1X4NA

Solution structure of kh domain in fuse binding protein 1
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
92
structure length
92
Chain Sequence
b'GSSGSSGHQQQRSVMTEEYKVPDGMVGFIIGRGGEQISRIQQESGCKIQIAPDSGGLPERSCMLTGTPESVQSAKRLLDQIVEKGRSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Far upstream element binding protein 1
molecule tags Rna binding protein
source organism Mus musculus
publication title Solution structure of KH domain in FUSE binding protein 1
rcsb
total genus 15
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2005-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 1x4nA00
1TUAA 1WE8A 2HH2A 1K1GA 4AIMA 4JVYA 1EC6A 5K36G 3AEVB 2E3UA 2HH3A 2JVZA 2ANRA 2OPVA 1X4MA 4NBQA 2FMRA 1ZZIA 2MJHA 2P2RA 2CTLA 2Z0SA 2AXYA 1DTJA 3VKEA 5JEAG 4BA2I 2BL5A 2CTFA 2CPQA 2ANNA 4BA1I 2PQUA 1J5KA 5C0XG 4IFDG 2BA0A 1VIHA 2JE6I 2JA9A 2JZXA 2CTJA 1ZZJA 4OO1G 4WALA 2CTKA 3U1KA 1VIGA 2CTEA 4B8TA 2CTMA 4QMFB 2PY9A 1WVNA 1X4NA 4WANA 1KHMA 2OPUA 3L7ZC 2JEBI 1ZTGA 3V69A 2JEAI 4AM3A 2DGRA 2NN6G 1DT4A 2QNDA 2YQRA 4LIJA 4JVHA 1ZZKA 1J4WA
chains in the Genus database with same CATH superfamily
4JVYA 3AEVB 4AQYH 4LF6H 2JVZA 5FLXW 2VKCA 2OPVA 1X4MA 2MJHA 2FMRA 4JI3H 1XMOH 1DTJA 2CPMA 5JEAG 4EC5A 2D9IA 4PDBA 4JI4H 1PQXA 2ANNA 3OTOH 2LF0A 2PQUA 1WTJA 2A1SA 2JA9A 4DV6H 4JI8H 4DV1H 1WHRA 4NXNH 2LRRA 3GR5A 3NCVA 3GABA 1X4NA 4NZTM 4JYAH 1V9NA 3J7AK 2UU9H 1HNZH 2VQFH 4X64H 1HNWH 1DT4A 1MSZA 4B3MH 2UUCH 2UXCH 1J4WA 1TUAA 1X9ZA 5IWAH 3UOEA 1IBKH 5K36G 2Y3MA 1I94H 2P2RA 1ZZIA 2CTLA 1VBIA 2Z0SA 3T1YH 3OETA 4BA2I 2ZM6H 2FFMA 3EZJA 2ZQEA 1UG8A 2LTLA 2CPQA 4E9JA 1N33H 2M8WA 4OD6A 1J5KA 4IFDG 3SB1A 5LMNH 2F4VH 1VIHA 3FAUA 1J5EH 1ZZJA 4WALA 2CTKA 1N34H 4B8TA 2CTMA 3T1HH 2PY9A 1XNQH 5BR8H 4WANA 1SEIA 4B3SH 2K1HA 4JI6H 4JI2H 1S03G 4DR7H 2FPHX 4GKKH 4K0KH 4LFCH 4LF5H 4AM3A 3I0PA 4DV3H 2CWFA 3KDGA 2QNDA 4B3RH 4LIJA 1IBLH 1Z2IA 4LF7H 1HNXH 1K1GA 1HR0H 4OX9H 4JI7H 4OCHA 4LF4H 2E3UA 4NBQA 4FJSA 4LF8H 1F0XA 2HHHH 2AXYA 1NXUA 4DR3H 2BL5A 2CTFA 2LTMA 2UXDH 4BA1I 1XNRH 5DT9A 1I6UA 4OO1G 4JI1H 2CTJA 2UUBH 2X06A 4DV5H 2G8YA 1FKAH 4G08A 4JV5H 4DV0H 1FJGH 2OPUA 1KHMA 4DV2H 3L7ZC 3J81W 4DR4H 2JEBI 1ZTGA 4X62H 4X66H 2JEAI 1XRHA 3OSSD 2NN6G 4X65H 1S20A 4YHHH 4JI5H 1XMQH 1V8CA 5LMUH 4LFBH 1EC6A 1WE8A 4DV7H 2HH2A 4DR5H 4AIMA 4DUYH 2HH3A 4LFAH 2ANRA 4KHPH 5LL6b 4B3TH 3GKUA 5IT9W 4LF9H 3VKEA 1ODHA 3KDKA 2O4CA 4FJUA 4YY3H 2VQEH 4GKJH 4DV4H 4H8AA 4DR6H 5A2QW 2M6QA 4NZRM 5C0XG 2BA0A 4DR1H 2JE6I 2JZXA 2E5LH 1N32H 2UXBH 1IBMH 4DR2H 3RF2A 4DUZH 3U1KA 1VIGA 2CTEA 3J80W 1N36H 4QMFB 4JI0H 1WVNA 2CWHA 3JAMW 2PT7G 2UUAH 4B8CD 3V69A 4NXMH 1AN7A 2DGRA 2YQRA 4JVHA 3QD7X 1ZZKA 1X0AA
chains in the Genus database with same CATH topology
1TUAA 1WE8A 2HH2A 1K1GA 4AIMA 4JVYA 1EC6A 5K36G 3AEVB 2E3UA 2HH3A 2JVZA 2ANRA 2OPVA 1X4MA 4NBQA 2FMRA 1ZZIA 2MJHA 2P2RA 2CTLA 2Z0SA 2AXYA 1DTJA 3VKEA 5JEAG 4BA2I 2BL5A 2CTFA 2CPQA 2ANNA 4BA1I 2PQUA 1J5KA 5C0XG 4IFDG 2BA0A 1VIHA 2JE6I 2JA9A 2JZXA 2CTJA 1ZZJA 4OO1G 4WALA 2CTKA 3U1KA 1VIGA 2CTEA 4B8TA 2CTMA 4QMFB 2PY9A 1WVNA 1X4NA 4WANA 1KHMA 2OPUA 3L7ZC 2JEBI 1ZTGA 3V69A 2JEAI 4AM3A 2DGRA 2NN6G 1DT4A 2QNDA 2YQRA 4LIJA 4JVHA 1ZZKA 1J4WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TUA A;  1WE8 A;  2HH2 A;  1K1G A;  4AIM A;  4JVY A;  1EC6 A;  5K36 G;  3AEV B;  2E3U A;  2HH3 A;  2JVZ A;  2ANR A;  2OPV A;  1X4M A;  4NBQ A;  2FMR A;  1ZZI A;  2MJH A;  2P2R A;  2CTL A;  2Z0S A;  2AXY A;  1DTJ A;  3VKE A;  5JEA G;  4BA2 I;  2BL5 A;  2CTF A;  2CPQ A;  2ANN A;  4BA1 I;  2PQU A;  1J5K A;  5C0X G;  4IFD G;  2BA0 A;  1VIH A;  2JE6 I;  2JA9 A;  2JZX A;  2CTJ A;  1ZZJ A;  4OO1 G;  4WAL A;  2CTK A;  3U1K A;  1VIG A;  2CTE A;  4B8T A;  2CTM A;  4QMF B;  2PY9 A;  1WVN A;  1X4N A;  4WAN A;  1KHM A;  2OPU A;  3L7Z C;  2JEB I;  1ZTG A;  3V69 A;  2JEA I;  4AM3 A;  2DGR A;  2NN6 G;  1DT4 A;  2QND A;  2YQR A;  4LIJ A;  4JVH A;  1ZZK A;  1J4W A; 
#chains in the Genus database with same CATH topology
 4JVY A;  3AEV B;  4AQY H;  4LF6 H;  2JVZ A;  5FLX W;  2VKC A;  2OPV A;  1X4M A;  2MJH A;  2FMR A;  4JI3 H;  1XMO H;  1DTJ A;  2CPM A;  5JEA G;  4EC5 A;  2D9I A;  4PDB A;  4JI4 H;  1PQX A;  2ANN A;  3OTO H;  2LF0 A;  2PQU A;  1WTJ A;  2A1S A;  2JA9 A;  4DV6 H;  4JI8 H;  4DV1 H;  1WHR A;  4NXN H;  2LRR A;  3GR5 A;  3NCV A;  3GAB A;  1X4N A;  4NZT M;  4JYA H;  1V9N A;  3J7A K;  2UU9 H;  1HNZ H;  2VQF H;  4X64 H;  1HNW H;  1DT4 A;  1MSZ A;  4B3M H;  2UUC H;  2UXC H;  1J4W A;  1TUA A;  1X9Z A;  5IWA H;  3UOE A;  1IBK H;  5K36 G;  2Y3M A;  1I94 H;  2P2R A;  1ZZI A;  2CTL A;  1VBI A;  2Z0S A;  3T1Y H;  3OET A;  4BA2 I;  2ZM6 H;  2FFM A;  3EZJ A;  2ZQE A;  1UG8 A;  2LTL A;  2CPQ A;  4E9J A;  1N33 H;  2M8W A;  4OD6 A;  1J5K A;  4IFD G;  3SB1 A;  5LMN H;  2F4V H;  1VIH A;  3FAU A;  1J5E H;  1ZZJ A;  4WAL A;  2CTK A;  1N34 H;  4B8T A;  2CTM A;  3T1H H;  2PY9 A;  1XNQ H;  5BR8 H;  4WAN A;  1SEI A;  4B3S H;  2K1H A;  4JI6 H;  4JI2 H;  1S03 G;  4DR7 H;  2FPH X;  4GKK H;  4K0K H;  4LFC H;  4LF5 H;  4AM3 A;  3I0P A;  4DV3 H;  2CWF A;  3KDG A;  2QND A;  4B3R H;  4LIJ A;  1IBL H;  1Z2I A;  4LF7 H;  1HNX H;  1K1G A;  1HR0 H;  4OX9 H;  4JI7 H;  4OCH A;  4LF4 H;  2E3U A;  4NBQ A;  4FJS A;  4LF8 H;  1F0X A;  2HHH H;  2AXY A;  1NXU A;  4DR3 H;  2BL5 A;  2CTF A;  2LTM A;  2UXD H;  4BA1 I;  1XNR H;  5DT9 A;  1I6U A;  4OO1 G;  4JI1 H;  2CTJ A;  2UUB H;  2X06 A;  4DV5 H;  2G8Y A;  1FKA H;  4G08 A;  4JV5 H;  4DV0 H;  1FJG H;  2OPU A;  1KHM A;  4DV2 H;  3L7Z C;  3J81 W;  4DR4 H;  2JEB I;  1ZTG A;  4X62 H;  4X66 H;  2JEA I;  1XRH A;  3OSS D;  2NN6 G;  4X65 H;  1S20 A;  4YHH H;  4JI5 H;  1XMQ H;  1V8C A;  5LMU H;  4LFB H;  1EC6 A;  1WE8 A;  4DV7 H;  2HH2 A;  4DR5 H;  4AIM A;  4DUY H;  2HH3 A;  4LFA H;  2ANR A;  4KHP H;  5LL6 b;  4B3T H;  3GKU A;  5IT9 W;  4LF9 H;  3VKE A;  1ODH A;  3KDK A;  2O4C A;  4FJU A;  4YY3 H;  2VQE H;  4GKJ H;  4DV4 H;  4H8A A;  4DR6 H;  5A2Q W;  2M6Q A;  4NZR M;  5C0X G;  2BA0 A;  4DR1 H;  2JE6 I;  2JZX A;  2E5L H;  1N32 H;  2UXB H;  1IBM H;  4DR2 H;  3RF2 A;  4DUZ H;  3U1K A;  1VIG A;  2CTE A;  3J80 W;  1N36 H;  4QMF B;  4JI0 H;  1WVN A;  2CWH A;  3JAM W;  2PT7 G;  2UUA H;  4B8C D;  3V69 A;  4NXM H;  1AN7 A;  2DGR A;  2YQR A;  4JVH A;  3QD7 X;  1ZZK A;  1X0A A; 
#chains in the Genus database with same CATH homology
 1TUA A;  1WE8 A;  2HH2 A;  1K1G A;  4AIM A;  4JVY A;  1EC6 A;  5K36 G;  3AEV B;  2E3U A;  2HH3 A;  2JVZ A;  2ANR A;  2OPV A;  1X4M A;  4NBQ A;  2FMR A;  1ZZI A;  2MJH A;  2P2R A;  2CTL A;  2Z0S A;  2AXY A;  1DTJ A;  3VKE A;  5JEA G;  4BA2 I;  2BL5 A;  2CTF A;  2CPQ A;  2ANN A;  4BA1 I;  2PQU A;  1J5K A;  5C0X G;  4IFD G;  2BA0 A;  1VIH A;  2JE6 I;  2JA9 A;  2JZX A;  2CTJ A;  1ZZJ A;  4OO1 G;  4WAL A;  2CTK A;  3U1K A;  1VIG A;  2CTE A;  4B8T A;  2CTM A;  4QMF B;  2PY9 A;  1WVN A;  1X4N A;  4WAN A;  1KHM A;  2OPU A;  3L7Z C;  2JEB I;  1ZTG A;  3V69 A;  2JEA I;  4AM3 A;  2DGR A;  2NN6 G;  1DT4 A;  2QND A;  2YQR A;  4LIJ A;  4JVH A;  1ZZK A;  1J4W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...