2JEBI

Structure of a 9-subunit archaeal exosome bound to mn ions
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
214
structure length
197
Chain Sequence
KIVLQPRSIVVPGELLAEGEFQIPWSPYILKINSKYYSTVVGLFDVKDTQFEVIPLEGSFYYPKINDIVIGLVEDVEIYGWVVDIKAPYKAYLPASNLLGRSINVGEDLRRYLDVGDYVIARIENFDDPVLSVKGKDLGRVSNGIVIDIMPVKVPRVIGKNKSMYETLTSKFVANNGRIWAILIEAIRKIENESHIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EXOSOME COMPLEX EXONUCLEASE 2
publication title RNA Channelling by the Archaeal Exosome.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Hydrolase
total genus 40
structure length 197
sequence length 214
ec nomenclature
pdb deposition date 2007-01-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2jebI01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2jebI02
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 2jebI03
2LSSA 2YQRA 4DR1Q 2D0PA 1LUZA 3CC4A 2NVXH 3I4LA 2UUBL 3ULPA 1TWCH 4DR4Q 2LMCB 3MEFA 1K8OA 4A3DG 4GOPC 1E2VA 4X64L 1YJWA 2BH8A 3RLFA 3HKZG 1X3GA 1PH8A 2K32A 2O5JC 4A3EG 1YJ9A 2OQ0A 4OWXB 1N33Q 4DR6L 4DV7Q 4JBJA 4GS3A 2AXYA 5HGQA 4YCUA 1TUAA 3P20A 5BN4A 4LF9Q 3HOWG 1HCZA 3RR5A 4L5RC 2FMRA 2WB1G 2A68D 3HOYG 2HH2A 1Q86C 2ANRA 1VQ8A 1Q82C 4HIDA 1VQPA 4X62L 4QL5A 4QY7A 1HZBA 2V4DA 1CSPA 2YV5A 4LF5Q 4LJZC 5KNDA 3STBC 1KL9A 1GUNA 3GD7A 4A3EH 1EIFA 1X3EA 3U4ZA 1KIXA 5IYCG 4NXMQ 1N36L 3ND9A 1AE2A 1YHQA 1SR3A 4JI1Q 2IY5B 3NE5B 2EIFA 1D8LA 4LW1A 3HOWH 1YJNA 3BDOA 4DUYQ 3CCMA 1PHJA 2CTKA 5GAHC 1WE8A 1KRTA 1KC8C 3S14H 5JJKA 4YHHL 1V8QA 5IT9c 5C3EG 5C4JH 4BA1I 1V1QA 2UXDQ 4HJAA 1OXXK 2A69D 2VQFL 5JJIA 4BY7G 5HY6A 4GN3B 1X6OA 2LXJA 3EIVA 4GKJQ 3PCOB 2I0QA 1PMRA 1P8LA 2K52A 2K33A 3FHWA 1FVIA 3Q8DA 1JJCB 4QJFA 4GNXB 1H9JA 4IJLA 2CTFA 4GKKL 2E74C 1Z6HA 2UUAQ 3F2DA 1HZCA 3K7UC 2B29A 1K73C 3JAMc 4JI3Q 2ANNA 4R4QA 5C3EH 4K0KQ 1Y8OB 1EQQA 3H3VH 5BR8L 1HNXL 2K5NA 4UP9A 4JI4Q 2NVQH 3PIOA 2ZTCA 2HHHL 4JI2Q 4BY7H 3TS0A 1JJGA 1U0LA 1CI3M 2N49A 4LWCA 1R9TH 1MKHA 4B3SQ 1CKNA 1IBLQ 3F2BA 4DR1L 4JI6Q 2JQOA 3EQLC 3KF6A 1W2BA 4IFDG 1GUOA 3AQQA 1H9RA 2Z6KC 1L1OB 4DR4L 2Q2TA 3HOVG 4H44C 1X56A 2Q2IA 5IY0A 3D4RA 1IBKQ 3BZKA 3VKEA 3CPWA 4PZ8A 5C0XI 1KRSA 1E3PA 1E24A 3U9SA 3T1YL 4YWMA 1C9OA 4BA2I 1Z9FA 1PA6A 4BXXH 4JI8L 2F52A 4A76A 1VQFA 4OONA 1N33L 4DV6Q 3HFZB 2AKWB 3AYHB 1W3SA 3CF5A 5KNBA 4L5SA 4LF9L 3OOCA 5M3MH 1PFSA 1XNRL 1DXMA 3GTQH 4PMWA 1IW7C 2DNEA 4WJ4A 2R92H 2KA7A 1IYJB 2K5VA 1YVCA 5JEAG 1XMOL 5M5WH 4OO1I 1GHKA 1N34Q 3KDFA 4NBQA 3ULJA 3WWVA 3MXNB 2VQEL 1Y8PB 2VL6A 5ELOA 4YCVA 2YYZA 4JI1L 1PH7A 1PVOA 3HOXG 5GAEC 2KBNA 4OGQC 2UU9Q 3I2ZA 2K50A 1U5KA 1BVSA 3T51B 1E1OA 5JEAH 2R7ZH 1YZ6A 2WFWA 4B3MQ 3PSIA 1KD1C 3PUVA 4BY1G 3A8JE 3UE1A 4DK3C 2VW9A 3CXCA 4GLVB 2L5TA 4GKJL 2MFIA 2Z0SA 3J81c 1DTJA 1YIJA 2HT1A 4FDBA 1GKHA 3U4VA 3PV0A 3FKIH 3VR6A 2ZM6Q 1XJVA 3HOXH 1PH4A 4GZYC 2JA8H 1V9PA 4X65Q 4HIKA 4OWTB 2QA4A 1TWAH 2FXQA 3RLNA 4K0KL 3CC7A 2GVAA 1KXLA 4JI4L 5FLXc 1FL0A 1WI5A 4JC0A 4IO9A 4BY1H 2E8GA 1A62A 2PQAB 1Y1WH 3VR5A 4DV0L 4B3SL 2CTJA 2A6HD 3KF8B 4JI6L 2E2JH 1LYLA 1CTMA 4IPHA 3S16H 3VA7A 1PH1A 4H0LC 5GADC 3S1RH 1B9NA 3J80i 2NZOA 1ASYA 4A3KG 3I73A 4TVAB 2ALYB 3I4MG 3UDXA 5ELNA 1GD7A 1FR3A 4HIOA 2CWPA 2ZT9C 1PH2A 1BBUA 4DK0A 1A63A 2AMCB 1M1KC 3B6YA 3A7LA 1VQIA 1Y8NB 2N8NA 4POFA 1FYCA 4IJHA 2WAQE 2BE5C 3CAMA 1TU2B 4DR3Q 5M5YH 1WFQA 3LNNA 1QUQA 4NB3A 1FJGL 3S17H 1WYDA 4HJ7A 2UUCL 2VS1A 2D5DA 1VQ6A 4A3FG 3M7NA 3CCLA 2JJQA 1B9MA 2CCZA 4IFDJ 3T1HQ 2JXMB 2F3IA 2Q2HA 3CMEA 2B3GA 2OPUA 3S1QH 1A0IA 4LUZA 5C0XH 1KHMA 1Q81C 1HZAA 2CTEA 4DNIA 1QZGA 2QNDA 3HKZE 4KKSA 3M3YH 3TEHB 1I5FA 2GN5A 3T56B 1EIYB 1Q12A 2AHOB 5C4XH 4A3FH 5IP9H 4DR2L 1BDOA 4DUZL 1VQAA 4DKAC 2NZHA 2HQLA 5BN5A 1BBWA 4JVHA 3L2PA 4DAYB 2AUKA 4XTCS 2Y0SG 4JV5Q 2WB1E 3I7FA 4B3ML 3UE0A 3M9BA 2P2RA 1P16A 2PPBC 4A93H 1OTCA 3DM3A 3NEMA 1PYSB 1K3RA 2GVBA 2IT1A 3CCVA 2D0OA 4I7ZC 1CFMA 2EJFC 1BKBA 1Q90A 4R4TA 2A6EC 1S40A 4LF4L 4PZ7A 4YY3Q 2UXBQ 1IYVA 4X65L 4DK6C 1LACA 2B63G 4DV4Q 4LFCQ 2KCTA 2EQSA 4G7OC 1J4WA 3JC66 2EDGA 3S2DH 1DT4A 4KN7C 3F2CA 1OXSC 4P73A 1SMXA 3U58A 1DD2A 3PF5A 3A7AB 2E5LQ 1HNWQ 2EJMA 2QGQA 4IQZA 3I4NG 3BG3A 3CMAA 4KKUA 2N78A 5J3BA 3H15A 3FMCA 2E2IH 4ALPA 4B3RQ 2B63H 3OTOL 4P71A 2K4KA 3UDIA 4LFAQ 1I6HH 3PUYA 1L0WA 4LF7Q 1E22A 4QIWE 3ULLA 1SRUA 4GLAC 2XTIA 1E1TA 2BA0A 4G7ZC 1VQKA 2V1CC 4YWLA 2CWAA 3NELA 4L5QA 4KLKA 3I4NH 1I94Q 3A5ZB 2A68C 3CCUA 3F1ZA 2F4VQ 1KQSA 1H9SB 1CKNB 4JI0L 1YHAA 4DR7Q 3KF6B 1GHJA 3GTGH 2RCNA 4G7HC 1GUSA 1K8AC 4XIGS 2ZJRA 3T1HL 4A3JG 2CW0C 3AEVB 4NXNQ 2F1MA 4DV1Q 3S1NH 1VIHA 4TKOB 1VQLA 4BXXG 2B8GA 3WDNA 2CTMA 1E2ZA 1O7IA 5IWAQ 1IXRA 4DNTB 2PNHA 1SFOH 3J81j 4GNXA 4DR5Q 2MO1A 3K7AH 3A74A 1VF5C 4DV3Q 4AQYQ 5M3MG 2JZXA 2OQKA 3OW2A 4KHPQ 1Q46A 1E2WA 3J7A5 5M3FH 4UP7A 2R92G 3J7ZC 5A35A 4JYAQ 3RLOA 2JEBI 5C44G 2A69C 4A3JH 3GQBA 3PO3G 5FLMG 5LMNQ 2AWOA 2PI2A 1C7YA 4GN4B 3I72A 4R1JA 1JJ2A 3AFPA 3HOZG 5E7NA 1M90C 1EOVA 1YITA 4LF8Q 2PMZE 3LGJA 4DV7L 4O2DA 4EQ5A 4C3IH 4QQBX 4P75A 1HNZQ 1L1OA 1A8VA 3TQYA 3H0GH 4GLXA 5GQOA 2Q2UA 3A8IE 1IBMQ 2HIXA 3KDFB 2ZTDA 2VUMG 4P74A 3CRKC 4HJ9A 4YY3L 2UXBL 3A8KE 1ZKOA 1AH9A 5C44H 5BN3A 2R7ZG 3W1BA 3UDGA 3I55A 4LF5L 4JBWA 1YNXA 1PV4A 2VZAA 3PO3H 5FLMH 3CQZH 2RHSB 4GNXC 4DV5Q 2UXCQ 4KKTA 2JA9A 3HOZH 1N32Q 5EAYA 3J81i 2YTVA 3I56A 4NXML 3HOUG 4UY8C 1HNWL 3FKIG 1XMQQ 1B7YB 3KJOA 4DUYL 4WANA 2DNCA 2JA8G 2VUMH 2NVYH 1HR0Q 3PUWA 4LNQA 4B3RL 5K36G 2VY3A 1VDZA 3GTLH 1B8AA 2UXDL 1HH2P 4BBRG 1K8MA 4X64Q 4DPGA 1L1OC 2MQHA 2NN6I 1Y1WG 1EYGA 4A3IH 5IYDH 1XPRA 4C3HH 3H94A 5IE8A 3L7ZC 3HOUH 3G4SA 3VR2A 1E7ZA 1TKWB 1VQHA 4A3CH 1JB7A 2EVBA 4LFBQ 3F8TA 1GJXA 4JCVE 3QIAA 1VCIA 2BA1A 4AYBG 2UUAL 4LF6Q 1I50H 5JJLA 5LMUQ 4JI3L 4H02A 3E9HA 5K36H 4DNRB 2JA6H 4AM3A 3E0EA 3I4OA 2VNUD 2RF4A 4BBRH 4JI2L 1EC6A 1QZHA 2A8VA 4X62Q 1CKMA 2DGYA 1YNJC 1IBLL 3MXUA 4PG3A 1VQOA 3K8AA 1X65A 5DLQE 5IWAL 2CTLA 2QEXA 2CQOA 1X9NA 3W5OA 1S3OA 4GOPB 4DV3L 1NMGA 1CUKA 1UE1A 4AH6A 1GVPA 3M4YA 1EWIA 1MIUA 3M4OH 3FP9A 1IBKL 1QJOA 1SN8A 2OTLA 1QUQB 1MJCA 5LMNL 3SE0A 5C0XG 2DN8A 1X3FA 3DLLA 2JA5G 2VQFQ 4LIJA 4LF8L 1ZZKA 2AWNA 3EN2A 4DV6L 4B8TA 4H13C 1RL2A 2CPQA 2PI2E 4DAMA 3L0OA 4OX9Q 1GO3E 2OCEA 1PH9A 1NBWA 1JT8A 1IBML 1IZ6A 4RMFA 4R4CA 5C4XG 5LMNW 1NTGA 5IP9G 3UDFA 4KMUC 4DK1A 3CCQA 4A3BG 2CKZB 2ASBA 3J80c 4A3GG 3CRLC 3RN5A 1CSQA 3A5UA 1LTLA 1VQ9A 1H9KA 2KCMA 3IKJA 2UXCL 1N34L 3V69A 4AIMA 1IL2A 2A6HC 4A93G 2JA5H 3IFTA 3AFQA 1UE5A 4A3LH 4OO1G 2DGRA 1XNQQ 3STBD 1VQDA 4IFDI 3SGIA 5FJ8G 2K7VA 3VDYA 1PH6A 2Y0SE 3OW7A 1LM0A 1XMQL 3GTJH 1YBYA 4JOIA 1WJJA 1WVNA 2PNRC 1HR0L 2UU9L 1G51A 4OWWB 2JA7G 1J6QA 3VR4A 4A3BH 2R6GA 4JI5Q 4A3GH 1YHBA 2LXKA 3S2HH 4JBMA 1I3QH 1X4NA 3CD6A 4PZ6A 4IOCA 3KYHC 2EJGC 3FPPA 2XGTA 2KHJA 3U50C 3BZCA 1N9WA 4OO1H 2PCFB 1HR0W 4UPAA 5JEAJ 4ME3A 1I6VC 3T1YQ 1YEZA 2NN6G 1ZYRC 5FJ8H 4JI8Q 4X6AH 1IYUA 2ZM6L 1Q8KA 1NJIC 4LFBL 3KJPA 4LUOA 2MJHA 1KHIA 1PH3A 2JA7H 4LF6L 1S72A 3EBEA 1VQEA 2I5HA 5LMUL 3OYYA 5GAGC 2IX0A 1Y1VG 1KAWA 1XNRQ 1X54A 4A3DH 2E75C 1NE3A 2JK8A 3ERSX 3ER0A 3NBHB 3QJYA 1ZTGA 1HZ9A 2ATWA 1EUJA 1XMOQ 2Q8IB 3KOJA 1Q1EA 2H5XA 4JOIC 2ZTEA 2NN6H 3PGZA 1Z47A 3G71A 3VR3A 1DCZA 3K0XA 2VQEQ 1HJPA 3JAMi 2B8FA 4Y7NH 1SROA 2I5MX 1B70B 4KI0A 4R4OA 3TREA 4EX5A 1Y1VH 1JMCA 4RG1A 1TWHH 1VS0A 4TQUS 4MNOA 3HOYH 4UP8A 3CPFA 3RN2A 1SLJA 1VIGA 3U1KA 3M85A 2DUDA 3KLWA 3S15H 4HR7B 3CC2A 1AE3A 2EXDA 3PUZA 3D0FA 4A3MG 2Z6KA 1QVCA 2N3SA 4DR3L 2JVZA 2JEAI 4DV2Q 1ASZA 1VQGA 4B3TQ 1XTDA 5IYCH 1OXTA 4OX9L 3OPOA 3CCRA 5M3FG 4KHZA 1CKOA 4JI7Q 3E9IA 1QVFA 5KNCA 1Q1BA 4IOAA 1IW7D 4Y52H 1G291 5AJ3Q 4A3MH 2D2CC 1UEBA 1XPUA 1NMFA 1PYBA 3S1MH 1XNQL 4DV0Q 1UWVA 1VQNA 2A19A 3H0GG 2KCCA 1DGSA 1H9SA 1VQBA 1H95A 1NY4A 2AUJD 1K1GA 3GTOH 5C0XJ 4QGUA 1QVGA 3CW2C 3TZUA 1VQ4A 3AEVA 4IPCA 4JI5L 4L8JA 3GTKH 3BU2A 1GUTA 4KN4C 2YTXA 1WCMG 2R7FA 4JV5L 1OXUA 4MTNA 2ZJPA 4BBSG 2K5HA 1V43A 1YI2A 2ZJQA 2C35B 3W1GA 2PQUA 4MZ9A 3G48A 3GTMH 3PO2G 1ZZIA 1C0AA 2IHFA 2IHEA 1J5EQ 3PIPA 4HIMA 1Q7YC 3A0JA 2BH2A 1VQ5A 4HJ8A 4IFDH 3QG1A 4X66Q 2WP8J 1J5KA 2ID0A 3GO5A 3TS2A 1FGUA 4JG2A 3CCJA 3RZDH 4DV4L 4LFCL 1FJGQ 1D7QA 3HOVH 2K75A 2UUCQ 4PV1C 1WCMH 2KENA 1HTPA 4QMFB 3AB9A 4LUVA 3T53B 4A3IG 1VQJA 4BBSH 3BJUA 2L15A 3HGBA 5IP7G 5IYDG 3M4PA 5GROA 4O0AA 3RNUA 3K80C 3CCEA 2E5LL 3PO2H 1GUGA 2PY9A 3GTPH 4A3CG 2IX1A 1T5EA 2CFMA 2JE6I 1VQCA 2UUBQ 1VF7A 4A4IA 1K8GA 3HKSA 3KLRA 4L5TA 2JA6G 1TWGH 1ONLA 1K0RA 4LK1C 2R93G 4LFAL 1RIPA 3MFYA 1GM5A 2I5LX 4DR2Q 4DUZQ 3NENA 4LF7L 2BDOA 2HH3A 4AYBE 2MNAA 5IP7H 3CCSA 4YWKA 2E2HH 2D62A 3PF4A 4JVYA 3CP0A 4DR6Q 3IRBA 4HJ5A 3SDZA 4DV2L 1I94L 4B3TL 5H1SE 2BE5D 1UE7A 3D31A 3TRZA 2F4VL 4JBKA 4J15A 2A1AA 2O5IC 4JI7L 4DR7L 1SE8A 2R93H 4LF4Q 1SMYC 3N6RA 1A6XA 4NXNL 4DV1L 1VQMA 4IPGA 2QF7A 4C2MH 2OPVA 1ZZJA 4OXPA 1Y69U 1WOCA 5AJ3L 1N8RC 1Z7TA 1HQMC 4WJ3M 4APVA 1L2FA 3S24A 1MJEA 4A75A 4RCNA 4DR5L 1T9HA 1N36Q 1H9MA 4C3JH 1O78A 1K83H 1TXYA 4AQYL 3LWUA 2R7DA 4KHPL 3GDEA 1X55A 1EWHA 3H3VI 4WALA 4JYAL 4P72A 5IYBG 1UE6A 2E76C 2PQAA 4YHHQ 3W3AA 3ICEA 3OTOQ 1X4MA 3G6EA 4IPDA 3DXJC 2HIVA 1JE5A 2YU9H 4YCWA 1EQRA 1G6PA 4A3LG 3K81C 1TWFH 4GOPA 4NPSA 3RZOH 4JK1C 2RHQB 1HNZL 2E3UA 1J5EL 1K9MC 4R4IA 2K14A 1YNNC 2MO0A 3KFUA 2OWOA 3PUXA 5M5XH 4X66L 1O7LA 4A3KH 4GKKQ 5IYBH 2KHIA 3I4MH 4GN5A 4POGA 3ND8A 4JI0Q 2ES2A 2WAQG 2NVTH 5BR8Q 4DV5L 2A6ED 1HNXQ 1LABA 1Y14B 1OXVA 1N32L 2HHHQ 2OTJA 2YTYA 2BL5A 3ZJYC 1VQ7A 1EFWA 1HPCA 3M4QA 1PH5A 1XPOA
chains in the Genus database with same CATH superfamily
2LSSA 2YQRA 2R7ZB 1CHQD 3A55A 1QWYA 4DR1Q 2D0PA 1LUZA 4QUCA 3CC4A 2NVXH 4EGVA 3I4LA 1ET9A 2UUBL 5IWAH 4E9JA 3ULPA 4DR5H 4FNFA 1TWCH 4YIJA 3C1EA 4M8AA 1PQXA 3S9WA 4B9XA 4DV3H 4AQYH 4DR4Q 2LMCB 3I0PA 3K5NA 2PZUA 2F0DA 3MEFA 4S3SA 4KHPH 1K8OA 2SDFA 3FKIB 4A3DG 4GOPC 5L37A 1E2VA 3KBXA 3VYTA 2BH8A 4X64L 1YJWA 1W6JA 2Q8RE 5DM73 3HKZG 3RLFA 4XQNA 1X3GA 2JA8B 2B2WA 3OWFA 4OHJA 1PDQA 2O2LD 3MAQA 1PH8A 2K32A 3IAYA 4FF2A 2O5JC 5LMNH 3D8GA 4A3EG 1TS3A 1YJ9A 2OQ0A 4OWXB 4LF8H 1N33Q 1CZWA 1PTOD 1ENAA 4DR6L 3FAUA 3WOFA 4DV7Q 1LT5D 4JBJA 4GS3A 1EYAA 4BY1B 2M8WA 2AXYA 1UAPA 5HGQA 2NTSA 3OSOA 4JW0A 1FD7D 4YCUA 1Y1WB 1TUAA 3P20A 5BN4A 2K1BA 4LF9Q 3HOWG 4DAYA 1IBMH 1HCZA 3RR5A 4L5RC 2FMRA 2WB1G 5G3LD 1DYQA 2E2JB 2A68D 3HOYG 2HH2A 4KTAA 4F7XA 1Q86C 4Z9CB 1QILA 3J81E 2CQAA 2ANRA 1VQ8A 3S1RB 1Q82C 5CV7A 2EPBA 4HIDA 1VQPA 3SR1A 4X62L 2SNSA 4QL5A 4QY7A 1HZBA 1F9RA 2V4DA 1CSPA 2YV5A 2NYZD 3SEBA 4LF5Q 5J1ZA 4LJZC 5C4ZA 5KNDA 3STBC 1KL9A 4DV5H 1GUNA 2UXCH 1I4HA 2RKSA 3GD7A 4A3EH 2CW0D 1EIFA 1ESFA 1M4VA 1X3EA 1N32H 2BCOA 2K04A 3U4ZA 1MHWC 1KIXA 2CHBD 5IYCG 4NXMQ 1N36L 3ND9A 2IJ0A 1AE2A 1TS2A 1YHQA 1SR3A 2PW7A 4JI1Q 2IY5B 3NE5B 2EIFA 1TY2A 1LT4D 1BCPF 3MXPA 4F88A 1XMQH 1D8LA 4LW1A 3HOWH 1YJNA 3BDOA 4DUYQ 2L12A 2F03A 3CCMA 2L55A 2X69A 2B2WC 1PHJA 2CTKA 4ZUJA 2OXPA 2KECA 5GAHC 1HR0H 2VB3X 2UU9H 4XQJA 1SYFA 5M5YB 1WE8A 1KRTA 1KC8C 3S14H 5JJKA 2F0IA 3NBHA 2K05A 4YHHL 1V8QA 5IT9c 5C3EG 5CYUA 4CKBA 1KAAA 3MEHA 5C4JH 4BA1I 1V1QA 3S17B 2UXDQ 3MXGA 4HJAA 1OXXK 2A69D 2VQFL 5JJIA 4BY7G 5HY6A 1STNA 3A56A 1CA6A 4X64H 1QNUA 4GN3B 1J8IA 2BDNA 1AN7A 2L11A 1X6OA 2LXJA 4ZLTF 1EY6A 3EIVA 1JWMD 4GKJQ 3PCOB 2I0QA 2EYPA 1PMRA 1P8LA 2K52A 3U9OA 3S1QB 2K33A 4DAVA 3FHWA 1FVIA 3ONAB 2GA4B 3Q8DA 1JJCB 1BQQT 4NZTM 4QJFA 4LFBH 1B1ZA 3Q24A 4GNXB 3J80L 1H9JA 4FXKC 4IJLA 2CTFA 1HFNA 3G6JB 4GKKL 2E74C 1HA5A 3M3YB 1Z6HA 2UUAQ 4LF6H 3F2DA 1HZCA 3CHBD 3K7UC 2B29A 2MGSA 1K73C 3JAMc 4JI3Q 5LMUH 2ANNA 4R4QA 5C3EH 1EL0A 4K0KQ 1Y8OB 1EQQA 3H3VH 5BR8L 3D6WA 4NDXA 1F0XA 1HNXL 2K5NA 4UP9A 4JI4Q 2NVQH 3MZ5A 3PIOA 4ZQ3A 2ZTCA 5C4XB 2HHHL 4MIUA 4J1MA 4A3FB 4JI2Q 4BY7H 3KBGA 3TS0A 4X62H 1QCBD 1JJGA 1U0LA 1CI3M 2EY2A 3N52A 2N49A 4LWCA 1R9TH 4A3GB 3J80W 1MKHA 4B3SQ 1CKNA 1IBLQ 4K5VA 4MHEA 3F2BA 3P75A 1LTSD 4DR1L 1G2TA 1EYDA 4QMGA 4JI6Q 2JQOA 1I3QB 3EQLC 4CDFC 3KF6A 1W2BA 3KLSX 4IFDG 1GUOA 3NTKA 3P7JA 4ZCKA 1EY8A 3AQQA 2CH4W 2F3WA 2QDBA 1H9RA 4R8IA 4A93B 3EVQA 3SK4A 1CM9A 1NUCA 1UNSA 1U4LA 2Z6KC 1L1OB 4DR4L 2Q2TA 3HOVG 4H44C 1MBYA 5FKAC 1X56A 1BCPC 2Z4HA 5KYLA 1K3BC 4O1NA 3Q23A 2Q2IA 3DMUA 5IY0A 5D3DA 3D4RA 4K2LA 1IBKQ 3BZKA 3VKEA 3CPWA 4PZ8A 5C0XI 1KRSA 1E3PA 1Q8IA 1E24A 1STYA 2JYOA 3U9SA 3SK8A 4HCSA 1ZEQX 2MJ8A 3T1YL 4YWMA 3VYSA 3K6OA 5JPNC 1C9OA 1PA6A 1Z9FA 4BA2I 4BXXH 4JI8L 2F52A 4A76A 1VQFA 4OONA 3BDCA 1I4PA 2IPKD 3S2DB 2VQFH 2M2LA 1N33L 4DV6Q 3HFZB 3MA2B 2AKWB 2DJFC 3AYHB 1W3SA 3I8ZA 3CF5A 2QEJC 5KNBA 4OX9H 4L5SA 4LF9L 2PQEA 1BNZA 3OOCA 5M3MH 1PFSA 2Z4IA 5T1IA 1XNRL 4F8MA 1DXMA 3GTQH 4QUFA 4PMWA 2PT7G 1IW7C 2DNEA 4WJ4A 4J8QA 2R92H 1R4QB 1IYJB 2KA7A 1I6UA 2K5VA 1YVCA 5JEAG 1XMOL 1ENFA 2MHVA 5M5WH 1WHRA 2B63B 4OO1I 3NWSA 1GHKA 5CBEE 1N34Q 3KDFA 4NBQA 1NXUA 3QB3A 1Y1VB 1AEXA 3ULJA 4HMJA 5JOBA 3WWVA 4U673 5ELEA 2WV6D 1I6HB 2B2TA 1DOLA 1HFGA 1MSHA 1YNJD 3MXNB 5IIFA 2VQEL 5I4DA 4HMIA 1Y8PB 1XNQH 2F0HA 1U4MA 1S03G 2VL6A 1RCVD 1V1OA 5ELOA 3NQTA 4YCVA 2YYZA 4JI1L 2FJ2A 1PH7A 1PVOA 4DF7A 3HOXG 4K5XA 4OCHA 5GAEC 2KBNA 4OGQC 2UU9Q 3I2ZA 2K50A 1U5KA 2P5ZX 3PIO3 1BVSA 4DA2A 1E1OA 3T51B 4JI5H 1IKMA 1JOKA 5JEAH 2R7ZH 1YZ6A 4CJ0B 5FOBB 4PMBA 1TVXA 2BOSA 4C1NI 2WIIB 2WFWA 4B3MQ 3PSIA 2FHTA 1KD1C 3PUVA 2KUMA 4BY1G 3GTGB 3A8JE 3UE1A 4R9WA 5IT9E 4DK3C 2VW9A 3CXCA 4RHSA 4GLVB 4RHRA 5EGTA 2L5TA 4GKJL 2MFIA 2Z0SA 3J81c 1DTJA 1YIJA 5D65A 3SB1A 3FPUB 4FDBA 2HT1A 1PRTD 3T1YH 1GKHA 3U4VA 4HSVA 2D9IA 4FJSA 4JI8H 3PV0A 3FKIH 4QF4A 3VR6A 2ZM6Q 4KY5A 1XJVA 2EOTA 3ITPA 4A3MB 3HOXH 5EQ0A 1EY0A 1PH4A 2RA4A 1ODHA 5E4XA 4GZYC 2JA8H 1SFOB 1V9PA 3I90A 4X65Q 4HIKA 4OWTB 2QA4A 1E0BA 3VYRA 1TWAH 3K7AB 2C9OA 3JAML 4KHVA 5JVH3 4LFCH 2FXQA 5C4HA 3RLNA 2B2TC 4K0KL 3CC7A 2GVAA 1KXLA 1XNRH 4CBVA 4JI4L 3P1HA 5FLXc 1HA6A 5CV8A 1IHZA 1FL0A 5M3FB 1WI5A 3BZDB 1LLRD 4JC0A 1SNOA 4IO9A 4BY1H 2E8GA 3NTIA 2F0JA 1A62A 1NCVA 2PQAB 3GV3A 1D5XC 4RKLA 3VR5A 1Y1WH 4DV0L 3CU7A 1XMOH 3MVVA 4B3SL 2CTJA 2A6HD 2HQEA 3KF8B 3JAMW 4JI6L 2Z6BA 2E2JH 3K5MA 1LYLA 1CTMA 4IPHA 1XX8A 3S16H 3VA7A 1PH1A 4H0LC 5GADC 3S1RH 1B9NA 3J80i 2NZOA 1ASYA 4RGMA 4A3KG 1KTKA 2N88A 3DM1A 3I73A 3D6CA 4CKEA 4TVAB 2ALYB 3I4MG 3H6MA 4G57A 3UDXA 1A2TA 4G08A 5ELNA 3FDTA 1GD7A 1FR3A 5COYA 2Z1CA 4HIOA 2CWPA 3H0GB 3QOLA 2ZT9C 1PH2A 1BBUA 4DK0A 1A63A 2AMCB 2WKCA 1F2MA 2KCNA 1M1KC 2RSNA 2K01A 3B6YA 2QDLA 2LY7A 3A7LA 4E6IA 1VQIA 2EY6A 2A74C 5C44B 1CQFA 1Y8NB 5I9PA 3SVMA 2N8NA 4POFA 1FYCA 1QOHA 4IJHA 2WAQE 5EBDA 2BE5C 4ZUIA 3CAMA 3PO3B 3CQZB 3DEPA 1VMCA 1TU2B 2R61A 5EBCA 1JOQA 5LL6X 4DR3Q 1SAPA 3HOZB 5M5YH 1WFQA 1LT6D 4XT3B 4DV2H 4BBSB 4CJ2C 4B3TH 1QUQA 3LNNA 4NB3A 4L63B 1ZYRD 3H3VC 2ZQEA 1BOSA 1EQTA 4R8NA 1FJGL 3PO2B 3S17H 2LTLA 1BXTA 1WYDA 3IL8A 1XXGA 4HJ7A 4KD4A 1HUNA 4RGNA 2LFNA 4DR7H 2UUCL 2VS1A 2XWBB 1LO5D 2D5DA 2N55A 3AU7A 4A3FG 1VQ6A 4JI7H 3CCLA 3M7NA 2JJQA 5IOCA 1B9MA 2CCZA 4IFDJ 3T1HQ 2LRRA 2JXMB 2VUMB 2NVYB 5C3WA 5ELFA 2F3IA 2Q2HA 2F3VA 1EIGA 2B3GA 3CMEA 2OPUA 1EFID 3S1QH 3GTLB 1TS4A 1A0IA 4LUZA 4ZRZA 5C0XH 2M6QA 1KHMA 1Q81C 1CZGA 2G5DA 1HZAA 2CTEA 1EU4A 4DNIA 2XSCA 2F0QA 1QZGA 2QNDA 3HKZE 5JPMC 4KKSA 3M3YH 4X3KA 1SBBB 4K2KA 4DV0H 4A3IB 1UEAB 2ICEC 3TEHB 4C3HB 1I5FA 2GN5A 3HOUB 3T56B 1EIYB 2MUYA 1Q12A 1JR0D 2AHOB 5CBAE 5HURA 5ELBA 5EPJA 5C4XH 1PZJD 3OHXC 1DZ1A 4A3FH 5IP9H 4DR2L 1RD9D 1EIHA 5CMDA 3E6ZX 4RAUC 1BDOA 4DUZL 1VQAA 4DKAC 4JYAH 3WOEA 2NZHA 4O42A 2HQLA 4IURA 2J0TD 1PTOF 1NAPA 1XWEA 1SNMA 5BN5A 1BBWA 4JVHA 3L2PA 1I50B 4DAYB 1L0XB 2AUKA 2Y0SG 4XTCS 1PFNA 1F9PA 2MP1A 5CV6A 4JV5Q 2WB1E 1WTJA 3DEOA 3I7FA 4B3ML 2JA6B 5C5LA 3UE0A 3M7GA 3M9BA 3OIPA 1JB3A 2P2RA 2KHSA 1P16A 1C8CA 2PPBC 4A93H 2LS01 1OTCA 5G3LF 4BBRB 3DM3A 2CVRA 3NEMA 1D1IA 1PYSB 1QNKA 3J81L 1K3RA 2GVBA 1X9ZA 2RCFA 2WKDA 2IT1A 1EOTA 2RDFA 3CCVA 4H8AA 1J5EH 1HNZH 4RFBA 1STBA 2D0OA 3NWTA 4I7ZC 1CFMA 1KABA 2EJFC 2CWHA 1BKBA 1GXDC 1Q90A 4OEMB 2FPHX 4R4TA 1WTVA 2A6EC 1S40A 4H7BA 4PZ7A 4LF4L 4X66H 1FKAH 4YY3Q 2UXBQ 4X65L 1IYVA 4DK6C 4C56C 4HEDA 4NW2A 4ODGA 1LACA 2B63G 4BS9A 1PFMA 4DV4Q 4LFCQ 2KCTA 2EQSA 1FJGH 3J81W 4G7OC 4AYBB 1J4WA 3JC66 2EDGA 2B2YA 3W2DA 3S2DH 1EYCA 2UUCH 1LT3D 1DT4A 1F77A 4KN7C 5EKKA 4N8X1 3F2CA 1OXSC 3M4OB 4P73A 2E2DC 1SMXA 3U58A 1DD2A 2I46A 2XRQD 3PF5A 1RJTA 3A7AB 2E5LQ 2F0GA 1HNWQ 5FLXE 5CV9A 1CA5A 4OIKA 4U68A 2EJMA 2QGQA 2F0EA 4IQZA 3X3NA 1BCPB 3I4NG 1SDFA 1C4QA 2L0CA 3BG3A 3LX0A 1SNDA 1LTGD 3CMAA 2UUBH 4KKUA 2N78A 5J3BA 3H15A 3FMCA 2E2IH 4ALPA 1I4QA 3HZXA 4B3RQ 1O80A 3IFDA 4Q0FA 2B63H 3OTOL 4P71A 2K4KA 3UDIA 4TSSA 1T5XD 4LFAQ 1I6HH 3PUYA 4DR2H 1L0WA 1EY7A 2J7ZA 4LF7Q 1KDBA 2HCIA 1E22A 4QIWE 2EYLA 1SRUA 3ULLA 4GLAC 1PTOC 4HSPA 4LAAA 2F0KA 2XTIA 1E1TA 2BA0A 4G7ZC 3UOEA 1RF2D 5AFWA 1VQKA 2V1CC 4YWLA 3NBIA 2NVTB 1JQYD 1S5FD 2CWAA 3NELA 4L5QA 2B2UA 1I4GA 5KYIA 4XDXA 4WFN3 4KLKA 1V1PA 4DR6H 3I4NH 2JA5B 1I94Q 3A5ZB 3GP7A 1UUPA 2A68C 2FINB 2G9DA 4OD6A 2B2YC 3CCUA 4FJUA 3F1ZA 1A3VA 2F4VQ 1KQSA 3NCVA 1H9SB 1CKNB 4B08A 3TP7A 4JI0L 1MI2A 2PZTA 1YHAA 1V9NA 1IL8A 4DR7Q 4X3TA 3KF6B 3GTJB 1GHJA 3GTGH 2RCNA 4G7HC 1GUSA 1K8AC 3GV6A 4EQNA 2NTTA 3NHHA 4IUPA 4XIGS 2ZJRA 3T1HL 5CV4A 4A3JG 4LF4H 2CW0C 1CQVA 2FFKB 3AEVB 2IW3A 4NXNQ 2F1MA 4DV1Q 3S1NH 2TMPA 1VIHA 4A3BB 1AN8A 4TKOB 4NZRM 2H4OA 1VQLA 4BXXG 3G7LA 2B8GA 5J39A 3WDNA 3TP5A 2CTMA 1E2ZA 3S2HB 3KLSA 3MWYW 1U4PA 1O7IA 4LMQD 5IWAQ 1F9QA 1IXRA 4C3IG 2PNHA 4DNTB 1S5ED 4KY7A 1SFOH 3J81j 4GNXA 4DR5Q 2F0VA 3NUCA 5LHY1 2MO1A 1AFPA 1N36H 3K7AH 4CDDC 3A74A 1VF5C 1SYDA 1HRJA 1S4ZA 4MTKA 4DV3Q 4AQYQ 1RTOA 5M3MG 4EVOA 2JZXA 2OQKA 3OW2A 5IGEA 2K5DA 2CPMA 4KHPQ 4KD3A 5C3XA 1Q46A 1E2WA 3J7A5 5M3FH 3A54A 3FEWX 4UP7A 2R92G 3J7ZC 5A35A 4JYAQ 4ZK9B 3RLOA 2JEBI 5C44G 2A69C 4A3JH 2IL8A 1R4PB 1PXUA 2X6LA 1I4RA 2B2UC 4YHHH 3GQBA 2JA7B 3PO3G 5FLMG 5LMNQ 2AWOA 2PI2A 3OTOH 1C7YA 4GN4B 4X3UA 2IWHA 3I72A 4R1JA 1SE3A 4FP5D 1B53A 3AFPA 1JJ2A 3NXWA 3L3OC 1WTRA 3HOZG 5E7NA 1M90C 1EOVA 3BVZA 1YITA 2PMZE 4LF8Q 3LGJA 4A3DB 4DV7L 4O2DA 1K28A 4EQ5A 1F2LA 2MPMA 2Z9HA 1ILPA 4C3IH 2QKIC 5I9OA 4QQBX 2WACA 4P75A 1X0AA 1HNZQ 1L1OA 3R8BA 1A8VA 1HTLD 2KOLA 3TQYA 3K5LA 3H0GH 4GLXA 4UAIA 5GQOA 3A8IE 2Q2UA 2X06A 1PLFA 1IBMQ 2HIXA 3KDFB 1B44D 2ZTDA 2NUCA 2ENBA 2VUMG 4P74A 4K6LA 3CRKC 4HJ9A 1UG8A 2D9UA 4YY3L 2UXBL 5ISRA 3A8KE 1ZKOA 1AH9A 4GKKH 2FMMA 3TMEA 5C44H 4I65A 5BN3A 2R7ZG 3W1BA 3UDGA 3I55A 4Y7NB 4LF5L 1JICA 2VB2X 1YNXA 1MSGA 4JBWA 1PV4A 4JI0H 2VZAA 3PO3H 5FLMH 3CQZH 2RHSB 4GNXC 2F0WA 4DV5Q 2UXCQ 5BR8H 4K6DA 1HNXH 4KKTA 2JA9A 1SMYD 4XYQA 1SYGA 2EYFA 3HOZH 1N32Q 4DN4M 1TWHB 2F0OA 2HHHH 5EAYA 4CKCA 5DAUA 3BDLA 3HOYB 1STAA 3J81i 5A2QE 1O7YA 2YTVA 4C3HG 3I56A 4NXML 3BVMA 3V96A 3HOUG 4UY8C 5IGDA 1HNWL 1ZXTA 1BR9A 3S15B 3FKIG 3BYTB 5M9OA 5CGKA 1XMQQ 4DR1H 1B7YB 3KJOA 5JAVA 3H91A 4DUYL 2KJXA 3R93A 4WANA 2DNCA 3GABA 2XIWA 1S5DD 2JA8G 5IODA 2VUMH 2NVYH 1HR0Q 3PUWA 4LNQA 2R3ZA 3AMUA 2LKVA 4B3RL 5IT9L 1FGBD 1FNUA 2L1BA 1J9OA 5K36G 4DR4H 4XYOA 2VY3A 2EE1A 4NP5A 1VDZA 2F4IA 2F0PA 3GTLH 5JVG3 3H09A 1B8AA 4I7AA 2A5HA 4WRDA 2UXDL 1I4XA 3EZJA 1HH2P 1PRTF 1B50A 1RKNA 4NKLA 4BBRG 1K8MA 1FNVA 4X64Q 4DPGA 1L1OC 3CKIB 4L6TB 1TR5A 2MQHA 2NN6I 1Y1WG 1EYGA 4A3IH 3I91A 3KDGA 4DXFA 1RHPA 5IYDH 1XPRA 4C3HH 1EZ8A 3H94A 5IE8A 3L7ZC 3HOUH 3G4SA 3VR2A 5IT9W 2EYHA 1E7ZA 1GOZA 1TKWB 2EXZA 4N9PA 5C3EB 1VQHA 4QCLA 4A3CH 1JB7A 1N33H 2EVBA 1D6EC 4LFBQ 3F8TA 3O13A 4DV7H 1GJXA 4JCVE 4BY7B 3OMGA 3R2TA 3QIAA 3S1MB 1VCIA 4RGOS 2BA1A 4AYBG 2UUAL 1YNND 4LF6Q 3K59A 4IUNA 1I50H 5JJLA 3RUZA 4LF9H 5LMUQ 4JI3L 4H02A 2ICIA 4DU9A 3E9HA 5K36H 4DNRB 2JA6H 4AM3A 3RD4A 1TT2A 3GTOB 3E0EA 3I4OA 2VNUD 2RF4A 4BBRH 4JI2L 1EC6A 1EY5A 1X3QA 1QZHA 2A8VA 4X62Q 4DFAA 1CKMA 2QILA 2DGYA 4V0BA 5EKIA 1YNJC 4QIWB 3GTKB 4LF5H 2XN9C 1IBLL 1KLUD 3MXUA 4PG3A 4K5WA 1VQOA 1STEA 3NK9A 4RGTA 4KY6A 3K8AA 3PQIA 1X65A 3MTSA 4IN3A 5DLQE 1CK1A 1GUWA 5IWAL 2CTLA 2QEXA 2CQOA 2VQEH 4NXMH 4PMCA 2KEDA 3W5OA 1S3OA 1X9NA 3ZYYX 4GOPB 5I2YA 2O4XA 4CDCC 4DV3L 1PZID 3GTMB 4JI1H 1NMGA 1CUKA 1SE4A 1UE1A 4AH6A 1RODA 1GVPA 4DUYH 3M4YA 1EWIA 1PZKD 2M00A 5EPKA 1MIUA 3M4OH 3FP9A 4ZYSA 1IBKL 2JP1A 1QJOA 1SN8A 1B4OA 3RMHA 2OTLA 5IGGA 1QUQB 1MJCA 2NB0A 1EWCA 2F0FA 2OT2A 2FMCA 2PYKA 1A3UA 4ZKBB 5HGTA 4P2CB 3URYA 4M1UB 5LMNL 3RZDB 5FO7B 3SE0A 1EU3A 1ML0D 3KF8A 5C0XG 3HOVB 2DN8A 2UXDH 1X3FA 2HCCA 5TSSA 2HUGA 1PRTC 1A15A 3DLLA 2JA5G 1WCMB 3GTQB 2VQFQ 4LIJA 5FK9C 4ZAIA 4LF8L 1ZZKA 1BF4A 2AWNA 3EN2A 4DV6L 4B8TA 1IKLA 3TSSA 4H13C 1RL2A 2NWGA 2CPQA 2EY1A 2PI2E 3C2PA 4DAMA 3L0OA 4GKJH 4RH6A 4HCEA 3X3MA 4OX9Q 2AQ1B 1GO3E 5M5WB 2ZXOA 4CHTB 2OCEA 1PH9A 1NBWA 1EEID 1IBML 1IZ6A 3LWEA 1JT8A 4RMFA 1DJRD 4R4CA 3GTPB 5C4XG 5LMNW 1NTGA 2QW7A 5IP9G 2EYJA 3UDFA 4KMUC 4DK1A 1KLGD 1X3PA 1A3TA 3CCQA 1EQVA 1XTCD 4V190 4EC5A 4FF3A 1WD1A 4A3BG 2CKZB 2ZXPA 2ASBA 1D5MC 3J80c 4A3GG 3CRLC 2KQ3A 4XT1B 2X6GA 3RN5A 1CSQA 3QD7X 2UUAH 3A5UA 3NPPA 2NZ1D 1ICWA 1LTLA 4JI3H 4B9WA 1VQ9A 4ID6A 1H9KA 1D5ZC 2KCMA 3IKJA 4K0KH 1TWGB 4IALA 2UXCL 1N34L 5I6WA 4AIMA 3V69A 4JI4H 2CWFA 2CH4A 1IL2A 2A6HC 3HRZC 1B3QA 3NQIA 4A93G 2JA5H 3IFTA 3AFQA 4JI2H 2EY5A 1UE5A 4A3LH 2A73B 4OO1G 2DGRA 2KEEA 2PMZB 1XNQQ 4J6HA 1CHPD 1LTAD 1QB5D 3STBD 5K5PA 1VQDA 4IFDI 3SGIA 5FJ8G 3J7AV 4B3SH 5FO9B 2K7VA 1IBLH 3VDYA 1PH6A 1KDAA 2Y3MA 2Y0SE 3OW7A 1LM0A 4Q5VA 4TRDA 1XMQL 5CV5A 4JI6H 3GTJH 1YBYA 2E2HB 1ET6A 4JOIA 1WJJA 5CC4A 5JJZA 1WVNA 5IGBA 2PNRC 4ME5A 1JORA 1HR0L 2UU9L 1G51A 4OWWB 2JA7G 1J6QA 2AQ2B 5DEHA 3VR4A 2SOBA 4A3BH 2R6GA 4JI5Q 4A3GH 1YHBA 2LXKA 1CT1D 2KVMA 3S2HH 1SXTA 1I3QH 4JBMA 1PTOB 1X4NA 3CD6A 4PZ6A 4IOCA 2Q8TA 3KYHC 1IBKH 4FXDA 1WD0A 1JC7A 2EJGC 3FPPA 2XGTA 3HOXB 1L0YB 2KHJA 3U50C 2RQXA 3BZCA 2R93B 1LTID 2M9VA 1S5BD 2F0UA 1N9WA 4OO1H 4PNYA 3PMFA 2PCFB 4JPBW 1WTOA 1HR0W 1TWAB 4UPAA 5JEAJ 4ME3A 1I6VC 3T1YQ 1YEZA 5LL6b 2NN6G 1ZYRC 3T4AC 5FJ8H 4JI8Q 3F2UA 1KNAA 4X6AH 4C2MB 1IYUA 2ZM6L 3DWAA 1Q8KA 1NJIC 1K0SA 4LFBL 4DV6H 4EQPA 3KJPA 5C6AA 4LUOA 2MJHA 1JE4A 1G91A 1ESRA 2K6AA 4KJNA 1KHIA 1NSNS 1PH3A 4WORA 3SXHA 2JA7H 4C3JB 4LF6L 1S72A 2PO4A 3EBEA 1VQEA 3SK5A 2I5HA 1G6ZA 5LMUL 1K83B 3OYYA 1II3A 5GAGC 2XVSA 2IX0A 1Y1VG 1KAWA 5FLXL 1XNRQ 1X54A 4A3DH 3S16B 2O4CA 5F2DA 1TS5A 2E75C 1NE3A 1O7ZA 2F0SA 5EPLA 2JK8A 3ERSX 3ER0A 3NBHB 3QJYA 1ZTGA 1HZ9A 2ATWA 1EUJA 5IGCA 1XMOQ 2Q8IB 3KOJA 1Q1EA 2H5XA 4JOIC 1HQRD 1SNPA 3D4DA 3MFGA 1V8CA 3I3CA 2ZTEA 1N34H 2NN6H 3HS0C 3EFXD 1RDPD 3I70A 3PGZA 3QO2A 4FF4A 1Z47A 3G71A 3GKUA 5KEEA 2YU9B 5I6YA 5FLXW 3VR3A 5KIXA 1DCZA 3K0XA 3OWEB 2VQEQ 1WTQA 1XYIA 1HJPA 3JAMi 1TWFB 2B8FA 2IX3A 4Y7NH 3EROA 2F0TA 3RZOB 1SROA 2I5MX 1B70B 1ICFB 4KI0A 4FYDA 4R4OA 3TREA 4EX5A 1U4RA 1Y1VH 1JMCA 4KJOA 4RG1A 1V1PB 1TWHH 1VS0A 4TQUS 1S5CD 5I2XA 4MNOA 3HOYH 4KK7A 1BUVT 2K28A 4UP8A 4DUZH 3CPFA 3RN2A 1SLJA 1BCPD 5M5XB 4HAEA 4A3KB 1VIGA 3U1KA 3DWQA 3M85A 2DUDA 2JSOA 2TSSA 3KLWA 3S15H 1SYBA 2F0NA 4HR7B 3EA6A 3CC2A 1AE3A 1WTXA 3I4MB 2EXDA 3PUZA 3D0FA 4A3MG 1WVLA 2OF1A 1ENCA 4B3MH 2Z6KA 4RKBA 4XQQA 1QVCA 2N3SA 4DR3L 2JVZA 2JEAI 1LTRD 4DV2Q 1ASZA 2VKCA 1VQGA 4B3TQ 4IZ8A 4OELB 3NTHA 1XTDA 5IYCH 1OXTA 1SSOA 4OX9L 1M8AA 3OPOA 1D2BA 5ELDA 1EY9A 2K5QA 5D3IB 3TP6A 3CCRA 5M3FG 3J7AF 4KHZA 1CKOA 4JI7Q 2ZM6H 3E9IA 2NVXB 1QVFA 1SNQA 4IUTA 1SE2A 5KNCA 4X65H 1TWCB 1Q1BA 2RDGA 1HUMA 1LTTD 4IOAA 1IW7D 4Y52H 4RA8A 1G291 1SEBD 5AJ3Q 4A3MH 2D2CC 5E1FA 2WAQB 3J80E 1UEBA 1XPUA 1NMFA 1TIID 2G8YA 3T16A 1PYBA 4UHVA 3NP8A 3S1MH 1XNQL 2L9HA 4FXGC 2RBMA 4DV0Q 1UWVA 1VQNA 2A19A 3SK6A 4N9TA 3MC0B 1MGSA 3H0GG 1DGSA 2KCCA 1H9SA 1VQBA 2XNAC 1H95A 1NY4A 5T1GA 2HD3A 2AUJD 1K1GA 3GTOH 2J4XA 4PQXA 5C0XJ 4QGUA 1JWUD 1QVGA 3CW2C 1MSZA 1G2SA 3TZUA 1VQ4A 1EZ6A 3KDKA 1WTPA 3QR8A 3K57A 1C48A 3V2TA 2F0MA 3TDQA 1PFBA 3AEVA 4IPCA 2HDMA 4JI5L 4L8JA 3GTKH 3BU2A 4ZKCB 1GUTA 1NR2A 1AZQA 2XRSD 4KN4C 2YTXA 1WCMG 2R7FA 4JV5L 1OXUA 2DJGC 4K14A 4MTNA 3TP8A 2ZJPA 2H1EA 3HP3A 4NMZA 4BBSG 2K5HA 1V43A 1YI2A 1S20A 2ZJQA 2C35B 3W1GA 2PQUA 4MZ9A 4QB4A 4WJWA 3G48A 2G9HD 3GTMH 3PO2G 5EJWA 1ZZIA 3HKZB 1C0AA 2IHFA 1PYWD 2IHEA 1B2TA 1J5EQ 3PIPA 1DOKA 4HIMA 1Q7YC 1MD2D 3DUZA 1EEFD 3A0JA 3TN2A 4ABNA 2BH2A 2Y0SB 5C5MA 3K5OA 4A3EB 4DR3H 1VQ5A 4HJ8A 4CDEC 4IFDH 2PW5A 4K8JA 2SEBD 4UDUC 4MN3A 3QG1A 4X66Q 2WP8J 1J5KA 2ID0A 3GO5A 5A2QL 3TS2A 2EZVA 1FGUA 4JG2A 3CCJA 3RZDH 4DV4L 1STHA 4LFCL 5D14A 1FJGQ 2PZWA 1D7QA 3HOVH 3E5SA 2K75A 1ILQA 2UUCQ 4PV1C 1WCMH 3HOWB 2KENA 3C46A 1HTPA 4QMFB 3AB9A 4LUVA 1STGA 2WB1B 5ELCA 3T53B 3T1HH 4A3IG 1VQJA 4BBSH 3BJUA 2L15A 3HGBA 5IP7G 5IYDG 2E2IB 3M4PA 5GROA 4BWGB 4O0AA 3S14B 1SNCA 1BBXC 3RNUA 5J22A 3ERQA 2FFMA 3K80C 4G4KA 3CCEA 2E5LL 3PO2H 2DY8A 3BYYB 4IUUA 1GUGA 2PY9A 3GTPH 4A3CG 1U9RA 2IX1A 5A2QW 1XRHA 5C4JB 2K5WA 1T5EA 4RCOA 2CFMA 4JVZA 1NNXA 2JE6I 3EJIA 1VQCA 1JOOA 2UUBQ 1VF7A 2F0LA 4ULLA 3E0JA 4A4IA 3Q0AA 1K8GA 1LTBD 5E4WC 5NUCA 3HKSA 2L4NA 3KLRA 3KK7A 4L5TA 3V05A 2DY7A 1TWGH 4IUVA 2JA6G 1ONLA 3QWNA 1JCKB 3C1FA 3K58A 1K0RA 4LK1C 2R93G 3OETA 3L9AX 1RIPA 4LFAL 3MFYA 1GM5A 2I5LX 4DR2Q 1BO0A 4DUZQ 3NENA 4LF7L 3GR5A 3I4NB 2BDOA 1F9SA 1PRTB 3MXNA 5IGFA 2HH3A 2NBFA 3Q6SA 4AYBE 5DNFA 2MNAA 5IP7H 1DOMA 5CR3A 1HHVA 3CCSA 4YWKA 1AP0A 4CJ1B 4JV5H 2E2HH 2D62A 2AQ3B 3J7YW 3PF4A 1QE6A 4JVYA 2NVQB 3K0YA 3CP0A 4DR6Q 3IRBA 1SJED 4HJ5A 4C3JG 3SDZA 4DV2L 5EKLA 1I94L 4B3TL 3OSSD 5H1SE 3QOJA 3S1NB 3DHQA 2BE5D 1UE7A 2Z8LA 3D31A 4KV6A 3TRZA 2F4VL 4JBKA 1JWSD 4J15A 1R9TB 2WINB 2A1AA 3E3XA 4K8IA 4ILWA 1WTHA 1PTOH 1OO9B 3VYUA 5FO8B 1Q3LA 1TY0A 4JI7L 2O5IC 4DR7L 1SE8A 4B8CD 2R93H 5DT9A 5CORA 2C5CA 1SYCA 4LF4Q 1SMYC 3N6RA 1AZPA 1KNEA 3D3RA 4YY3H 2UXBH 1A6XA 4NXNL 4DV1L 1TQOA 3J7AK 1KDCA 2B2VA 3R2IA 1VQMA 4DV4H 3D4WA 3FVQA 3VA5A 5LL6S 4IPGA 2QF7A 4C2MH 2RDHA 2OPVA 1ZZJA 3NSWA 4OXPA 1Y69U 1WOCA 2EYOA 5AJ3L 1WTWA 1LV9A 1Z7TA 1N8RC 1HQMC 2SNMA 3MHBA 5KGUA 3PIP3 4WJ3M 4APVA 5DM63 1L2FA 3S24A 4DGZA 1MJEA 4A75A 4RCNA 4IUQA 4DR5L 1T9HA 3JAME 1N36Q 1H9MA 4C3JH 1O78A 4A3JB 2LTMA 3RF2A 2QCPX 1K83H 1TXYA 4AQYL 2E5LH 1HNWH 2A1SA 3LWUA 2R7DA 3FRPB 1X32A 1W6KA 3HEJA 4KHPL 4XXEA 3DWPA 3GDEA 3SHLA 3BVGA 2I07B 4OL7A 4N8FA 1X55A 1EWHA 3Q22A 3H3VI 4WALA 4JYAL 2OEOA 1NR4A 4P72A 2RSOA 3TBIB 4C3IB 1UE6A 5IYBG 2E76C 2PQAA 1AW7A 4B3RH 4YHHQ 3W3AA 1A2UA 2EYMA 3ICEA 2K03A 3OTOQ 3KUPA 4FO2A 2B39A 1X4MA 3G6EA 3T13A 4IPDA 5M3MB 3DXJC 2HIVA 1JE5A 1EY4A 2YU9H 4DAPA 4FVMA 4YCWA 4LFAH 1EQRA 1G6PA 4A3LG 1RTNA 3K81C 4LF7H 4X3SA 3OIQA 2R92B 1TWFH 1VBIA 4GOPA 4NPSA 3RZOH 4JK1C 2RHQB 1HNZL 2E3UA 1J5EL 2LF0A 1K9MC 4FF1A 3HG9A 4R4IA 5E3FA 2K14A 1Z2IA 1YNNC 2MO0A 3KFUA 2OWOA 2B2VC 3PUXA 1SJHD 3UI2A 2JN4A 4PDBA 1SYEA 4OIJA 4RWSC 1B3AA 4X66L 5M5XH 1I94H 1O7LA 4A3KH 4EQOA 3C3LA 4GKKQ 3R3OA 2K1HA 2XWJB 2F4VH 5IYBH 2KHIA 3I4MH 4GN5A 4POGA 1F2YA 3ND8A 4CGYB 4JI0Q 4HTHA 4C1NK 2ES2A 2WAQG 2NVTH 4HN7A 1F2ZA 5BR8Q 4DV5L 1VMPA 2A6ED 1HNXQ 4DXGA 4F87A 2VXWA 1LABA 1Y14B 1FNWA 5KRUA 3BS1A 1OXVA 1N32L 2HDLA 2HHHQ 1DONA 2OTJA 1D1KA 2YTYA 1QG7A 1G8ZD 1HXYD 2RVLA 2BL5A 4NXNH 4DV1H 2ZXRA 3ZJYC 1VQ7A 1EFWA 1DM0B 3TZDA 1HPCA 3M4QA 3OMCA 1PH5A 1SEIA 1XPOA
chains in the Genus database with same CATH topology
2LSSA 2YQRA 2R7ZB 1CHQD 3A55A 1QWYA 4DR1Q 2D0PA 1LUZA 4QUCA 3CC4A 2NVXH 4EGVA 3I4LA 1ET9A 2UUBL 3ULPA 4FNFA 1TWCH 4YIJA 3C1EA 4M8AA 3S9WA 4B9XA 4DR4Q 2LMCB 3K5NA 2PZUA 2F0DA 4S3SA 3MEFA 1K8OA 2SDFA 3FKIB 4A3DG 4GOPC 1E2VA 3KBXA 3VYTA 2BH8A 4X64L 1YJWA 1W6JA 2Q8RE 5DM73 3RLFA 3HKZG 4XQNA 2JA8B 1X3GA 2B2WA 3OWFA 4OHJA 1PDQA 2O2LD 3MAQA 1PH8A 2K32A 3IAYA 4FF2A 2O5JC 3D8GA 4A3EG 1TS3A 1YJ9A 2OQ0A 4OWXB 1N33Q 1CZWA 1PTOD 1ENAA 4DR6L 3WOFA 4DV7Q 1LT5D 4JBJA 4GS3A 1EYAA 4BY1B 2AXYA 1UAPA 5HGQA 2NTSA 3OSOA 1FD7D 1Y1WB 4YCUA 1TUAA 3P20A 5BN4A 2K1BA 4LF9Q 3HOWG 4DAYA 1HCZA 3RR5A 4L5RC 2FMRA 2WB1G 5G3LD 1DYQA 2E2JB 2A68D 3HOYG 2HH2A 4KTAA 4F7XA 1Q86C 4Z9CB 1QILA 3J81E 2CQAA 2ANRA 1VQ8A 3S1RB 1Q82C 5CV7A 2EPBA 4HIDA 1VQPA 3SR1A 4X62L 2SNSA 4QL5A 4QY7A 1HZBA 1F9RA 2V4DA 1CSPA 2YV5A 2NYZD 3SEBA 4LF5Q 5J1ZA 4LJZC 5C4ZA 5KNDA 3STBC 1KL9A 1GUNA 1I4HA 2RKSA 3GD7A 4A3EH 2CW0D 1ESFA 1EIFA 1M4VA 1X3EA 2BCOA 2K04A 3U4ZA 1KIXA 2CHBD 5IYCG 4NXMQ 1N36L 3ND9A 2IJ0A 1AE2A 1TS2A 1YHQA 1SR3A 2PW7A 4JI1Q 2IY5B 3NE5B 2EIFA 1TY2A 1LT4D 1BCPF 3MXPA 4F88A 1D8LA 4LW1A 3HOWH 1YJNA 3BDOA 4DUYQ 2L12A 2F03A 3CCMA 2L55A 2X69A 2B2WC 1PHJA 2CTKA 4ZUJA 2OXPA 2KECA 5GAHC 2VB3X 4XQJA 1SYFA 5M5YB 1WE8A 1KRTA 1KC8C 3S14H 5JJKA 2F0IA 3NBHA 2K05A 4YHHL 1V8QA 5IT9c 5C3EG 5CYUA 4CKBA 1KAAA 3MEHA 5C4JH 4BA1I 3S17B 1V1QA 2UXDQ 3MXGA 4HJAA 1OXXK 2A69D 2VQFL 5JJIA 4BY7G 5HY6A 1STNA 3A56A 1CA6A 1QNUA 4GN3B 1J8IA 2BDNA 2L11A 1X6OA 2LXJA 4ZLTF 1EY6A 3EIVA 1JWMD 4GKJQ 3PCOB 2I0QA 2EYPA 1PMRA 1P8LA 2K52A 3U9OA 3S1QB 2K33A 4DAVA 3FHWA 1FVIA 3ONAB 2GA4B 3Q8DA 1JJCB 1BQQT 4QJFA 1B1ZA 3Q24A 4GNXB 3J80L 1H9JA 4FXKC 4IJLA 2CTFA 1HFNA 3G6JB 4GKKL 2E74C 1HA5A 3M3YB 1Z6HA 2UUAQ 3F2DA 1HZCA 3CHBD 3K7UC 2MGSA 2B29A 1K73C 3JAMc 4JI3Q 2ANNA 4R4QA 1EL0A 5C3EH 4K0KQ 1Y8OB 1EQQA 3H3VH 5BR8L 3D6WA 4NDXA 1HNXL 2K5NA 4UP9A 4JI4Q 2NVQH 3MZ5A 3PIOA 4ZQ3A 2ZTCA 5C4XB 2HHHL 4MIUA 4J1MA 4A3FB 4JI2Q 4BY7H 3KBGA 3TS0A 1QCBD 1JJGA 1U0LA 1CI3M 2EY2A 3N52A 2N49A 4A3GB 4LWCA 1R9TH 1MKHA 4B3SQ 1CKNA 1IBLQ 4K5VA 4MHEA 3F2BA 3P75A 1LTSD 4DR1L 1G2TA 1EYDA 4QMGA 4JI6Q 2JQOA 1I3QB 3EQLC 3KF6A 1W2BA 3KLSX 4IFDG 1GUOA 3NTKA 3P7JA 1EY8A 3AQQA 2F3WA 2QDBA 1H9RA 4R8IA 4A93B 3EVQA 3SK4A 1CM9A 1NUCA 1UNSA 1U4LA 2Z6KC 1L1OB 4DR4L 2Q2TA 3HOVG 4H44C 1MBYA 5FKAC 1X56A 1BCPC 2Z4HA 5KYLA 4O1NA 3Q23A 2Q2IA 3DMUA 5IY0A 5D3DA 3D4RA 4K2LA 1IBKQ 3BZKA 3VKEA 3CPWA 5C0XI 4PZ8A 1KRSA 1E3PA 1Q8IA 1E24A 1STYA 2JYOA 3U9SA 3SK8A 4HCSA 1ZEQX 2MJ8A 3T1YL 4YWMA 3VYSA 3K6OA 5JPNC 1C9OA 4BA2I 1Z9FA 1PA6A 4BXXH 4JI8L 2F52A 4A76A 1VQFA 4OONA 3BDCA 1I4PA 2IPKD 3S2DB 2M2LA 1N33L 4DV6Q 3HFZB 3MA2B 2AKWB 3AYHB 1W3SA 3I8ZA 3CF5A 2QEJC 5KNBA 4L5SA 4LF9L 2PQEA 1BNZA 3OOCA 5M3MH 1PFSA 2Z4IA 5T1IA 1XNRL 4F8MA 1DXMA 3GTQH 4QUFA 4PMWA 1IW7C 2DNEA 4WJ4A 4J8QA 2R92H 1R4QB 2KA7A 1IYJB 2K5VA 1YVCA 5JEAG 1XMOL 1ENFA 2MHVA 5M5WH 2B63B 4OO1I 3NWSA 1GHKA 5CBEE 1N34Q 3KDFA 4NBQA 3QB3A 1Y1VB 1AEXA 3ULJA 4HMJA 5JOBA 4U673 3WWVA 5ELEA 2WV6D 1I6HB 2B2TA 1DOLA 1HFGA 1MSHA 1YNJD 3MXNB 5IIFA 2VQEL 5I4DA 4HMIA 1Y8PB 2F0HA 1U4MA 2VL6A 1RCVD 1V1OA 5ELOA 3NQTA 4YCVA 2YYZA 4JI1L 2FJ2A 1PH7A 1PVOA 4DF7A 3HOXG 4K5XA 5GAEC 2KBNA 4OGQC 2UU9Q 3I2ZA 2K50A 1U5KA 3PIO3 1BVSA 4DA2A 3T51B 1E1OA 1IKMA 1JOKA 5JEAH 2R7ZH 1YZ6A 4CJ0B 5FOBB 4PMBA 1TVXA 2BOSA 4C1NI 2WIIB 2WFWA 4B3MQ 3PSIA 2FHTA 1KD1C 3PUVA 2KUMA 3GTGB 4BY1G 3A8JE 3UE1A 4R9WA 5IT9E 4DK3C 2VW9A 3CXCA 4RHSA 4GLVB 4RHRA 5EGTA 2L5TA 4GKJL 2MFIA 2Z0SA 3J81c 1DTJA 1YIJA 5D65A 3FPUB 4FDBA 2HT1A 1PRTD 1GKHA 3U4VA 4HSVA 3PV0A 3FKIH 4QF4A 3VR6A 2ZM6Q 4KY5A 1XJVA 2EOTA 3ITPA 4A3MB 3HOXH 5EQ0A 1EY0A 1PH4A 2RA4A 5E4XA 4GZYC 2JA8H 1SFOB 1V9PA 3I90A 4X65Q 4HIKA 4OWTB 2QA4A 1E0BA 3VYRA 3JAML 3K7AB 2C9OA 1TWAH 4KHVA 5JVH3 5C4HA 2FXQA 3RLNA 2B2TC 4K0KL 3CC7A 2GVAA 1KXLA 4CBVA 4JI4L 3P1HA 1HA6A 5FLXc 5CV8A 1IHZA 1FL0A 5M3FB 1WI5A 3BZDB 1LLRD 4JC0A 1SNOA 4IO9A 4BY1H 2E8GA 3NTIA 2F0JA 1A62A 1NCVA 2PQAB 3GV3A 1D5XC 4RKLA 3VR5A 1Y1WH 4DV0L 3CU7A 3MVVA 4B3SL 2CTJA 2A6HD 2HQEA 3KF8B 4JI6L 2E2JH 3K5MA 1LYLA 1CTMA 4IPHA 1XX8A 3S16H 3VA7A 1PH1A 4H0LC 5GADC 3S1RH 1B9NA 3J80i 2NZOA 1ASYA 4RGMA 4A3KG 1KTKA 2N88A 3DM1A 3I73A 3D6CA 4CKEA 4TVAB 2ALYB 3I4MG 3H6MA 4G57A 3UDXA 1A2TA 5ELNA 3FDTA 1GD7A 1FR3A 5COYA 2Z1CA 4HIOA 2CWPA 3H0GB 3QOLA 2ZT9C 1PH2A 1BBUA 4DK0A 1A63A 2AMCB 2WKCA 1F2MA 2KCNA 1M1KC 2RSNA 2K01A 3B6YA 2LY7A 3A7LA 4E6IA 1VQIA 2EY6A 2A74C 5C44B 1CQFA 1Y8NB 5I9PA 3SVMA 2N8NA 4POFA 1FYCA 1QOHA 4IJHA 5EBDA 2WAQE 2BE5C 4ZUIA 3CAMA 3PO3B 3CQZB 3DEPA 1VMCA 1TU2B 2R61A 5EBCA 1JOQA 5LL6X 4DR3Q 1SAPA 3HOZB 5M5YH 1WFQA 1LT6D 4XT3B 4BBSB 4CJ2C 3LNNA 1QUQA 4NB3A 4L63B 1ZYRD 3H3VC 1BOSA 1EQTA 4R8NA 1FJGL 3PO2B 3S17H 1BXTA 3IL8A 1HUNA 1XXGA 1WYDA 4KD4A 4HJ7A 4RGNA 2LFNA 2UUCL 2XWBB 2VS1A 1LO5D 2D5DA 2N55A 3AU7A 4A3FG 1VQ6A 3M7NA 3CCLA 2JJQA 5IOCA 1B9MA 2CCZA 4IFDJ 3T1HQ 2JXMB 2VUMB 2NVYB 5C3WA 5ELFA 2F3IA 2Q2HA 2F3VA 1EIGA 2B3GA 3CMEA 2OPUA 1EFID 3S1QH 3GTLB 1TS4A 1A0IA 4ZRZA 5C0XH 4LUZA 1KHMA 1Q81C 1CZGA 1HZAA 2CTEA 1EU4A 4DNIA 2XSCA 2F0QA 1QZGA 2QNDA 5JPMC 3HKZE 4KKSA 3M3YH 4X3KA 1SBBB 4K2KA 4A3IB 1UEAB 2ICEC 3TEHB 4C3HB 1I5FA 2GN5A 3HOUB 3T56B 1EIYB 2MUYA 1Q12A 1JR0D 5CBAE 5HURA 2AHOB 5ELBA 5EPJA 5C4XH 1PZJD 3OHXC 1DZ1A 4A3FH 5IP9H 4DR2L 1RD9D 1EIHA 5CMDA 3E6ZX 4RAUC 1BDOA 4DUZL 1VQAA 4DKAC 3WOEA 2NZHA 4O42A 2HQLA 4IURA 2J0TD 1PTOF 1NAPA 1XWEA 1SNMA 5BN5A 1BBWA 4JVHA 3L2PA 1I50B 4DAYB 1L0XB 2AUKA 4XTCS 2Y0SG 1PFNA 1F9PA 2MP1A 5CV6A 4JV5Q 2WB1E 3DEOA 2JA6B 3I7FA 4B3ML 5C5LA 3UE0A 3M7GA 3OIPA 3M9BA 1JB3A 2P2RA 2KHSA 1P16A 1C8CA 2PPBC 4A93H 2LS01 1OTCA 5G3LF 4BBRB 3DM3A 2CVRA 3NEMA 1D1IA 1QNKA 3J81L 1PYSB 1K3RA 2GVBA 2IT1A 1EOTA 2WKDA 2RDFA 3CCVA 4RFBA 1STBA 3NWTA 2D0OA 4I7ZC 1CFMA 1KABA 2EJFC 1BKBA 1GXDC 1Q90A 4R4TA 1WTVA 2A6EC 1S40A 4H7BA 4PZ7A 4LF4L 4YY3Q 2UXBQ 1IYVA 4X65L 4DK6C 4C56C 4HEDA 4NW2A 4ODGA 1LACA 2B63G 4BS9A 1PFMA 4DV4Q 4LFCQ 2KCTA 2EQSA 4G7OC 4AYBB 1J4WA 3JC66 2EDGA 2B2YA 3W2DA 3S2DH 1EYCA 1LT3D 1DT4A 1F77A 4KN7C 5EKKA 3F2CA 1OXSC 3M4OB 4P73A 2E2DC 1SMXA 3U58A 1DD2A 2I46A 2XRQD 3PF5A 1RJTA 3A7AB 2E5LQ 2F0GA 1HNWQ 5FLXE 5CV9A 1CA5A 4OIKA 4U68A 2EJMA 2QGQA 2F0EA 3X3NA 4IQZA 1BCPB 3I4NG 1SDFA 1C4QA 2L0CA 3BG3A 3LX0A 1SNDA 1LTGD 3CMAA 4KKUA 2N78A 5J3BA 3H15A 3FMCA 2E2IH 4ALPA 1I4QA 3HZXA 4B3RQ 1O80A 3IFDA 4Q0FA 2B63H 3OTOL 4P71A 2K4KA 3UDIA 4TSSA 1T5XD 4LFAQ 1I6HH 3PUYA 1L0WA 1EY7A 2J7ZA 4LF7Q 1KDBA 2HCIA 1E22A 4QIWE 2EYLA 1SRUA 3ULLA 4HSPA 1PTOC 4GLAC 4LAAA 2F0KA 2XTIA 1E1TA 2BA0A 4G7ZC 1RF2D 5AFWA 1VQKA 2V1CC 4YWLA 3NBIA 2NVTB 1JQYD 1S5FD 2CWAA 3NELA 4L5QA 2B2UA 1I4GA 5KYIA 4XDXA 4WFN3 4KLKA 1V1PA 3I4NH 2JA5B 1I94Q 3A5ZB 3GP7A 1UUPA 2A68C 2FINB 2G9DA 2B2YC 3CCUA 3F1ZA 1A3VA 2F4VQ 1KQSA 1H9SB 4B08A 1CKNB 3TP7A 4JI0L 1MI2A 2PZTA 1YHAA 1IL8A 4DR7Q 4X3TA 3KF6B 3GTJB 1GHJA 3GTGH 2RCNA 4G7HC 1GUSA 1K8AC 4EQNA 3GV6A 2NTTA 3NHHA 4IUPA 4XIGS 2ZJRA 3T1HL 5CV4A 4A3JG 2CW0C 1CQVA 2FFKB 3AEVB 2IW3A 4NXNQ 2F1MA 4DV1Q 3S1NH 2TMPA 1VIHA 4A3BB 1AN8A 4TKOB 2H4OA 1VQLA 4BXXG 3G7LA 2B8GA 5J39A 3WDNA 3TP5A 2CTMA 1E2ZA 3S2HB 3KLSA 3MWYW 1U4PA 1O7IA 4LMQD 5IWAQ 1F9QA 4C3IG 1IXRA 4DNTB 2PNHA 1S5ED 4KY7A 1SFOH 3J81j 4GNXA 4DR5Q 2F0VA 3NUCA 5LHY1 1AFPA 2MO1A 3K7AH 3A74A 1VF5C 1SYDA 1HRJA 1S4ZA 4DV3Q 4AQYQ 1RTOA 5M3MG 4EVOA 2JZXA 2OQKA 3OW2A 5IGEA 2K5DA 4KHPQ 4KD3A 5C3XA 1Q46A 1E2WA 3J7A5 5M3FH 3A54A 3FEWX 4UP7A 2R92G 3J7ZC 5A35A 4JYAQ 4ZK9B 3RLOA 2JEBI 5C44G 2A69C 4A3JH 2IL8A 1R4PB 1PXUA 2X6LA 1I4RA 2B2UC 3GQBA 2JA7B 3PO3G 5FLMG 5LMNQ 2AWOA 2PI2A 1C7YA 2IWHA 4X3UA 4GN4B 3I72A 4R1JA 1SE3A 4FP5D 1B53A 3AFPA 1JJ2A 3NXWA 3L3OC 1WTRA 3HOZG 5E7NA 1M90C 1EOVA 3BVZA 1YITA 2PMZE 4LF8Q 3LGJA 4A3DB 4DV7L 4O2DA 4EQ5A 1F2LA 2MPMA 1ILPA 4C3IH 2QKIC 5I9OA 4QQBX 2WACA 4P75A 1HNZQ 1L1OA 3R8BA 1HTLD 2KOLA 3K5LA 1A8VA 3TQYA 3H0GH 4GLXA 4UAIA 5GQOA 3A8IE 2Q2UA 1PLFA 1IBMQ 2HIXA 3KDFB 1B44D 2ZTDA 2NUCA 2ENBA 2VUMG 4P74A 4K6LA 3CRKC 4HJ9A 2D9UA 4YY3L 2UXBL 5ISRA 3A8KE 1ZKOA 1AH9A 2FMMA 3TMEA 5C44H 4I65A 5BN3A 2R7ZG 3W1BA 3UDGA 3I55A 4Y7NB 4LF5L 1JICA 2VB2X 4JBWA 1MSGA 1YNXA 1PV4A 2VZAA 3PO3H 5FLMH 3CQZH 2RHSB 4GNXC 2F0WA 4DV5Q 2UXCQ 4K6DA 4KKTA 2JA9A 1SMYD 4XYQA 1SYGA 2EYFA 3HOZH 1N32Q 4DN4M 1TWHB 2F0OA 5EAYA 4CKCA 5DAUA 3BDLA 3HOYB 1STAA 3J81i 5A2QE 1O7YA 4C3HG 2YTVA 3I56A 4NXML 3BVMA 3V96A 3HOUG 4UY8C 5IGDA 1HNWL 1ZXTA 1BR9A 3S15B 3FKIG 3BYTB 5M9OA 5CGKA 1XMQQ 1B7YB 3KJOA 5JAVA 3H91A 4DUYL 2KJXA 3R93A 4WANA 2DNCA 2XIWA 1S5DD 2JA8G 5IODA 2VUMH 2NVYH 1HR0Q 3PUWA 4LNQA 2R3ZA 3AMUA 2LKVA 4B3RL 5IT9L 1FGBD 1FNUA 2L1BA 1J9OA 5K36G 4XYOA 2VY3A 2EE1A 4NP5A 1VDZA 2F4IA 2F0PA 3GTLH 5JVG3 3H09A 1B8AA 2A5HA 4WRDA 2UXDL 1I4XA 1HH2P 1PRTF 1B50A 1RKNA 4NKLA 4BBRG 1K8MA 1FNVA 4X64Q 4DPGA 1L1OC 3CKIB 4L6TB 1TR5A 2MQHA 2NN6I 1Y1WG 1EYGA 4A3IH 3I91A 4DXFA 1RHPA 5IYDH 1XPRA 4C3HH 1EZ8A 3H94A 5IE8A 3L7ZC 3HOUH 3G4SA 3VR2A 2EYHA 1E7ZA 1GOZA 1TKWB 2EXZA 4N9PA 5C3EB 4QCLA 1VQHA 4A3CH 1JB7A 2EVBA 1D6EC 4LFBQ 3F8TA 3O13A 1GJXA 4JCVE 4BY7B 3OMGA 3R2TA 3QIAA 3S1MB 1VCIA 4RGOS 2BA1A 4AYBG 2UUAL 1YNND 4LF6Q 3K59A 4IUNA 1I50H 5JJLA 3RUZA 5LMUQ 4JI3L 4H02A 2ICIA 4DU9A 3E9HA 5K36H 4DNRB 2JA6H 4AM3A 3RD4A 1TT2A 3GTOB 3E0EA 3I4OA 2VNUD 2RF4A 4BBRH 4JI2L 1EC6A 1EY5A 1X3QA 1QZHA 2A8VA 4X62Q 4DFAA 1CKMA 2QILA 2DGYA 4V0BA 5EKIA 1YNJC 4QIWB 3GTKB 2XN9C 1IBLL 1KLUD 3MXUA 4PG3A 4K5WA 1VQOA 1STEA 3NK9A 4RGTA 4KY6A 3K8AA 1X65A 3MTSA 4IN3A 5DLQE 1CK1A 1GUWA 5IWAL 2CTLA 2QEXA 2CQOA 4PMCA 2KEDA 3W5OA 1S3OA 1X9NA 3ZYYX 4GOPB 5I2YA 2O4XA 4DV3L 1PZID 3GTMB 1NMGA 1CUKA 1SE4A 1UE1A 4AH6A 1RODA 1GVPA 3M4YA 1EWIA 1PZKD 2M00A 5EPKA 1MIUA 3M4OH 3FP9A 4ZYSA 1IBKL 2JP1A 1QJOA 1SN8A 1B4OA 3RMHA 2OTLA 5IGGA 1QUQB 1MJCA 2NB0A 1EWCA 2F0FA 2OT2A 2FMCA 2PYKA 1A3UA 4ZKBB 5HGTA 4P2CB 3URYA 4M1UB 5LMNL 3RZDB 5FO7B 3SE0A 1EU3A 1ML0D 3KF8A 5C0XG 3HOVB 2DN8A 1X3FA 2HCCA 5TSSA 2HUGA 1PRTC 1A15A 3DLLA 3GTQB 1WCMB 2JA5G 2VQFQ 4LIJA 5FK9C 4ZAIA 4LF8L 1ZZKA 1BF4A 2AWNA 3EN2A 4DV6L 4B8TA 1IKLA 3TSSA 4H13C 1RL2A 2NWGA 2CPQA 2EY1A 3C2PA 2PI2E 4DAMA 3L0OA 4RH6A 4HCEA 3X3MA 4OX9Q 2AQ1B 5M5WB 1GO3E 2ZXOA 4CHTB 2OCEA 1PH9A 1NBWA 1EEID 1IBML 3LWEA 1IZ6A 1JT8A 4RMFA 1DJRD 4R4CA 3GTPB 5C4XG 5LMNW 1NTGA 5IP9G 2EYJA 3UDFA 4KMUC 4DK1A 1KLGD 1X3PA 1A3TA 3CCQA 1EQVA 1XTCD 4V190 4FF3A 1WD1A 4A3BG 2CKZB 2ZXPA 2ASBA 1D5MC 3J80c 4A3GG 3CRLC 2KQ3A 4XT1B 2X6GA 3RN5A 1CSQA 3A5UA 3NPPA 2NZ1D 1ICWA 1LTLA 4B9WA 1VQ9A 4ID6A 1H9KA 1D5ZC 2KCMA 3IKJA 1TWGB 4IALA 2UXCL 1N34L 5I6WA 4AIMA 3V69A 1IL2A 2A6HC 3HRZC 3NQIA 4A93G 2JA5H 3IFTA 3AFQA 2EY5A 1UE5A 4A3LH 2A73B 4OO1G 2DGRA 2KEEA 2PMZB 1XNQQ 4J6HA 1CHPD 1LTAD 1QB5D 3STBD 5K5PA 1VQDA 4IFDI 3SGIA 3J7AV 5FJ8G 5FO9B 2K7VA 3VDYA 1PH6A 1KDAA 2Y0SE 3OW7A 1LM0A 4Q5VA 4TRDA 1XMQL 5CV5A 3GTJH 1YBYA 2E2HB 1ET6A 4JOIA 1WJJA 5CC4A 5JJZA 1WVNA 5IGBA 2PNRC 4ME5A 1JORA 1HR0L 2UU9L 1G51A 4OWWB 2JA7G 1J6QA 2AQ2B 5DEHA 3VR4A 2SOBA 4A3BH 2R6GA 4JI5Q 4A3GH 1YHBA 2LXKA 1CT1D 2KVMA 3S2HH 1SXTA 1I3QH 4JBMA 1PTOB 1X4NA 3CD6A 4PZ6A 4IOCA 2Q8TA 3KYHC 4FXDA 1WD0A 1JC7A 2EJGC 3FPPA 3HOXB 2R93B 1L0YB 2KHJA 2XGTA 2RQXA 3BZCA 3U50C 1LTID 2M9VA 1S5BD 2F0UA 1N9WA 4OO1H 4PNYA 3PMFA 2PCFB 1WTOA 1HR0W 1TWAB 4UPAA 5JEAJ 4ME3A 1I6VC 3T1YQ 1YEZA 2NN6G 1ZYRC 3T4AC 5FJ8H 4JI8Q 3F2UA 1KNAA 4X6AH 4C2MB 1IYUA 2ZM6L 3DWAA 1Q8KA 1NJIC 4LFBL 4EQPA 3KJPA 5C6AA 4LUOA 2MJHA 1JE4A 1G91A 1ESRA 2K6AA 4KJNA 1KHIA 1NSNS 1PH3A 4WORA 3SXHA 2JA7H 4C3JB 4LF6L 1S72A 2PO4A 3EBEA 3SK5A 1G6ZA 1VQEA 2I5HA 5LMUL 1K83B 3OYYA 1II3A 5GAGC 2XVSA 2IX0A 1Y1VG 1KAWA 5FLXL 1XNRQ 1X54A 4A3DH 3S16B 5F2DA 5EPLA 1TS5A 1O7ZA 2E75C 2F0SA 1NE3A 2JK8A 3ERSX 3ER0A 3NBHB 3QJYA 1ZTGA 1HZ9A 2ATWA 5IGCA 1EUJA 1XMOQ 2Q8IB 3KOJA 1Q1EA 2H5XA 4JOIC 1HQRD 1SNPA 3D4DA 3MFGA 3I3CA 2ZTEA 2NN6H 3HS0C 3EFXD 1RDPD 3I70A 3PGZA 3QO2A 4FF4A 1Z47A 3G71A 5KEEA 2YU9B 5I6YA 3VR3A 5KIXA 1DCZA 3OWEB 3K0XA 2VQEQ 1WTQA 1XYIA 1HJPA 3JAMi 1TWFB 2B8FA 2IX3A 4Y7NH 3EROA 2F0TA 3RZOB 1SROA 2I5MX 1B70B 4KI0A 4FYDA 4R4OA 3TREA 4EX5A 1U4RA 1Y1VH 1JMCA 4KJOA 4RG1A 1V1PB 1TWHH 1VS0A 4TQUS 1S5CD 5I2XA 4MNOA 3HOYH 4KK7A 1BUVT 2K28A 4UP8A 3CPFA 3RN2A 1SLJA 1BCPD 5M5XB 4HAEA 4A3KB 1VIGA 3U1KA 3DWQA 3M85A 2JSOA 2DUDA 2TSSA 3KLWA 3S15H 1SYBA 2F0NA 4HR7B 3EA6A 3CC2A 3I4MB 1WTXA 1AE3A 2EXDA 3PUZA 3D0FA 4A3MG 1WVLA 2OF1A 1ENCA 2Z6KA 4RKBA 4XQQA 1QVCA 2N3SA 4DR3L 2JVZA 2JEAI 1LTRD 4DV2Q 1ASZA 1VQGA 4B3TQ 4IZ8A 3NTHA 1XTDA 5IYCH 1OXTA 1SSOA 4OX9L 1M8AA 3OPOA 1D2BA 5ELDA 1EY9A 2K5QA 5D3IB 3TP6A 3CCRA 5M3FG 3J7AF 4KHZA 1CKOA 4JI7Q 3E9IA 2NVXB 1QVFA 1SNQA 4IUTA 1SE2A 5KNCA 1TWCB 1Q1BA 2RDGA 1HUMA 1LTTD 4IOAA 1IW7D 4Y52H 4RA8A 1G291 1SEBD 5AJ3Q 4A3MH 2D2CC 5E1FA 2WAQB 3J80E 1UEBA 1XPUA 1NMFA 1TIID 3T16A 1PYBA 3NP8A 3S1MH 1XNQL 2L9HA 4FXGC 2RBMA 4DV0Q 1UWVA 1VQNA 2A19A 3SK6A 4N9TA 3MC0B 1MGSA 3H0GG 2KCCA 2XNAC 1H9SA 1DGSA 1VQBA 1H95A 1NY4A 5T1GA 2AUJD 1K1GA 3GTOH 2J4XA 4PQXA 5C0XJ 4QGUA 1JWUD 1QVGA 3CW2C 1G2SA 3TZUA 1VQ4A 1EZ6A 1WTPA 3K57A 1C48A 3V2TA 2F0MA 3TDQA 1PFBA 3AEVA 4IPCA 2HDMA 4JI5L 4L8JA 3GTKH 3BU2A 4ZKCB 1GUTA 1NR2A 1AZQA 2XRSD 4KN4C 2YTXA 1WCMG 2R7FA 4JV5L 1OXUA 4K14A 4MTNA 3TP8A 2ZJPA 2H1EA 3HP3A 4NMZA 4BBSG 2K5HA 1V43A 1YI2A 2ZJQA 2C35B 3W1GA 2PQUA 4QB4A 4MZ9A 4WJWA 3G48A 2G9HD 3GTMH 3PO2G 5EJWA 1ZZIA 3HKZB 1C0AA 2IHFA 1PYWD 1B2TA 2IHEA 1J5EQ 3PIPA 1DOKA 4HIMA 1Q7YC 1MD2D 3DUZA 1EEFD 3TN2A 3A0JA 4ABNA 2BH2A 2Y0SB 5C5MA 3K5OA 4A3EB 1VQ5A 4HJ8A 4IFDH 2PW5A 4K8JA 2SEBD 4UDUC 4MN3A 3QG1A 4X66Q 2WP8J 1J5KA 2ID0A 3GO5A 5A2QL 3TS2A 2EZVA 1FGUA 4JG2A 3CCJA 3RZDH 4DV4L 1STHA 4LFCL 5D14A 1FJGQ 2PZWA 1D7QA 3HOVH 3E5SA 2K75A 1ILQA 2UUCQ 4PV1C 1WCMH 3HOWB 2KENA 3C46A 1HTPA 4QMFB 3AB9A 4LUVA 1STGA 2WB1B 5ELCA 3T53B 4A3IG 1VQJA 4BBSH 3BJUA 2L15A 3HGBA 2E2IB 5IP7G 5IYDG 3M4PA 5GROA 4BWGB 4O0AA 3S14B 1SNCA 1BBXC 3RNUA 5J22A 3ERQA 3K80C 4G4KA 3CCEA 2E5LL 3PO2H 2DY8A 3BYYB 4IUUA 1GUGA 2PY9A 3GTPH 4A3CG 1U9RA 2IX1A 5C4JB 2K5WA 1T5EA 4RCOA 2CFMA 2JE6I 3EJIA 1VQCA 1JOOA 2UUBQ 1VF7A 2F0LA 4ULLA 3E0JA 3Q0AA 4A4IA 1K8GA 1LTBD 5E4WC 5NUCA 3HKSA 2L4NA 3KLRA 3KK7A 4L5TA 3V05A 2DY7A 1TWGH 4IUVA 2JA6G 1ONLA 3QWNA 1JCKB 3C1FA 3K58A 1K0RA 4LK1C 2R93G 3L9AX 1RIPA 4LFAL 3MFYA 1GM5A 2I5LX 4DR2Q 1BO0A 4DUZQ 3NENA 4LF7L 3I4NB 2BDOA 1F9SA 1PRTB 3MXNA 5IGFA 2HH3A 2NBFA 3Q6SA 4AYBE 5DNFA 2MNAA 5IP7H 1DOMA 5CR3A 1HHVA 3CCSA