4B8CD

Nuclease module of the yeast ccr4-not complex
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
686
structure length
318
Chain Sequence
b'VNASNPLLHPHLDDPSLLNNPIWKLQLHLAAVSAQSLGQPNIYARQNAMKKYLCTKQALMEMADTLTDSKTAKDDQLWHALDLSNLQIFNISANIFKYDFLTRLYLNGNSLTELPAEIKNLSNLRVLDLSHNRLTSLPAELGSCFQLKYFYFFDNMVTTLPWEFGNLCNLQFLGVEGNPLEKQFLKILTEKSVTGLIFYLRDNRPEIPLPHETLCQHYATPKMYRYTPSWALSWDYRRNKLKEQILSYDSDLLCLQVESKTFEEYWVPTGIFVDGCCIFFLPFTNFTPSFTDVIEVDPEYVSKFIGFPNDKFPSDHIP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POLY(A) RIBONUCLEASE POP2
publication title Architecture of the Nuclease Module of the Yeast Ccr4-not Complex: The not1-Caf1-Ccr4 Interaction.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/cell cycle
total genus 68
structure length 318
sequence length 686
chains with identical sequence J, K, L
ec nomenclature ec 3.1.13.4: Poly(A)-specific ribonuclease.
pdb deposition date 2012-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF03372 Exo_endo_phos Endonuclease/Exonuclease/phosphatase family
D PF12799 LRR_4 Leucine Rich repeats (2 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.210 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 4b8cD03
3.30.1370.190 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 4b8cD02
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4b8cD01
4PSJA 3G3AA 1GWBA 3GOZA 3RIZA 3WPDA 4KNGA 1KOOA 4ARNA 4CP6A 4V2DA 5AWDA 1M9SA 4R07A 4K17A 3A79B 4YEBB 4M7EC 1Z7XW 2BNHA 2JE1A 4CILA 3FXIA 4V2CA 4LSCA 3ULAA 4GLPA 4Z61C 4BSSA 5FTTB 3WPBA 2P1NB 2BEXA 2XWTC 1QYYA 4H09A 3RJ0A 2JE0A 3P72A 4RWTC 2CA6A 2WQXA 3UN9A 2WFHA 4FHOA 4R6GA 1KOHA 2P1OB 1DFJI 3BZ5A 1H6UA 4L3FA 1LTXA 2RR6A 3M19A 3WPFA 5GMGA 3G39A 2ELLA 4FDWA 4R58A 1P8VA 3RFSA 1SQ0B 2V9TB 3W3JA 1OGQA 4R5CA 2WQWA 4R6AA 5GMFA 3WPCA 2OMZA 5B0TA 1FO1A 2O6SA 3SB4A 3W3LA 4ECNA 2OMVA 3WPHA 3ZYNA 4CNCA 3C6OB 3ZYIA 2OMWA 1A9NA 3RW6A 1YRGA 4G8AA 3WPIA 1DCEA 4L3AA 2Z66A 4AY9X 4V2EA 1XEUA 1W8AA 4GT6A 4I6JB 4Y61B 4Q3IA 2ASTB 3ULUA 2R9UA 1D0BA 1OZNA 1O6TA 2Z82A 4TZHA 5AWBA 4U09A 5B0NA 3C6PB 4QXEA 1XKUA 4FCGA 5AWAA 2FT3A 3PMHG 4PERA 1K5DC 3RGXA 3WPEA 4BV4R 2Q4GW 4PEQB 2P1MB 2P1PB 1JL5A 4Q3GA 4NKGA 4Z8GA 1ZIWA 5GMHA 2WQUA 2O6QA 5LFNA 4RCWA 4R0AA 2UZXA 3UL7A 3W3KA 1P9AG 3E4GA 4LI2A 3OGKB 2A0ZA 1G9UA 1IO0A 3W3MA 5IYXC 2Y5QA 4ECOA 4LXRA 2Z62A 4CNMA 3REZA 1OTMA 2Z65A 4KT1A 2Z7XA 4FMZA 1XWDC 1O6SA 3RFJA 2O6RA 3KJ4A 3G04C 4LSXA 4WYKA 4R5DA 3W3NA 3G06A 4R6FA 2ID5A 3O53A 4FD0A 4LI1A 1O6VA 3G3BA 4MQWX 3E2JA 4RCAB 4XOSA 1PGVA 1M0ZA 4CC4A 3RW7A 3E6JA 4QBZA 1A4YA 2WQVA 2P1QB 5GQRK 3OJAA 4Q62A 4IM6A 1DS9A 4U08A 2OMYA 2OMUA 4M7EA 5IJDA 1OOKG 5IJCA 3RGZA 4FS7A 1FQVA 3M18A 4Z94G 4U7LA 1XCDA 3E3ZA 4AW4A 5D3IA 5CMPA 3UL9A 4Z79A 2Z63A 3W3GA 2RA8A 4J4LA 3OGLB 1OTNA 4U06A 1U0ND 2V9SA 1OTOA 5B4PA 3VQ2A 4BSUA 5CMNA 4KXFB 4PKIG 4B8CD 3ZYJA 5GS2B 5IJBA 4XGOA 2XOTA 5AWCA 3C6NB 1WWLA 4C2BB 4P8SA 4BSRA 3WPGA 4J0MA 4UFRA 2IFGA 4LXSA 3ULVA 3VQ1A 5HZLB 3DZEA 4P91A 2Z7XB 3ZYOA 5AZ5A 4EZGA 3RFEA 3CVRA 4HQ1A 4Z64C 1XECA 4QC0A 4PQ8A 4LSAA 1P8TA 1M10B 3UL8A 4NKHA 4WP6A 3CIGA 4LSXC 4R6JA 2Z81A 4ARRA 1M9LA 4OQTA 2OMTA 4R09A 2UZYA 3OJAB 3CIYA 3O6NA 2JQDA 4C2AB 5HDHA 1K5GC 1FT8A 4R08A 3TSRE 4CC4C 5GS0A 2ASSB 4XSQA 3OGMB 2Z64A 2OMXA 2V70A 4MN8B 3JB9j 1FS2A 1H6TA 3WN4A 5A5CA
chains in the Genus database with same CATH superfamily
1K83L 4PSJA 2E3UA 3G3AA 1GWBA 3GOZA 3RIZA 6RXNA 3WPDA 5FLXW 1HNWH 4KNGA 4NBQA 1KOOA 4ARNA 4CP6A 4V2DA 3U1KA 5AWDA 1M9SA 5GAGc 4JV5H 2M4YA 3S15L 4R07A 4K17A 3FKIL 3CQZL 1S2ZA 3PIP1 3A79B 4A3ML 4YEBB 1BQ8A 4M7EC 3KYYA 1NXGA 4NZTM 2BL5A 3RZDL 1Z7XW 2BNHA 1TWHL 2OPUA 2UXDH 2JE1A 4CILA 3S2DL 3J7AK 1IBLH 4ZN3B 4YWLA 4LF5H 1P7PA 2CTLA 1UG8A 3FXIA 4V2CA 3S1QL 1N32H 4LSCA 3ULAA 4KHPH 4GLPA 3LWQB 2V0FA 3RJ0A 4JVYA 2JA7L 1WHRA 3S1ML 2CTMA 1IROA 3GTPL 1B71A 4Z61C 4BSSA 2NVYL 1R0FA 4X64H 5FTTB 3WPBA 2XJQA 4B3MH 3H3VM 1WE8A 3HOUL 2P1NB 2XJPA 3KYXA 4A3JL 3OETA 2BEXA 2XWTC 2VL6A 1YK4A 1QYYA 5EINC 2JE0A 3P72A 4H09A 1R0IA 3MSUA 4AHZA 4C3HL 4A3LL 4RWTC 2FFMA 4TPUA 2QNDA 3GKUA 2CA6A 2ERSA 2BE5D 2LTMA 2MS3A 3A44A 4BBRL 2CKCA 2WQXA 3KDKA 1FJGH 2XJSA 3UN9A 2WFHA 2ANNA 1F0XA 2JEBI 5IYDL 4FHOA 4R6GA 1KOHA 2P1OB 4C2M1 1DFJI 3P8BA 3BZ5A 1F4LA 2UU9H 1H6UA 4L3FA 1LTXA 2RR6A 3M19A 3WPFA 5GMGA 3G39A 2ELLA 4BXXL 2JVZA 4FDWA 4R58A 3JAMW 1B2OA 2M6QA 1P8VA 1BFYA 5DT9A 2CTFA 4LF9H 1IBMH 3RFSA 4H8AA 2NYDA 2O4CA 5IYCL 1S30A 3I4NL 1SQ0B 2VQFH 2CTEA 3SB1A 2V9TB 5MFPA 5C4XL 2APOB 4V196 1OGQA 3W3JA 3GTJL 4BY1L 2R92L 4R5CA 2FMRA 5DM61 1RWDA 1ZTGA 4A3CL 1R9TL 1DTJA 1E8JA 2WQWA 4WANA 4R6AA 4JAGA 1VBIA 5GMFA 1K1GA 3WPCA 2Z3QB 1QYBA 5AN9H 4JI1H 2OMZA 5B0TA 4AR3A 1FO1A 2O6SA 1WTJA 4NXMH 3SB4A 2L0ZA 1HR0H 2JA9A 5A2QW 5GAEc 4GKJH 1IRNA 3W3LA 1PFVA 1T9PA 2XJRA 3S1NL 1BQ9A 2M4VA 4ECNA 5GADc 4YY3H 4PDBA 1YUZA 4LF7H 2OMVA 3GR5A 3WPHA 3ZYNA 4CNCA 1LKOA 3LWOB 2PT7G 1RDVA 3C6OB 1AN7A 3ZYIA 2OMWA 2NVQL 2UXBH 3PKIA 1A9NA 2AXYA 4AM3A 2CTKA 3RW6A 4AHXA 2JE6I 1YRGA 4G8AA 3WPIA 2PSMC 5K36G 2HH2A 1DCEA 4L3AA 2Z66A 5IT9W 1SEIA 4AY9X 1KHMA 4V2EA 5FJ8L 2FPHX 1XEUA 1W8AA 1J5EH 4GT6A 3HJYB 4I6JB 4Y61B 4Q3IA 2ASTB 5M5YL 1NXUA 2G8YA 3ULUA 3MQKB 1EC6A 4LF8H 2R9UA 4AHWA 1ZZJA 2E5LH 1D0BA 1OZNA 3EZJA 4QIWP 1O6TA 4C3IL 2VUML 1S20A 2Z82A 4TZHA 5AWBA 2V0EA 2DSXA 1XNRH 1FHHA 1CADA 4U09A 5B0NA 3WWNB 5MFZA 2ZM6H 5MGNA 3HKZP 5K2ME 4A3GL 1WCML 1Z92B 3C6PB 4X66H 2JI1A 1DVBA 3GTQL 2HVYC 3S14L 1B13A 4QXEA 1LKPA 3H9BA 4B8TA 3JR7A 1XKUA 4FCGA 5AWAA 2FT3A 1C09A 3PMHG 4PERA 1LTLA 4DV0H 4DUZH 1PFUA 3J80W 1K5DC 4G6BA 2CPMA 1QQTA 3RGXA 3WPEA 4X6AL 4BV4R 4BA1I 3VPBE 2Y3MA 4Y52L 2Q4GW 4PEQB 2P1MB 2P1PB 1JL5A 4Q3GA 3RF2A 4DV4H 1QCVA 2XJUA 2A6ED 4NKGA 4Z8GA 1ZIWA 5GMHA 2WQUA 4AHYA 1V9NA 2VQEH 2O6QA 5LFNA 3AEVB 4RCWA 4Y7NL 3T1HH 2NVXL 2KN9A 2QL0A 4R0AA 2GMGA 3MPSA 2M6OA 2UZXA 2LRRA 3UL7A 1IBKH 5LMUH 5LMNH 3W3KA 4A3EL 1XMOH 7RXNA 1XMQH 4JI7H 4DR1H 1P9AG 3RZ6A 5IP9L 5RXNA 1N33H 2NVTL 3E4GA 4LI2A 5AI3A 5JVG1 4DR4H 3OGKB 2A0ZA 4OX9H 3KYWA 4JI6H 1G9UA 1IO0A 4JI0H 5M3FL 2MJHA 1YK5A 1VZGA 2D9IA 3KYVA 4A93L 1DX8A 2RFKB 3W3MA 5IYXC 2Y5QA 2NN6G 4ECOA 4AYBP 1YUXA 4LXRA 1FHMA 2Z62A 3HOXL 4POGA 4CNMA 3REZA 3PKJA 1IW7D 4X65H 2Z0SA 1OTMA 2Z65A 2PVEA 3HOYL 2A1SA 4BBSL 3V69A 4KT1A 3H9CA 1TUAA 3KDGA 2Z7XA 4FMZA 2K1HA 4NXNH 1O6SA 1XWDC 3RFJA 5MLC3 4A3IL 2PPTA 3PL5A 2CKAA 2O6RA 3G04C 3KJ4A 4OD6A 4WALA 4LSXA 4WYKA 4B3SH 5LL6b 1JYBA 3B08B 4LFBH 4R5DA 3G06A 3W3NA 4AI0A 2KKDA 4OO1G 4R6FA 1BRFA 4A3BL 2ID5A 4U671 2RDVA 2JI3A 4LF4H 5M3ML 1X4MA 3FAUA 3O53A 1VZIA 4FD0A 4LI1A 1O6VA 3GTKL 3RZTA 3G3BA 4MQWX 3E2JA 3J81W 3VKEA 2E2JL 1TWFL 1BE7A 2A6HD 4C3JL 1RB9A 4RCAB 3GTLL 2LF0A 4XOSA 1IU6A 1WJVA 1PGVA 2VKCA 2E2IL 4JI8H 1X4NA 1M0ZA 4CC4A 1Y1VL 3E6JA 1TWCL 4K9FA 3RW7A 4DV7H 2F4VH 1HNXH 4POFA 1R0JA 5M5XL 1CAAA 3PWFA 4QBZA 2M6PA 1MSZA 1X9ZA 2PY9A 1A4YA 3B0AB 1S24A 3T1YH 1TWAL 2PMZP 2XJTA 5C44L 2WQVA 2JA8L 1RYQA 5C0XG 3IU3I 4IFDG 8RXNA 3PZAA 2OPVA 1Y1WL 3S17L 1J5KA 2P1QB 1SFOL 5GQRK 4JAEA 5AI2A 4XXBB 4X62H 1IU5A 3OJAA 2B5ID 4DV5H 4Q62A 4IM6A 2CTJA 1DS9A 1I94H 1SMMA 4U08A 2O5JD 4LFCH 1NXEA 2OMYA 4ME3A 2OMUA 4DR6H 4M7EA 3QD7X 3I0PA 1OOKG 5IJCA 5IJDA 3HJWB 3RGZA 1R0HA 2PQUA 4DR2H 5M5WL 4FS7A 3KYUA 4WFN1 4ZN1B 4JADA 2A69D 1LKMA 1OWBA 3H99A 3NFPI 2LCQA 1VCXA 4JAFA 3J7Z1 1FQVA 2CWHA 2YU9L 3S1RL 5C4JL 3M18A 2JEAI 4Z94G 3ZG6A 4OCHA 4AIMA 4U7LA 1T9QA 1TWGL 1XCDA 4XGHA 1ZRPA 1S03G 3E3ZA 4AW4A 5D3IA 4LIJA 5CMPA 3UL9A 4Z79A 5C3EL 4TVMA 2Z63A 1N36H 3W3GA 2RA8A 1PQXA 3S2HL 4J4LA 3OGLB 2A68D 2PVXA 1OTNA 4U06A 5DM71 1I3QL 1U0ND 4YHHH 2V9SA 5EIOC 2H12A 1OTOA 3H97A 2B63L 3LWPB 5B4PA 2R7ZL 3GTML 1H7VA 1PZXA 2EY4E 3VQ2A 4DV2H 4BSUA 4NZRM 5CMNA 2JZXA 4E9JA 3LWVB 4KXFB 4PKIG 3LNLA 3PO2L 4BY7L 4B8CD 3ZYJA 5GS2B 2CR8A 5IJBA 4AR4A 2ANRA 2WB1P 1I6HL 4XGOA 4GS7D 5JVH1 2XOTA 1R0GA 1B2JA 4FJUA 2UUCH 3I4ML 5GAHc 5AWCA 3LPEB 3S16L 4A3DL 4DR5H 3C6NB 4B3TH 4JYAH 1WWLA 3K7AL 4C2BB 4DR3H 3K35A 4P8SA 2LTLA 2HH3A 4LFAH 2ZQEA 4BSRA 3WPGA 2YQRA 1T9OA 4J0MA 4AI3A 4JI3H 4UFRA 4DR7H 3PIO1 3OTOH 1ZZIA 4JI4H 1SMWA 4YWMA 1DT4A 2IFGA 4AI1A 3H0GL 4LXSA 2M8WA 2HHHH 4DUYH 4A3FL 3ULVA 3VQ1A 3QVDA 5HZLB 3GABA 2JA6L 2ERJA 3UOEA 3DZEA 2AUSB 4EC5A 3QQCE 2WAQP 1I50L 5BR8H 2C6BA 1PFWA 2AYJA 2K2DA 1SMUA 2JI2A 3RYGA 4P91A 2Z7XB 3ZYOA 2XJVA 4RXNA 2CWFA 3LWRB 4DV1H 1OWCA 2HR5A 5FLML 1YV1A 5AZ5A 5IY0A 4G08A 1HNZH 4UY81 4EZGA 3RFEA 2ZIXA 1VIHA 4K0KH 3CVRA 4QMFB 4HQ1A 4Z64C 1XECA 5MF6A 1XNQH 3FDJA 4QC0A 1XRHA 4PQ8A 2UXCH 1NNQA 3HAXC 1J4WA 2R93L 4DV6H 4AR5A 3GTOL 4LSAA 4AR6A 4LHNA 2X06A 1X0AA 2CPQA 1P8TA 1M10B 1RYTA 2DGRA 2BA0A 3UL8A 4NKHA 1I6UA 3P2AA 4AI2A 4LHLA 2V3BB 4LF6H 4WP6A 1WVNA 2Y0SP 5IYBL 4A3KL 3CIGA 1RDGA 1Z2IA 3RZOL 2UUBH 5H1Sc 2C6AA 3OSSD 5JEAG 4R6JA 2Z81A 4LSXC 3HOWL 4ARRA 2P2RA 2UUAH 2Z3RB 1ODHA 2PYAA 1M9LA 4OQTA 3HOVL 4AQYH 2OMTA 1PFYA 2J9UB 1VZHA 3WWLA 4R09A 2UZYA 3OJAB 3CIYA 4JI2H 3O6NA 3GTGL 3SS2A 4BA2I 2JQDA 1VIGA 4C2AB 5HDHA 1V8CA 1K5GC 3M3YL 1ZZKA 4JI5H 2JA5L 1FT8A 3HOZL 4R08A 3TSRE 4FJSA 5IWAH 4CC4C 5GS0A 5IP7L 3L7ZC 2ASSB 4XSQA 4DV3H 3OGMB 4GKKH 2AQCA 3PO3L 3NCVA 2Z64A 2OMXA 4B3RH 3J7Y1 2E2HL 4JVHA 2V70A 3M4OL 1N34H 1FKAH 4MN8B 1FS2A 3JB9j 1H6TA 3WN4A 4E6YA 5A5CA
chains in the Genus database with same CATH topology
4PSJA 3G3AA 1GWBA 3GOZA 3RIZA 6RXNA 3WPDA 5FLXW 1HNWH 4KNGA 1KOOA 4ARNA 4CP6A 4V2DA 5AWDA 1M9SA 5GAGc 4JV5H 2M4YA 4R07A 4K17A 3PIP1 1S2ZA 3A79B 4YEBB 1BQ8A 4M7EC 3KYYA 1NXGA 4NZTM 1Z7XW 2BNHA 2JE1A 4CILA 2UXDH 3J7AK 1IBLH 4ZN3B 4YWLA 4LF5H 3FXIA 4V2CA 1N32H 4LSCA 3ULAA 4KHPH 4GLPA 2V0FA 1IROA 1B71A 4Z61C 4BSSA 4X64H 1R0FA 5FTTB 3WPBA 2XJQA 4B3MH 2P1NB 2XJPA 3KYXA 3OETA 2BEXA 2XWTC 2VL6A 1YK4A 1QYYA 5EINC 2JE0A 3P72A 4H09A 1R0IA 3MSUA 4AHZA 4RWTC 3RJ0A 4TPUA 2CA6A 2ERSA 2BE5D 2MS3A 3A44A 2WQXA 2CKCA 3KDKA 1FJGH 2XJSA 3UN9A 2WFHA 1F0XA 4FHOA 4R6GA 1KOHA 2P1OB 1DFJI 3BZ5A 3P8BA 2UU9H 1H6UA 4L3FA 1LTXA 2RR6A 3M19A 3WPFA 5GMGA 3G39A 2ELLA 4FDWA 4R58A 3JAMW 1B2OA 1P8VA 1BFYA 5DT9A 4LF9H 1IBMH 3RFSA 2NYDA 2O4CA 1S30A 1SQ0B 2VQFH 3SB1A 2V9TB 5MFPA 3W3JA 4V196 1OGQA 4R5CA 5DM61 1RWDA 1E8JA 2WQWA 4R6AA 5GMFA 4JAGA 3WPCA 2Z3QB 1QYBA 5AN9H 4JI1H 2OMZA 5B0TA 4AR3A 1FO1A 2O6SA 4NXMH 3SB4A 2L0ZA 1HR0H 5A2QW 5GAEc 4GKJH 1IRNA 3W3LA 1T9PA 2XJRA 1BQ9A 2M4VA 4ECNA 5GADc 4YY3H 4PDBA 1YUZA 4LF7H 2OMVA 3GR5A 3WPHA 3ZYNA 4CNCA 1LKOA 2PT7G 1RDVA 3C6OB 1AN7A 3ZYIA 2OMWA 2UXBH 3PKIA 1A9NA 3RW6A 4AHXA 1YRGA 4G8AA 3WPIA 2PSMC 1DCEA 4L3AA 2Z66A 5IT9W 1SEIA 4AY9X 4V2EA 2FPHX 1XEUA 1W8AA 1J5EH 4GT6A 4I6JB 4Y61B 4Q3IA 2ASTB 3ULUA 2R9UA 4LF8H 4AHWA 2E5LH 1D0BA 1OZNA 3EZJA 1O6TA 2Z82A 4TZHA 5AWBA 2V0EA 2DSXA 1XNRH 1FHHA 1CADA 4U09A 5B0NA 3WWNB 5MFZA 2ZM6H 5MGNA 5K2ME 3C6PB 1Z92B 4X66H 2JI1A 1DVBA 4QXEA 1B13A 1LKPA 1XKUA 4FCGA 5AWAA 2FT3A 1C09A 3PMHG 4PERA 1LTLA 4DV0H 4DUZH 3J80W 1K5DC 4G6BA 3RGXA 3WPEA 4BV4R 3VPBE 2Y3MA 2Q4GW 4PEQB 2P1MB 2P1PB 1JL5A 4Q3GA 3RF2A 4DV4H 1QCVA 2XJUA 2A6ED 4NKGA 4Z8GA 1ZIWA 5GMHA 2WQUA 4AHYA 2VQEH 2O6QA 5LFNA 4RCWA 3T1HH 4R0AA 2KN9A 2QL0A 2GMGA 3MPSA 2M6OA 2UZXA 3UL7A 1IBKH 5LMUH 5LMNH 3W3KA 1XMOH 7RXNA 1XMQH 4JI7H 4DR1H 1P9AG 3RZ6A 1N33H 5RXNA 3E4GA 4LI2A 5AI3A 5JVG1 4DR4H 3OGKB 2A0ZA 4OX9H 3KYWA 4JI6H 1G9UA 1IO0A 4JI0H 1YK5A 1VZGA 2D9IA 3KYVA 1DX8A 3W3MA 5IYXC 2Y5QA 4ECOA 1YUXA 4LXRA 1FHMA 2Z62A 4POGA 4CNMA 3REZA 3PKJA 1IW7D 4X65H 1OTMA 2Z65A 2PVEA 4KT1A 3KDGA 2Z7XA 4FMZA 4NXNH 1O6SA 1XWDC 3RFJA 5MLC3 2PPTA 2CKAA 2O6RA 3G04C 3KJ4A 4OD6A 4LSXA 4WYKA 4B3SH 5LL6b 1JYBA 3B08B 4LFBH 4R5DA 3G06A 3W3NA 4AI0A 2KKDA 4R6FA 1BRFA 2ID5A 4U671 2RDVA 2JI3A 4LF4H 3FAUA 3O53A 1VZIA 4FD0A 4LI1A 1O6VA 3RZTA 3G3BA 4MQWX 3E2JA 3J81W 2A6HD 1BE7A 1RB9A 4RCAB 2LF0A 4XOSA 1IU6A 1WJVA 1PGVA 2VKCA 4JI8H 1M0ZA 4CC4A 3RW7A 3E6JA 4K9FA 4DV7H 2F4VH 1HNXH 4POFA 1R0JA 1CAAA 3PWFA 4QBZA 2M6PA 1X9ZA 1A4YA 3B0AB 1S24A 3T1YH 2XJTA 2WQVA 1RYQA 3IU3I 8RXNA 3PZAA 2P1QB 5GQRK 4JAEA 5AI2A 4XXBB 4X62H 1IU5A 3OJAA 2B5ID 4DV5H 4Q62A 4IM6A 1DS9A 1I94H 1SMMA 4U08A 2O5JD 4LFCH 1NXEA 2OMYA 4ME3A 2OMUA 4DR6H 4M7EA 3QD7X 1OOKG 5IJCA 5IJDA 3RGZA 1R0HA 4DR2H 4FS7A 3KYUA 4WFN1 4ZN1B 4JADA 2A69D 1LKMA 1OWBA 3NFPI 2LCQA 1VCXA 4JAFA 3J7Z1 1FQVA 3M18A 4Z94G 3ZG6A 4OCHA 4U7LA 1T9QA 1XCDA 4XGHA 1ZRPA 1S03G 3E3ZA 4AW4A 5D3IA 5CMPA 3UL9A 4Z79A 4TVMA 2Z63A 1N36H 3W3GA 2RA8A 4J4LA 3OGLB 2A68D 2PVXA 1OTNA 4U06A 5DM71 1U0ND 4YHHH 2V9SA 5EIOC 2H12A 1OTOA 5B4PA 3VQ2A 4BSUA 1H7VA 4DV2H 4NZRM 5CMNA 4E9JA 4KXFB 4PKIG 3LNLA 4B8CD 3ZYJA 5GS2B 2CR8A 5IJBA 4AR4A 4XGOA 4GS7D 5JVH1 2XOTA 1R0GA 1B2JA 2UUCH 5GAHc 5AWCA 3LPEB 4DR5H 3C6NB 4B3TH 4JYAH 1WWLA 4C2BB 4DR3H 3K35A 4P8SA 4LFAH 4BSRA 2ZQEA 3WPGA 1T9OA 4J0MA 4AI3A 4JI3H 4UFRA 4DR7H 3PIO1 3OTOH 4JI4H 1SMWA 4YWMA 2IFGA 4AI1A 4LXSA 2HHHH 4DUYH 3ULVA 3VQ1A 3QVDA 5HZLB 3GABA 2ERJA 3DZEA 4EC5A 3QQCE 5BR8H 2C6BA 2AYJA 2K2DA 1SMUA 2JI2A 3RYGA 4P91A 2Z7XB 3ZYOA 2XJVA 4RXNA 4DV1H 1OWCA 2HR5A 1YV1A 5AZ5A 5IY0A 4G08A 1HNZH 4UY81 4EZGA 3RFEA 2ZIXA 3CVRA 4K0KH 4HQ1A 4Z64C 1XECA 5MF6A 1XNQH 4QC0A 4PQ8A 2UXCH 1NNQA 4DV6H 4AR5A 4LSAA 4AR6A 4LHNA 1P8TA 1M10B 1RYTA 3UL8A 4NKHA 1I6UA 3P2AA 4AI2A 4LHLA 2V3BB 4LF6H 4WP6A 3CIGA 1RDGA 2UUBH 5H1Sc 2C6AA 3OSSD 4R6JA 4LSXC 2Z81A 4ARRA 2UUAH 2Z3RB 1ODHA 2PYAA 1M9LA 4OQTA 4AQYH 2OMTA 2J9UB 1VZHA 3WWLA 4R09A 2UZYA 3OJAB 3CIYA 4JI2H 3O6NA 3SS2A 2JQDA 4C2AB 5HDHA 1K5GC 4JI5H 1FT8A 4R08A 3TSRE 5IWAH 4CC4C 5GS0A 2ASSB 4XSQA 4DV3H 3OGMB 4GKKH 2Z64A 3NCVA 2OMXA 4B3RH 3J7Y1 2V70A 1N34H 1FKAH 4MN8B 1FS2A 3JB9j 1H6TA 3WN4A 4E6YA 5A5CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PSJ A;  3G3A A;  1GWB A;  3GOZ A;  3RIZ A;  3WPD A;  4KNG A;  1KOO A;  4ARN A;  4CP6 A;  4V2D A;  5AWD A;  1M9S A;  4R07 A;  4K17 A;  3A79 B;  4YEB B;  4M7E C;  1Z7X W;  2BNH A;  2JE1 A;  4CIL A;  3FXI A;  4V2C A;  4LSC A;  3ULA A;  4GLP A;  4Z61 C;  4BSS A;  5FTT B;  3WPB A;  2P1N B;  2BEX A;  2XWT C;  1QYY A;  4H09 A;  3RJ0 A;  2JE0 A;  3P72 A;  4RWT C;  2CA6 A;  2WQX A;  3UN9 A;  2WFH A;  4FHO A;  4R6G A;  1KOH A;  2P1O B;  1DFJ I;  3BZ5 A;  1H6U A;  4L3F A;  1LTX A;  2RR6 A;  3M19 A;  3WPF A;  5GMG A;  3G39 A;  2ELL A;  4FDW A;  4R58 A;  1P8V A;  3RFS A;  1SQ0 B;  2V9T B;  3W3J A;  1OGQ A;  4R5C A;  2WQW A;  4R6A A;  5GMF A;  3WPC A;  2OMZ A;  5B0T A;  1FO1 A;  2O6S A;  3SB4 A;  3W3L A;  4ECN A;  2OMV A;  3WPH A;  3ZYN A;  4CNC A;  3C6O B;  3ZYI A;  2OMW A;  1A9N A;  3RW6 A;  1YRG A;  4G8A A;  3WPI A;  1DCE A;  4L3A A;  2Z66 A;  4AY9 X;  4V2E A;  1XEU A;  1W8A A;  4GT6 A;  4I6J B;  4Y61 B;  4Q3I A;  2AST B;  3ULU A;  2R9U A;  1D0B A;  1OZN A;  1O6T A;  2Z82 A;  4TZH A;  5AWB A;  4U09 A;  5B0N A;  3C6P B;  4QXE A;  1XKU A;  4FCG A;  5AWA A;  2FT3 A;  3PMH G;  4PER A;  1K5D C;  3RGX A;  3WPE A;  4BV4 R;  2Q4G W;  4PEQ B;  2P1M B;  2P1P B;  1JL5 A;  4Q3G A;  4NKG A;  4Z8G A;  1ZIW A;  5GMH A;  2WQU A;  2O6Q A;  5LFN A;  4RCW A;  4R0A A;  2UZX A;  3UL7 A;  3W3K A;  1P9A G;  3E4G A;  4LI2 A;  3OGK B;  2A0Z A;  1G9U A;  1IO0 A;  3W3M A;  5IYX C;  2Y5Q A;  4ECO A;  4LXR A;  2Z62 A;  4CNM A;  3REZ A;  1OTM A;  2Z65 A;  4KT1 A;  2Z7X A;  4FMZ A;  1XWD C;  1O6S A;  3RFJ A;  2O6R A;  3KJ4 A;  3G04 C;  4LSX A;  4WYK A;  4R5D A;  3W3N A;  3G06 A;  4R6F A;  2ID5 A;  3O53 A;  4FD0 A;  4LI1 A;  1O6V A;  3G3B A;  4MQW X;  3E2J A;  4RCA B;  4XOS A;  1PGV A;  1M0Z A;  4CC4 A;  3RW7 A;  3E6J A;  4QBZ A;  1A4Y A;  2WQV A;  2P1Q B;  5GQR K;  3OJA A;  4Q62 A;  4IM6 A;  1DS9 A;  4U08 A;  2OMY A;  2OMU A;  4M7E A;  5IJD A;  1OOK G;  5IJC A;  3RGZ A;  4FS7 A;  1FQV A;  3M18 A;  4Z94 G;  4U7L A;  1XCD A;  3E3Z A;  4AW4 A;  5D3I A;  5CMP A;  3UL9 A;  4Z79 A;  2Z63 A;  3W3G A;  2RA8 A;  4J4L A;  3OGL B;  1OTN A;  4U06 A;  1U0N D;  2V9S A;  1OTO A;  5B4P A;  3VQ2 A;  4BSU A;  5CMN A;  4KXF B;  4PKI G;  4B8C D;  3ZYJ A;  5GS2 B;  5IJB A;  4XGO A;  2XOT A;  5AWC A;  3C6N B;  1WWL A;  4C2B B;  4P8S A;  4BSR A;  3WPG A;  4J0M A;  4UFR A;  2IFG A;  4LXS A;  3ULV A;  3VQ1 A;  5HZL B;  3DZE A;  4P91 A;  2Z7X B;  3ZYO A;  5AZ5 A;  4EZG A;  3RFE A;  3CVR A;  4HQ1 A;  4Z64 C;  1XEC A;  4QC0 A;  4PQ8 A;  4LSA A;  1P8T A;  1M10 B;  3UL8 A;  4NKH A;  4WP6 A;  3CIG A;  4LSX C;  4R6J A;  2Z81 A;  4ARR A;  1M9L A;  4OQT A;  2OMT A;  4R09 A;  2UZY A;  3OJA B;  3CIY A;  3O6N A;  2JQD A;  4C2A B;  5HDH A;  1K5G C;  1FT8 A;  4R08 A;  3TSR E;  4CC4 C;  5GS0 A;  2ASS B;  4XSQ A;  3OGM B;  2Z64 A;  2OMX A;  2V70 A;  4MN8 B;  3JB9 j;  1FS2 A;  1H6T A;  3WN4 A;  5A5C A; 
#chains in the Genus database with same CATH topology
 1K83 L;  4PSJ A;  2E3U A;  3G3A A;  1GWB A;  3GOZ A;  3RIZ A;  6RXN A;  3WPD A;  5FLX W;  1HNW H;  4KNG A;  4NBQ A;  1KOO A;  4ARN A;  4CP6 A;  4V2D A;  3U1K A;  5AWD A;  1M9S A;  5GAG c;  4JV5 H;  2M4Y A;  3S15 L;  4R07 A;  4K17 A;  3FKI L;  3CQZ L;  1S2Z A;  3PIP 1;  3A79 B;  4A3M L;  4YEB B;  1BQ8 A;  4M7E C;  3KYY A;  1NXG A;  4NZT M;  2BL5 A;  3RZD L;  1Z7X W;  2BNH A;  1TWH L;  2OPU A;  2UXD H;  2JE1 A;  4CIL A;  3S2D L;  3J7A K;  1IBL H;  4ZN3 B;  4YWL A;  4LF5 H;  1P7P A;  2CTL A;  1UG8 A;  3FXI A;  4V2C A;  3S1Q L;  1N32 H;  4LSC A;  3ULA A;  4KHP H;  4GLP A;  3LWQ B;  2V0F A;  3RJ0 A;  4JVY A;  2JA7 L;  1WHR A;  3S1M L;  2CTM A;  1IRO A;  3GTP L;  1B71 A;  4Z61 C;  4BSS A;  2NVY L;  1R0F A;  4X64 H;  5FTT B;  3WPB A;  2XJQ A;  4B3M H;  3H3V M;  1WE8 A;  3HOU L;  2P1N B;  2XJP A;  3KYX A;  4A3J L;  3OET A;  2BEX A;  2XWT C;  2VL6 A;  1YK4 A;  1QYY A;  5EIN C;  2JE0 A;  3P72 A;  4H09 A;  1R0I A;  3MSU A;  4AHZ A;  4C3H L;  4A3L L;  4RWT C;  2FFM A;  4TPU A;  2QND A;  3GKU A;  2CA6 A;  2ERS A;  2BE5 D;  2LTM A;  2MS3 A;  3A44 A;  4BBR L;  2CKC A;  2WQX A;  3KDK A;  1FJG H;  2XJS A;  3UN9 A;  2WFH A;  2ANN A;  1F0X A;  2JEB I;  5IYD L;  4FHO A;  4R6G A;  1KOH A;  2P1O B;  4C2M 1;  1DFJ I;  3P8B A;  3BZ5 A;  1F4L A;  2UU9 H;  1H6U A;  4L3F A;  1LTX A;  2RR6 A;  3M19 A;  3WPF A;  5GMG A;  3G39 A;  2ELL A;  4BXX L;  2JVZ A;  4FDW A;  4R58 A;  3JAM W;  1B2O A;  2M6Q A;  1P8V A;  1BFY A;  5DT9 A;  2CTF A;  4LF9 H;  1IBM H;  3RFS A;  4H8A A;  2NYD A;  2O4C A;  5IYC L;  1S30 A;  3I4N L;  1SQ0 B;  2VQF H;  2CTE A;  3SB1 A;  2V9T B;  5MFP A;  5C4X L;  2APO B;  4V19 6;  1OGQ A;  3W3J A;  3GTJ L;  4BY1 L;  2R92 L;  4R5C A;  2FMR A;  5DM6 1;  1RWD A;  1ZTG A;  4A3C L;  1R9T L;  1DTJ A;  1E8J A;  2WQW A;  4WAN A;  4R6A A;  4JAG A;  1VBI A;  5GMF A;  1K1G A;  3WPC A;  2Z3Q B;  1QYB A;  5AN9 H;  4JI1 H;  2OMZ A;  5B0T A;  4AR3 A;  1FO1 A;  2O6S A;  1WTJ A;  4NXM H;  3SB4 A;  2L0Z A;  1HR0 H;  2JA9 A;  5A2Q W;  5GAE c;  4GKJ H;  1IRN A;  3W3L A;  1PFV A;  1T9P A;  2XJR A;  3S1N L;  1BQ9 A;  2M4V A;  4ECN A;  5GAD c;  4YY3 H;  4PDB A;  1YUZ A;  4LF7 H;  2OMV A;  3GR5 A;  3WPH A;  3ZYN A;  4CNC A;  1LKO A;  3LWO B;  2PT7 G;  1RDV A;  3C6O B;  1AN7 A;  3ZYI A;  2OMW A;  2NVQ L;  2UXB H;  3PKI A;  1A9N A;  2AXY A;  4AM3 A;  2CTK A;  3RW6 A;  4AHX A;  2JE6 I;  1YRG A;  4G8A A;  3WPI A;  2PSM C;  5K36 G;  2HH2 A;  1DCE A;  4L3A A;  2Z66 A;  5IT9 W;  1SEI A;  4AY9 X;  1KHM A;  4V2E A;  5FJ8 L;  2FPH X;  1XEU A;  1W8A A;  1J5E H;  4GT6 A;  3HJY B;  4I6J B;  4Y61 B;  4Q3I A;  2AST B;  5M5Y L;  1NXU A;  2G8Y A;  3ULU A;  3MQK B;  1EC6 A;  4LF8 H;  2R9U A;  4AHW A;  1ZZJ A;  2E5L H;  1D0B A;  1OZN A;  3EZJ A;  4QIW P;  1O6T A;  4C3I L;  2VUM L;  1S20 A;  2Z82 A;  4TZH A;  5AWB A;  2V0E A;  2DSX A;  1XNR H;  1FHH A;  1CAD A;  4U09 A;  5B0N A;  3WWN B;  5MFZ A;  2ZM6 H;  5MGN A;  3HKZ P;  5K2M E;  4A3G L;  1WCM L;  1Z92 B;  3C6P B;  4X66 H;  2JI1 A;  1DVB A;  3GTQ L;  2HVY C;  3S14 L;  1B13 A;  4QXE A;  1LKP A;  3H9B A;  4B8T A;  3JR7 A;  1XKU A;  4FCG A;  5AWA A;  2FT3 A;  1C09 A;  3PMH G;  4PER A;  1LTL A;  4DV0 H;  4DUZ H;  1PFU A;  3J80 W;  1K5D C;  4G6B A;  2CPM A;  1QQT A;  3RGX A;  3WPE A;  4X6A L;  4BV4 R;  4BA1 I;  3VPB E;  2Y3M A;  4Y52 L;  2Q4G W;  4PEQ B;  2P1M B;  2P1P B;  1JL5 A;  4Q3G A;  3RF2 A;  4DV4 H;  1QCV A;  2XJU A;  2A6E D;  4NKG A;  4Z8G A;  1ZIW A;  5GMH A;  2WQU A;  4AHY A;  1V9N A;  2VQE H;  2O6Q A;  5LFN A;  3AEV B;  4RCW A;  4Y7N L;  3T1H H;  2NVX L;  2KN9 A;  2QL0 A;  4R0A A;  2GMG A;  3MPS A;  2M6O A;  2UZX A;  2LRR A;  3UL7 A;  1IBK H;  5LMU H;  5LMN H;  3W3K A;  4A3E L;  1XMO H;  7RXN A;  1XMQ H;  4JI7 H;  4DR1 H;  1P9A G;  3RZ6 A;  5IP9 L;  5RXN A;  1N33 H;  2NVT L;  3E4G A;  4LI2 A;  5AI3 A;  5JVG 1;  4DR4 H;  3OGK B;  2A0Z A;  4OX9 H;  3KYW A;  4JI6 H;  1G9U A;  1IO0 A;  4JI0 H;  5M3F L;  2MJH A;  1YK5 A;  1VZG A;  2D9I A;  3KYV A;  4A93 L;  1DX8 A;  2RFK B;  3W3M A;  5IYX C;  2Y5Q A;  2NN6 G;  4ECO A;  4AYB P;  1YUX A;  4LXR A;  1FHM A;  2Z62 A;  3HOX L;  4POG A;  4CNM A;  3REZ A;  3PKJ A;  1IW7 D;  4X65 H;  2Z0S A;  1OTM A;  2Z65 A;  2PVE A;  3HOY L;  2A1S A;  4BBS L;  3V69 A;  4KT1 A;  3H9C A;  1TUA A;  3KDG A;  2Z7X A;  4FMZ A;  2K1H A;  4NXN H;  1O6S A;  1XWD C;  3RFJ A;  5MLC 3;  4A3I L;  2PPT A;  3PL5 A;  2CKA A;  2O6R A;  3G04 C;  3KJ4 A;  4OD6 A;  4WAL A;  4LSX A;  4WYK A;  4B3S H;  5LL6 b;  1JYB A;  3B08 B;  4LFB H;  4R5D A;  3G06 A;  3W3N A;  4AI0 A;  2KKD A;  4OO1 G;  4R6F A;  1BRF A;  4A3B L;  2ID5 A;  4U67 1;  2RDV A;  2JI3 A;  4LF4 H;  5M3M L;  1X4M A;  3FAU A;  3O53 A;  1VZI A;  4FD0 A;  4LI1 A;  1O6V A;  3GTK L;  3RZT A;  3G3B A;  4MQW X;  3E2J A;  3J81 W;  3VKE A;  2E2J L;  1TWF L;  1BE7 A;  2A6H D;  4C3J L;  1RB9 A;  4RCA B;  3GTL L;  2LF0 A;  4XOS A;  1IU6 A;  1WJV A;  1PGV A;  2VKC A;  2E2I L;  4JI8 H;  1X4N A;  1M0Z A;  4CC4 A;  1Y1V L;  3E6J A;  1TWC L;  4K9F A;  3RW7 A;  4DV7 H;  2F4V H;  1HNX H;  4POF A;  1R0J A;  5M5X L;  1CAA A;  3PWF A;  4QBZ A;  2M6P A;  1MSZ A;  1X9Z A;  2PY9 A;  1A4Y A;  3B0A B;  1S24 A;  3T1Y H;  1TWA L;  2PMZ P;  2XJT A;  5C44 L;  2WQV A;  2JA8 L;  1RYQ A;  5C0X G;  3IU3 I;  4IFD G;  8RXN A;  3PZA A;  2OPV A;  1Y1W L;  3S17 L;  1J5K A;  2P1Q B;  1SFO L;  5GQR K;  4JAE A;  5AI2 A;  4XXB B;  4X62 H;  1IU5 A;  3OJA A;  2B5I D;  4DV5 H;  4Q62 A;  4IM6 A;  2CTJ A;  1DS9 A;  1I94 H;  1SMM A;  4U08 A;  2O5J D;  4LFC H;  1NXE A;  2OMY A;  4ME3 A;  2OMU A;  4DR6 H;  4M7E A;  3QD7 X;  3I0P A;  1OOK G;  5IJC A;  5IJD A;  3HJW B;  3RGZ A;  1R0H A;  2PQU A;  4DR2 H;  5M5W L;  4FS7 A;  3KYU A;  4WFN 1;  4ZN1 B;  4JAD A;  2A69 D;  1LKM A;  1OWB A;  3H99 A;  3NFP I;  2LCQ A;  1VCX A;  4JAF A;  3J7Z 1;  1FQV A;  2CWH A;  2YU9 L;  3S1R L;  5C4J L;  3M18 A;  2JEA I;  4Z94 G;  3ZG6 A;  4OCH A;  4AIM A;  4U7L A;  1T9Q A;  1TWG L;  1XCD A;  4XGH A;  1ZRP A;  1S03 G;  3E3Z A;  4AW4 A;  5D3I A;  4LIJ A;  5CMP A;  3UL9 A;  4Z79 A;  5C3E L;  4TVM A;  2Z63 A;  1N36 H;  3W3G A;  2RA8 A;  1PQX A;  3S2H L;  4J4L A;  3OGL B;  2A68 D;  2PVX A;  1OTN A;  4U06 A;  5DM7 1;  1I3Q L;  1U0N D;  4YHH H;  2V9S A;  5EIO C;  2H12 A;  1OTO A;  3H97 A;  2B63 L;  3LWP B;  5B4P A;  2R7Z L;  3GTM L;  1H7V A;  1PZX A;  2EY4 E;  3VQ2 A;  4DV2 H;  4BSU A;  4NZR M;  5CMN A;  2JZX A;  4E9J A;  3LWV B;  4KXF B;  4PKI G;  3LNL A;  3PO2 L;  4BY7 L;  4B8C D;  3ZYJ A;  5GS2 B;  2CR8 A;  5IJB A;  4AR4 A;  2ANR A;  2WB1 P;  1I6H L;  4XGO A;  4GS7 D;  5JVH 1;  2XOT A;  1R0G A;  1B2J A;  4FJU A;  2UUC H;  3I4M L;  5GAH c;  5AWC A;  3LPE B;  3S16 L;  4A3D L;  4DR5 H;  3C6N B;  4B3T H;  4JYA H;  1WWL A;  3K7A L;  4C2B B;  4DR3 H;  3K35 A;  4P8S A;  2LTL A;  2HH3 A;  4LFA H;  2ZQE A;  4BSR A;  3WPG A;  2YQR A;  1T9O A;  4J0M A;  4AI3 A;  4JI3 H;  4UFR A;  4DR7 H;  3PIO 1;  3OTO H;  1ZZI A;  4JI4 H;  1SMW A;  4YWM A;  1DT4 A;  2IFG A;  4AI1 A;  3H0G L;  4LXS A;  2M8W A;  2HHH H;  4DUY H;  4A3F L;  3ULV A;  3VQ1 A;  3QVD A;  5HZL B;  3GAB A;  2JA6 L;  2ERJ A;  3UOE A;  3DZE A;  2AUS B;  4EC5 A;  3QQC E;  2WAQ P;  1I50 L;  5BR8 H;  2C6B A;  1PFW A;  2AYJ A;  2K2D A;  1SMU A;  2JI2 A;  3RYG A;  4P91 A;  2Z7X B;  3ZYO A;  2XJV A;  4RXN A;  2CWF A;  3LWR B;  4DV1 H;  1OWC A;  2HR5 A;  5FLM L;  1YV1 A;  5AZ5 A;  5IY0 A;  4G08 A;  1HNZ H;  4UY8 1;  4EZG A;  3RFE A;  2ZIX A;  1VIH A;  4K0K H;  3CVR A;  4QMF B;  4HQ1 A;  4Z64 C;  1XEC A;  5MF6 A;  1XNQ H;  3FDJ A;  4QC0 A;  1XRH A;  4PQ8 A;  2UXC H;  1NNQ A;  3HAX C;  1J4W A;  2R93 L;  4DV6 H;  4AR5 A;  3GTO L;  4LSA A;  4AR6 A;  4LHN A;  2X06 A;  1X0A A;  2CPQ A;  1P8T A;  1M10 B;  1RYT A;  2DGR A;  2BA0 A;  3UL8 A;  4NKH A;  1I6U A;  3P2A A;  4AI2 A;  4LHL A;  2V3B B;  4LF6 H;  4WP6 A;  1WVN A;  2Y0S P;  5IYB L;  4A3K L;  3CIG A;  1RDG A;  1Z2I A;  3RZO L;  2UUB H;  5H1S c;  2C6A A;  3OSS D;  5JEA G;  4R6J A;  2Z81 A;  4LSX C;  3HOW L;  4ARR A;  2P2R A;  2UUA H;  2Z3R B;  1ODH A;  2PYA A;  1M9L A;  4OQT A;  3HOV L;  4AQY H;  2OMT A;  1PFY A;  2J9U B;  1VZH A;  3WWL A;  4R09 A;  2UZY A;  3OJA B;  3CIY A;  4JI2 H;  3O6N A;  3GTG L;  3SS2 A;  4BA2 I;  2JQD A;  1VIG A;  4C2A B;  5HDH A;  1V8C A;  1K5G C;  3M3Y L;  1ZZK A;  4JI5 H;  2JA5 L;  1FT8 A;  3HOZ L;  4R08 A;  3TSR E;  4FJS A;  5IWA H;  4CC4 C;  5GS0 A;  5IP7 L;  3L7Z C;  2ASS B;  4XSQ A;  4DV3 H;  3OGM B;  4GKK H;  2AQC A;  3PO3 L;  3NCV A;  2Z64 A;  2OMX A;  4B3R H;  3J7Y 1;  2E2H L;  4JVH A;  2V70 A;  3M4O L;  1N34 H;  1FKA H;  4MN8 B;  1FS2 A;  3JB9 j;  1H6T A;  3WN4 A;  4E6Y A;  5A5C A; 
#chains in the Genus database with same CATH homology
 4PSJ A;  3G3A A;  1GWB A;  3GOZ A;  3RIZ A;  6RXN A;  3WPD A;  5FLX W;  1HNW H;  4KNG A;  1KOO A;  4ARN A;  4CP6 A;  4V2D A;  5AWD A;  1M9S A;  5GAG c;  4JV5 H;  2M4Y A;  4R07 A;  4K17 A;  3PIP 1;  1S2Z A;  3A79 B;  4YEB B;  1BQ8 A;  4M7E C;  3KYY A;  1NXG A;  4NZT M;  1Z7X W;  2BNH A;  2JE1 A;  4CIL A;  2UXD H;  3J7A K;  1IBL H;  4ZN3 B;  4YWL A;  4LF5 H;  3FXI A;  4V2C A;  1N32 H;  4LSC A;  3ULA A;  4KHP H;  4GLP A;  2V0F A;  1IRO A;  1B71 A;  4Z61 C;  4BSS A;  4X64 H;  1R0F A;  5FTT B;  3WPB A;  2XJQ A;  4B3M H;  2P1N B;  2XJP A;  3KYX A;  3OET A;  2BEX A;  2XWT C;  2VL6 A;  1YK4 A;  1QYY A;  5EIN C;  2JE0 A;  3P72 A;  4H09 A;  1R0I A;  3MSU A;  4AHZ A;  4RWT C;  3RJ0 A;  4TPU A;  2CA6 A;  2ERS A;  2BE5 D;  2MS3 A;  3A44 A;  2WQX A;  2CKC A;  3KDK A;  1FJG H;  2XJS A;  3UN9 A;  2WFH A;  1F0X A;  4FHO A;  4R6G A;  1KOH A;  2P1O B;  1DFJ I;  3BZ5 A;  3P8B A;  2UU9 H;  1H6U A;  4L3F A;  1LTX A;  2RR6 A;  3M19 A;  3WPF A;  5GMG A;  3G39 A;  2ELL A;  4FDW A;  4R58 A;  3JAM W;  1B2O A;  1P8V A;  1BFY A;  5DT9 A;  4LF9 H;  1IBM H;  3RFS A;  2NYD A;  2O4C A;  1S30 A;  1SQ0 B;  2VQF H;  3SB1 A;  2V9T B;  5MFP A;  3W3J A;  4V19 6;  1OGQ A;  4R5C A;  5DM6 1;  1RWD A;  1E8J A;  2WQW A;  4R6A A;  5GMF A;  4JAG A;  3WPC A;  2Z3Q B;  1QYB A;  5AN9 H;  4JI1 H;  2OMZ A;  5B0T A;  4AR3 A;  1FO1 A;  2O6S A;  4NXM H;  3SB4 A;  2L0Z A;  1HR0 H;  5A2Q W;  5GAE c;  4GKJ H;  1IRN A;  3W3L A;  1T9P A;  2XJR A;  1BQ9 A;  2M4V A;  4ECN A;  5GAD c;  4YY3 H;  4PDB A;  1YUZ A;  4LF7 H;  2OMV A;  3GR5 A;  3WPH A;  3ZYN A;  4CNC A;  1LKO A;  2PT7 G;  1RDV A;  3C6O B;  1AN7 A;  3ZYI A;  2OMW A;  2UXB H;  3PKI A;  1A9N A;  3RW6 A;  4AHX A;  1YRG A;  4G8A A;  3WPI A;  2PSM C;  1DCE A;  4L3A A;  2Z66 A;  5IT9 W;  1SEI A;  4AY9 X;  4V2E A;  2FPH X;  1XEU A;  1W8A A;  1J5E H;  4GT6 A;  4I6J B;  4Y61 B;  4Q3I A;  2AST B;  3ULU A;  2R9U A;  4LF8 H;  4AHW A;  2E5L H;  1D0B A;  1OZN A;  3EZJ A;  1O6T A;  2Z82 A;  4TZH A;  5AWB A;  2V0E A;  2DSX A;  1XNR H;  1FHH A;  1CAD A;  4U09 A;  5B0N A;  3WWN B;  5MFZ A;  2ZM6 H;  5MGN A;  5K2M E;  3C6P B;  1Z92 B;  4X66 H;  2JI1 A;  1DVB A;  4QXE A;  1B13 A;  1LKP A;  1XKU A;  4FCG A;  5AWA A;  2FT3 A;  1C09 A;  3PMH G;  4PER A;  1LTL A;  4DV0 H;  4DUZ H;  3J80 W;  1K5D C;  4G6B A;  3RGX A;  3WPE A;  4BV4 R;  3VPB E;  2Y3M A;  2Q4G W;  4PEQ B;  2P1M B;  2P1P B;  1JL5 A;  4Q3G A;  3RF2 A;  4DV4 H;  1QCV A;  2XJU A;  2A6E D;  4NKG A;  4Z8G A;  1ZIW A;  5GMH A;  2WQU A;  4AHY A;  2VQE H;  2O6Q A;  5LFN A;  4RCW A;  3T1H H;  4R0A A;  2KN9 A;  2QL0 A;  2GMG A;  3MPS A;  2M6O A;  2UZX A;  3UL7 A;  1IBK H;  5LMU H;  5LMN H;  3W3K A;  1XMO H;  7RXN A;  1XMQ H;  4JI7 H;  4DR1 H;  1P9A G;  3RZ6 A;  1N33 H;  5RXN A;  3E4G A;  4LI2 A;  5AI3 A;  5JVG 1;  4DR4 H;  3OGK B;  2A0Z A;  4OX9 H;  3KYW A;  4JI6 H;  1G9U A;  1IO0 A;  4JI0 H;  1YK5 A;  1VZG A;  2D9I A;  3KYV A;  1DX8 A;  3W3M A;  5IYX C;  2Y5Q A;  4ECO A;  1YUX A;  4LXR A;  1FHM A;  2Z62 A;  4POG A;  4CNM A;  3REZ A;  3PKJ A;  1IW7 D;  4X65 H;  1OTM A;  2Z65 A;  2PVE A;  4KT1 A;  3KDG A;  2Z7X A;  4FMZ A;  4NXN H;  1O6S A;  1XWD C;  3RFJ A;  5MLC 3;  2PPT A;  2CKA A;  2O6R A;  3G04 C;  3KJ4 A;  4OD6 A;  4LSX A;  4WYK A;  4B3S H;  5LL6 b;  1JYB A;  3B08 B;  4LFB H;  4R5D A;  3G06 A;  3W3N A;  4AI0 A;  2KKD A;  4R6F A;  1BRF A;  2ID5 A;  4U67 1;  2RDV A;  2JI3 A;  4LF4 H;  3FAU A;  3O53 A;  1VZI A;  4FD0 A;  4LI1 A;  1O6V A;  3RZT A;  3G3B A;  4MQW X;  3E2J A;  3J81 W;  2A6H D;  1BE7 A;  1RB9 A;  4RCA B;  2LF0 A;  4XOS A;  1IU6 A;  1WJV A;  1PGV A;  2VKC A;  4JI8 H;  1M0Z A;  4CC4 A;  3RW7 A;  3E6J A;  4K9F A;  4DV7 H;  2F4V H;  1HNX H;  4POF A;  1R0J A;  1CAA A;  3PWF A;  4QBZ A;  2M6P A;  1X9Z A;  1A4Y A;  3B0A B;  1S24 A;  3T1Y H;  2XJT A;  2WQV A;  1RYQ A;  3IU3 I;  8RXN A;  3PZA A;  2P1Q B;  5GQR K;  4JAE A;  5AI2 A;  4XXB B;  4X62 H;  1IU5 A;  3OJA A;  2B5I D;  4DV5 H;  4Q62 A;  4IM6 A;  1DS9 A;  1I94 H;  1SMM A;  4U08 A;  2O5J D;  4LFC H;  1NXE A;  2OMY A;  4ME3 A;  2OMU A;  4DR6 H;  4M7E A;  3QD7 X;  1OOK G;  5IJC A;  5IJD A;  3RGZ A;  1R0H A;  4DR2 H;  4FS7 A;  3KYU A;  4WFN 1;  4ZN1 B;  4JAD A;  2A69 D;  1LKM A;  1OWB A;  3NFP I;  2LCQ A;  1VCX A;  4JAF A;  3J7Z 1;  1FQV A;  3M18 A;  4Z94 G;  3ZG6 A;  4OCH A;  4U7L A;  1T9Q A;  1XCD A;  4XGH A;  1ZRP A;  1S03 G;  3E3Z A;  4AW4 A;  5D3I A;  5CMP A;  3UL9 A;  4Z79 A;  4TVM A;  2Z63 A;  1N36 H;  3W3G A;  2RA8 A;  4J4L A;  3OGL B;  2A68 D;  2PVX A;  1OTN A;  4U06 A;  5DM7 1;  1U0N D;  4YHH H;  2V9S A;  5EIO C;  2H12 A;  1OTO A;  5B4P A;  3VQ2 A;  4BSU A;  1H7V A;  4DV2 H;  4NZR M;  5CMN A;  4E9J A;  4KXF B;  4PKI G;  3LNL A;  4B8C D;  3ZYJ A;  5GS2 B;  2CR8 A;  5IJB A;  4AR4 A;  4XGO A;  4GS7 D;  5JVH 1;  2XOT A;  1R0G A;  1B2J A;  2UUC H;  5GAH c;  5AWC A;  3LPE B;  4DR5 H;  3C6N B;  4B3T H;  4JYA H;  1WWL A;  4C2B B;  4DR3 H;  3K35 A;  4P8S A;  4LFA H;  4BSR A;  2ZQE A;  3WPG A;  1T9O A;  4J0M A;  4AI3 A;  4JI3 H;  4UFR A;  4DR7 H;  3PIO 1;  3OTO H;  4JI4 H;  1SMW A;  4YWM A;  2IFG A;  4AI1 A;  4LXS A;  2HHH H;  4DUY H;  3ULV A;  3VQ1 A;  3QVD A;  5HZL B;  3GAB A;  2ERJ A;  3DZE A;  4EC5 A;  3QQC E;  5BR8 H;  2C6B A;  2AYJ A;  2K2D A;  1SMU A;  2JI2 A;  3RYG A;  4P91 A;  2Z7X B;  3ZYO A;  2XJV A;  4RXN A;  4DV1 H;  1OWC A;  2HR5 A;  1YV1 A;  5AZ5 A;  5IY0 A;  4G08 A;  1HNZ H;  4UY8 1;  4EZG A;  3RFE A;  2ZIX A;  3CVR A;  4K0K H;  4HQ1 A;  4Z64 C;  1XEC A;  5MF6 A;  1XNQ H;  4QC0 A;  4PQ8 A;  2UXC H;  1NNQ A;  4DV6 H;  4AR5 A;  4LSA A;  4AR6 A;  4LHN A;  1P8T A;  1M10 B;  1RYT A;  3UL8 A;  4NKH A;  1I6U A;  3P2A A;  4AI2 A;  4LHL A;  2V3B B;  4LF6 H;  4WP6 A;  3CIG A;  1RDG A;  2UUB H;  5H1S c;  2C6A A;  3OSS D;  4R6J A;  4LSX C;  2Z81 A;  4ARR A;  2UUA H;  2Z3R B;  1ODH A;  2PYA A;  1M9L A;  4OQT A;  4AQY H;  2OMT A;  2J9U B;  1VZH A;  3WWL A;  4R09 A;  2UZY A;  3OJA B;  3CIY A;  4JI2 H;  3O6N A;  3SS2 A;  2JQD A;  4C2A B;  5HDH A;  1K5G C;  4JI5 H;  1FT8 A;  4R08 A;  3TSR E;  5IWA H;  4CC4 C;  5GS0 A;  2ASS B;  4XSQ A;  4DV3 H;  3OGM B;  4GKK H;  2Z64 A;  3NCV A;  2OMX A;  4B3R H;  3J7Y 1;  2V70 A;  1N34 H;  1FKA H;  4MN8 B;  1FS2 A;  3JB9 j;  1H6T A;  3WN4 A;  4E6Y A;  5A5C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...