2JEBI

Structure of a 9-subunit archaeal exosome bound to mn ions
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
214
structure length
197
Chain Sequence
KIVLQPRSIVVPGELLAEGEFQIPWSPYILKINSKYYSTVVGLFDVKDTQFEVIPLEGSFYYPKINDIVIGLVEDVEIYGWVVDIKAPYKAYLPASNLLGRSINVGEDLRRYLDVGDYVIARIENFDDPVLSVKGKDLGRVSNGIVIDIMPVKVPRVIGKNKSMYETLTSKFVANNGRIWAILIEAIRKIENESHIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords EXOSOME COMPLEX EXONUCLEASE 2
publication title RNA Channelling by the Archaeal Exosome.
pubmed doi rcsb
source organism Sulfolobus solfataricus
total genus 40
structure length 197
sequence length 214
ec nomenclature
pdb deposition date 2007-01-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2jebI01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2jebI02
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 2jebI03
1K8OA 1YVCA 3S1NH 3CD6A 3I7FA 4JV5L 4GKJQ 5LMUL 2C35B 3KOJA 1KXLA 2CFMA 3K81C 2CKZB 3F2BA 1VIGA 3ULJA 2UXDQ 5IWAQ 1YJNA 3UDFA 4L8JA 3GTQH 4PZ7A 4JI7Q 2IX1A 2QEXA 4JI2Q 3HOYG 1HQMC 4A3EH 2KCTA 2ZT9C 2LMCB 2VY3A 4LF9Q 2IHEA 4TKOB 3PUWA 1IYVA 4QL5A 5M5WH 1VQ8A 4JBKA 5FLMG 2KHJA 1QZGA 2NVXH 2OWOA 4B8TA 1XNRL 2MJHA 2ANRA 3S14H 1TWAH 3T1HQ 3CXCA 3K0XA 4X64Q 2UXBL 4DR2L 4X62L 1DCZA 2L5TA 1A62A 3OW2A 2F52A 5IT9c 3MEFA 3VR4A 4K0KL 2ID0A 1E22A 5KNDA 4I7ZC 3GTJH 2IT1A 2A68D 3VR5A 2OQ0A 1VQJA 5IYBH 1UE6A 1KRTA 3QG1A 4J15A 2JA7H 2E5LQ 2JA8H 4IJHA 4GOPB 4LF4Q 3PIPA 2VUMG 3PUVA 1TWHH 3ULPA 1TWCH 2PI2E 1X3EA 1SN8A 4HJ7A 1S40A 4A3DG 1E2VA 4JC0A 1M1KC 3A8IE 1YZ6A 2UUAL 1GVPA 2AMCB 3CCQA 2A69C 5LMUQ 4PMWA 3A8JE 2OQKA 5H1SE 2B8GA 2HHHL 1UWVA 1G51A 2MFIA 3H0GH 4A3JG 2ASBA 3K7AH 1VQ4A 3K8AA 3H3VI 1IBMQ 1N9WA 2A6ED 1WYDA 2BH8A 1XPUA 4LIJA 3Q8DA 3CMEA 2CTJA 1FGUA 2PI2A 2WB1E 2DGYA 5C0XI 4XIGS 5BN4A 5IYDG 1ASZA 2A6HD 1Y1WG 4GN3B 2UXBQ 4DR2Q 4A76A 1HNWL 4IO9A 2UUCL 3AB9A 2YQRA 1OXXK 4YHHL 3PCOB 3TREA 2DNCA 2NVTH 3KLWA 4A3GH 3SDZA 1WCMG 1ONLA 5GADC 3RN2A 4JCVE 4K0KQ 4DR6Q 3RLOA 3B6YA 1EQRA 3HKZE 2R93G 3OOCA 2LXJA 2YV5A 1JMCA 5EAYA 4LNQA 2ZM6L 2CWAA 1K3RA 5C4JH 1HR0W 4DV1L 4DV5Q 1XJVA 1NMFA 3CPWA 2JA6H 3A0JA 1TKWB 2JK8A 5FJ8H 2CCZA 4OO1I 4GLXA 4LK1C 5IE8A 2VQEL 4LF7L 3GDEA 2UXCL 1KQSA 1I94L 1H95A 3PIOA 4JI3Q 2IX0A 1ZZJA 1NY4A 1IBLL 2K33A 3FMCA 3M4YA 4AYBG 2ZTCA 4NB3A 3KJOA 3HOWH 3CCJA 4IFDG 1J5KA 4A3KH 4BY7G 4DV4Q 1XPOA 4A4IA 1WVNA 2L15A 3UE1A 2PNHA 2Q8IB 2I5LX 2EVBA 4L5TA 1Y1VG 4NPSA 1KHIA 5M5YH 1AE2A 4A3LH 4GKKL 1XNQQ 3LNNA 2A19A 2DNEA 4AH6A 2CQOA 1LM0A 1CSPA 2BDOA 1NE3A 5IP7G 3RLFA 3AQQA 4H0LC 4DV2L 4RMFA 2N3SA 5C44G 3EQLC 1N36L 1YNNC 2GN5A 4A3CH 4QIWE 2DN8A 3QIAA 4OO1G 1JJ2A 3K80C 4DK6C 2D0PA 3KF8B 5M3MG 4JI1L 3GO5A 4JI5Q 2HQLA 1O7LA 4POFA 3RR5A 4DK1A 2ZM6Q 4DR5Q 4QMFB 2BA1A 2B8FA 1X3FA 3LGJA 4DV1Q 3J7A5 4LF6L 3GTPH 2ANNA 1FR3A 3PO3H 2KCMA 4DUYQ 3PV0A 3HOZG 3NEMA 2PY9A 2ES2A 4B3ML 1CKNA 2NN6I 1HTPA 3CCRA 3E0EA 3I4OA 4DAMA 3I73A 2Z6KA 3T51B 2CTMA 1X9NA 1MJCA 1IW7C 4DV0L 1SMXA 5GQOA 1CKOA 2AWNA 1VIHA 1EUJA 4IOAA 1HNXQ 2Z0SA 2UUBL 2N49A 4GN4B 1MIUA 1I5FA 1YJ9A 4R4CA 2B29A 4YCVA 4YCWA 4TVAB 5AJ3L 4HR7B 4QQBX 4LJZC 3KLRA 3BJUA 1ZZKA 1YEZA 2D0OA 1EWIA 4JOIA 4LFCL 4A93H 2O5IC 4BBRG 2E2IH 1SROA 1H9MA 4LFAL 1I6VC 2A1AA 1N36Q 1S72A 4YY3L 4NXML 3HOVH 3PUXA 5LMNL 2AUKA 4OX9Q 1VQLA 3WWVA 3S15H 1E1OA 1IBKL 4OXPA 2NN6G 1QJOA 3PUZA 1KHMA 4A3MG 4X66L 2VZAA 5HY6A 1FL0A 1KAWA 3UDXA 2A6HC 3KYHC 1HZBA 1OXVA 1V9PA 2EXDA 4JI6L 4GLAC 1EOVA 2FMRA 1K8MA 1VQDA 3ERSX 4G7OC 1V1QA 2KA7A 5IY0A 2KBNA 2GVAA 3CCVA 1VQKA 4B3TL 1XTDA 2CTEA 5J3BA 4DNIA 4JI0L 2K5HA 1I50H 4A75A 5C4XH 2K14A 2E2HH 4B3RL 4YWMA 4JVHA 4WALA 2RHSB 5JEAG 4DR7L 1K9MC 1PH9A 5IYCG 2CPQA 3D31A 1WOCA 3PF5A 2PQUA 3P20A 4UP9A 2R92G 1CKMA 1PYBA 3W5OA 2E8GA 1GUSA 1ZKOA 3EIVA 1SFOH 3KDFB 1XMOL 4P74A 3I4LA 3L0OA 4P72A 1CTMA 4GNXC 2E74C 1A0IA 3VR6A 5AJ3Q 1PFSA 5BN3A 3AYHB 4DR3L 1HZ9A 1X65A 3HOYH 4JG2A 1PHJA 4BBSH 2WAQG 1VQHA 4KN4C 3S17H 4G7HC 1L1OC 1NBWA 4YCUA 1Q82C 1KRSA 2EIFA 2R6GA 5FLMH 1RIPA 1IBKQ 2PQAA 3M4OH 3F2DA 2JZXA 1S3OA 1WFQA 4MZ9A 2BE5C 3A8KE 4A3FG 2ZJPA 4IFDJ 1JE5A 2EJGC 3A5UA 4LF5L 3HKSA 2UU9L 1LTLA 1BBUA 2JJQA 1CSQA 3S2DH 1VCIA 2MO1A 3KFUA 3GTOH 4B3TQ 2AHOB 4JYAQ 4R4OA 3BU2A 4BY1G 5HGQA 1O78A 4IPHA 3STBD 3DXJC 1DD2A 5GAHC 3GQBA 1TWFH 1VQNA 2Q2HA 3PO2G 4DR7Q 3D4RA 1E24A 2H5XA 2LSSA 2KHIA 3I2ZA 1HJPA 5ELOA 2RF4A 1H9RA 1J6QA 4A3DH 4GZYC 1N33L 1DT4A 5IYBG 2DUDA 1BBWA 3FP9A 2D2CC 4JV5Q 2IHFA 3GTKH 4IPCA 1VQFA 2R7ZG 3BZKA 2RCNA 4A3JH 4OWWB 1LACA 3RLNA 3SE0A 1OTCA 5IP9G 2Y0SG 4DR3Q 2F4VL 3SGIA 3CP0A 1G6PA 2I0QA 1GUGA 1TU2B 5M3FG 2K32A 1EC6A 4WJ3M 4DV3L 3CC7A 1E2ZA 3W1BA 2JE6I 1G291 5IYDH 2ALYB 4GOPC 1Z7TA 3S2HH 4DK0A 3H0GG 2VQFL 3TS2A 1OXSC 4NXNL 3KDFA 1XNRQ 1Y1WH 1Q7YC 1YI2A 4X62Q 3HOXH 1UE1A 2NZHA 4APVA 4LF5Q 4UPAA 1WCMH 1YHAA 1CKNB 1X4NA 3U4ZA 1XPRA 1FJGL 1YBYA 2R93H 1GKHA 1QVFA 3OTOL 1K8AC 3GTLH 3T1YL 2K4KA 4LF8L 1Q1EA 3T56B 1QVGA 4HIOA 1J5EL 1PH1A 1B8AA 1I6HH 5ELNA 1ASYA 4DK3C 3S1QH 1CFMA 4H13C 4HJ5A 1T9HA 2AXYA 4R4TA 5C0XG 4P75A 3T53B 2UUAQ 2I5HA 1D7QA 4L5RC 2EJFC 2ZTEA 1Z6HA 4IFDH 4BY7H 2HHHQ 1XMQL 1K73C 2F4VQ 2RHQB 3U4VA 4KHPL 4R4QA 4C2MH 2MO0A 3L2PA 1Y1VH 4P73A 4C3IH 5C3EG 4DV3Q 4RCNA 2N78A 1VQPA 1D8LA 5IP7H 2JA5H 3U9SA 3BG3A 3TZUA 5C44H 2QA4A 3ND8A 4JBWA 1E3PA 4X65L 1EIYB 2JQOA 3GTGH 3OPOA 2MNAA 1HNWQ 1Q86C 4PG3A 3CCLA 2UUCQ 3LWUA 4OO1H 2F1MA 4YHHQ 3JAMi 3M9BA 4DUZL 3U58A 3HOUG 1HPCA 5M3MH 1L2FA 1X3GA 4P71A 1A63A 4B3SL 4BXXG 2YU9H 1WE8A 2XGTA 1GM5A 5BR8L 4O2DA 3KJPA 4KN7C 3HGBA 4IPDA 3CCUA 3CRLC 2CTKA 5FLXc 4KMUC 1K83H 3RN5A 3I4MG 1SR3A 3HOZH 5M5XH 3IFTA 2CWPA 4C3HH 1EQQA 2VNUD 4L5QA 4POGA 1VF5C 2N8NA 3N6RA 2A68C 2VQEQ 4LF7Q 1VQOA 1A8VA 1I94Q 2UXCQ 2WAQE 3TQYA 1HNZL 2DGRA 3I72A 2Q2UA 1IL2A 2WFWA 3WDNA 2EQSA 2YTYA 4O0AA 1OXTA 1IBLQ 1A6XA 1OXUA 4AM3A 4KKTA 4IOCA 3A7LA 4L5SA 1B70B 1XMQQ 3EN2A 1B9NA 1VDZA 1TUAA 1PH6A 1QUQA 4PV1C 1QVCA 2PQAB 2A69D 4OWXB 4DV7L 1H9KA 4KI0A 3VR3A 1FVIA 3CW2C 1YNJC 2V4DA 3BZCA 4DR1L 4GKKQ 3M85A 1X4MA 1J4WA 1EFWA 1L0WA 1NMGA 4BBRH 5JJLA 1VQEA 4DV2Q 4DR4L 2VS1A 1Y8PB 2OPUA 1KD1C 4GKJL 1W3SA 3BDOA 2A6EC 3S1MH 3G48A 1PH8A 1HZCA 1ZTGA 2PPBC 3MXNB 2UXDL 5IWAL 1JJCB 4A3BG 3I56A 2NN6H 4GN5A 4A3MH 4JI7L 1NTGA 4BA1I 4JI2L 2E2JH 4JI1Q 3F8TA 3FKIG 4LF9L 5BR8Q 4GS3A 1U5KA 1SLJA 3I4NG 1B9MA 1GUNA 3ICEA 1K1GA 1TXYA 3GTMH 1H9SA 2XTIA 4UP8A 4R4IA 1JT8A 1V8QA 2HIXA 4LF6Q 1VF7A 2CTFA 4ME3A 2Y0SE 1GUTA 3J81j 2O5JC 4B3MQ 3ZJYC 2K5VA 1HNZQ 4R1JA 1LUZA 1JB7A 2JVZA 5JEAH 2A8VA 3HFZB 4A3IG 2AUJD 3PF4A 5IYCH 1PYSB 2HIVA 3IKJA 4HIKA 2OCEA 4DV0Q 3CCSA 2R92H 1O7IA 1VQBA 2B63G 2NVQH 1I3QH 4HIMA 2P2RA 4DV7Q 1AH9A 2F3IA 2UUBQ 3NENA 4PZ8A 4AQYL 3TS0A 3A7AB 3DLLA 1GHKA 3CC2A 3CC4A 2VW9A 4QGUA 5K36G 4DR4Q 4LFCQ 2Q2TA 3U50C 5GROA 4LFAQ 3CMAA 2WP8J 4JI4L 4YY3Q 4NXMQ 4WANA 4DAYB 2K50A 3CRKC 5LMNQ 2BH2A 1KL9A 5C0XJ 4OGQC 1PV4A 3VDYA 1IBML 5JJIA 2E76C 4A3FH 2OTJA 2EJMA 4X66Q 1SRUA 3S1RH 3VR2A 4BBSG 4A3EG 3CCMA 1UE7A 1IZ6A 4DKAC 3AEVA 4JI6Q 4KHZA 4HJ8A 3FPPA 1VQ6A 1H9JA 1C0AA 4AYBE 1WJJA 4JI0Q 4BY1H 4ALPA 1MKHA 3F2CA 4Y7NH 2NZOA 1KC8C 1X56A 3IRBA 3PO2H 1VQ5A 4UP7A 4B3RQ 1IYJB 2JXMB 4GLVB 4DR6L 1KIXA 2VUMH 1T5EA 1LYLA 4JI8L 1PMRA 1Y14B 1LABA 1M90C 3JAMc 2E3UA 3D0FA 5E7NA 1Y8OB 1IW7D 4G7ZC 4TQUS 4AQYQ 1XMOQ 2R7ZH 1BVSA 4DV5L 3CAMA 2JA7G 4JBJA 2JA8G 2D5DA 5IP9H 3KF6A 4LUOA 3F1ZA 5GAEC 1VQAA 4GNXA 4LWCA 3ULLA 5M3FH 4KLKA 4YWKA 4JI3L 4LFBL 4JI4Q 4C3JH 3H94A 3J81i 1PH5A 2B3GA 1K0RA 2Q2IA 1WI5A 1N34L 3A5ZB 4DV4L 1PH7A 3JC66 1PH2A 2K75A 4FDBA 2LXKA 3J80i 1B7YB 4QY7A 3RNUA 1L1OA 4Y52H 1CUKA 3QJYA 2ATWA 1HR0L 1E7ZA 3V69A 1XNQL 2BA0A 1DGSA 1YIJA 4WJ4A 3VA7A 2UU9Q 1ZYRC 3G71A 1NJIC 2D62A 1C9OA 3M3YH 4QJFA 1P8LA 2JA9A 2BL5A 1X55A 1UE5A 2I5MX 2R7FA 4DNRB 4IFDI 3ER0A 2CW0C 3HOXG 3E9IA 1VS0A 2VL6A 1FYCA 1QUQB 3H3VH 4A3GG 1X6OA 2IY5B 3OYYA 4EQ5A 1VQ9A 2KENA 4JI5L 5KNCA 1ZZIA 1VQMA 3AFPA 4JI8Q 1DTJA 4IPGA 4DR5L 5C0XH 1N33Q 4RG1A 3S24A 3VKEA 2GVBA 3M4PA 1GO3E 1Y8NB 1Q90A 4OWTB 4YWLA 1EIFA 4DUYL 2Z6KC 1Z47A 2V1CC 3CF5A 2JA6G 5FJ8G 2AKWB 4DPGA 3ND9A 1N32L 2JEAI 3M7NA 5C3EH 3K7UC 2K52A 4LFBQ 5KNBA 3CCEA 1SE8A 3W1GA 1YJWA 2MQHA 1C7YA 2QGQA 1N34Q 4DV6L 1V43A 4JK1C 3HOWG 2VQFQ 3G6EA 1HNXL 1H9SB 1SMYC 4A3KG 4NBQA 4NXNQ 5JEAJ 1HR0Q 1YITA 4JOIC 4GOPA 1PVOA 2YTVA 4XTCS 1Q81C 3A74A 4A3LG 3HOUH 3NE5B 1K8GA 2JA5G 2BE5D 4HJ9A 4BA2I 1GD7A 3CQZH 4BXXH 1FJGQ 5JJKA 3H15A 1QZHA 1HH2P 3OTOQ 1RL2A 3S16H 2JEBI 3UE0A 3T1YQ 4A3CG 1Q8KA 4OX9L 4LF8Q 1VQIA 3UDGA 3I4MH 2YTXA 3FHWA 5DLQE 2K7VA 2OPVA 1J5EQ 2R7DA 4LUVA 2EDGA 2ZJRA 1N8RC 1VQGA 1VQ7A 4KKUA 3PUYA 1GUOA 3TRZA 2CTLA 1HCZA 3PSIA 1EYGA 2PMZE 4LUZA 1W2BA 1Q12A 2WB1G 3STBC 1DXMA 4OONA 3MXUA 5GAGC 3PO3G 4HJAA 1Q46A 3RZOH 1N32Q 4HIDA 4KHPQ 1BKBA 3DM3A 1E1TA 3J7ZC 4X6AH 4H02A 3NELA 2ZJQA 1VQCA 4JBMA 3MFYA 3NBHB 4DV6Q 1AE3A 1YHBA 3AEVB 3L7ZC 3HKZG 2NVYH 1CI3M 3M4QA 1YNXA 4X65Q 2HT1A 1JJGA 2PCFB 3PGZA 1EWHA 4KKSA 2OTLA 2PNRC 2KCCA 4A3BH 2AWOA 2FXQA 4DUZQ 5BN5A 4EX5A 4PZ6A 3FKIH 1E2WA 4A93G 4IQZA 1Y69U 4IJLA 2E75C 4B3SQ 1IYUA 3I4NH 3EBEA 3E9HA 3HOVG 1Z9FA 1MJEA 1PH3A 1PA6A 1X54A 3T1HL 4AIMA 2ZTDA 3J81c 3I55A 2QNDA 4X64L 2QF7A 1P16A 3UDIA 3KF6B 1HZAA 2HH2A 3OW7A 3RZDH 4H44C 1IXRA 4A3IH 1PH4A 4GNXB 1U0LA 3J80c 1YHQA 1Q1BA 2YYZA 1BDOA 3AFQA 2HH3A 3G4SA 2K5NA 5LMNW 4UY8C 2B63H 4JYAL 4DNTB 5A35A 3CPFA 1UEBA 1GJXA 1GHJA 3GD7A 5C4XG 3TEHB 1L1OB 4JVYA 4MNOA 3U1KA 2E5LL 4MTNA 4DR1Q 4LF4L 3W3AA 1TWGH 4LW1A 5K36H 1R9TH
chains in the Genus database with same CATH superfamily
1K8OA 5E3FA 1YVCA 3BZDB 1WHRA 3S1NH 3CD6A 3S16B 3OSSD 3MXGA 3I7FA 2N55A 4JV5L 3OIPA 4CKBA 4GKJH 4GKJQ 3D6CA 1EY4A 5LMUL 3I4MB 2C35B 3KOJA 1KXLA 2CFMA 3K81C 2CKZB 3F2BA 1GOZA 1VIGA 2F0PA 3ULJA 2UXDH 2F0JA 2UXDQ 5IWAH 5IWAQ 1YJNA 4N8X1 3UDFA 3FAUA 2HDMA 4L8JA 3GTQH 4PZ7A 4JI7H 1LO5D 4JI7Q 2IX1A 2F0EA 3MXPA 2QEXA 4JI2H 3DWAA 4JI2Q 1SNCA 4L63B 3HOYG 1HQMC 4A3EH 2KCTA 2ZT9C 2LMCB 4LF9H 2RVLA 2VY3A 2IHEA 4LF9Q 4TKOB 5I9OA 2D9IA 3PUWA 1IYVA 2L11A 3C46A 1DYQA 3NBHA 2IWHA 4QL5A 5C6AA 5M5WH 1EEFD 1LT4D 1VQ8A 4JBKA 3RMHA 5FLMG 2KHJA 1QZGA 2NVXH 2OWOA 3MAQA 4B9WA 1CM9A 4B8TA 1WTHA 4V0BA 1XNRL 3NTKA 2MJHA 2ANRA 3S14H 3T1HH 1TWAH 3T1HQ 4HSPA 3NTIA 3RZOB 5T1GA 1WTPA 4X64H 3PMFA 3CXCA 3K0XA 4X64Q 2UXBL 4DR2L 4X62L 1JE4A 5CV7A 1DCZA 1EOTA 2WACA 2L5TA 1EQTA 2VXWA 1A62A 4MTKA 4ODGA 3X3NA 2PZWA 4FF2A 4RHSA 1HHVA 2BOSA 3OW2A 2F52A 1C48A 1HQRD 4F7XA 4K6DA 5IT9c 3NP8A 3MEFA 3VR4A 4K0KL 1SNQA 2ID0A 1E22A 1CK1A 5KNDA 4I7ZC 2NVYB 3GTJH 2IT1A 4Q5VA 2A68D 3K59A 1PTOB 3I70A 3VR5A 2EOTA 5E4XA 2OQ0A 1VQJA 2K01A 5IYBH 1UE6A 5G3LD 2ZQEA 1KRTA 5DM73 3K6OA 2PQEA 2BDNA 3QG1A 3NUCA 4J15A 2JA7H 4RAUC 4A3BB 2E5LH 2E5LQ 2XRQD 2JA8H 4IJHA 1QWYA 3QWNA 4LF4H 4GOPB 4LF4Q 3PIPA 3HG9A 4CJ2C 2VUMG 1TWHH 3PUVA 2F4IA 3Q23A 4M1UB 3FKIB 4EGVA 3ULPA 1JWSD 4JW0A 5J22A 3GKUA 2F0OA 1TWCH 2QW7A 2PI2E 1X32A 3BYTB 3I4NB 1X3EA 4O1NA 1SN8A 1YNJD 1BR9A 2PZTA 5CBAE 4HJ7A 1E2VA 4JC0A 1S40A 4A3DG 1AZPA 2NYZD 1M1KC 2O4XA 3A8IE 4CHTB 1YZ6A 2UUAL 2IJ0A 2Z4HA 1GVPA 2AMCB 3S15B 3DM1A 3CCQA 4G57A 1NSNS 2A69C 5LMUQ 5LMUH 5FLXW 2TSSA 4PMWA 3A8JE 2OQKA 5H1SE 2B8GA 1XX8A 2HHHL 1UWVA 1G51A 5EPLA 2MFIA 3H0GH 4A3JG 3J81E 2L4NA 5TSSA 1TS4A 2AQ3B 2B2VC 2ASBA 3K7AH 2AQ1B 1VQ4A 3K8AA 3H3VI 1IBMH 1IBMQ 2K04A 1N9WA 1MSHA 4X3UA 1EYCA 2A6ED 1WYDA 3CU7A 5KRUA 2BH8A 1S5BD 5M9OA 5A2QE 1HUNA 3NSWA 3U9OA 2NUCA 3RZDB 1XPUA 1QCBD 4LIJA 3Q8DA 4A3IB 3CMEA 1JWUD 4DFAA 2CTJA 1FGUA 2PI2A 1M4VA 2WB1E 2DGYA 4PMBA 5C0XI 4XIGS 5BN4A 5IYDG 1EEID 4RGTA 2B63B 1EY6A 1ASZA 3R8BA 3NCVA 1NNXA 3KLSX 4HTHA 2A6HD 1Y1WG 2UXBH 4DR2H 1PRTC 4GN3B 4DR2Q 4A76A 2UXBQ 2FMCA 2CH4A 3ZYYX 1HNWL 4IO9A 1XRHA 2UUCL 3AB9A 4ZK9B 2YQRA 1OXXK 5FO7B 4YHHL 3C1FA 3PCOB 1ENAA 3TREA 4FJUA 1EQVA 1SE3A 1IKLA 2DNCA 1WTQA 2NVTH 3KLWA 4A3GH 2SDFA 3SDZA 1SE2A 1WCMG 1ONLA 3DHQA 2PW5A 5GADC 1B3QA 3BS1A 3I3CA 3RN2A 4K0KH 3UOEA 4JCVE 2HCCA 4K0KQ 1TWGB 4DR6H 4DR6Q 3RLOA 5EGTA 1TR5A 3B6YA 1EQRA 1R9TB 3HKZE 2SNSA 1O80A 2R93G 1UUPA 3OOCA 3K58A 2LXJA 3S1NB 2YV5A 1I4PA 4E6IA 1JMCA 5EAYA 4LNQA 1WTJA 2ZM6L 3J80L 3KDGA 2CWAA 3QD7X 1K3RA 5C4JH 3K5LA 1HR0W 1XWEA 4DV1L 1BCPF 1STNA 4DV5H 1EZ8A 4DV5Q 4DXFA 3G6JB 1XJVA 2E2DC 3Q0AA 1NMFA 3CPWA 2JA6H 3A0JA 3MWYW 3GTQB 1TKWB 2JK8A 5FJ8H 2CCZA 4OO1I 1SDFA 4OEMB 4GLXA 1HTLD 4TSSA 1DOKA 1BCPD 4LK1C 3QB3A 2EYJA 4FXDA 3HZXA 5IE8A 2VQEL 4LF7L 4BBSB 2G5DA 3GDEA 4A3EB 1KQSA 1I94L 2UXCL 1H95A 2K03A 3PIOA 4JI3H 4JI3Q 1U4MA 2EXZA 2IX0A 3NHHA 2F03A 5IGDA 5M5WB 1ZZJA 1NY4A 1IBLL 1JWMD 2K33A 1S5CD 3FMCA 3NWSA 1DJRD 3M4YA 4AYBG 2NVXB 3URYA 2ZTCA 1PFMA 4NB3A 4EQOA 3KJOA 3HOWH 3CCJA 2B2YA 2CH4W 1TWAB 3S14B 4IFDG 1WTVA 1J5KA 4A3KH 3HEJA 4BY7G 4DV4H 4DV4Q 1XPOA 3S9WA 3BVMA 4A4IA 5IGCA 2CPMA 1WVNA 2L15A 1SJHD 3UE1A 2PNHA 1WTXA 2Q8IB 2I5LX 2EVBA 2JYOA 3QR8A 1SSOA 1Y1VG 4L5TA 1KHIA 4NPSA 4KTAA 5IT9E 1RKNA 4C3IG 1AE2A 5M5YH 4A3LH 4GKKL 1XNQH 1XNQQ 3LNNA 4ME5A 3LWEA 2A19A 2DNEA 4AH6A 2CQOA 1LM0A 1CSPA 2BDOA 1NE3A 5IP7G 3RLFA 3AQQA 4H0LC 4DV2L 4PDBA 4RMFA 3GTJB 2DY7A 2N3SA 1U4RA 5C44G 3EQLC 1PZKD 1N36L 3Q6SA 4CDDC 5D3DA 1YNNC 1PFBA 4RFBA 2GN5A 1LT6D 2WIIB 4A3CH 4K6LA 1ENCA 4QIWE 1KNAA 1X0AA 2JA7B 1KAAA 2DN8A 2KVMA 4NMZA 5CYUA 1SBBB 3QIAA 1JJ2A 4OO1G 3X3MA 1J8IA 2JA8B 3K80C 4DK6C 1V8CA 2D0PA 4ILWA 1TWHB 3KF8B 4ZCKA 5M3MG 3FEWX 2F3VA 4JI1L 3GO5A 4JI5H 4JI5Q 2HQLA 1TY2A 4ZKBB 1O7LA 1TWCB 4POFA 2OF1A 5JAVA 3AMUA 2K5WA 3RR5A 4DK1A 2RSNA 2ZM6H 2ZM6Q 4DR5H 4DR5Q 4QMFB 2BA1A 2B8FA 1X3FA 3LGJA 1PQXA 4DV1H 4DV1Q 1DOMA 4CGYB 4LF6L 3J7A5 5LL6X 2MUYA 3GTPH 2ANNA 4XT3B 1EIHA 1FR3A 1ESRA 1MD2D 2KCMA 3K7AB 4DUYQ 3PO3H 1LV9A 3PV0A 4DUYH 3HOZG 3NEMA 4XQNA 4C3HG 1TT2A 2PY9A 2ES2A 4B3ML 3P1HA 1CKNA 2B2TC 4IUQA 2NN6I 4RGNA 1HTPA 3CCRA 1SYBA 3E0EA 3I4OA 4DAMA 3I73A 2Z6KA 3T51B 2CTMA 5L37A 2EYOA 1SNPA 1X9NA 1MJCA 1IW7C 1V1PA 2H1EA 4DV0L 1SMXA 5GQOA 2N88A 3BDLA 5I9PA 1CKOA 1PTOD 2AWNA 1VIHA 3V2TA 1EUJA 1W6JA 2IL8A 4IOAA 4ULLA 1HNXH 1HNXQ 4LMQD 1NAPA 2Z0SA 2CVRA 1NR4A 2UUBL 2N49A 1ESFA 2PZUA 4GN4B 1MIUA 1F2YA 1FNVA 1I5FA 1YJ9A 2NVTB 4A3GB 5IT9W 4R4CA 2B29A 4YCVA 4XQJA 4YCWA 4TVAB 5AJ3L 4HR7B 2K5DA 4QQBX 4LJZC 3KLRA 3BJUA 1ZZKA 1BXTA 4OD6A 1YEZA 2D0OA 3I91A 1EWIA 2KECA 4JOIA 4LFCL 1EY7A 4A93H 2E2IH 4BBRG 2O5IC 1SROA 1H9MA 4LFAL 1I6VC 3C2PA 1N36H 2A1AA 1N36Q 2PT7G 3JAMW 1S72A 1S03G 3DUZA 4YY3L 4NXML 3HOVH 3PUXA 1S5ED 4G4KA 2A73B 5C4JB 1ZYRD 5LMNL 1AW7A 4OX9H 2AUKA 4OX9Q 2K1BA 1VQLA 2EY1A 5KYLA 3WWVA 3S15H 2ZXPA 2KUMA 1E1OA 1IBKL 2WINB 1SYFA 4OXPA 1ML0D 2JA6B 2NN6G 1QJOA 3PUZA 1KDAA 1S20A 1KHMA 4A3MG 5ISRA 3IFDA 4X66L 4K5XA 2VZAA 2CW0D 1PLFA 5FO8B 5LHY1 3P7JA 5HY6A 2HUGA 1DM0B 2TMPA 1FL0A 1KAWA 3UDXA 2A6HC 3KYHC 1HZBA 1OXVA 1V9PA 2J0TD 2EXDA 4JI6L 4GLAC 1EOVA 2FMRA 1K8MA 1VQDA 4XYOA 2JP1A 3H3VC 1G91A 1C4QA 2KJXA 3ERSX 4G7OC 1V1QA 2KA7A 5IY0A 3HOWB 5CMDA 2VB2X 1CQFA 2XSCA 2KBNA 5LL6b 1EFID 4A3KB 2FFKB 2GVAA 3CCVA 1VQKA 1XTDA 4B3TL 2CTEA 1AZQA 5J3BA 4DNIA 4K2LA 4JI0L 3KBGA 1F9QA 2K5HA 2QEJC 1D6EC 1I50H 4X3SA 4A75A 2LFNA 4DAPA 1M8AA 2K14A 2L1BA 5C4XH 1PDQA 3NPPA 2E2HH 5M5YB 4B3RL 3KF8A 4YWMA 1ILPA 2XVSA 4JVHA 4WALA 2JA5B 2I46A 3ONAB 5JPMC 2RHSB 5JEAG 4DR7L 5IGEA 1K9MC 3SHLA 1PH9A 1O7YA 5IYCG 2CPQA 4RKLA 3D31A 1WOCA 3PF5A 2PQUA 3P20A 4UP9A 1SAPA 2R92G 1CKMA 1PYBA 4OHJA 3W5OA 2E8GA 3Q22A 1GUSA 1ZKOA 1BCPC 3EIVA 1SFOH 3KDFB 4HCSA 1XMOL 4P74A 3OMGA 4HCEA 1K3BC 1I6UA 3MC0B 3I4LA 2PO4A 3L0OA 4P72A 1CTMA 4GNXC 2E74C 2G8YA 3GR5A 1A0IA 3VR6A 5AJ3Q 1PFSA 1EY5A 3SVMA 1STEA 5BN3A 2XWBB 2KEEA 2F0KA 3MVVA 3AYHB 4DR3L 1HZ9A 2F0VA 1X65A 3HOYH 2EYHA 2EE1A 4F88A 4JG2A 1PHJA 3MHBA 2SOBA 2O4CA 3IAYA 3HS0C 4BBSH 2WAQG 1VQHA 4KN4C 3S17H 1NBWA 1L1OC 4G7HC 2WB1B 1K28A 4YCUA 1SYDA 1KRSA 2EIFA 1Q82C 3D6WA 2R6GA 5EBCA 1JB3A 5FLMH 3GTPB 1RIPA 1TS3A 3DWQA 2FFMA 1IBKH 1IBKQ 2PQAA 3M4OH 3PO3B 1RTNA 4ZAIA 3F2DA 3Q24A 2AQ2B 2JZXA 2L9HA 1S3OA 1WFQA 4MZ9A 2BE5C 1TIID 2DJGC 3A8KE 4A3FG 5KGUA 2ZJPA 4IFDJ 1EU4A 1JE5A 1GXDC 2EJGC 3A5UA 1WTOA 2JSOA 2F0IA 3UI2A 4LF5L 3HKSA 3QO2A 2F0WA 2X69A 1RJTA 2UU9L 5D3IB 1LTLA 1BBUA 2JJQA 1WTRA 3SB1A 1CSQA 3S2DH 1I4GA 4O42A 5IGFA 4XQQA 1ICWA 3MEHA 1VCIA 5G3LF 3HKZB 5I6YA 2MO1A 3GV3A 4RHRA 3KFUA 3GTOH 1AN8A 4B3TQ 1TS5A 1MBYA 2AHOB 2Q8TA 4JYAH 4JYAQ 4R4OA 5JJZA 3BU2A 1V9NA 4BY1G 5HGQA 5J39A 4KV6A 1O78A 4IPHA 3V96A 2B2WC 2CQAA 3STBD 1WD0A 3DXJC 1DD2A 5GAHC 3GQBA 1JORA 1TWFH 1LTTD 1VQNA 2Q2HA 3PO2G 4DR7Q 3D4RA 1E24A 2H5XA 2LSSA 2KHIA 3SXHA 3I2ZA 1F2MA 1HJPA 5ELOA 4EC5A 4CDCC 5ELFA 2KEDA 4A93B 2RF4A 3IL8A 2IW3A 3NXWA 2E2IB 1H9RA 3E3XA 1J6QA 5AFWA 3AU7A 5C5LA 4QMGA 1I4RA 1QNUA 4A3DH 4GZYC 1N33L 3HOVB 1DT4A 5IYBG 2DUDA 1BBWA 3FP9A 2D2CC 2Z4IA 4JV5H 2Q8RE 4IUTA 4JV5Q 1OO9B 3VA5A 2IHFA 2OEOA 3GTKH 4IPCA 1VQFA 2R7ZG 2HD3A 3BZKA 2RCNA 4A3JH 4OWWB 3DEPA 1LACA 3RLNA 3SE0A 1HFGA 1OTCA 5IP9G 4DR3H 1LTGD 2Y0SG 4DR3Q 2F4VL 1UAPA 1FKAH 3SGIA 4CDEC 3CP0A 1LTSD 1G6PA 2I0QA 4QF4A 3EVQA 2RCFA 1GUGA 2P5ZX 1TU2B 5M3FG 2K32A 1EC6A 3QOJA 3ITPA 4WJ3M 4DV3L 4J6HA 3CC7A 1E2ZA 3D4DA 1PFNA 3W1BA 4C3JG 2JE6I 3J80E 2DJFC 4RH6A 4RGMA 1G291 5IYDH 2ALYB 4WJWA 4OIJA 4GOPC 1Z7TA 1KLGD 2R3ZA 3S2HH 4DK0A 3H0GG 2VQFL 3TS2A 2ENBA 4OELB 1WVLA 2J4XA 1I4QA 1U4LA 1CA6A 1OXSC 4NXNL 1XNRH 3KDFA 4YIJA 1XNRQ 1Y1WH 1Q7YC 3D3RA 4ZYSA 1NXUA 2F0HA 1MHWC 1YI2A 1I50B 1R4PB 4QIWB 4X62Q 4X62H 5C4XB 3HOXH 2E2HB 1TVXA 1UE1A 3TP7A 2NZHA 4LF5H 4APVA 4LF5Q 4UPAA 1WCMH 1YHAA 4DAVA 1CKNB 4B8CD 1X4NA 1QILA 4LAAA 4HN7A 3U4ZA 1XPRA 2F0GA 2CWFA 1FJGL 4QUFA 1YBYA 4DAYA 2R93H 1EYAA 1GKHA 1QVFA 3K5NA 4PMCA 3OTOL 5CORA 1V1PB 2EYLA 1K8AC 4N9TA 1SJED 2B2UC 3GTLH 1SFOB 3T1YL 2K4KA 1KNEA 4LF8L 1Q1EA 3T56B 1X3QA 4IZ8A 1QVGA 3P75A 1A2UA 1CZWA 2XRSD 4HIOA 1J5EL 1PH1A 2LKVA 2CHBD 1B8AA 3WOEA 1I6HH 5ELNA 1L0XB 1HFNA 1ASYA 3E6ZX 4DK3C 3HOYB 1STAA 3HP3A 3S1QH 1CFMA 4H13C 4HJ5A 1Q3LA 1T9HA 2AXYA 3R2TA 4R4TA 3N52A 5C0XG 3S17B 3A56A 4DN4M 4P75A 3TP8A 3T53B 4DXGA 1S5DD 2UUAH 2UUAQ 4HMJA 2I5HA 1D7QA 2HDLA 1I4XA 5I4DA 4ZRZA 4L5RC 2EJFC 2ZTEA 1Z6HA 4IFDH 3M4OB 4BY7H 2HHHH 2LY7A 2HHHQ 2EY5A 5IODA 1XMQL 1K73C 1AN7A 3J81W 1A15A 2F4VQ 4X3KA 2RHQB 3U4VA 4KHPL 5EPJA 1SNMA 4R4QA 3SEBA 4C2MH 2MO0A 3L2PA 1Y1VH 4P73A 4E9JA 1K0SA 3TP5A 4C3IH 5C3EG 4DV3Q 2M8WA 4RCNA 2B2VA 2N78A 4HAEA 4FXGC 1VMCA 5A2QW 1VQPA 1D8LA 1KDCA 3S2DB 3J80W 5IP7H 2JA5H 5JOBA 2RA4A 3ERQA 3U9SA 3BG3A 5DNFA 1QNKA 3OETA 1HXYD 1BNZA 3TZUA 3GTOB 4K5VA 1SEBD 1TS2A 3CKIB 3OHXC 5C44H 2QA4A 1CA5A 3ND8A 4JBWA 1E3PA 1MI2A 4CJ0B 4X65L 5J1ZA 1SE4A 1EIYB 4DU9A 2JQOA 1LT5D 1G2TA 2QDBA 4K2KA 4Y7NB 4J1MA 3GTGH 1HNWH 3OPOA 2MNAA 1HNWQ 2KCNA 3EJIA 4ZLTF 1Q86C 4PG3A 2UUCH 3CCLA 2UUCQ 3LWUA 4OO1H 4YHHH 2F1MA 4YHHQ 1TWFB 3JAMi 3I90A 3VYUA 3M9BA 2WV6D 4DUZL 3E0JA 2VUMB 3U58A 3HOUG 1HPCA 5M3MH 1QE6A 1L2FA 1X3GA 2RDGA 4P71A 1A63A 4B3SL 4UHVA 4BXXG 4A3DB 2YU9H 1WE8A 1SEIA 2XGTA 3SK4A 1GM5A 1D5MC 5BR8L 4O2DA 5F2DA 3KJPA 3KDKA 4KN7C 3A55A 5EKLA 3GTKB 1EY9A 2XN9C 3EA6A 3HGBA 4IPDA 3CCUA 3CRLC 2CTKA 5FLXc 4A3JB 4KY6A 1K83H 4KMUC 2Y3MA 3RN5A 3I4MG 3MTSA 1SR3A 3BYYB 5EPKA 1F9PA 3HOZH 5M5XH 2CWPA 3IFTA 4C3HH 1S5FD 1F2ZA 2L55A 1EQQA 4HSVA 2ICIA 2VNUD 4L5QA 4POGA 1DZ1A 2PW7A 4OCHA 1VF5C 1CZGA 2N8NA 3N6RA 2VQEH 2A68C 2VQEQ 4LF7Q 4LF7H 1I94H 2UXCH 1VQOA 1A8VA 1I94Q 2UXCQ 2WAQE 3TQYA 1HNZL 1SXTA 1PTOF 2DGRA 3I72A 3L3OC 2Q2UA 1IL2A 4ZKCB 1D1IA 2WFWA 3WDNA 2EQSA 2YTYA 4O0AA 3D8GA 4R8NA 1IBLH 1OXTA 1IBLQ 3JAML 1A6XA 3S2HB 1OXUA 4AM3A 4FXKC 4KKTA 4J8QA 4IOCA 3A7LA 4L5SA 1XMQH 1B70B 2K28A 1XMQQ 1Y1WB 5DM63 3EN2A 1B9NA 1VDZA 1TUAA 5EBDA 1PH6A 1O7ZA 1QUQA 4PV1C 1QVCA 1J9OA 4BWGB 2PQAB 3HOXB 2A69D 2FHTA 4OWXB 5IGGA 1H9KA 4KI0A 4DV7L 2FMMA 4KD4A 3VR3A 1FVIA 1WCMB 2F0SA 3CW2C 1YNJC 2V4DA 3BZCA 4DR1L 1T5XD 4GKKH 4IURA 3W2DA 4GKKQ 2B39A 2F0NA 4KD3A 3M85A 1X4MA 1J4WA 2LF0A 2FJ2A 1EFWA 1L0WA 1KABA 1NMGA 4BBRH 3T13A 5JJLA 5HURA 2R93B 4DV2H 1VQEA 4DV2Q 2NTSA 2M2LA 4DR4L 4HEDA 2VS1A 5CV4A 1TY0A 3HRZC 1Y8PB 3NBIA 3GTLB 1F77A 2OPUA 2FPHX 4CBVA 1KD1C 1W3SA 4GKJL 2MPMA 2GA4B 1HA6A 1XTCD 3BDOA 2A6EC 4F87A 2F3WA 3S1MH 3G48A 1PH8A 1HZCA 1ZTGA 5C3XA 1EZ6A 2PPBC 3MXNB 2UXDL 5IWAL 1JJCB 5IGBA 4A3BG 3I56A 4KJNA 2NN6H 3V05A 4GN5A 4N9PA 4A3MH 4BS9A 1I6HB 1PRTD 4JI7L 1NTGA 3SR1A 5ELCA 4BA1I 4JI2L 3S1QB 1B1ZA 2E2JH 4JI1H 4JI1Q 4XYQA 3F8TA 3FKIG 4LF9L 1BF4A 5BR8Q 3TMEA 4GS3A 1U5KA 1SYCA 1SLJA 3I4NG 1B9MA 1GUNA 3ICEA 1K1GA 1EL0A 1TXYA 4WFN3 1RCVD 3GTMH 1H9SA 3L9AX 2XTIA 2QKIC 4UP8A 4AYBB 2O2LD 4IUPA 1D1KA 4R4IA 1V8QA 1JT8A 1U9RA 3BVGA 2HIXA 1HRJA 4LF6H 4LF6Q 1VF7A 4BY7B 2EYPA 2CTFA 2RDFA 5E1FA 4RGOS 1JQYD 4ME3A 2Y0SE 1GUTA 3J81j 1JCKB 4KY7A 1RHPA 4C2MB 1B3AA 1STBA 4B3MH 4B3MQ 1Y1VB 2O5JC 3TN2A 3ZJYC 4C3IB 2EYFA 1HNZH 2K5VA 1HNZQ 1BOSA 4R1JA 1LUZA 3G7LA 1JB7A 2JVZA 4FF3A 5JEAH 2A8VA 3HFZB 4QCLA 4A3IG 2AUJD 3PF4A 4Z9CB 4FO2A 1PYSB 5IYCH 2HIVA 2B2TA 3IKJA 4HIKA 2OCEA 4DV0H 4DV0Q 2X6GA 3CCSA 5C44B 2R92H 1O7IA 4KY5A 1VQBA 2B63G 1I4HA 2NVQH 1I3QH 5KIXA 4HIMA 4FJSA 5EJWA 3GTGB 2P2RA 4DV7H 4DV7Q 1AH9A 2UUBH 2F3IA 2UUBQ 1PYWD 3NENA 4PZ8A 4AQYL 3PQIA 4CDFC 3E5SA 4K5WA 3TS0A 3MZ5A 5CV8A 1CHQD 5I2YA 5C5MA 3A7AB 4XT1B 5M3MB 3DLLA 3CC2A 5CGKA 1GHKA 1MSZA 3CC4A 2Z9HA 1SMYD 4HMIA 2VW9A 4QGUA 1HA5A 4DR4H 4EVOA 5K36G 4DR4Q 4LFCQ 4LFCH 5K5PA 2Q2TA 2Z1CA 3U50C 2YU9B 5GROA 4LFAH 4LFAQ 2M9VA 1EWCA 3CMAA 2WP8J 4B08A 3J7AF 4M8AA 5KEEA 1F9SA 4YY3H 4JI4L 4YY3Q 4NXMH 4NXMQ 1JR0D 5FLXE 4WANA 4DAYB 3FPUB 2K50A 3BVZA 4NDXA 3CRKC 2EY2A 5LMNH 5LMNQ 2BH2A 3NQTA 1K83B 1NR2A 3RD4A 1KL9A 5C0XJ 4OIKA 3HOZB 5M5XB 4OGQC 1SNDA 2EPBA 4C3HB 4MHEA 4CKEA 1ODHA 1II3A 1PV4A 3VDYA 4PNYA 1IBML 5DAUA 1YNND 1B2TA 5JJIA 1XXGA 2E76C 5CV9A 4A3FH 2EJMA 2OTJA 4X66Q 1SRUA 4X66H 3S1RH 3VR2A 3KBXA 4MN3A 2F0DA 1D5XC 4K14A 4BBSG 4A3EG 3CCMA 1PZID 4FP5D 2VKCA 1UE7A 1W6KA 1IZ6A 1RD9D 4DKAC 3AEVA 2A1SA 4JI6Q 4MIUA 4KHZA 4EQNA 2CWHA 4JI6H 2RQXA 4HJ8A 2WKDA 3FPPA 3K0YA 1H9JA 1VQ6A 2X06A 1RTOA 3FVQA 1C0AA 2BCOA 1IL8A 3R2IA 4L6TB 4AYBE 1BO0A 4QB4A 1WJJA 4UDUC 1LTRD 1EY8A 5LL6S 4B3TH 4QUCA 2Z8LA 2EYMA 3KUPA 3GABA 4JI0H 4JI0Q 4BY1H 2EY6A 4I7AA 5FLXL 4ALPA 1MKHA 3F2CA 2MHVA 3NTHA 3MXNA 3VYTA 3R3OA 4Y7NH 4P2CB 4V190 2NZOA 1KC8C 2LTMA 1X56A 3IRBA 3PO2H 3OMCA 1VQ5A 4UP7A 4B3RH 5JVH3 1FNUA 4B3RQ 1IYJB 2JXMB 4GLVB 4DR6L 1KIXA 1NCVA 4DR7H 4BBRB 2VUMH 3TBIB 5EKKA 1T5EA 1LYLA 1ILQA 3VYRA 4JI8L 1PMRA 2I07B 1Y14B 1LABA 5D14A 4R9WA 1M90C 3JAMc 2E3UA 1CQVA 3D0FA 2RDHA 3DEOA 5E7NA 1Y8OB 1ENFA 4ZUIA 1U4PA 4WRDA 3F2UA 1IW7D 4G7ZC 4AQYH 1XMOH 4TQUS 4XXEA 4AQYQ 1XMOQ 1IHZA 1BVSA 4DV5L 1E0BA 2R7ZH 3S1MB 1VBIA 3CAMA 1FNWA 1LT3D 4KHVA 2JA7G 2WKCA 1AP0A 4JBJA 2JA8G 2D5DA 4A3MB 1SNOA 5IP9H 4C1NI 3KF6A 4LUOA 3F1ZA 1UNSA 2F0MA 2E2JB 5GAEC 4KK7A 1VQAA 3NQIA 1PTOC 4GNXA 1JOQA 4LWCA 3ULLA 5M3FH 1PRTB 4KLKA 2B2YC 4YWKA 1LLRD 4JI3L 4LFBL 4JI4H 4JI4Q 1A3VA 3DMUA 4C3JH 3H94A 4R8IA 3J81i 1PH5A 2B3GA 3GTMB 3TP6A 1K0RA 2Q2IA 1WI5A 1N34L 4ZUJA 3A5ZB 3C3LA 2G9DA 4ZQ3A 4DV4L 1PH7A 1KDBA 3JC66 1PH2A 2M6QA 2K75A 2MJ8A 3I8ZA 4FDBA 2LXKA 3J80i 1B7YB 1QOHA 4QY7A 2QCPX 1L1OA 3RNUA 4Y52H 3TSSA 2ZXRA 1QB5D 1CUKA 3QJYA 4RA8A 1HR0L 2ATWA 1KTKA 1E7ZA 1NUCA 3V69A 2F0TA 1BQQT 1LTAD 4JPBW 1DOLA 1XNQL 2BA0A 3CHBD 1DGSA 2G9HD 1YIJA 3FRPB 3KK7A 1V1OA 4WJ4A 2KOLA 3K5OA 3VA7A 4EQPA 1IKMA 2UU9H 2UU9Q 1D5ZC 1ZYRC 3G71A 1NJIC 3NWTA 2JN4A 5CBEE 2D62A 1C9OA 3M3YH 3PIP3 5ELEA 1VMPA 4QJFA 1P8LA 2JA9A 4CJ1B 2BL5A 1X55A 2R92B 1UE5A 2I5MX 3M7GA 2NVQB 3NK9A 1I3QB 1JICA 2R7FA 4DNRB 4IFDI 3FDTA 3ER0A 2CW0C 1BUVT 3HOXG 1KLUD 2XNAC 1ET6A 2MP1A 4F8MA 4H7BA 3E9IA 1VS0A 5FOBB 5CR3A 2VL6A 1FYCA 1ICFB 3J81L 1QUQB 3H3VH 4A3GG 1X6OA 2IY5B 2D9UA 3OYYA 4EQ5A 1VQ9A 2HCIA 1G2SA 2KENA 1FGBD 4JI5L 4C56C 5C4HA 5KNCA 1JOKA 4JVZA 3DWPA 3J7AV 2B2WA 2NWGA 5CV5A 4JI8H 1ZZIA 1VQMA 3AFPA 4JI8Q 5DEHA 2X6LA 5A2QL 1DTJA 4OL7A 1SYGA 2PMZB 2WAQB 4IPGA 4IALA 1AFPA 4DR5L 4PQXA 5C0XH 1N33H 1N33Q 1X9ZA 1F2LA 4RG1A 3S24A 5JPNC 3VKEA 3EZJA 2GVBA 2NBFA 3M4PA 4S3SA 1GO3E 1Y8NB 1Q90A 4OWTB 4YWLA 1EIFA 4ABNA 1EY0A 4DUYL 1F0XA 4X3TA 1CT1D 2Z6KC 1Z47A 2V1CC 1G8ZD 3CF5A 2KQ3A 4DF7A 2JA6G 4A3FB 5FJ8G 2AKWB 4DGZA 3ND9A 4DPGA 3S1RB 4NP5A 1N32L 2F4VH 2JEAI 2SEBD 3M7NA 5C3EH 3BDCA 3K7UC 2K52A 4LFBH 4LFBQ 2Z6BA 5KNBA 3J7AK 3CCEA 1SE8A 3W1GA 4DV3H 1YJWA 2MQHA 1C7YA 1G6ZA 2ICEC 2QGQA 1N34H 5EQ0A 1N34Q 1STHA 5HGTA 1SYEA 4CKCA 1X3PA 1V43A 4DV6L 4NKLA 4JK1C 2VQFH 3HOWG 2H4OA 2VQFQ 5FKAC 3G6EA 3OWEB 1HNXL 1H9SB 2K05A 5D65A 1SMYC 4A3KG 4NBQA 4NXNH 4NXNQ 5JEAJ 3T4AC 1TQOA 4BY1B 1HR0H 1HR0Q 1YITA 4JOIC 2QDLA 4GOPA 4UAIA 2QILA 1PVOA 2YTVA 5NUCA 3MFGA 4XTCS 1ET9A 1JOOA 5CC4A 1Q8IA 1Q81C 3PO2B 5DT9A 1F9RA 3A74A 4FF1A 4A3LG 5IOCA 3OIQA 4FNFA 3HOUH 1RODA 3TZDA 3NE5B 1K8GA 2JA5G 5ELDA 1GUWA 1B4OA 4FVMA 4Q0FA 2BE5D 4NZTM 4HJ9A 1B53A 4BA2I 1LTID 3JAME 1GD7A 2OT2A 3CQZH 4BXXH 1FJGH 1FJGQ 5JJKA 5C3WA 3H15A 1QZHA 1HH2P 3OTOH 3OTOQ 1RL2A 1STGA 1UEAB 2LS01 3S16H 4WORA 1B50A 5ELBA 4NZRM 2JEBI 3UE0A 3TDQA 3T1YH 2EZVA 3T1YQ 3PIO3 1Q8KA 4OX9L 4A3CG 4LF8Q 2R7ZB 4LF8H 1VQIA 2LRRA 3UDGA 4ID6A 3I4MH 2YTXA 5JVG3 3FHWA 5DLQE 1MGSA 2B2UA 2K7VA 2OPVA 1J5EH 1QG7A 2R7DA 1J5EQ 4FYDA 2Y0SB 4RWSC 4LUVA 1EU3A 1EIGA 3SK5A 2L0CA 5FK9C 2EDGA 2ZJRA 2R61A 1N8RC 1VQGA 1VQ7A 5M3FB 1FD7D 3GP7A 4B9XA 5IT9L 4I65A 1Z2IA 4KKUA 1S4ZA 3PUYA 1GUOA 3TRZA 1LTBD 5COYA 4C3JB 2CTLA 5C4ZA 5IIFA 1HCZA 4K8JA 3PSIA 4XDXA 1EYGA 2PMZE 4LUZA 3D4WA 3VYSA 1W2BA 2FINB 1Q12A 3H0GB 2WB1G 4RCOA 3STBC 1RDPD 4U68A 1R4QB 1DXMA 1EYDA 4IUNA 4OONA 2F0LA 3MXUA 5GAGC 2M00A 3PO3G 4HJAA 1Q46A 1RF2D 3A54A 3RZOH 2IPKD 2RBMA 1N32H 1B44D 2MGSA 1N32Q 2DY8A 4HIDA 2RKSA 4KHPH 1A2TA 4KHPQ 3C1EA 2OXPA 1BKBA 1WD1A 3DM3A 1E1TA 1L0YB 3J7ZC 4X6AH 2ZXOA 4H02A 3NELA 2ZJQA 1CHPD 1VQCA 4JBMA 5EKIA 2L12A 4IN3A 3SK8A 2F0FA 1PZJD 3MFYA 3NBHB 3K5MA 3M3YB 4DV6H 4DV6Q 1AE3A 3KLSA 4C1NK 1YHBA 3AEVB 3L7ZC 3HKZG 2NVYH 3H91A 5I6WA 2K5QA 3LX0A 1XYIA 1PTOH 1WTWA 1CI3M 3M4QA 1YNXA 4X65H 4X65Q 2HT1A 1A3UA 1JJGA 2PCFB 1AEXA 3EROA 3PGZA 4NW2A 1EWHA 5T1IA 2HQEA 2A74C 4KKSA 1PRTF 2OTLA 3MA2B 2PNRC 2KCCA 4A3BH 2AWOA 4KJOA 2NZ1D 2FXQA 1ZXTA 1HUMA 4DUZH 4DUZQ 5BN5A 4EX5A 4PZ6A 2K6AA 1E2WA 3FKIH 1C8CA 4A93G 4IQZA 1Y69U 2K1HA 4IJLA 2NB0A 2E75C 3H09A 4B3SH 2SNMA 4B3SQ 2LTLA 1IYUA 3J7YW 3RF2A 3I4NH 3EBEA 3E9HA 3RUZA 5BR8H 3HOVG 1JC7A 2A5HA 4FF4A 2VB3X 1UG8A 1Z9FA 1MJEA 4TRDA 3I0PA 3WOFA 1PH3A 3QOLA 2F0QA 2C9OA 3K57A 2XWJB 1PA6A 3SK6A 1X54A 2PYKA 3T1HL 3EFXD 1A3TA 4AIMA 2ZTDA 1D2BA 3J81c 3I55A 2QNDA 4X64L 3OWFA 5KYIA 2NTTA 1BBXC 3GV6A 5C3EB 1STYA 2KHSA 1PXUA 1P16A 2QF7A 3UDIA 1DONA 1BCPB 3KF6B 2IX3A 1HZAA 2HH2A 3OW7A 3RZDH 4H44C 1IXRA 4A3IH 1MSGA 4IUVA 1PH4A 4GNXB 1U0LA 2F0UA 3J80c 1YHQA 1Q1BA 4K8IA 4H8AA 2J7ZA 2YYZA 1BDOA 3AFQA 3T16A 2HH3A 3G4SA 3H6MA 2K5NA 5E4WC 5LMNW 3O13A 4IUUA 4UY8C 2B63H 4JYAL 4DA2A 4DNTB 3R93A 3OSOA 5A35A 3CPFA 1UEBA 5FO9B 2C5CA 4N8FA 1GJXA 1GHJA 5CV6A 3GD7A 1ZEQX 5C4XG 3TEHB 4RKBA 1L1OB 4JVYA 4MNOA 3U1KA 2E5LL 3HOUB 4MTNA 2RSOA 4DR1H 4DR1Q 4LF4L 2XIWA 5I2XA 3W3AA 1TWGH 4LW1A 4U673 5K36H 3CQZB 4G08A 1R9TH
chains in the Genus database with same CATH topology
1K8OA 5E3FA 3BZDB 1YVCA 3S1NH 3CD6A 3S16B 3MXGA 3I7FA 2N55A 4JV5L 3OIPA 4CKBA 4GKJQ 3D6CA 1EY4A 5LMUL 3I4MB 2C35B 3KOJA 1KXLA 2CFMA 3K81C 2CKZB 3F2BA 1GOZA 1VIGA 2F0PA 3ULJA 2F0JA 2UXDQ 5IWAQ 1YJNA 3UDFA 2HDMA 4L8JA 3GTQH 4PZ7A 1LO5D 4JI7Q 2IX1A 2F0EA 3MXPA 2QEXA 3DWAA 4JI2Q 1SNCA 4L63B 3HOYG 1HQMC 4A3EH 2KCTA 2ZT9C 2LMCB 2RVLA 2VY3A 2IHEA 4LF9Q 4TKOB 5I9OA 3PUWA 1IYVA 2L11A 3C46A 1DYQA 3NBHA 2IWHA 4QL5A 5C6AA 5M5WH 1EEFD 1LT4D 1VQ8A 4JBKA 3RMHA 5FLMG 2KHJA 1QZGA 2NVXH 2OWOA 3MAQA 4B9WA 1CM9A 4B8TA 4V0BA 1XNRL 3NTKA 2MJHA 2ANRA 3S14H 1TWAH 3T1HQ 4HSPA 3NTIA 3RZOB 5T1GA 1WTPA 3PMFA 3CXCA 3K0XA 4X64Q 2UXBL 4DR2L 4X62L 1JE4A 5CV7A 1DCZA 1EOTA 2WACA 2L5TA 1EQTA 2VXWA 1A62A 4ODGA 3X3NA 2PZWA 4FF2A 4RHSA 1HHVA 2BOSA 3OW2A 2F52A 1C48A 1HQRD 4F7XA 4K6DA 5IT9c 3NP8A 3MEFA 3VR4A 4K0KL 1SNQA 2ID0A 1E22A 1CK1A 5KNDA 4I7ZC 2NVYB 3GTJH 2IT1A 4Q5VA 2A68D 3K59A 1PTOB 3I70A 3VR5A 2EOTA 5E4XA 2OQ0A 1VQJA 2K01A 5IYBH 5G3LD 1UE6A 1KRTA 5DM73 3K6OA 2PQEA 2BDNA 3QG1A 3NUCA 4J15A 2JA7H 4RAUC 4A3BB 2E5LQ 2XRQD 2JA8H 4IJHA 1QWYA 3QWNA 4GOPB 4LF4Q 3PIPA 3HG9A 4CJ2C 2VUMG 3PUVA 1TWHH 2F4IA 3Q23A 4M1UB 3FKIB 4EGVA 3ULPA 1JWSD 5J22A 2F0OA 1TWCH 2PI2E 1X32A 3BYTB 3I4NB 1X3EA 4O1NA 1SN8A 1YNJD 1BR9A 2PZTA 5CBAE 4HJ7A 1E2VA 4JC0A 1S40A 4A3DG 1AZPA 2NYZD 1M1KC 2O4XA 3A8IE 4CHTB 1YZ6A 2UUAL 2IJ0A 2Z4HA 1GVPA 2AMCB 3S15B 3DM1A 3CCQA 4G57A 1NSNS 2A69C 5LMUQ 2TSSA 4PMWA 3A8JE 2OQKA 5H1SE 2B8GA 1XX8A 2HHHL 1UWVA 1G51A 5EPLA 2MFIA 3H0GH 4A3JG 3J81E 2L4NA 5TSSA 1TS4A 2AQ3B 2B2VC 2ASBA 3K7AH 2AQ1B 1VQ4A 3K8AA 3H3VI 1IBMQ 2K04A 1N9WA 1MSHA 4X3UA 1EYCA 2A6ED 1WYDA 3CU7A 5KRUA 2BH8A 1S5BD 5M9OA 5A2QE 1HUNA 3NSWA 3U9OA 2NUCA 3RZDB 1XPUA 1QCBD 4LIJA 3Q8DA 4A3IB 3CMEA 1JWUD 4DFAA 2CTJA 1FGUA 2PI2A 1M4VA 2WB1E 4PMBA 5C0XI 2DGYA 4XIGS 5BN4A 5IYDG 1EEID 4RGTA 2B63B 1EY6A 1ASZA 3R8BA 3KLSX 4HTHA 2A6HD 1Y1WG 1PRTC 4GN3B 4DR2Q 4A76A 2UXBQ 2FMCA 3ZYYX 1HNWL 4IO9A 2UUCL 3AB9A 4ZK9B 2YQRA 1OXXK 5FO7B 4YHHL 3C1FA 3PCOB 1ENAA 3TREA 1EQVA 1SE3A 1IKLA 2DNCA 1WTQA 2NVTH 3KLWA 4A3GH 2SDFA 3SDZA 1SE2A 3DHQA 1ONLA 1WCMG 2PW5A 5GADC 3BS1A 3I3CA 3RN2A 4JCVE 2HCCA 4K0KQ 1TWGB 4DR6Q 3RLOA 5EGTA 1TR5A 3B6YA 1R9TB 1EQRA 3HKZE 2SNSA 1O80A 2R93G 1UUPA 3OOCA 3K58A 3S1NB 2LXJA 2YV5A 1I4PA 4E6IA 1JMCA 5EAYA 4LNQA 2ZM6L 3J80L 2CWAA 1K3RA 5C4JH 3K5LA 1HR0W 1XWEA 4DV1L 1BCPF 1STNA 1EZ8A 4DV5Q 4DXFA 3G6JB 1XJVA 2E2DC 3Q0AA 1NMFA 3CPWA 2JA6H 3A0JA 3MWYW 3GTQB 1TKWB 2JK8A 5FJ8H 2CCZA 4OO1I 1SDFA 4GLXA 1HTLD 4TSSA 1DOKA 1BCPD 4LK1C 3QB3A 2EYJA 4FXDA 3HZXA 5IE8A 2VQEL 4BBSB 4LF7L 4A3EB 3GDEA 1KQSA 1I94L 2UXCL 1H95A 2K03A 3PIOA 4JI3Q 1U4MA 2EXZA 2IX0A 3NHHA 2F03A 5IGDA 5M5WB 1ZZJA 1NY4A 1IBLL 1JWMD 2K33A 1S5CD 3FMCA 3NWSA 1DJRD 3M4YA 4AYBG 2NVXB 3URYA 2ZTCA 1PFMA 4NB3A 4EQOA 3KJOA 3HOWH 3CCJA 2B2YA 3S14B 1TWAB 4IFDG 1J5KA 1WTVA 4A3KH 3HEJA 4BY7G 4DV4Q 1XPOA 3S9WA 3BVMA 4A4IA 5IGCA 1WVNA 2L15A 1SJHD 3UE1A 2PNHA 1WTXA 2Q8IB 2I5LX 2EVBA 2JYOA 4L5TA 1SSOA 1Y1VG 4NPSA 1KHIA 5IT9E 4KTAA 4C3IG 1RKNA 1AE2A 5M5YH 4A3LH 4GKKL 1XNQQ 3LNNA 4ME5A 3LWEA 2A19A 2DNEA 4AH6A 2CQOA 1LM0A 1CSPA 2BDOA 1NE3A 5IP7G 3RLFA 3AQQA 4H0LC 4DV2L 4RMFA 3GTJB 2DY7A 2N3SA 1U4RA 5C44G 3EQLC 1PZKD 1N36L 3Q6SA 5D3DA 1YNNC 1PFBA 4RFBA 2GN5A 1LT6D 2WIIB 4A3CH 4K6LA 1ENCA 4QIWE 1KNAA 2JA7B 1KAAA 2DN8A 2KVMA 4NMZA 5CYUA 1SBBB 3QIAA 4OO1G 1JJ2A 3X3MA 1J8IA 2JA8B 3K80C 4DK6C 2D0PA 4ILWA 1TWHB 3KF8B 5M3MG 3FEWX 2F3VA 4JI1L 3GO5A 4JI5Q 2HQLA 1TY2A 4ZKBB 1O7LA 1TWCB 4POFA 2OF1A 5JAVA 3AMUA 2K5WA 3RR5A 4DK1A 2RSNA 2ZM6Q 4DR5Q 4QMFB 2BA1A 2B8FA 1X3FA 3LGJA 4DV1Q 1DOMA 4CGYB 4LF6L 3J7A5 5LL6X 2MUYA 3GTPH 2ANNA 4XT3B 1EIHA 1FR3A 1ESRA 1MD2D 3K7AB 2KCMA 4DUYQ 3PO3H 1LV9A 3PV0A 3HOZG 3NEMA 4XQNA 4C3HG 1TT2A 2PY9A 2ES2A 4B3ML 3P1HA 1CKNA 2B2TC 4IUQA 2NN6I 4RGNA 1HTPA 3CCRA 1SYBA 3E0EA 3I4OA 4DAMA 3I73A 2Z6KA 3T51B 2CTMA 2EYOA 1SNPA 1X9NA 1MJCA 1IW7C 1V1PA 2H1EA 4DV0L 1SMXA 5GQOA 2N88A 3BDLA 5I9PA 1PTOD 2AWNA 1CKOA 1VIHA 3V2TA 1EUJA 1W6JA 2IL8A 4IOAA 4ULLA 1HNXQ 4LMQD 1NAPA 2Z0SA 2CVRA 1NR4A 2UUBL 2N49A 1ESFA 2PZUA 4GN4B 1MIUA 1F2YA 1FNVA 1I5FA 2NVTB 1YJ9A 4A3GB 4R4CA 2B29A 4YCVA 4XQJA 4YCWA 4TVAB 5AJ3L 4HR7B 2K5DA 4QQBX 4LJZC 3KLRA 3BJUA 1ZZKA 1BXTA 1YEZA 2D0OA 3I91A 1EWIA 2KECA 4JOIA 4LFCL 1EY7A 4A93H 2O5IC 4BBRG 2E2IH 1SROA 1H9MA 4LFAL 1I6VC 3C2PA 2A1AA 1N36Q 1S72A 3DUZA 4YY3L 4NXML 3HOVH 3PUXA 1S5ED 4G4KA 2A73B 5C4JB 1ZYRD 5LMNL 1AW7A 2AUKA 4OX9Q 2K1BA 1VQLA 2EY1A 5KYLA 3WWVA 3S15H 2ZXPA 2KUMA 1E1OA 1IBKL 2WINB 1SYFA 4OXPA 1ML0D 2JA6B 2NN6G 1QJOA 3PUZA 1KDAA 1KHMA 4A3MG 5ISRA 3IFDA 4X66L 4K5XA 2VZAA 2CW0D 1PLFA 5FO8B 5LHY1 3P7JA 5HY6A 2HUGA 1DM0B 2TMPA 1FL0A 1KAWA 3UDXA 2A6HC 3KYHC 1HZBA 1OXVA 1V9PA 2J0TD 2EXDA 4JI6L 4GLAC 1EOVA 2FMRA 1K8MA 4XYOA 1VQDA 2JP1A 3H3VC 1G91A 1C4QA 2KJXA 3ERSX 4G7OC 1V1QA 2KA7A 5IY0A 3HOWB 5CMDA 2VB2X 1CQFA 2XSCA 2KBNA 1EFID 4A3KB 2FFKB 2GVAA 3CCVA 1VQKA 1XTDA 4B3TL 2CTEA 1AZQA 5J3BA 4DNIA 4K2LA 4JI0L 3KBGA 1F9QA 2K5HA 2QEJC 1D6EC 1I50H 4X3SA 4A75A 2LFNA 4DAPA 1M8AA 2L1BA 2K14A 5C4XH 1PDQA 3NPPA 5M5YB 2E2HH 4B3RL 3KF8A 1ILPA 4YWMA 2XVSA 4JVHA 4WALA 2JA5B 2I46A 3ONAB 5JPMC 2RHSB 5JEAG 4DR7L 5IGEA 1K9MC 3SHLA 1PH9A 1O7YA 5IYCG 2CPQA 4RKLA 3D31A 1WOCA 3PF5A 2PQUA 3P20A 4UP9A 1SAPA 2R92G 1CKMA 1PYBA 4OHJA 3W5OA 2E8GA 3Q22A 1GUSA 1ZKOA 1BCPC 3EIVA 1SFOH 3KDFB 4HCSA 1XMOL 4P74A 3OMGA 4HCEA 3MC0B 3I4LA 2PO4A 3L0OA 4P72A 1CTMA 4GNXC 2E74C 1A0IA 3VR6A 5AJ3Q 1PFSA 1EY5A 3SVMA 1STEA 5BN3A 2XWBB 2KEEA 2F0KA 3MVVA 3AYHB 4DR3L 2F0VA 1HZ9A 1X65A 3HOYH 2EYHA 2EE1A 4F88A 4JG2A 1PHJA 3MHBA 2SOBA 3IAYA 3HS0C 4BBSH 2WAQG 1VQHA 4KN4C 3S17H 4G7HC 1L1OC 1NBWA 2WB1B 4YCUA 1Q82C 1SYDA 1KRSA 2EIFA 3D6WA 2R6GA 5EBCA 1JB3A 5FLMH 3GTPB 1RIPA 1TS3A 3DWQA 1IBKQ 2PQAA 3PO3B 3M4OH 1RTNA 4ZAIA 3F2DA 3Q24A 2AQ2B 2JZXA 2L9HA 1S3OA 1WFQA 4MZ9A 2BE5C 1TIID 3A8KE 4A3FG 5KGUA 2ZJPA 4IFDJ 1EU4A 1GXDC 1WTOA 2EJGC 1JE5A 3A5UA 2JSOA 2F0IA 3UI2A 4LF5L 3QO2A 3HKSA 2F0WA 2X69A 1RJTA 2UU9L 5D3IB 1LTLA 1BBUA 2JJQA 1WTRA 1CSQA 3S2DH 1I4GA 4O42A 5IGFA 4XQQA 1ICWA 3MEHA 1VCIA 5G3LF 3HKZB 5I6YA 2MO1A 3GV3A 4RHRA 3KFUA 3GTOH 1AN8A 4B3TQ 1TS5A 1MBYA 2AHOB 2Q8TA 4JYAQ 4R4OA 5JJZA 3BU2A 4BY1G 5J39A 5HGQA 4KV6A 1O78A 4IPHA 3V96A 2B2WC 2CQAA 1WD0A 3STBD 3DXJC 1DD2A 5GAHC 3GQBA 1JORA 1TWFH 1LTTD 1VQNA 2Q2HA 3PO2G 4DR7Q 3D4RA 1E24A 3SXHA 2H5XA 2KHIA 2LSSA 3I2ZA 1F2MA 1HJPA 5ELOA 5ELFA 2KEDA 4A93B 3IL8A 3NXWA 2IW3A 2E2IB 2RF4A 1H9RA 1J6QA 5AFWA 3AU7A 5C5LA 4QMGA 1I4RA 1QNUA 4A3DH 4GZYC 1N33L 3HOVB 1DT4A 5IYBG 2DUDA 1BBWA 3FP9A 2D2CC 2Z4IA 2Q8RE 4IUTA 4JV5Q 1OO9B 3VA5A 2OEOA 2IHFA 3GTKH 4IPCA 1VQFA 2R7ZG 3BZKA 2RCNA 4A3JH 4OWWB 3DEPA 1LACA 3RLNA 3SE0A 1HFGA 1OTCA 5IP9G 1LTGD 2Y0SG 4DR3Q 2F4VL 1UAPA 3SGIA 3CP0A 1LTSD 1G6PA 2I0QA 4QF4A 3EVQA 1GUGA 1TU2B 5M3FG 2K32A 1EC6A 3QOJA 3ITPA 4WJ3M 4DV3L 4J6HA 3CC7A 1E2ZA 3D4DA 1PFNA 3W1BA 4C3JG 2JE6I 3J80E 4RH6A 4RGMA 1G291 5IYDH 4WJWA 2ALYB 4OIJA 4GOPC 1Z7TA 1KLGD 2R3ZA 3S2HH 4DK0A 3H0GG 2VQFL 3TS2A 2ENBA 1WVLA 2J4XA 1I4QA 1U4LA 1CA6A 1OXSC 4NXNL 3KDFA 4YIJA 1XNRQ 1Y1WH 1Q7YC 3D3RA 4ZYSA 2F0HA 1YI2A 1I50B 1R4PB 4QIWB 4X62Q 5C4XB 3HOXH 2E2HB 1TVXA 1UE1A 3TP7A 2NZHA 4APVA 4LF5Q 4UPAA 1WCMH 1YHAA 4DAVA 1CKNB 1X4NA 1QILA 4LAAA 4HN7A 3U4ZA 1XPRA 2F0GA 1FJGL 4QUFA 1YBYA 4DAYA 2R93H 1EYAA 1GKHA 1QVFA 3K5NA 4PMCA 3OTOL 5CORA 1V1PB 2EYLA 1K8AC 4N9TA 1SJED 2B2UC 3GTLH 1SFOB 3T1YL 2K4KA 1KNEA 4LF8L 1Q1EA 3T56B 1X3QA 4IZ8A 1QVGA 3P75A 1A2UA 1CZWA 2XRSD 4HIOA 1J5EL 1PH1A 2LKVA 2CHBD 3WOEA 1B8AA 1I6HH 5ELNA 1L0XB 1HFNA 1ASYA 3E6ZX 3HOYB 4DK3C 1STAA 3HP3A 3S1QH 1CFMA 4H13C 4HJ5A 1Q3LA 1T9HA 2AXYA 3R2TA 4R4TA 3N52A 5C0XG 3S17B 3A56A 4DN4M 4P75A 3TP8A 3T53B 4DXGA 1S5DD 2UUAQ 4HMJA 2I5HA 1D7QA 2HDLA 1I4XA 5I4DA 4ZRZA 4L5RC 2EJFC 2ZTEA 1Z6HA 4IFDH 3M4OB 4BY7H 2LY7A 2HHHQ 2EY5A 5IODA 1XMQL 1K73C 1A15A 2F4VQ 4X3KA 2RHQB 3U4VA 4KHPL 5EPJA 1SNMA 3SEBA 4R4QA 4C2MH 2MO0A 3L2PA 1Y1VH 4P73A 3TP5A 4C3IH 5C3EG 4DV3Q 4RCNA 2B2VA 2N78A 4HAEA 4FXGC 1VMCA 1VQPA 1D8LA 1KDCA 3S2DB 5IP7H 2JA5H 5JOBA 2RA4A 3ERQA 3U9SA 3BG3A 5DNFA 1QNKA 1HXYD 1BNZA 3TZUA 3GTOB 4K5VA 1SEBD 1TS2A 3CKIB 3OHXC 5C44H 2QA4A 1CA5A 3ND8A 4JBWA 1E3PA 1MI2A 4CJ0B 4X65L 5J1ZA 1SE4A 1EIYB 4DU9A 2JQOA 1LT5D 1G2TA 2QDBA 4K2KA 4Y7NB 4J1MA 3GTGH 3OPOA 2MNAA 1HNWQ 2KCNA 3EJIA 4ZLTF 1Q86C 4PG3A 3CCLA 2UUCQ 3LWUA 4OO1H 2F1MA 4YHHQ 1TWFB 3JAMi 3I90A 3VYUA 3M9BA 2WV6D 4DUZL 3E0JA 2VUMB 3U58A 3HOUG 1HPCA 5M3MH 1QE6A 1L2FA 1X3GA 2RDGA 4P71A 1A63A 4B3SL 4BXXG 4A3DB 2YU9H 1WE8A 2XGTA 3SK4A 1GM5A 1D5MC 5BR8L 4O2DA 5F2DA 3KJPA 4KN7C 3A55A 5EKLA 3GTKB 1EY9A 2XN9C 3EA6A 3HGBA 4IPDA 3CCUA 3CRLC 2CTKA 5FLXc 4A3JB 4KY6A 4KMUC 1K83H 3RN5A 3I4MG 3MTSA 3BYYB 5EPKA 1SR3A 1F9PA 3HOZH 5M5XH 3IFTA 2CWPA 4C3HH 1S5FD 1F2ZA 2L55A 1EQQA 4HSVA 2ICIA 2VNUD 4L5QA 4POGA 1DZ1A 2PW7A 1VF5C 1CZGA 2N8NA 3N6RA 2A68C 2VQEQ 4LF7Q 1VQOA 1A8VA 1I94Q 2UXCQ 2WAQE 3TQYA 1HNZL 1SXTA 1PTOF 2DGRA 3I72A 3L3OC 2Q2UA 1IL2A 4ZKCB 1D1IA 2WFWA 3WDNA 2EQSA 2YTYA 4O0AA 3D8GA 4R8NA 1OXTA 1IBLQ 3JAML 1A6XA 3S2HB 1OXUA 4AM3A 4FXKC 4KKTA 4J8QA 4IOCA 3A7LA 4L5SA 1B70B 2K28A 1XMQQ 1Y1WB 5DM63 3EN2A 1B9NA 1VDZA 1TUAA 5EBDA 1PH6A 1O7ZA 1QUQA 4PV1C 1QVCA 1J9OA 4BWGB 2PQAB 3HOXB 2A69D 2FHTA 4OWXB 5IGGA 1H9KA 4KI0A 4DV7L 2FMMA 4KD4A 3VR3A 1WCMB 1FVIA 2F0SA 3CW2C 1YNJC 2V4DA 3BZCA 4DR1L 1T5XD 4IURA 3W2DA 4GKKQ 2B39A 2F0NA 4KD3A 3M85A 1X4MA 1J4WA 2FJ2A 1EFWA 1L0WA 1KABA 1NMGA 4BBRH 3T13A 5JJLA 5HURA 2R93B 1VQEA 4DV2Q 2NTSA 2M2LA 4DR4L 4HEDA 5CV4A 2VS1A 1TY0A 3HRZC 1Y8PB 3NBIA 3GTLB 1F77A 2OPUA 4CBVA 1KD1C 1W3SA 4GKJL 2MPMA 2GA4B 1HA6A 1XTCD 3BDOA 2A6EC 4F87A 2F3WA 3S1MH 3G48A 1PH8A 1HZCA 1ZTGA 5C3XA 1EZ6A 2PPBC 3MXNB 2UXDL 5IWAL 5IGBA 1JJCB 4A3BG 3I56A 4KJNA 2NN6H 3V05A 4GN5A 4N9PA 4A3MH 4BS9A 1I6HB 1PRTD 4JI7L 3SR1A 1NTGA 5ELCA 4BA1I 4JI2L 3S1QB 1B1ZA 2E2JH 4JI1Q 4XYQA 3F8TA 3FKIG 4LF9L 1BF4A 5BR8Q 3TMEA 4GS3A 1U5KA 1SYCA 1SLJA 3I4NG 1B9MA 1GUNA 3ICEA 1K1GA 1EL0A 1TXYA 4WFN3 1RCVD 3GTMH 1H9SA 3L9AX 2XTIA 2QKIC 4AYBB 4UP8A 2O2LD 4IUPA 1D1KA 4R4IA 1V8QA 1JT8A 1U9RA 3BVGA 1HRJA 2HIXA 4LF6Q 1VF7A 4BY7B 2EYPA 2CTFA 2RDFA 5E1FA 4RGOS 1JQYD 4ME3A 2Y0SE 1GUTA 3J81j 1JCKB 4KY7A 1RHPA 4C2MB 1B3AA 1STBA 2O5JC 1Y1VB 4B3MQ 3TN2A 4C3IB 3ZJYC 2EYFA 2K5VA 1HNZQ 1BOSA 4R1JA 1LUZA 3G7LA 1JB7A 2JVZA 4FF3A 5JEAH 2A8VA 3HFZB 4QCLA 4A3IG 2AUJD 3PF4A 4Z9CB 4FO2A 1PYSB 5IYCH 2HIVA 2B2TA 3IKJA 4HIKA 2OCEA 4DV0Q 2X6GA 3CCSA 5C44B 2R92H 1O7IA 4KY5A 1VQBA 2B63G 1I4HA 2NVQH 1I3QH 5KIXA 4HIMA 5EJWA 3GTGB 2P2RA 4DV7Q 1AH9A 2F3IA 2UUBQ 1PYWD 3NENA 4PZ8A 4AQYL 3E5SA 4K5WA 3TS0A 3MZ5A 5CV8A 1CHQD 5I2YA 5C5MA 3A7AB 4XT1B 5M3MB 3DLLA 1GHKA 5CGKA 3CC2A 3CC4A 1SMYD 4HMIA 2VW9A 4QGUA 1HA5A 4EVOA 5K36G 4DR4Q 4LFCQ 5K5PA 2Q2TA 2Z1CA 3U50C 2YU9B 5GROA 4LFAQ 2M9VA 1EWCA 3CMAA 2WP8J 4B08A 3J7AF 4M8AA 5KEEA 1F9SA 4JI4L 4YY3Q 4NXMQ 5FLXE 1JR0D 4WANA 4DAYB 3FPUB 2K50A 3BVZA 4NDXA 3CRKC 2EY2A 5LMNQ 2BH2A 3NQTA 1K83B 1NR2A 3RD4A 5C0XJ 1KL9A 4OIKA 3HOZB 5M5XB 4OGQC 1SNDA 2EPBA 4C3HB 4MHEA 4CKEA 1II3A 1PV4A 3VDYA 4PNYA 1IBML 5DAUA 1YNND 1B2TA 5JJIA 1XXGA 2E76C 5CV9A 4A3FH 2EJMA 2OTJA 4X66Q 1SRUA 3S1RH 3VR2A 3KBXA 4MN3A 2F0DA 1D5XC 4K14A 4BBSG 4A3EG 3CCMA 1PZID 4FP5D 1UE7A 1W6KA 1IZ6A 1RD9D 4DKAC 3AEVA 4JI6Q 4MIUA 4KHZA 4EQNA 2RQXA 4HJ8A 2WKDA 3FPPA 3K0YA 1H9JA 1VQ6A 1RTOA 3FVQA 1C0AA 2BCOA 1IL8A 3R2IA 4L6TB 4AYBE 1BO0A 4QB4A 1WJJA 4UDUC 1LTRD 1EY8A 5LL6S 4QUCA 2Z8LA 2EYMA 3KUPA 4JI0Q 4BY1H 2EY6A 5FLXL 4ALPA 1MKHA 3F2CA 2MHVA 3NTHA 3MXNA 3VYTA 3R3OA 4Y7NH 4P2CB 4V190 2NZOA 1KC8C 1X56A 3IRBA 3PO2H 3OMCA 1VQ5A 4UP7A 5JVH3 1FNUA 4B3RQ 1IYJB 2JXMB 4GLVB 4DR6L 1KIXA 1NCVA 4BBRB 2VUMH 3TBIB 5EKKA 1T5EA 1LYLA 1ILQA 3VYRA 4JI8L 1PMRA 2I07B 1Y14B 1LABA 5D14A 4R9WA 1M90C 3JAMc 2E3UA 1CQVA 3DEOA 2RDHA 3D0FA 5E7NA 1Y8OB 1ENFA 4ZUIA 1U4PA 4WRDA 3F2UA 1IW7D 4G7ZC 4TQUS 4XXEA 4AQYQ 1XMOQ 1IHZA 3S1MB 1BVSA 1E0BA 4DV5L 2R7ZH 4KHVA 1FNWA 1LT3D 3CAMA 2JA7G 2WKCA 1AP0A 4JBJA 2JA8G 2D5DA 4A3MB 1SNOA 5IP9H 4C1NI 3KF6A 4LUOA 3F1ZA 1UNSA 2F0MA 2E2JB 5GAEC 4KK7A 1VQAA 3NQIA 1PTOC 4GNXA 1JOQA 4LWCA 3ULLA 5M3FH 1PRTB 4KLKA 2B2YC 4YWKA 1LLRD 4JI3L 4LFBL 4JI4Q 1A3VA 3DMUA 4C3JH 3H94A 4R8IA 3J81i 1PH5A 2B3GA 3GTMB 3TP6A 1K0RA 2Q2IA 1WI5A 1N34L 4ZUJA 3A5ZB 3C3LA 2G9DA 4ZQ3A 4DV4L 1PH7A 1KDBA 3JC66 1PH2A 2K75A 2MJ8A 3I8ZA 4FDBA 2LXKA 3J80i 1B7YB 1QOHA 4QY7A 2QCPX 1L1OA 3RNUA 4Y52H 3TSSA 2ZXRA 1QB5D 1CUKA 3QJYA 4RA8A 1HR0L 2ATWA 1KTKA 1E7ZA 1NUCA 3V69A 2F0TA 1BQQT 1LTAD 1DOLA 1XNQL 2BA0A 3CHBD 1DGSA 2G9HD 1YIJA 3FRPB 3KK7A 1V1OA 4WJ4A 2KOLA 3K5OA 3VA7A 4EQPA 1IKMA 2UU9Q 1D5ZC 1ZYRC 3G71A 1NJIC 3NWTA 5CBEE 2D62A 1C9OA 3M3YH 3PIP3 5ELEA 1VMPA 4QJFA 1P8LA 4CJ1B 2JA9A 2BL5A 1X55A 2R92B 1UE5A 2I5MX 3M7GA 2NVQB 3NK9A 1I3QB 1JICA 2R7FA 4DNRB 4IFDI 3FDTA 3ER0A 2CW0C 1BUVT 3HOXG 1KLUD 2XNAC 1ET6A 2MP1A 4F8MA 4H7BA 3E9IA 5FOBB 1VS0A 5CR3A 2VL6A 1FYCA 3J81L 1QUQB 3H3VH 4A3GG 1X6OA 2IY5B 2D9UA 3OYYA 4EQ5A 1VQ9A 2HCIA 1G2SA 2KENA 1FGBD 4JI5L 4C56C 5C4HA 5KNCA 1JOKA 3DWPA 3J7AV 2B2WA 2NWGA 5CV5A 1ZZIA 1VQMA 3AFPA 4JI8Q 5DEHA 2X6LA 5A2QL 1DTJA 4OL7A 1SYGA 2PMZB 2WAQB 1AFPA 4IALA 4IPGA 4DR5L 4PQXA 5C0XH 1N33Q 1F2LA 4RG1A 3S24A 5JPNC 3VKEA 2GVBA 2NBFA 3M4PA 4S3SA 1GO3E 1Y8NB 1Q90A 4OWTB 4YWLA 1EIFA 4ABNA 1EY0A 4DUYL 4X3TA 1CT1D 2Z6KC 1Z47A 2V1CC 1G8ZD 3CF5A 2KQ3A 4DF7A 2JA6G 4A3FB 5FJ8G 4DGZA 2AKWB 3ND9A 3S1RB 4DPGA 4NP5A 1N32L 2JEAI 2SEBD 3M7NA 5C3EH 3BDCA 3K7UC 2K52A 4LFBQ 5KNBA 3CCEA 1SE8A 3W1GA 1YJWA 2MQHA 1G6ZA 1C7YA 2ICEC 2QGQA 5EQ0A 1N34Q 1STHA 5HGTA 1SYEA 4CKCA 1X3PA 1V43A 4DV6L 4NKLA 4JK1C 3HOWG 2H4OA 2VQFQ 5FKAC 3G6EA 3OWEB 1HNXL 1H9SB 2K05A 5D65A 1SMYC 4A3KG 4NBQA 4NXNQ 5JEAJ 3T4AC 1TQOA 4BY1B 1HR0Q 1YITA 4JOIC 4GOPA 4UAIA 2QILA 1PVOA 2YTVA 5NUCA 3MFGA 4XTCS 1ET9A 1JOOA 5CC4A 1Q8IA 3PO2B 1Q81C 1F9RA 3A74A 4FF1A 4A3LG 5IOCA 3OIQA 4FNFA 3HOUH 1RODA 3TZDA 3NE5B 1K8GA 2JA5G 5ELDA 1GUWA 1B4OA 4FVMA 4Q0FA 2BE5D 4HJ9A 1B53A 4BA2I 1LTID 3JAME 1GD7A 2OT2A 3CQZH 4BXXH 1FJGQ 5JJKA 5C3WA 3H15A 1QZHA 1HH2P 3OTOQ 1RL2A 1STGA 1UEAB 2LS01 3S16H 4WORA 1B50A 5ELBA 2JEBI 3UE0A 3TDQA 2EZVA 3T1YQ 3PIO3 1Q8KA 4OX9L 4A3CG 2R7ZB 4LF8Q 1VQIA 3UDGA 4ID6A 3I4MH 5JVG3 2YTXA 3FHWA 5DLQE 1MGSA 2B2UA 2K7VA 2OPVA 1QG7A 2R7DA 1J5EQ 4FYDA 2Y0SB 4RWSC 4LUVA 1EU3A 1EIGA 3SK5A 2L0CA 5FK9C 2EDGA 2ZJRA 2R61A 1N8RC 1VQGA 1VQ7