4B8CD

Nuclease module of the yeast ccr4-not complex
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
686
structure length
318
Chain Sequence
b'VNASNPLLHPHLDDPSLLNNPIWKLQLHLAAVSAQSLGQPNIYARQNAMKKYLCTKQALMEMADTLTDSKTAKDDQLWHALDLSNLQIFNISANIFKYDFLTRLYLNGNSLTELPAEIKNLSNLRVLDLSHNRLTSLPAELGSCFQLKYFYFFDNMVTTLPWEFGNLCNLQFLGVEGNPLEKQFLKILTEKSVTGLIFYLRDNRPEIPLPHETLCQHYATPKMYRYTPSWALSWDYRRNKLKEQILSYDSDLLCLQVESKTFEEYWVPTGIFVDGCCIFFLPFTNFTPSFTDVIEVDPEYVSKFIGFPNDKFPSDHIP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POLY(A) RIBONUCLEASE POP2
molecule tags Hydrolase/cell cycle
source organism Saccharomyces cerevisiae
publication title Architecture of the Nuclease Module of the Yeast Ccr4-not Complex: The not1-Caf1-Ccr4 Interaction.
pubmed doi rcsb
total genus 68
structure length 318
sequence length 686
chains with identical sequence J, K, L
ec nomenclature ec 3.1.13.4: Poly(A)-specific ribonuclease.
pdb deposition date 2012-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF03372 Exo_endo_phos Endonuclease/Exonuclease/phosphatase family
D PF12799 LRR_4 Leucine Rich repeats (2 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.210 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 4b8cD03
3.30.1370.190 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 4b8cD02
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4b8cD01
1Z7XW 3G04C 4QC0A 3GOZA 3OJAB 3RGZA 4MQWX 2Z65A 4U09A 4ECOA 2Z82A 1M9LA 4OQTA 5AWBA 4Z64C 2UZYA 2V9SA 2RR6A 5B0TA 4EZGA 4Q3GA 4R58A 3WPFA 1XECA 3M18A 4R0AA 1K5GC 3C6PB 2O6SA 2P1QB 4KNGA 4LI2A 4CNCA 3ZYIA 2WQXA 3REZA 3WPEA 3WPGA 4YEBB 3O53A 4V2CA 1K5DC 3BZ5A 3ZYOA 1U0ND 4CC4C 1XWDC 4V2EA 1DFJI 1OZNA 1FT8A 1P8TA 4R6GA 2Z81A 5AWDA 4G8AA 3UN9A 3W3GA 4RCWA 3RGXA 2BEXA 3CIGA 5HDHA 3C6NB 4IM6A 4P91A 4I6JB 5GQRK 4R5CA 1H6UA 4XOSA 4WYKA 4QXEA 2IFGA 1ZIWA 2WQVA 5GMGA 1A9NA 3OGKB 4L3FA 3RFSA 4B8CD 4NKGA 2A0ZA 4L3AA 5AWCA 4Z79A 2O6RA 4TZHA 4U7LA 3DZEA 3O6NA 4R6AA 3ULAA 3RFEA 3A79B 4U08A 1FQVA 2Z66A 2ELLA 2XWTC 5LFNA 3ULVA 2BNHA 5FTTB 4R6FA 4J0MA 5HZLB 4C2BB 1KOOA 4LSAA 2V70A 2Z64A 1DCEA 2OMXA 2RA8A 4BV4R 4MN8B 3RW6A 2P1OB 4KXFB 4AY9X 5B4PA 3SB4A 2Z62A 4V2DA 4BSUA 4R08A 1M0ZA 4PSJA 3ULUA 3RW7A 3RIZA 4P8SA 3CIYA 4FD0A 2CA6A 4U06A 5IYXC 4PERA 1M10B 4LSXC 1D0BA 4Z8GA 5IJDA 1GWBA 2OMVA 4UFRA 3ZYJA 4Y61B 3W3MA 2P1PB 2ID5A 3M19A 4QBZA 5B0NA 1FO1A 2JQDA 4RCAB 3UL9A 1WWLA 4LXRA 3CVRA 3WPHA 2OMYA 4Q62A 1P8VA 3P72A 1OTMA 4ECNA 2WQUA 4FS7A 1QYYA 2UZXA 2FT3A 3C6OB 1W8AA 4PEQB 4WP6A 3UL7A 4ARRA 4Z61C 4R07A 3W3NA 3G3AA 3W3LA 5GMFA 1OTOA 5AWAA 1YRGA 4GT6A 1PGVA 2Y5QA 1P9AG 3E4GA 4KT1A 5GS2B 3JB9j 4CC4A 4GLPA 4FDWA 2OMUA 3ZYNA 4LSCA 3OGMB 2OMZA 4C2AB 3W3KA 3G39A 3W3JA 4CNMA 1OGQA 4NKHA 4BSRA 5GS0A 5CMPA 3WN4A 2WFHA 3G3BA 4Z94G 1LTXA 2JE0A 1A4YA 2Z7XB 4LXSA 1H6TA 1OTNA 4CILA 2O6QA 4AW4A 4R5DA 1SQ0B 5AZ5A 2Q4GW 2XOTA 4XGOA 1DS9A 4H09A 3G06A 1M9SA 2Z63A 4Q3IA 4BSSA 4PKIG 4R6JA 4M7EA 1O6TA 1XEUA 4LI1A 3RFJA 2WQWA 4HQ1A 3UL8A 4CP6A 1O6VA 3OGLB 2OMTA 4J4LA 4ARNA 2V9TB 3WPCA 1FS2A 1XKUA 1KOHA 3E6JA 4FCGA 3E2JA 3OJAA 5CMNA 2P1NB 1XCDA 2ASSB 1IO0A 1OOKG 2R9UA 2ASTB 4FHOA 5D3IA 3TSRE 4LSXA 3WPBA 2P1MB 3E3ZA 4RWTC 3FXIA 5A5CA 5GMHA 5IJBA 3WPDA 3WPIA 3VQ2A 5IJCA 3KJ4A 4M7EC 2JE1A 2Z7XA 3RJ0A 3PMHG 3VQ1A 1O6SA 2OMWA 4FMZA 4PQ8A 4XSQA 4K17A 4R09A 1G9UA 1JL5A
chains in the Genus database with same CATH superfamily
2UU9H 3GOZA 3OJAB 3K7AL 3QQCE 1DT4A 5IYDL 4MQWX 2PVEA 3UOEA 1R0IA 2Z65A 1T9OA 5B0TA 3KYYA 4JI0H 2RR6A 1IBKH 2MS3A 2NN6G 4JI2H 3WPFA 4A3JL 4BBRL 1K5GC 2QL0A 1H7VA 4LFBH 2O6SA 2P1QB 2R7ZL 4LI2A 4CNCA 1HNWH 3REZA 1ZZKA 2A69D 4DV2H 2PY9A 3GTKL 2ZIXA 5DM61 5IP9L 3RF2A 4B3MH 4DR7H 3S14L 1OZNA 3HJYB 1P8TA 5AWDA 1WE8A 1WCML 5MGNA 2FFMA 1I94H 3CIGA 4IM6A 3OSSD 1HNZH 4AI3A 5MLC3 4A3FL 1AN7A 4EC5A 4XOSA 2M8WA 1IU5A 5GMGA 2K1HA 2AXYA 3GTQL 4B8CD 4AIMA 3OGKB 4AR3A 4L3AA 3IU3I 1C09A 1HNXH 4QIWP 1K83L 5BR8H 8RXNA 2Z66A 1ODHA 4AI2A 3H3VM 3WWLA 2XWTC 2CTJA 3ULVA 2ZM6H 4LSAA 1KOOA 1DCEA 2RA8A 4MN8B 2MJHA 4JI4H 4R08A 2GMGA 4V2DA 1WTJA 5M5YL 4PSJA 2XJVA 4Y7NL 1Y1WL 3LWPB 5H1Sc 3LWVB 5IYCL 4AR6A 1SMMA 4LHLA 4Z8GA 4OX9H 1QCVA 2AUSB 1VZIA 4JYAH 2OMVA 2C6BA 3W3MA 1EC6A 2P1PB 4POGA 2FPHX 2LTLA 4LXRA 3WPHA 4WALA 3P72A 4Q62A 2WQUA 2CKCA 2ANRA 1QYYA 2FT3A 3C6OB 1SMWA 4PEQB 4WP6A 4ARRA 1VZGA 2HR5A 5MFPA 4Z61C 3W3LA 1YUXA 4GT6A 3E4GA 1P9AG 5GS2B 3A44A 4BY1L 2E2JL 2E5LH 3OGMB 4C2AB 2LTMA 4DR1H 3G39A 3W3JA 4CNMA 5GAHc 1OGQA 4JAFA 5CMPA 4A3EL 4DV4H 2WFHA 2XJUA 2V0EA 6RXNA 1LTXA 3JAMW 4AHYA 4A3KL 4LXSA 1H6TA 1RDVA 1S30A 2CWFA 4H8AA 2V3BB 2B63L 1RYTA 5AZ5A 1PZXA 4XGOA 4H09A 3I4NL 4Q3IA 5AI2A 4C3IL 4BXXL 4PKIG 4A3BL 2OPVA 4YY3H 4AQYH 2CTMA 4M7EA 4AR4A 4IFDG 3J7Z1 4TVMA 3UL8A 1R0GA 2ERSA 2PYAA 3LNLA 2C6AA 1O6VA 3OGLB 4J4LA 3WPCA 1VIHA 2HH2A 3S2DL 1J4WA 1FS2A 1XKUA 5K2ME 4LFAH 3OJAA 3J81W 4B8TA 2CPQA 5CMNA 2ASTB 3S15L 3FKIL 4FJSA 1WJVA 5FJ8L 3WPDA 5A5CA 2H12A 3KJ4A 3RJ0A 3PMHG 2HVYC 3H0GL 4FMZA 4XSQA 1LKOA 1S24A 1Z7XW 4QC0A 2Y3MA 2WAQP 3JR7A 5MF6A 1M9LA 1SEIA 2UZYA 2V9SA 4EZGA 3S1NL 4Q3GA 1B2JA 1N32H 3C6PB 4BA1I 4KNGA 2Z3RB 4BBSL 3T1YH 2JI2A 3LWRB 1DX8A 4NZTM 4UY81 4V2CA 1U0ND 3P2AA 3S2HL 1QYBA 2BA0A 1DFJI 3GTLL 4LF7H 2Z81A 1RYQA 4OCHA 3UN9A 1N36H 2BEXA 2VQFH 1F4LA 4P91A 2UUBH 3VKEA 1H6UA 1T9PA 4QXEA 1B2OA 1MSZA 2WQVA 2YQRA 2A0ZA 2LRRA 3M3YL 3CQZL 4Z79A 2PSMC 1PFWA 3DZEA 4RXNA 4R6AA 3RFEA 2NVQL 1SMUA 2ERJA 3GTML 3AEVB 1J5KA 5M3FL 2AQCA 2V0FA 4J0MA 3S1ML 4R6FA 4BA2I 4E9JA 5IY0A 2JZXA 5IWAH 2G8YA 2B5ID 2LCQA 2P1OB 2JEBI 2Z62A 4BSUA 2WB1P 4JAGA 1M0ZA 3RIZA 5C4XL 2XJRA 3RZOL 4E6YA 4DV1H 3KYXA 2JA7L 2CA6A 1OWBA 3HOZL 3PIP1 1CADA 4ZN1B 1D0BA 1GWBA 1TWAL 3ZYJA 1TUAA 4X62H 4Y61B 4FJUA 1TWCL 2R93L 2JQDA 4RCAB 4YWLA 1I6UA 1WWLA 2Y0SP 2M4YA 1OTMA 4JI6H 4ECNA 3PWFA 1W8AA 3GTJL 5GMFA 1NXGA 1P7PA 3G3AA 5C3EL 2NYDA 1OTOA 5AWAA 3PZAA 1R0JA 5C0XG 4NXMH 3JB9j 3S1QL 4NZRM 5EIOC 1XNQH 4GLPA 1NXEA 2OMZA 5C4JL 3W3KA 4V196 3GR5A 3HOUL 4NKHA 4BSRA 4JV5H 5GS0A 2K2DA 5DT9A 4X65H 4AI1A 4DUZH 5JVH1 4LF4H 4KHPH 1A4YA 2Z7XB 4GS7D 1ZZIA 2JI3A 2O6QA 1ZRPA 3T1HH 4AW4A 4JI8H 1SQ0B 2M6PA 4C2M1 3H97A 3G06A 5GAGc 3P8BA 1B71A 3S1RL 4OO1G 1KHMA 4HQ1A 4LI1A 3HOYL 3GTGL 2OMTA 4DV0H 2V9TB 1KOHA 1K1GA 2CKAA 4XXBB 5JVG1 3E2JA 3KDGA 4NXNH 1IO0A 1XCDA 4FHOA 1ZIWA 2UXCH 2P1MB 3E3ZA 1I3QL 1LKPA 1PQXA 3VQ2A 2JE1A 2Z7XA 3LWQB 2Z0SA 3KYUA 5IP7L 1O6SA 2OMWA 2PQUA 4R09A 4LSCA 3G04C 1BFYA 5EINC 2ZQEA 3S16L 4C3JL 3S17L 2Z82A 2DGRA 5AWBA 4Z64C 1X9ZA 4JAEA 2A6ED 1XECA 3RZ6A 2E3UA 4DV6H 2RDVA 2XJPA 4NBQA 2WQXA 3WPGA 2DSXA 3OETA 1ZZJA 3O53A 4YEBB 3ZYOA 3PIO1 4DR6H 1R0FA 4CC4C 4V2EA 1I50L 1OWCA 3I4ML 1FT8A 3NFPI 3GKUA 4A3GL 2UUCH 4WANA 4RCWA 3RGXA 1J5EH 3H99A 4ZN3B 3C6NB 1IU6A 2JA8L 4QMFB 4AR5A 3MPSA 4WYKA 3HOWL 2IFGA 2BE5D 4NKGA 5FLML 3HJWB 4WFN1 1SFOL 2O6RA 2E2IL 3O6NA 3A79B 4DR2H 3SB1A 4DR3H 2ELLA 1LTLA 2O5JD 2HHHH 4U671 3NCVA 5LFNA 2BNHA 5HZLB 4C2BB 2V70A 4BV4R 2OMXA 5B4PA 3SB4A 2PVXA 4B3RH 3RW7A 2CPMA 2FMRA 4JI5H 3K35A 2OPUA 1BRFA 2ANNA 4FD0A 2JI1A 4LIJA 4LSXC 1S03G 4LF8H 3J7Y1 2Z3QB 2ID5A 3M19A 2UXBH 2VKCA 1FO1A 4DV5H 4QBZA 4AM3A 1XMOH 1YUZA 4POFA 4FS7A 2UZXA 3B08B 2JEAI 4R07A 3W3NA 4BY7L 4LFCH 4YHHH 3FAUA 2NVTL 2X06A 5DM71 1YRGA 5A2QW 1IRNA 1PGVA 1R0HA 1YK5A 1IBMH 4FDWA 3ZYNA 4JI3H 1F0XA 1S2ZA 3MSUA 4B3TH 4K9FA 1E8JA 1PFUA 3WN4A 4DV3H 4Z94G 3QVDA 2JE0A 2J9UB 4CILA 5GAEc 2HH3A 2Q4GW 2XOTA 5C44L 1M9SA 1RWDA 1NXUA 4JVHA 2Z63A 5IYBL 4YWMA 2QNDA 4R6JA 2PMZP 1O6TA 1XEUA 2NVYL 1N33H 4ARNA 5RXNA 1TWGL 4X66H 3E6JA 2JA5L 3HOXL 2F4VH 5IT9W 5M5XL 3TSRE 3M4OL 1OOKG 2R9UA 3OTOH 4LF5H 5D3IA 1X0AA 5GMHA 3FXIA 1PFYA 4LF9H 4A3IL 5IJCA 3RYGA 3RZTA 4M7EC 1PFVA 3PL5A 2L0ZA 3GTPL 1HR0H 4PQ8A 3V69A 2PT7G 3H9CA 2VUML 3HKZP 4K17A 1LKMA 1JL5A 3RGZA 1V9NA 1JYBA 1WVNA 4JI7H 4U09A 4ECOA 3GABA 4OQTA 1VBIA 4C3HL 4G6BA 1BQ9A 1RB9A 2AYJA 3LPEB 4R58A 3M18A 2E2HL 4R0AA 5M5WL 3FDJA 3ZYIA 3WPEA 4DUYH 3KYWA 3BZ5A 1IBLH 4JADA 4AHXA 4GKKH 1XWDC 4A3CL 2APOB 2KN9A 4R6GA 2O4CA 3W3GA 5JEAG 3GTOL 5AI3A 1YV1A 5LMNH 5LMUH 4G8AA 1R9TL 4A3ML 1VZHA 2M6OA 5HDHA 2XJQA 4I6JB 1I6HL 4A3LL 5GQRK 4R5CA 4DV7H 3HAXC 4TPUA 1T9QA 2JA6L 1VIGA 3I0PA 2XJTA 3MQKB 2P2RA 4L3FA 3RFSA 1A9NA 4LHNA 1DTJA 4A3DL 5AWCA 1Z2IA 4TZHA 4U7LA 4PDBA 2VL6A 2CTLA 3ULAA 3PO3L 4U08A 2JA9A 1FQVA 5LL6b 1X4MA 2LF0A 5FTTB 1FKAH 1FHHA 3L7ZC 2KKDA 1Z92B 2Z64A 1X4NA 3RW6A 4KXFB 1Y1VL 4AY9X 4ME3A 3EZJA 2NVXL 4GKJH 3ULUA 1BQ8A 5AN9H 4X6AL 1YK4A 4P8SA 3CIYA 3U1KA 4U06A 5GADc 5IYXC 3RZDL 3J7AK 1M10B 4PERA 1XNRH 1UG8A 2CTFA 3QD7X 5IJDA 4XGHA 4UFRA 2R92L 2RFKB 3H9BA 4DR4H 5B0NA 3UL9A 5MFZA 1S20A 4G08A 3CVRA 2EY4E 3VPBE 2UUAH 3SS2A 4A93L 4AHWA 1P8VA 2OMYA 3KDKA 3UL7A 1BE7A 2CTEA 4DR5H 3LWOB 2BL5A 4LF6H 2Y5QA 1IW7D 4KT1A 3PO2L 1RDGA 2XJSA 4CC4A 5K36G 2OMUA 4B3SH 1TWHL 2UXDH 2VQEH 2JVZA 4Y52L 4OD6A 3G3BA 1DVBA 3KYVA 3PKIA 1IROA 3HOVL 3PKJA 3ZG6A 4AYBP 1VCXA 4R5DA 2M6QA 4AI0A 2A1SA 2CTKA 2A68D 7RXNA 2JE6I 1DS9A 4BSSA 2CWHA 3J80W 1NNQA 1WHRA 1XRHA 1K5DC 2A6HD 2WQWA 1B13A 5FLXW 4K0KH 3B0AB 3RFJA 4CP6A 5M3ML 2D9IA 4JI1H 4FCGA 3WWNB 1TWFL 1V8CA 1XMQH 2CR8A 2ASSB 2P1NB 5IJBA 1ZTGA 2PPTA 1CAAA 3WPBA 4RWTC 2YU9L 4X64H 4AHZA 3WPIA 1FJGH 1N34H 2M4VA 1QQTA 3VQ1A 1FHMA 4LSXA 4JVYA 1G9UA 1OTNA
chains in the Genus database with same CATH topology
2UU9H 3GOZA 3OJAB 3QQCE 4MQWX 2PVEA 1R0IA 2Z65A 1T9OA 5B0TA 3KYYA 4JI0H 2RR6A 1IBKH 2MS3A 3WPFA 4JI2H 1K5GC 2O6SA 2QL0A 1H7VA 4LFBH 2P1QB 4LI2A 4CNCA 1HNWH 3REZA 4DV2H 2A69D 4DR7H 1K5DC 2ZIXA 5DM61 3RF2A 4B3MH 1OZNA 1P8TA 5AWDA 5MGNA 3CIGA 1I94H 4IM6A 3OSSD 1HNZH 4AI3A 5MLC3 1AN7A 4EC5A 4XOSA 5GMGA 1IU5A 3OGKB 4B8CD 4AR3A 4L3AA 3IU3I 1C09A 1HNXH 5BR8H 8RXNA 2Z66A 1ODHA 4AI2A 3WWLA 2XWTC 3ULVA 2ZM6H 4LSAA 1KOOA 1DCEA 2RA8A 4MN8B 4JI4H 4R08A 2GMGA 4V2DA 4PSJA 2XJVA 5H1Sc 4AR6A 1SMMA 4LHLA 4Z8GA 4OX9H 1QCVA 4JYAH 1VZIA 2OMVA 2C6BA 3W3MA 2P1PB 4POGA 2FPHX 4LXRA 3WPHA 4Q62A 3P72A 2WQUA 2CKCA 1QYYA 3C6OB 2FT3A 1SMWA 4PEQB 4WP6A 4ARRA 1VZGA 2HR5A 5MFPA 4Z61C 3W3LA 1YUXA 4GT6A 3E4GA 1P9AG 5GS2B 3A44A 2E5LH 3OGMB 4C2AB 4DR1H 3G39A 3W3JA 4CNMA 5GAHc 1OGQA 4JAFA 5CMPA 4DV4H 2WFHA 2XJUA 2V0EA 6RXNA 1LTXA 3JAMW 4AHYA 4LXSA 1H6TA 1RDVA 1S30A 2V3BB 1RYTA 5AZ5A 4XGOA 4H09A 4Q3IA 5AI2A 4PKIG 4YY3H 4AQYH 4M7EA 4AR4A 4TVMA 3J7Z1 3UL8A 1R0GA 2ERSA 2PYAA 3LNLA 2C6AA 1O6VA 3OGLB 4J4LA 3WPCA 1FS2A 1XKUA 5K2ME 4LFAH 3OJAA 3J81W 5CMNA 2ASTB 1WJVA 3WPDA 5A5CA 2H12A 3KJ4A 3RJ0A 3PMHG 4FMZA 4XSQA 1LKOA 1S24A 1Z7XW 4QC0A 2Y3MA 5MF6A 1M9LA 1SEIA 2UZYA 2V9SA 4EZGA 4Q3GA 1B2JA 1N32H 3C6PB 4KNGA 2Z3RB 3T1YH 2JI2A 1DX8A 4NZTM 4UY81 4V2CA 1U0ND 3P2AA 1QYBA 1DFJI 4LF7H 2Z81A 1RYQA 4OCHA 3UN9A 1N36H 2BEXA 2VQFH 4P91A 2UUBH 1H6UA 1T9PA 4QXEA 1B2OA 2WQVA 2A0ZA 4Z79A 2PSMC 3DZEA 4R6AA 4RXNA 3RFEA 1SMUA 2ERJA 2V0FA 4J0MA 4R6FA 4E9JA 5IY0A 5IWAH 2B5ID 2LCQA 2P1OB 2Z62A 4BSUA 4JAGA 1M0ZA 3RIZA 2XJRA 4E6YA 4DV1H 3KYXA 2CA6A 1OWBA 3PIP1 1CADA 4ZN1B 1D0BA 1GWBA 3ZYJA 4X62H 4Y61B 2JQDA 4RCAB 4YWLA 1I6UA 1WWLA 2M4YA 1OTMA 4JI6H 4ECNA 3PWFA 1W8AA 5GMFA 1NXGA 3G3AA 2NYDA 1OTOA 5AWAA 3PZAA 1R0JA 4NXMH 3JB9j 4NZRM 5EIOC 1XNQH 4GLPA 1NXEA 2OMZA 3W3KA 4V196 3GR5A 4NKHA 4BSRA 4JV5H 5GS0A 2K2DA 5DT9A 4X65H 4DUZH 4AI1A 5JVH1 4LF4H 4KHPH 1A4YA 2Z7XB 4GS7D 2JI3A 2O6QA 1ZRPA 3T1HH 4AW4A 4JI8H 1SQ0B 2M6PA 3G06A 5GAGc 3P8BA 1B71A 4LI1A 4HQ1A 2OMTA 4DV0H 2V9TB 1KOHA 2CKAA 4XXBB 5JVG1 3E2JA 3KDGA 4NXNH 1IO0A 1XCDA 4FHOA 1ZIWA 2UXCH 2P1MB 3E3ZA 1LKPA 3VQ2A 2JE1A 2Z7XA 3KYUA 1O6SA 2OMWA 4R09A 4LSCA 3G04C 1BFYA 5EINC 2ZQEA 2Z82A 5AWBA 4Z64C 1X9ZA 4JAEA 2A6ED 1XECA 3RZ6A 4DV6H 2RDVA 2XJPA 2WQXA 3WPGA 2DSXA 3OETA 4YEBB 3O53A 3ZYOA 3PIO1 4DR6H 1R0FA 4CC4C 4V2EA 1OWCA 1FT8A 3NFPI 2UUCH 4RCWA 3RGXA 1J5EH 4ZN3B 3C6NB 1IU6A 4AR5A 3MPSA 4WYKA 2IFGA 2BE5D 4NKGA 4WFN1 2O6RA 3O6NA 3A79B 4DR2H 3SB1A 4DR3H 2ELLA 1LTLA 2O5JD 2HHHH 4U671 3NCVA 5LFNA 2BNHA 5HZLB 4C2BB 2V70A 4BV4R 2OMXA 5B4PA 3SB4A 2PVXA 4B3RH 3RW7A 4JI5H 3K35A 1BRFA 4FD0A 2JI1A 4LSXC 1S03G 4LF8H 3J7Y1 2Z3QB 2ID5A 3M19A 2UXBH 2VKCA 1FO1A 4DV5H 4QBZA 1XMOH 1YUZA 4POFA 4FS7A 2UZXA 3B08B 4R07A 3W3NA 4LFCH 4YHHH 3FAUA 5DM71 1YRGA 5A2QW 1IRNA 1PGVA 1R0HA 1YK5A 1IBMH 4FDWA 3ZYNA 4JI3H 1F0XA 1S2ZA 3MSUA 4B3TH 4K9FA 1E8JA 3WN4A 4DV3H 4Z94G 3QVDA 2JE0A 2J9UB 4CILA 5GAEc 2Q4GW 2XOTA 1M9SA 1RWDA 2Z63A 4YWMA 4R6JA 1O6TA 1XEUA 1N33H 4ARNA 5RXNA 4X66H 3E6JA 2F4VH 5IT9W 3TSRE 1OOKG 5D3IA 2R9UA 3OTOH 4LF5H 5GMHA 3FXIA 4LF9H 5IJCA 3RYGA 3RZTA 4M7EC 2L0ZA 1HR0H 4PQ8A 3RGZA 2PT7G 4K17A 1LKMA 1JL5A 1JYBA 4JI7H 4U09A 4ECOA 3GABA 4OQTA 4G6BA 1BQ9A 1RB9A 2AYJA 3LPEB 4R58A 3M18A 4R0AA 3ZYIA 3WPEA 4DUYH 3KYWA 3BZ5A 1IBLH 4JADA 4AHXA 4GKKH 1XWDC 2KN9A 4R6GA 2O4CA 3W3GA 4G8AA 5LMNH 5AI3A 1YV1A 5LMUH 1VZHA 2M6OA 5HDHA 2XJQA 4I6JB 5GQRK 4R5CA 4DV7H 4TPUA 1T9QA 1A9NA 2XJTA 3RFSA 4L3FA 4LHNA 5AWCA 4TZHA 4U7LA 4PDBA 2VL6A 3ULAA 4U08A 1FQVA 5LL6b 2LF0A 5FTTB 1FKAH 1FHHA 2KKDA 1Z92B 2Z64A 3RW6A 4KXFB 4AY9X 4ME3A 3EZJA 4GKJH 3ULUA 1BQ8A 5AN9H 1YK4A 4P8SA 3CIYA 4U06A 5GADc 5IYXC 3J7AK 4PERA 1M10B 1XNRH 5IJDA 3QD7X 4XGHA 4UFRA 5B0NA 4DR4H 3UL9A 5MFZA 4G08A 3CVRA 3VPBE 2UUAH 2OMYA 3SS2A 1P8VA 4AHWA 3KDKA 3UL7A 1BE7A 4DR5H 4LF6H 2Y5QA 1IW7D 4KT1A 1RDGA 2XJSA 4CC4A 2OMUA 4B3SH 2UXDH 2VQEH 4OD6A 3G3BA 1DVBA 3KYVA 3PKIA 1IROA 3PKJA 3ZG6A 1VCXA 4R5DA 4AI0A 2A68D 7RXNA 1DS9A 4BSSA 3J80W 1NNQA 3RFJA 2A6HD 2WQWA 1B13A 5FLXW 4K0KH 3B0AB 4CP6A 2D9IA 4JI1H 4FCGA 3WWNB 1XMQH 2CR8A 2ASSB 2P1NB 5IJBA 2PPTA 1CAAA 3WPBA 4RWTC 4X64H 4AHZA 3WPIA 1FJGH 1N34H 2M4VA 3VQ1A 1FHMA 4LSXA 1G9UA 1OTNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z7X W;  3G04 C;  4QC0 A;  3GOZ A;  3OJA B;  3RGZ A;  4MQW X;  2Z65 A;  4U09 A;  4ECO A;  2Z82 A;  1M9L A;  4OQT A;  5AWB A;  4Z64 C;  2UZY A;  2V9S A;  2RR6 A;  5B0T A;  4EZG A;  4Q3G A;  4R58 A;  3WPF A;  1XEC A;  3M18 A;  4R0A A;  1K5G C;  3C6P B;  2O6S A;  2P1Q B;  4KNG A;  4LI2 A;  4CNC A;  3ZYI A;  2WQX A;  3REZ A;  3WPE A;  3WPG A;  4YEB B;  3O53 A;  4V2C A;  1K5D C;  3BZ5 A;  3ZYO A;  1U0N D;  4CC4 C;  1XWD C;  4V2E A;  1DFJ I;  1OZN A;  1FT8 A;  1P8T A;  4R6G A;  2Z81 A;  5AWD A;  4G8A A;  3UN9 A;  3W3G A;  4RCW A;  3RGX A;  2BEX A;  3CIG A;  5HDH A;  3C6N B;  4IM6 A;  4P91 A;  4I6J B;  5GQR K;  4R5C A;  1H6U A;  4XOS A;  4WYK A;  4QXE A;  2IFG A;  1ZIW A;  2WQV A;  5GMG A;  1A9N A;  3OGK B;  4L3F A;  3RFS A;  4B8C D;  4NKG A;  2A0Z A;  4L3A A;  5AWC A;  4Z79 A;  2O6R A;  4TZH A;  4U7L A;  3DZE A;  3O6N A;  4R6A A;  3ULA A;  3RFE A;  3A79 B;  4U08 A;  1FQV A;  2Z66 A;  2ELL A;  2XWT C;  5LFN A;  3ULV A;  2BNH A;  5FTT B;  4R6F A;  4J0M A;  5HZL B;  4C2B B;  1KOO A;  4LSA A;  2V70 A;  2Z64 A;  1DCE A;  2OMX A;  2RA8 A;  4BV4 R;  4MN8 B;  3RW6 A;  2P1O B;  4KXF B;  4AY9 X;  5B4P A;  3SB4 A;  2Z62 A;  4V2D A;  4BSU A;  4R08 A;  1M0Z A;  4PSJ A;  3ULU A;  3RW7 A;  3RIZ A;  4P8S A;  3CIY A;  4FD0 A;  2CA6 A;  4U06 A;  5IYX C;  4PER A;  1M10 B;  4LSX C;  1D0B A;  4Z8G A;  5IJD A;  1GWB A;  2OMV A;  4UFR A;  3ZYJ A;  4Y61 B;  3W3M A;  2P1P B;  2ID5 A;  3M19 A;  4QBZ A;  5B0N A;  1FO1 A;  2JQD A;  4RCA B;  3UL9 A;  1WWL A;  4LXR A;  3CVR A;  3WPH A;  2OMY A;  4Q62 A;  1P8V A;  3P72 A;  1OTM A;  4ECN A;  2WQU A;  4FS7 A;  1QYY A;  2UZX A;  2FT3 A;  3C6O B;  1W8A A;  4PEQ B;  4WP6 A;  3UL7 A;  4ARR A;  4Z61 C;  4R07 A;  3W3N A;  3G3A A;  3W3L A;  5GMF A;  1OTO A;  5AWA A;  1YRG A;  4GT6 A;  1PGV A;  2Y5Q A;  1P9A G;  3E4G A;  4KT1 A;  5GS2 B;  3JB9 j;  4CC4 A;  4GLP A;  4FDW A;  2OMU A;  3ZYN A;  4LSC A;  3OGM B;  2OMZ A;  4C2A B;  3W3K A;  3G39 A;  3W3J A;  4CNM A;  1OGQ A;  4NKH A;  4BSR A;  5GS0 A;  5CMP A;  3WN4 A;  2WFH A;  3G3B A;  4Z94 G;  1LTX A;  2JE0 A;  1A4Y A;  2Z7X B;  4LXS A;  1H6T A;  1OTN A;  4CIL A;  2O6Q A;  4AW4 A;  4R5D A;  1SQ0 B;  5AZ5 A;  2Q4G W;  2XOT A;  4XGO A;  1DS9 A;  4H09 A;  3G06 A;  1M9S A;  2Z63 A;  4Q3I A;  4BSS A;  4PKI G;  4R6J A;  4M7E A;  1O6T A;  1XEU A;  4LI1 A;  3RFJ A;  2WQW A;  4HQ1 A;  3UL8 A;  4CP6 A;  1O6V A;  3OGL B;  2OMT A;  4J4L A;  4ARN A;  2V9T B;  3WPC A;  1FS2 A;  1XKU A;  1KOH A;  3E6J A;  4FCG A;  3E2J A;  3OJA A;  5CMN A;  2P1N B;  1XCD A;  2ASS B;  1IO0 A;  1OOK G;  2R9U A;  2AST B;  4FHO A;  5D3I A;  3TSR E;  4LSX A;  3WPB A;  2P1M B;  3E3Z A;  4RWT C;  3FXI A;  5A5C A;  5GMH A;  5IJB A;  3WPD A;  3WPI A;  3VQ2 A;  5IJC A;  3KJ4 A;  4M7E C;  2JE1 A;  2Z7X A;  3RJ0 A;  3PMH G;  3VQ1 A;  1O6S A;  2OMW A;  4FMZ A;  4PQ8 A;  4XSQ A;  4K17 A;  4R09 A;  1G9U A;  1JL5 A; 
#chains in the Genus database with same CATH topology
 2UU9 H;  3GOZ A;  3OJA B;  3K7A L;  3QQC E;  1DT4 A;  5IYD L;  4MQW X;  2PVE A;  3UOE A;  1R0I A;  2Z65 A;  1T9O A;  5B0T A;  3KYY A;  4JI0 H;  2RR6 A;  1IBK H;  2MS3 A;  2NN6 G;  4JI2 H;  3WPF A;  4A3J L;  4BBR L;  1K5G C;  2QL0 A;  1H7V A;  4LFB H;  2O6S A;  2P1Q B;  2R7Z L;  4LI2 A;  4CNC A;  1HNW H;  3REZ A;  1ZZK A;  2A69 D;  4DV2 H;  2PY9 A;  3GTK L;  2ZIX A;  5DM6 1;  5IP9 L;  3RF2 A;  4B3M H;  4DR7 H;  3S14 L;  1OZN A;  3HJY B;  1P8T A;  5AWD A;  1WE8 A;  1WCM L;  5MGN A;  2FFM A;  1I94 H;  3CIG A;  4IM6 A;  3OSS D;  1HNZ H;  4AI3 A;  5MLC 3;  4A3F L;  1AN7 A;  4EC5 A;  4XOS A;  2M8W A;  1IU5 A;  5GMG A;  2K1H A;  2AXY A;  3GTQ L;  4B8C D;  4AIM A;  3OGK B;  4AR3 A;  4L3A A;  3IU3 I;  1C09 A;  1HNX H;  4QIW P;  1K83 L;  5BR8 H;  8RXN A;  2Z66 A;  1ODH A;  4AI2 A;  3H3V M;  3WWL A;  2XWT C;  2CTJ A;  3ULV A;  2ZM6 H;  4LSA A;  1KOO A;  1DCE A;  2RA8 A;  4MN8 B;  2MJH A;  4JI4 H;  4R08 A;  2GMG A;  4V2D A;  1WTJ A;  5M5Y L;  4PSJ A;  2XJV A;  4Y7N L;  1Y1W L;  3LWP B;  5H1S c;  3LWV B;  5IYC L;  4AR6 A;  1SMM A;  4LHL A;  4Z8G A;  4OX9 H;  1QCV A;  2AUS B;  1VZI A;  4JYA H;  2OMV A;  2C6B A;  3W3M A;  1EC6 A;  2P1P B;  4POG A;  2FPH X;  2LTL A;  4LXR A;  3WPH A;  4WAL A;  3P72 A;  4Q62 A;  2WQU A;  2CKC A;  2ANR A;  1QYY A;  2FT3 A;  3C6O B;  1SMW A;  4PEQ B;  4WP6 A;  4ARR A;  1VZG A;  2HR5 A;  5MFP A;  4Z61 C;  3W3L A;  1YUX A;  4GT6 A;  3E4G A;  1P9A G;  5GS2 B;  3A44 A;  4BY1 L;  2E2J L;  2E5L H;  3OGM B;  4C2A B;  2LTM A;  4DR1 H;  3G39 A;  3W3J A;  4CNM A;  5GAH c;  1OGQ A;  4JAF A;  5CMP A;  4A3E L;  4DV4 H;  2WFH A;  2XJU A;  2V0E A;  6RXN A;  1LTX A;  3JAM W;  4AHY A;  4A3K L;  4LXS A;  1H6T A;  1RDV A;  1S30 A;  2CWF A;  4H8A A;  2V3B B;  2B63 L;  1RYT A;  5AZ5 A;  1PZX A;  4XGO A;  4H09 A;  3I4N L;  4Q3I A;  5AI2 A;  4C3I L;  4BXX L;  4PKI G;  4A3B L;  2OPV A;  4YY3 H;  4AQY H;  2CTM A;  4M7E A;  4AR4 A;  4IFD G;  3J7Z 1;  4TVM A;  3UL8 A;  1R0G A;  2ERS A;  2PYA A;  3LNL A;  2C6A A;  1O6V A;  3OGL B;  4J4L A;  3WPC A;  1VIH A;  2HH2 A;  3S2D L;  1J4W A;  1FS2 A;  1XKU A;  5K2M E;  4LFA H;  3OJA A;  3J81 W;  4B8T A;  2CPQ A;  5CMN A;  2AST B;  3S15 L;  3FKI L;  4FJS A;  1WJV A;  5FJ8 L;  3WPD A;  5A5C A;  2H12 A;  3KJ4 A;  3RJ0 A;  3PMH G;  2HVY C;  3H0G L;  4FMZ A;  4XSQ A;  1LKO A;  1S24 A;  1Z7X W;  4QC0 A;  2Y3M A;  2WAQ P;  3JR7 A;  5MF6 A;  1M9L A;  1SEI A;  2UZY A;  2V9S A;  4EZG A;  3S1N L;  4Q3G A;  1B2J A;  1N32 H;  3C6P B;  4BA1 I;  4KNG A;  2Z3R B;  4BBS L;  3T1Y H;  2JI2 A;  3LWR B;  1DX8 A;  4NZT M;  4UY8 1;  4V2C A;  1U0N D;  3P2A A;  3S2H L;  1QYB A;  2BA0 A;  1DFJ I;  3GTL L;  4LF7 H;  2Z81 A;  1RYQ A;  4OCH A;  3UN9 A;  1N36 H;  2BEX A;  2VQF H;  1F4L A;  4P91 A;  2UUB H;  3VKE A;  1H6U A;  1T9P A;  4QXE A;  1B2O A;  1MSZ A;  2WQV A;  2YQR A;  2A0Z A;  2LRR A;  3M3Y L;  3CQZ L;  4Z79 A;  2PSM C;  1PFW A;  3DZE A;  4RXN A;  4R6A A;  3RFE A;  2NVQ L;  1SMU A;  2ERJ A;  3GTM L;  3AEV B;  1J5K A;  5M3F L;  2AQC A;  2V0F A;  4J0M A;  3S1M L;  4R6F A;  4BA2 I;  4E9J A;  5IY0 A;  2JZX A;  5IWA H;  2G8Y A;  2B5I D;  2LCQ A;  2P1O B;  2JEB I;  2Z62 A;  4BSU A;  2WB1 P;  4JAG A;  1M0Z A;  3RIZ A;  5C4X L;  2XJR A;  3RZO L;  4E6Y A;  4DV1 H;  3KYX A;  2JA7 L;  2CA6 A;  1OWB A;  3HOZ L;  3PIP 1;  1CAD A;  4ZN1 B;  1D0B A;  1GWB A;  1TWA L;  3ZYJ A;  1TUA A;  4X62 H;  4Y61 B;  4FJU A;  1TWC L;  2R93 L;  2JQD A;  4RCA B;  4YWL A;  1I6U A;  1WWL A;  2Y0S P;  2M4Y A;  1OTM A;  4JI6 H;  4ECN A;  3PWF A;  1W8A A;  3GTJ L;  5GMF A;  1NXG A;  1P7P A;  3G3A A;  5C3E L;  2NYD A;  1OTO A;  5AWA A;  3PZA A;  1R0J A;  5C0X G;  4NXM H;  3JB9 j;  3S1Q L;  4NZR M;  5EIO C;  1XNQ H;  4GLP A;  1NXE A;  2OMZ A;  5C4J L;  3W3K A;  4V19 6;  3GR5 A;  3HOU L;  4NKH A;  4BSR A;  4JV5 H;  5GS0 A;  2K2D A;  5DT9 A;  4X65 H;  4AI1 A;  4DUZ H;  5JVH 1;  4LF4 H;  4KHP H;  1A4Y A;  2Z7X B;  4GS7 D;  1ZZI A;  2JI3 A;  2O6Q A;  1ZRP A;  3T1H H;  4AW4 A;  4JI8 H;  1SQ0 B;  2M6P A;  4C2M 1;  3H97 A;  3G06 A;  5GAG c;  3P8B A;  1B71 A;  3S1R L;  4OO1 G;  1KHM A;  4HQ1 A;  4LI1 A;  3HOY L;  3GTG L;  2OMT A;  4DV0 H;  2V9T B;  1KOH A;  1K1G A;  2CKA A;  4XXB B;  5JVG 1;  3E2J A;  3KDG A;  4NXN H;  1IO0 A;  1XCD A;  4FHO A;  1ZIW A;  2UXC H;  2P1M B;  3E3Z A;  1I3Q L;  1LKP A;  1PQX A;  3VQ2 A;  2JE1 A;  2Z7X A;  3LWQ B;  2Z0S A;  3KYU A;  5IP7 L;  1O6S A;  2OMW A;  2PQU A;  4R09 A;  4LSC A;  3G04 C;  1BFY A;  5EIN C;  2ZQE A;  3S16 L;  4C3J L;  3S17 L;  2Z82 A;  2DGR A;  5AWB A;  4Z64 C;  1X9Z A;  4JAE A;  2A6E D;  1XEC A;  3RZ6 A;  2E3U A;  4DV6 H;  2RDV A;  2XJP A;  4NBQ A;  2WQX A;  3WPG A;  2DSX A;  3OET A;  1ZZJ A;  3O53 A;  4YEB B;  3ZYO A;  3PIO 1;  4DR6 H;  1R0F A;  4CC4 C;  4V2E A;  1I50 L;  1OWC A;  3I4M L;  1FT8 A;  3NFP I;  3GKU A;  4A3G L;  2UUC H;  4WAN A;  4RCW A;  3RGX A;  1J5E H;  3H99 A;  4ZN3 B;  3C6N B;  1IU6 A;  2JA8 L;  4QMF B;  4AR5 A;  3MPS A;  4WYK A;  3HOW L;  2IFG A;  2BE5 D;  4NKG A;  5FLM L;  3HJW B;  4WFN 1;  1SFO L;  2O6R A;  2E2I L;  3O6N A;  3A79 B;  4DR2 H;  3SB1 A;  4DR3 H;  2ELL A;  1LTL A;  2O5J D;  2HHH H;  4U67 1;  3NCV A;  5LFN A;  2BNH A;  5HZL B;  4C2B B;  2V70 A;  4BV4 R;  2OMX A;  5B4P A;  3SB4 A;  2PVX A;  4B3R H;  3RW7 A;  2CPM A;  2FMR A;  4JI5 H;  3K35 A;  2OPU A;  1BRF A;  2ANN A;  4FD0 A;  2JI1 A;  4LIJ A;  4LSX C;  1S03 G;  4LF8 H;  3J7Y 1;  2Z3Q B;  2ID5 A;  3M19 A;  2UXB H;  2VKC A;  1FO1 A;  4DV5 H;  4QBZ A;  4AM3 A;  1XMO H;  1YUZ A;  4POF A;  4FS7 A;  2UZX A;  3B08 B;  2JEA I;  4R07 A;  3W3N A;  4BY7 L;  4LFC H;  4YHH H;  3FAU A;  2NVT L;  2X06 A;  5DM7 1;  1YRG A;  5A2Q W;  1IRN A;  1PGV A;  1R0H A;  1YK5 A;  1IBM H;  4FDW A;  3ZYN A;  4JI3 H;  1F0X A;  1S2Z A;  3MSU A;  4B3T H;  4K9F A;  1E8J A;  1PFU A;  3WN4 A;  4DV3 H;  4Z94 G;  3QVD A;  2JE0 A;  2J9U B;  4CIL A;  5GAE c;  2HH3 A;  2Q4G W;  2XOT A;  5C44 L;  1M9S A;  1RWD A;  1NXU A;  4JVH A;  2Z63 A;  5IYB L;  4YWM A;  2QND A;  4R6J A;  2PMZ P;  1O6T A;  1XEU A;  2NVY L;  1N33 H;  4ARN A;  5RXN A;  1TWG L;  4X66 H;  3E6J A;  2JA5 L;  3HOX L;  2F4V H;  5IT9 W;  5M5X L;  3TSR E;  3M4O L;  1OOK G;  2R9U A;  3OTO H;  4LF5 H;  5D3I A;  1X0A A;  5GMH A;  3FXI A;  1PFY A;  4LF9 H;  4A3I L;  5IJC A;  3RYG A;  3RZT A;  4M7E C;  1PFV A;  3PL5 A;  2L0Z A;  3GTP L;  1HR0 H;  4PQ8 A;  3V69 A;  2PT7 G;  3H9C A;  2VUM L;  3HKZ P;  4K17 A;  1LKM A;  1JL5 A;  3RGZ A;  1V9N A;  1JYB A;  1WVN A;  4JI7 H;  4U09 A;  4ECO A;  3GAB A;  4OQT A;  1VBI A;  4C3H L;  4G6B A;  1BQ9 A;  1RB9 A;  2AYJ A;  3LPE B;  4R58 A;  3M18 A;  2E2H L;  4R0A A;  5M5W L;  3FDJ A;  3ZYI A;  3WPE A;  4DUY H;  3KYW A;  3BZ5 A;  1IBL H;  4JAD A;  4AHX A;  4GKK H;  1XWD C;  4A3C L;  2APO B;  2KN9 A;  4R6G A;  2O4C A;  3W3G A;  5JEA G;  3GTO L;  5AI3 A;  1YV1 A;  5LMN H;  5LMU H;  4G8A A;  1R9T L;  4A3M L;  1VZH A;  2M6O A;  5HDH A;  2XJQ A;  4I6J B;  1I6H L;  4A3L L;  5GQR K;  4R5C A;  4DV7 H;  3HAX C;  4TPU A;  1T9Q A;  2JA6 L;  1VIG A;  3I0P A;  2XJT A;  3MQK B;  2P2R A;  4L3F A;  3RFS A;  1A9N A;  4LHN A;  1DTJ A;  4A3D L;  5AWC A;  1Z2I A;  4TZH A;  4U7L A;  4PDB A;  2VL6 A;  2CTL A;  3ULA A;  3PO3 L;  4U08 A;  2JA9 A;  1FQV A;  5LL6 b;  1X4M A;  2LF0 A;  5FTT B;  1FKA H;  1FHH A;  3L7Z C;  2KKD A;  1Z92 B;  2Z64 A;  1X4N A;  3RW6 A;  4KXF B;  1Y1V L;  4AY9 X;  4ME3 A;  3EZJ A;  2NVX L;  4GKJ H;  3ULU A;  1BQ8 A;  5AN9 H;  4X6A L;  1YK4 A;  4P8S A;  3CIY A;  3U1K A;  4U06 A;  5GAD c;  5IYX C;  3RZD L;  3J7A K;  1M10 B;  4PER A;  1XNR H;  1UG8 A;  2CTF A;  3QD7 X;  5IJD A;  4XGH A;  4UFR A;  2R92 L;  2RFK B;  3H9B A;  4DR4 H;  5B0N A;  3UL9 A;  5MFZ A;  1S20 A;  4G08 A;  3CVR A;  2EY4 E;  3VPB E;  2UUA H;  3SS2 A;  4A93 L;  4AHW A;  1P8V A;  2OMY A;  3KDK A;  3UL7 A;  1BE7 A;  2CTE A;  4DR5 H;  3LWO B;  2BL5 A;  4LF6 H;  2Y5Q A;  1IW7 D;  4KT1 A;  3PO2 L;  1RDG A;  2XJS A;  4CC4 A;  5K36 G;  2OMU A;  4B3S H;  1TWH L;  2UXD H;  2VQE H;  2JVZ A;  4Y52 L;  4OD6 A;  3G3B A;  1DVB A;  3KYV A;  3PKI A;  1IRO A;  3HOV L;  3PKJ A;  3ZG6 A;  4AYB P;  1VCX A;  4R5D A;  2M6Q A;  4AI0 A;  2A1S A;  2CTK A;  2A68 D;  7RXN A;  2JE6 I;  1DS9 A;  4BSS A;  2CWH A;  3J80 W;  1NNQ A;  1WHR A;  1XRH A;  1K5D C;  2A6H D;  2WQW A;  1B13 A;  5FLX W;  4K0K H;  3B0A B;  3RFJ A;  4CP6 A;  5M3M L;  2D9I A;  4JI1 H;  4FCG A;  3WWN B;  1TWF L;  1V8C A;  1XMQ H;  2CR8 A;  2ASS B;  2P1N B;  5IJB A;  1ZTG A;  2PPT A;  1CAA A;  3WPB A;  4RWT C;  2YU9 L;  4X64 H;  4AHZ A;  3WPI A;  1FJG H;  1N34 H;  2M4V A;  1QQT A;  3VQ1 A;  1FHM A;  4LSX A;  4JVY A;  1G9U A;  1OTN A; 
#chains in the Genus database with same CATH homology
 2UU9 H;  3GOZ A;  3OJA B;  3QQC E;  4MQW X;  2PVE A;  1R0I A;  2Z65 A;  1T9O A;  5B0T A;  3KYY A;  4JI0 H;  2RR6 A;  1IBK H;  2MS3 A;  3WPF A;  4JI2 H;  1K5G C;  2O6S A;  2QL0 A;  1H7V A;  4LFB H;  2P1Q B;  4LI2 A;  4CNC A;  1HNW H;  3REZ A;  4DV2 H;  2A69 D;  4DR7 H;  1K5D C;  2ZIX A;  5DM6 1;  3RF2 A;  4B3M H;  1OZN A;  1P8T A;  5AWD A;  5MGN A;  3CIG A;  1I94 H;  4IM6 A;  3OSS D;  1HNZ H;  4AI3 A;  5MLC 3;  1AN7 A;  4EC5 A;  4XOS A;  5GMG A;  1IU5 A;  3OGK B;  4B8C D;  4AR3 A;  4L3A A;  3IU3 I;  1C09 A;  1HNX H;  5BR8 H;  8RXN A;  2Z66 A;  1ODH A;  4AI2 A;  3WWL A;  2XWT C;  3ULV A;  2ZM6 H;  4LSA A;  1KOO A;  1DCE A;  2RA8 A;  4MN8 B;  4JI4 H;  4R08 A;  2GMG A;  4V2D A;  4PSJ A;  2XJV A;  5H1S c;  4AR6 A;  1SMM A;  4LHL A;  4Z8G A;  4OX9 H;  1QCV A;  4JYA H;  1VZI A;  2OMV A;  2C6B A;  3W3M A;  2P1P B;  4POG A;  2FPH X;  4LXR A;  3WPH A;  4Q62 A;  3P72 A;  2WQU A;  2CKC A;  1QYY A;  3C6O B;  2FT3 A;  1SMW A;  4PEQ B;  4WP6 A;  4ARR A;  1VZG A;  2HR5 A;  5MFP A;  4Z61 C;  3W3L A;  1YUX A;  4GT6 A;  3E4G A;  1P9A G;  5GS2 B;  3A44 A;  2E5L H;  3OGM B;  4C2A B;  4DR1 H;  3G39 A;  3W3J A;  4CNM A;  5GAH c;  1OGQ A;  4JAF A;  5CMP A;  4DV4 H;  2WFH A;  2XJU A;  2V0E A;  6RXN A;  1LTX A;  3JAM W;  4AHY A;  4LXS A;  1H6T A;  1RDV A;  1S30 A;  2V3B B;  1RYT A;  5AZ5 A;  4XGO A;  4H09 A;  4Q3I A;  5AI2 A;  4PKI G;  4YY3 H;  4AQY H;  4M7E A;  4AR4 A;  4TVM A;  3J7Z 1;  3UL8 A;  1R0G A;  2ERS A;  2PYA A;  3LNL A;  2C6A A;  1O6V A;  3OGL B;  4J4L A;  3WPC A;  1FS2 A;  1XKU A;  5K2M E;  4LFA H;  3OJA A;  3J81 W;  5CMN A;  2AST B;  1WJV A;  3WPD A;  5A5C A;  2H12 A;  3KJ4 A;  3RJ0 A;  3PMH G;  4FMZ A;  4XSQ A;  1LKO A;  1S24 A;  1Z7X W;  4QC0 A;  2Y3M A;  5MF6 A;  1M9L A;  1SEI A;  2UZY A;  2V9S A;  4EZG A;  4Q3G A;  1B2J A;  1N32 H;  3C6P B;  4KNG A;  2Z3R B;  3T1Y H;  2JI2 A;  1DX8 A;  4NZT M;  4UY8 1;  4V2C A;  1U0N D;  3P2A A;  1QYB A;  1DFJ I;  4LF7 H;  2Z81 A;  1RYQ A;  4OCH A;  3UN9 A;  1N36 H;  2BEX A;  2VQF H;  4P91 A;  2UUB H;  1H6U A;  1T9P A;  4QXE A;  1B2O A;  2WQV A;  2A0Z A;  4Z79 A;  2PSM C;  3DZE A;  4R6A A;  4RXN A;  3RFE A;  1SMU A;  2ERJ A;  2V0F A;  4J0M A;  4R6F A;  4E9J A;  5IY0 A;  5IWA H;  2B5I D;  2LCQ A;  2P1O B;  2Z62 A;  4BSU A;  4JAG A;  1M0Z A;  3RIZ A;  2XJR A;  4E6Y A;  4DV1 H;  3KYX A;  2CA6 A;  1OWB A;  3PIP 1;  1CAD A;  4ZN1 B;  1D0B A;  1GWB A;  3ZYJ A;  4X62 H;  4Y61 B;  2JQD A;  4RCA B;  4YWL A;  1I6U A;  1WWL A;  2M4Y A;  1OTM A;  4JI6 H;  4ECN A;  3PWF A;  1W8A A;  5GMF A;  1NXG A;  3G3A A;  2NYD A;  1OTO A;  5AWA A;  3PZA A;  1R0J A;  4NXM H;  3JB9 j;  4NZR M;  5EIO C;  1XNQ H;  4GLP A;  1NXE A;  2OMZ A;  3W3K A;  4V19 6;  3GR5 A;  4NKH A;  4BSR A;  4JV5 H;  5GS0 A;  2K2D A;  5DT9 A;  4X65 H;  4DUZ H;  4AI1 A;  5JVH 1;  4LF4 H;  4KHP H;  1A4Y A;  2Z7X B;  4GS7 D;  2JI3 A;  2O6Q A;  1ZRP A;  3T1H H;  4AW4 A;  4JI8 H;  1SQ0 B;  2M6P A;  3G06 A;  5GAG c;  3P8B A;  1B71 A;  4LI1 A;  4HQ1 A;  2OMT A;  4DV0 H;  2V9T B;  1KOH A;  2CKA A;  4XXB B;  5JVG 1;  3E2J A;  3KDG A;  4NXN H;  1IO0 A;  1XCD A;  4FHO A;  1ZIW A;  2UXC H;  2P1M B;  3E3Z A;  1LKP A;  3VQ2 A;  2JE1 A;  2Z7X A;  3KYU A;  1O6S A;  2OMW A;  4R09 A;  4LSC A;  3G04 C;  1BFY A;  5EIN C;  2ZQE A;  2Z82 A;  5AWB A;  4Z64 C;  1X9Z A;  4JAE A;  2A6E D;  1XEC A;  3RZ6 A;  4DV6 H;  2RDV A;  2XJP A;  2WQX A;  3WPG A;  2DSX A;  3OET A;  4YEB B;  3O53 A;  3ZYO A;  3PIO 1;  4DR6 H;  1R0F A;  4CC4 C;  4V2E A;  1OWC A;  1FT8 A;  3NFP I;  2UUC H;  4RCW A;  3RGX A;  1J5E H;  4ZN3 B;  3C6N B;  1IU6 A;  4AR5 A;  3MPS A;  4WYK A;  2IFG A;  2BE5 D;  4NKG A;  4WFN 1;  2O6R A;  3O6N A;  3A79 B;  4DR2 H;  3SB1 A;  4DR3 H;  2ELL A;  1LTL A;  2O5J D;  2HHH H;  4U67 1;  3NCV A;  5LFN A;  2BNH A;  5HZL B;  4C2B B;  2V70 A;  4BV4 R;  2OMX A;  5B4P A;  3SB4 A;  2PVX A;  4B3R H;  3RW7 A;  4JI5 H;  3K35 A;  1BRF A;  4FD0 A;  2JI1 A;  4LSX C;  1S03 G;  4LF8 H;  3J7Y 1;  2Z3Q B;  2ID5 A;  3M19 A;  2UXB H;  2VKC A;  1FO1 A;  4DV5 H;  4QBZ A;  1XMO H;  1YUZ A;  4POF A;  4FS7 A;  2UZX A;  3B08 B;  4R07 A;  3W3N A;  4LFC H;  4YHH H;  3FAU A;  5DM7 1;  1YRG A;  5A2Q W;  1IRN A;  1PGV A;  1R0H A;  1YK5 A;  1IBM H;  4FDW A;  3ZYN A;  4JI3 H;  1F0X A;  1S2Z A;  3MSU A;  4B3T H;  4K9F A;  1E8J A;  3WN4 A;  4DV3 H;  4Z94 G;  3QVD A;  2JE0 A;  2J9U B;  4CIL A;  5GAE c;  2Q4G W;  2XOT A;  1M9S A;  1RWD A;  2Z63 A;  4YWM A;  4R6J A;  1O6T A;  1XEU A;  1N33 H;  4ARN A;  5RXN A;  4X66 H;  3E6J A;  2F4V H;  5IT9 W;  3TSR E;  1OOK G;  5D3I A;  2R9U A;  3OTO H;  4LF5 H;  5GMH A;  3FXI A;  4LF9 H;  5IJC A;  3RYG A;  3RZT A;  4M7E C;  2L0Z A;  1HR0 H;  4PQ8 A;  3RGZ A;  2PT7 G;  4K17 A;  1LKM A;  1JL5 A;  1JYB A;  4JI7 H;  4U09 A;  4ECO A;  3GAB A;  4OQT A;  4G6B A;  1BQ9 A;  1RB9 A;  2AYJ A;  3LPE B;  4R58 A;  3M18 A;  4R0A A;  3ZYI A;  3WPE A;  4DUY H;  3KYW A;  3BZ5 A;  1IBL H;  4JAD A;  4AHX A;  4GKK H;  1XWD C;  2KN9 A;  4R6G A;  2O4C A;  3W3G A;  4G8A A;  5LMN H;  5AI3 A;  1YV1 A;  5LMU H;  1VZH A;  2M6O A;  5HDH A;  2XJQ A;  4I6J B;  5GQR K;  4R5C A;  4DV7 H;  4TPU A;  1T9Q A;  1A9N A;  2XJT A;  3RFS A;  4L3F A;  4LHN A;  5AWC A;  4TZH A;  4U7L A;  4PDB A;  2VL6 A;  3ULA A;  4U08 A;  1FQV A;  5LL6 b;  2LF0 A;  5FTT B;  1FKA H;  1FHH A;  2KKD A;  1Z92 B;  2Z64 A;  3RW6 A;  4KXF B;  4AY9 X;  4ME3 A;  3EZJ A;  4GKJ H;  3ULU A;  1BQ8 A;  5AN9 H;  1YK4 A;  4P8S A;  3CIY A;  4U06 A;  5GAD c;  5IYX C;  3J7A K;  4PER A;  1M10 B;  1XNR H;  5IJD A;  3QD7 X;  4XGH A;  4UFR A;  5B0N A;  4DR4 H;  3UL9 A;  5MFZ A;  4G08 A;  3CVR A;  3VPB E;  2UUA H;  2OMY A;  3SS2 A;  1P8V A;  4AHW A;  3KDK A;  3UL7 A;  1BE7 A;  4DR5 H;  4LF6 H;  2Y5Q A;  1IW7 D;  4KT1 A;  1RDG A;  2XJS A;  4CC4 A;  2OMU A;  4B3S H;  2UXD H;  2VQE H;  4OD6 A;  3G3B A;  1DVB A;  3KYV A;  3PKI A;  1IRO A;  3PKJ A;  3ZG6 A;  1VCX A;  4R5D A;  4AI0 A;  2A68 D;  7RXN A;  1DS9 A;  4BSS A;  3J80 W;  1NNQ A;  3RFJ A;  2A6H D;  2WQW A;  1B13 A;  5FLX W;  4K0K H;  3B0A B;  4CP6 A;  2D9I A;  4JI1 H;  4FCG A;  3WWN B;  1XMQ H;  2CR8 A;  2ASS B;  2P1N B;  5IJB A;  2PPT A;  1CAA A;  3WPB A;  4RWT C;  4X64 H;  4AHZ A;  3WPI A;  1FJG H;  1N34 H;  2M4V A;  3VQ1 A;  1FHM A;  4LSX A;  1G9U A;  1OTN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...