X9NA 3A5UA 3U4VA 4IUPA 3DEPA 1U9RA 1NMFA 4QUFA 1YNNC 3DM1A 4KI0A 3QOLA 4R4CA 2BH2A 4QCLA 2N8NA 1M90C 1PTOF 1L1OC 4Q0FA 3RLOA 3PO2B 2NZ1D 1Q90A 3FRPB 1GHKA 3FDTA 5CYUA 4RGTA 1B3AA 2IWHA 2RHSB 1FD7D 5FLMH 4RMFA 4HMIA 1WVLA 4O1NA 2QEJC 1XXGA 4ZUIA 2JA5H 3P1HA 2ZJQA 2Y0SB 1DOKA 3OMCA 4J1MA 1QZHA 4DAPA 2NTSA 5IY0A 1V43A 2EOTA 1CM9A 3UDIA 1KDCA 1S5DD 3SDZA 4LNQA 3A7LA 3JC66 4HIMA 1VF7A 4C1NK 3HOZB 1S4ZA 4KJNA 1PFBA 1Y8PB 2WFWA 4XIGS 1HQRD 5AJ3Q 2R7ZB 4JCVE 2CTKA 3K5LA 3BDCA 1Q81C 4J15A 3STBC 3AEVA 1CKMA 4JI7Q 1B9MA 4ID6A 5ELCA 2JK8A 1Q3LA 4DUZQ 1PTOD 1K8MA 2SEBD 1XNQL 4XQJA 3J80E 5CV4A 3SE0A 1YBYA 4A3EH 1FR3A 4ZQ3A 2D0OA 4S3SA 5CV5A 1I4RA 1BKBA 1MJCA 1LT4D 2A6EC 2OCEA