4B8CD

Nuclease module of the yeast ccr4-not complex
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
686
structure length
318
Chain Sequence
VNASNPLLHPHLDDPSLLNNPIWKLQLHLAAVSAQSLGQPNIYARQNAMKKYLCTKQALMEMADTLTDSKTAKDDQLWHALDLSNLQIFNISANIFKYDFLTRLYLNGNSLTELPAEIKNLSNLRVLDLSHNRLTSLPAELGSCFQLKYFYFFDNMVTTLPWEFGNLCNLQFLGVEGNPLEKQFLKILTEKSVTGLIFYLRDNRPEIPLPHETLCQHYATPKMYRYTPSWALSWDYRRNKLKEQILSYDSDLLCLQVESKTFEEYWVPTGIFVDGCCIFFLPFTNFTPSFTDVIEVDPEYVSKFIGFPNDKFPSDHIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POLY(A) RIBONUCLEASE POP2
publication title Architecture of the Nuclease Module of the Yeast Ccr4-not Complex: The not1-Caf1-Ccr4 Interaction.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/cell cycle
total genus 68
structure length 318
sequence length 686
chains with identical sequence J, K, L
ec nomenclature ec 3.1.13.4: Poly(A)-specific ribonuclease.
pdb deposition date 2012-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF03372 Exo_endo_phos Endonuclease/Exonuclease/phosphatase family
D PF12799 LRR_4 Leucine Rich repeats (2 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.210 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 4b8cD03
3.30.1370.190 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 4b8cD02
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4b8cD01
1XECA 3OGLB 1D0BA 4FMZA 3ULUA 3WPIA 3OGKB 4LI1A 2OMXA 1QYYA 3TSRE 4AY9X 1A4YA 3VQ1A 4V2EA 4PQ8A 2V9TB 1GWBA 4R58A 3WPEA 2CA6A 1M10B 4G8AA 1O6VA 4P8SA 5GS0A 4LI2A 1O6SA 2P1NB 3WPFA 2JE1A 3ZYJA 2Z82A 2OMZA 4ECOA 3E3ZA 1OTMA 1XWDC 4RCWA 2BEXA 4HQ1A 3C6PB 4CP6A 4I6JB 2P1PB 1OZNA 2O6RA 4UFRA 4KNGA 2WQUA 2A0ZA 4LXRA 4ARRA 2WQWA 1W8AA 3VQ2A 1OOKG 4Q3IA 3E4GA 3WPBA 3W3GA 2P1MB 3C6OB 2R9UA 3ULVA 1M9LA 4CC4C 4Z79A 4BSRA 4GT6A 3C6NB 1K5DC 2Z63A 2O6SA 2UZYA 4Z61C 1OTOA 4IM6A 3RGXA 3WPGA 5AWCA 2WQVA 3UL8A 3W3MA 4CC4A 2JE0A 4YEBB 4RCAB 4Z94G 3RGZA 5B0NA 3M19A 5AWDA 5LFNA 2Z81A 2Z62A 4Z8GA 3OJAA 4J4LA 5GMGA 1XKUA 2RR6A 3JB9j 3WPDA 4AW4A 5HDHA 4FDWA 1Z7XW 1O6TA 5GMFA 3FXIA 4R6AA 4B8CD 4R5DA 3G3BA 4XSQA 1XEUA 1JL5A 4J0MA 2JQDA 2Z66A 4WP6A 5IYXC 5AWAA 4LSXC 3RW6A 4R08A 2ASTB 3RFSA 5CMPA 1U0ND 4PERA 1FQVA 4U08A 4Y61B 3OJAB 4R6FA 2BNHA 4ARNA 5GS2B 2OMUA 3CIYA 4ECNA 4NKGA 4PSJA 2Y5QA 4PEQB 4K17A 3REZA 1P8VA 3W3KA 1OGQA 4LSXA 2FT3A 4Z64C 1OTNA 4R5CA 4RWTC 1SQ0B 3WN4A 4CILA 1IO0A 2Z65A 4U06A 5B0TA 2Z7XA 3SB4A 1PGVA 3RFJA 4CNCA 3W3NA 4U7LA 4V2DA 3ZYIA 4LSCA 3DZEA 5FTTB 4BV4R 4R07A 2V70A 1K5GC 1P9AG 3ZYNA 1H6TA 5AZ5A 4FD0A 2ID5A 3O6NA 3CIGA 2Z64A 2OMTA 3G04C 2UZXA 3P72A 5IJCA 1DS9A 4QXEA 2XWTC 3PMHG 4FCGA 4BSSA 5IJBA 5D3IA 1KOHA 1FT8A 3CVRA 3RFEA 1M9SA 3OGMB 3A79B 3RW7A 4QC0A 4M7EC 5AWBA 4MQWX 3WPCA 1WWLA 4FHOA 2WQXA 2OMYA 2ELLA 4LSAA 5HZLB 4CNMA 4L3AA 5B4PA 2V9SA 4C2AB 2OMVA 4QBZA 2P1OB 2XOTA 3WPHA 4Q62A 4GLPA 3RJ0A 1DFJI 3BZ5A 4KXFB 4H09A 1A9NA 4M7EA 4C2BB 3ZYOA 4R0AA 4FS7A 3O53A 3RIZA 1M0ZA 4R09A 4TZHA 2Q4GW 2P1QB 4LXSA 3KJ4A 3M18A 5A5CA 1XCDA 5GQRK 3UN9A 3G06A 1ZIWA 1DCEA 3ULAA 4R6JA 3W3LA 2OMWA 4P91A 1G9UA 2WFHA 1KOOA 4Q3GA 5GMHA 4WYKA 2O6QA 1LTXA 2ASSB 2IFGA 3E2JA 4OQTA 3W3JA 4PKIG 2RA8A 3UL7A 4L3FA 4EZGA 4NKHA 4MN8B 3G39A 4V2CA 1P8TA 4U09A 5IJDA 4R6GA 5CMNA 1YRGA 3UL9A 1H6UA 3GOZA 1FO1A 3E6JA 2Z7XB 4XOSA 4KT1A 4BSUA 1FS2A 4XGOA 3G3AA
chains in the Genus database with same CATH superfamily
2M6PA 3VPBE 1BRFA 1XECA 4JAEA 1SMUA 2ANNA 2PY9A 1RYQA 1TWHL 3OGLB 1D0BA 5MGNA 2ERSA 4FMZA 3QD7X 4LF8H 4ZN3B 3ULUA 3WPIA 5JEAG 1LKPA 4TPUA 4K0KH 3OGKB 1F0XA 2BE5D 4LI1A 2FFMA 2JEBI 4DR7H 2OMXA 5EINC 3GTLL 1HNXH 1V9NA 2OPUA 3HAXC 2UUCH 3SB1A 1QYYA 3GKUA 3TSRE 4AY9X 3K7AL 3HOVL 3FDJA 4X62H 4X66H 3HKZP 1A4YA 3VQ1A 4BA2I 4V2EA 1J4WA 1MSZA 3U1KA 3WWLA 2UXCH 4PQ8A 2V9TB 3I4ML 2CTLA 3S14L 2PYAA 1S24A 5IYBL 3S2DL 1GWBA 1RWDA 1QQTA 1ZTGA 4R58A 3WPEA 2CA6A 1M10B 3T1HH 4A3ML 2JA6L 2JVZA 4G8AA 1S30A 2WB1P 4DV5H 4BXXL 1O6VA 4AR3A 4P8SA 5GS0A 4DV0H 1ZZIA 4XXBB 5BR8H 1FJGH 2MS3A 4KHPH 4AQYH 4LI2A 2EY4E 3B08B 1O6SA 2P1NB 3WPFA 2G8YA 2D9IA 2NN6G 4B8TA 2JE1A 1PQXA 1OWBA 5MF6A 1IW7D 2K1HA 4BA1I 2FPHX 2O4CA 3ZYJA 5C4XL 2Z82A 2CKAA 3S1ML 2OMZA 5GAGc 4ECOA 4BBRL 3GTJL 3E3ZA 4BY1L 1K1GA 4A3KL 1OTMA 1XWDC 4RCWA 3T1YH 2BEXA 4HQ1A 5JVG1 3S17L 3C6PB 4LHNA 4CP6A 2M4YA 4I6JB 1CAAA 1BQ9A 4WFN1 2P1PB 1J5KA 1ZZJA 1HNZH 4GKKH 1OZNA 1FKAH 2O6RA 2BA0A 4KNGA 4UFRA 5MFZA 3HOXL 2WQUA 2K2DA 2A0ZA 5C0XG 4FJSA 1YK4A 1YV1A 4LXRA 2UXBH 4ARRA 1N33H 2WQWA 3PKJA 1W8AA 3VQ2A 4IFDG 4AR6A 2QNDA 1OOKG 5FJ8L 4AI1A 5RXNA 4Q3IA 1RDVA 2ERJA 2PVXA 4AYBP 2NVTL 4G08A 3E4GA 1IU5A 3WPBA 4NZRM 3W3GA 2E3UA 2PMZP 5GAEc 2P1MB 1BQ8A 4GS7D 8RXNA 2B5ID 1I50L 2E2HL 4AHXA 1KHMA 4BY7L 3PWFA 1SMMA 3C6OB 4A3FL 3P8BA 2ZM6H 3GTML 5C44L 3WWNB 4A3GL 2R9UA 3ULVA 1M9LA 2V0EA 2V0FA 5M5YL 4CC4C 1BFYA 4Z79A 2JI3A 2HR5A 3ZG6A 4DUYH 3LWOB 4BSRA 1B71A 4GT6A 1RB9A 1S2ZA 3C6NB 2UXDH 3HOYL 1K5DC 1NXEA 5M3ML 2BL5A 2AQCA 5IT9W 1JYBA 2Z63A 3FAUA 5MLC3 4B3TH 3QVDA 4A93L 2PPTA 2O6SA 2UZYA 4Z61C 3GABA 2P2RA 1VBIA 3NFPI 3AEVB 1OTOA 4RXNA 4AI3A 1DVBA 3S1RL 2HHHH 3HJYB 4IM6A 3RGXA 2A6ED 4OD6A 3RYGA 3WPGA 5AWCA 3S2HL 1I6HL 4K9FA 3GTQL 3KDKA 2R93L 1I94H 2WQVA 4OO1G 3UL8A 2JE6I 1R0IA 3K35A 1I3QL 1BE7A 5IY0A 2ZIXA 3W3MA 4UY81 4Y7NL 4DR4H 3V69A 1EC6A 4CC4A 1Z2IA 2JE0A 1TWGL 1LTLA 3SS2A 3KYXA 4YEBB 3LWPB 4JI2H 1IU6A 2JI1A 5FLXW 2RDVA 3RZOL 4RCAB 1K83L 4A3JL 3MSUA 4Z94G 1VCXA 5B0NA 1V8CA 4QIWP 3RGZA 2CPQA 4AR4A 2XJVA 2L0ZA 4JI4H 1LKMA 3M19A 5IWAH 5LFNA 5AWDA 2A68D 2Z81A 2QL0A 1ZRPA 2Z62A 3OJAA 4J4LA 4TVMA 4JVHA 1XKUA 4AI0A 2RR6A 4Z8GA 5GMGA 3WPDA 5AN9H 3JB9j 1RYTA 4AW4A 5HDHA 1FHMA 4FDWA 1X9ZA 1T9PA 2V3BB 1S20A 1Z7XW 1NXGA 2VQEH 5LMNH 3J80W 4PDBA 2M4VA 1Y1WL 1R0HA 1DX8A 1Z92B 4POFA 3MPSA 3HOUL 5EIOC 4EC5A 1YUZA 4X65H 1O6TA 5GMFA 3FXIA 4R6AA 4B8CD 4R5DA 1Y1VL 3G3BA 4XSQA 1NXUA 2JA7L 2AXYA 1XEUA 3J7Y1 1JL5A 4J0MA 2JQDA 3CQZL 2Z66A 2JA8L 4JVYA 5LMUH 1R0JA 5M5XL 2VKCA 4WP6A 3S1QL 5IYXC 5AWAA 2YU9L 3UOEA 4LSXC 3RW6A 4R08A 2R92L 4NBQA 2Z3QB 2ASTB 3RFSA 3H3VM 5CMPA 4X6AL 3H99A 1U0ND 4PERA 2WAQP 3QQCE 1FQVA 1YUXA 4U08A 4Y61B 1N36H 3OJAB 2CWHA 1XMOH 1C09A 1H7VA 2LTMA 2JA5L 5AI2A 4H8AA 4JV5H 4R6FA 2BNHA 4LF4H 4A3CL 5A2QW 4ARNA 2J9UB 5GS2B 2DSXA 2OMUA 4C3IL 3OSSD 2XJQA 2C6AA 6RXNA 2A6HD 3CIYA 4ECNA 3B0AB 5AI3A 4NKGA 2A1SA 2JEAI 4PSJA 1ODHA 2Y5QA 1WCML 2Y0SP 4DV3H 5M3FL 4PEQB 4E6YA 4A3LL 3RZTA 4K17A 2A69D 3REZA 1P8VA 3GTKL 1PZXA 2APOB 3W3KA 1OGQA 4LSXA 4JI3H 1TUAA 2FT3A 4Z64C 1YK5A 4V196 2LTLA 2R7ZL 1TWFL 4DR1H 1OTNA 3S16L 4R5CA 3PL5A 1VZHA 1WJVA 1DTJA 4RWTC 1SQ0B 1IBKH 4C3JL 2CR8A 3A44A 2PVEA 3H9CA 3JR7A 3WN4A 3I0PA 4CILA 1IO0A 4A3EL 1TWCL 2Z65A 1B13A 2O5JD 4JI5H 1VZIA 2PT7G 4U06A 1I6UA 5B0TA 2Z7XA 3SB4A 1PGVA 1T9QA 2CTFA 4LF9H 2M6OA 1FHHA 1X4MA 3RFJA 4CNCA 3W3NA 4U7LA 2XJRA 3G3AA 1VZGA 5IP9L 3HOZL 4ZN1B 2UU9H 4V2DA 4JAGA 1SEIA 2XJPA 3ZYIA 3PZAA 4LSCA 3DZEA 5FTTB 4BV4R 4R07A 2V70A 1K5GC 3M3YL 2PQUA 1P9AG 1IROA 3ZYNA 2AUSB 1H6TA 4OCHA 5AZ5A 2M6QA 2VQFH 4FD0A 2ID5A 4B3SH 1QYBA 1IBMH 4GKJH 3O6NA 5K2ME 3CIGA 2Z64A 2VL6A 1HNWH 2OMTA 3G04C 2UZXA 4XGHA 3P72A 1R0FA 5IJCA 1DS9A 5M5WL 3LNLA 4QXEA 2XWTC 3PMHG 2Z3RB 1WTJA 4JI8H 4JI1H 3S15L 3GTPL 1N32H 4FCGA 4BSSA 5IJBA 1UG8A 3PIO1 1VIGA 2CTMA 5D3IA 1KOHA 1FT8A 2XJSA 3CVRA 1R9TL 3RFEA 1XMQH 2YQRA 1M9SA 3EZJA 3OGMB 5DM71 3A79B 2UUAH 4JADA 1IBLH 3RW7A 4QC0A 1PFYA 2Z0SA 4BBSL 3KDGA 2ZQEA 2OPVA 1F4LA 4M7EC 4AHYA 5IYDL 2NVQL 5AWBA 2LCQA 2E5LH 4AM3A 4MQWX 3PKIA 1WWLA 3WPCA 1QCVA 4FHOA 2WQXA 3LPEB 3IU3I 3PIP1 1WHRA 1TWAL 1HR0H 2OMYA 2ELLA 4LSAA 5HZLB 2E2JL 3NCVA 4NZTM 4DV4H 4LF6H 4CNMA 4L3AA 3GR5A 3GTOL 1PFVA 4E9JA 2V9SA 4JI7H 1T9OA 5B4PA 5C4JL 2OMVA 4C2AB 2DGRA 4QBZA 4YWMA 3KYUA 2CPMA 1J5EH 1B2OA 4DUZH 4DR3H 2P1OB 1DT4A 5IP7L 2XOTA 2X06A 3WPHA 3S1NL 1VIHA 2B63L 4U671 1P7PA 4LFAH 3KYYA 2NVYL 4Q62A 4GLPA 3J7AK 1RDGA 3RJ0A 3H9BA 2H12A 4NXNH 1DFJI 2UUBH 4DR6H 2MJHA 3BZ5A 4FJUA 3I4NL 4KXFB 4JYAH 1PFUA 4H09A 5DT9A 5GADc 1A9NA 1E8JA 4M7EA 5IYCL 2HH3A 4YWLA 4DV1H 4DR2H 4C2BB 1SMWA 4AI2A 5MFPA 2XJTA 3OETA 3ZYOA 4R0AA 4FS7A 3KYWA 5K36G 3H97A 1WE8A 3LWQB 3RZ6A 3PO3L 1X4NA 3O53A 3RIZA 1M0ZA 4R09A 4LF5H 4TZHA 4LFBH 1NNQA 2RFKB 2Q4GW 2P1QB 4LXSA 2CTEA 4AHWA 4POGA 4LF7H 3KYVA 2CTKA 1XRHA 4ME3A 3J7Z1 3KJ4A 2LF0A 4B3RH 3HOWL 2HH2A 4YY3H 4B3MH 3M18A 5LL6b 2F4VH 4NXMH 4X64H 5A5CA 2JI2A 2CKCA 1XCDA 5GQRK 3UN9A 2ANRA 3G06A 1ZIWA 3RF2A 4DV6H 1IRNA 2JZXA 5JVH1 2C6BA 1DCEA 1R0GA 3ULAA 4A3DL 2GMGA 5H1Sc 2FMRA 4R6JA 3W3LA 2OMWA 5C3EL 4P91A 2E2IL 1G9UA 4AHZA 2WFHA 1KOOA 4G6BA 4Q3GA 4LIJA 1OWCA 4JI6H 4C3HL 1SFOL 2CWFA 5GMHA 5GAHc 4WYKA 1LKOA 2HVYC 3L7ZC 4QMFB 3LWRB 2O6QA 4AIMA 4DV2H 1B2JA 2NVXL 1N34H 2KN9A 5DM61 1WVNA 1LTXA 2AYJA 2M8WA 2ASSB 2IFGA 3E2JA 2XJUA 4OQTA 3W3JA 4PKIG 1AN7A 1XNQH 3P2AA 4A3IL 4YHHH 2RA8A 3UL7A 2LRRA 4JAFA 4L3FA 4EZGA 4NKHA 4LFCH 4MN8B 4JI0H 3G39A 3FKIL 2VUML 2KKDA 3OTOH 1S03G 4WALA 4Y52L 4V2CA 1P8TA 4U09A 1CADA 4C2M1 4WANA 4R6GA 3PO2L 5IJDA 5CMNA 2PSMC 1YRGA 3UL9A 2Y3MA 4LHLA 3JAMW 1X0AA 4AR5A 5FLML 2CTJA 1H6UA 3GOZA 1FO1A 1ZZKA 4DR5H 3GTGL 3E6JA 2Z7XB 4XOSA 3M4OL 3VKEA 3H0GL 4DV7H 3J81W 4OX9H 3LWVB 3MQKB 1PFWA 7RXNA 2NYDA 4KT1A 4BSUA 4A3BL 3RZDL 3HJWB 1FS2A 4XGOA 2JA9A 1XNRH
chains in the Genus database with same CATH topology
2M6PA 3VPBE 1BRFA 1XECA 4JAEA 1SMUA 1RYQA 3OGLB 1D0BA 5MGNA 2ERSA 4FMZA 3QD7X 4LF8H 4ZN3B 3ULUA 3WPIA 3OGKB 1LKPA 4TPUA 4K0KH 1F0XA 2BE5D 4LI1A 4DR7H 2OMXA 5EINC 1HNXH 2UUCH 3SB1A 1QYYA 3TSRE 4AY9X 4X62H 4X66H 1A4YA 3VQ1A 4V2EA 3WWLA 2UXCH 4PQ8A 2V9TB 2PYAA 1S24A 1GWBA 1RWDA 4R58A 3WPEA 2CA6A 1M10B 3T1HH 4G8AA 1S30A 4DV5H 1O6VA 4AR3A 4P8SA 5GS0A 4DV0H 4XXBB 5BR8H 1FJGH 2MS3A 4KHPH 4AQYH 4LI2A 3B08B 1O6SA 2P1NB 3WPFA 2D9IA 2JE1A 1OWBA 5MF6A 1IW7D 2FPHX 2O4CA 3ZYJA 2Z82A 2CKAA 2OMZA 5GAGc 4ECOA 3E3ZA 1OTMA 1XWDC 4RCWA 3T1YH 2BEXA 4HQ1A 5JVG1 3C6PB 4LHNA 4CP6A 2M4YA 4I6JB 1CAAA 1BQ9A 4WFN1 2P1PB 1HNZH 4GKKH 1OZNA 1FKAH 2O6RA 4UFRA 4KNGA 5MFZA 2WQUA 2K2DA 2A0ZA 1YK4A 1YV1A 4LXRA 2UXBH 4ARRA 1N33H 2WQWA 3PKJA 1W8AA 3VQ2A 4AR6A 1OOKG 4AI1A 5RXNA 4Q3IA 1RDVA 2ERJA 2PVXA 4G08A 3E4GA 1IU5A 3WPBA 4NZRM 3W3GA 5GAEc 2P1MB 1BQ8A 4GS7D 8RXNA 2B5ID 4AHXA 3C6OB 3PWFA 1SMMA 3P8BA 2ZM6H 3WWNB 2R9UA 3ULVA 1M9LA 2V0EA 2V0FA 4CC4C 1BFYA 4Z79A 2JI3A 2HR5A 3ZG6A 4DUYH 4BSRA 1B71A 4GT6A 1RB9A 1S2ZA 3C6NB 2UXDH 1K5DC 1NXEA 5IT9W 1JYBA 2Z63A 3FAUA 5MLC3 3QVDA 2PPTA 2O6SA 2UZYA 4Z61C 3GABA 3NFPI 1OTOA 4RXNA 4AI3A 1DVBA 2HHHH 4IM6A 3RGXA 2A6ED 4OD6A 3RYGA 3WPGA 5AWCA 4K9FA 3KDKA 1I94H 2WQVA 3UL8A 1R0IA 3K35A 1BE7A 5IY0A 2ZIXA 3W3MA 4UY81 4DR4H 4CC4A 2JE0A 1LTLA 3SS2A 3KYXA 4YEBB 4JI2H 1IU6A 2JI1A 5FLXW 2RDVA 4RCAB 3MSUA 4Z94G 1VCXA 5B0NA 3RGZA 4AR4A 2XJVA 2L0ZA 4JI4H 1LKMA 3M19A 5IWAH 5LFNA 5AWDA 2A68D 2Z81A 2QL0A 1ZRPA 2Z62A 3OJAA 4J4LA 4TVMA 1XKUA 2RR6A 4AI0A 4Z8GA 5GMGA 3JB9j 3WPDA 5AN9H 1RYTA 4AW4A 5HDHA 1FHMA 4FDWA 1X9ZA 1T9PA 2V3BB 1Z7XW 1NXGA 2VQEH 5LMNH 3J80W 4PDBA 2M4VA 1R0HA 1DX8A 1Z92B 4POFA 3MPSA 4EC5A 5EIOC 4X65H 1YUZA 1O6TA 5GMFA 3FXIA 4R6AA 4B8CD 4R5DA 3G3BA 4XSQA 1XEUA 3J7Y1 1JL5A 4J0MA 2JQDA 2Z66A 5LMUH 1R0JA 2VKCA 4WP6A 5IYXC 5AWAA 4LSXC 3RW6A 4R08A 2Z3QB 2ASTB 3RFSA 5CMPA 1U0ND 4PERA 1FQVA 3QQCE 1YUXA 4U08A 4Y61B 1N36H 3OJAB 1XMOH 1C09A 1H7VA 5AI2A 4JV5H 4R6FA 2BNHA 4LF4H 5A2QW 4ARNA 2J9UB 5GS2B 2DSXA 2OMUA 3OSSD 2XJQA 2C6AA 6RXNA 2A6HD 3CIYA 4ECNA 3B0AB 5AI3A 4NKGA 4PSJA 1ODHA 2Y5QA 4DV3H 4PEQB 4E6YA 4K17A 3RZTA 2A69D 3REZA 1P8VA 3W3KA 1OGQA 4LSXA 4JI3H 2FT3A 4Z64C 1YK5A 4V196 4DR1H 1OTNA 4R5CA 1VZHA 1WJVA 4RWTC 1SQ0B 1IBKH 2CR8A 3A44A 2PVEA 3WN4A 4CILA 1IO0A 2Z65A 1B13A 2O5JD 4JI5H 1VZIA 2PT7G 4U06A 1I6UA 5B0TA 2Z7XA 3SB4A 1PGVA 1T9QA 4LF9H 2M6OA 1FHHA 3RFJA 4CNCA 3W3NA 4U7LA 2XJRA 3G3AA 1VZGA 4ZN1B 2UU9H 4V2DA 4JAGA 1SEIA 2XJPA 3ZYIA 3PZAA 4LSCA 3DZEA 5FTTB 4BV4R 4R07A 2V70A 1K5GC 1P9AG 1IROA 3ZYNA 1H6TA 4OCHA 5AZ5A 2VQFH 4FD0A 2ID5A 4B3SH 1QYBA 1IBMH 4GKJH 3O6NA 5K2ME 3CIGA 2Z64A 2VL6A 1HNWH 2OMTA 3G04C 2UZXA 4XGHA 3P72A 1R0FA 5IJCA 1DS9A 3LNLA 4QXEA 2XWTC 3PMHG 2Z3RB 4JI8H 4JI1H 1N32H 4FCGA 4BSSA 5IJBA 3PIO1 5D3IA 1KOHA 1FT8A 2XJSA 3CVRA 3RFEA 1XMQH 1M9SA 3EZJA 3OGMB 5DM71 3A79B 2UUAH 4JADA 1IBLH 3RW7A 4QC0A 3KDGA 2ZQEA 4M7EC 4AHYA 5AWBA 2LCQA 2E5LH 4MQWX 3WPCA 3PKIA 1WWLA 1QCVA 4FHOA 2WQXA 3LPEB 3IU3I 3PIP1 1HR0H 2OMYA 2ELLA 4LSAA 5HZLB 3NCVA 4CNMA 4NZTM 4DV4H 4LF6H 4L3AA 3GR5A 4E9JA 2V9SA 5B4PA 4JI7H 1T9OA 4C2AB 2OMVA 4QBZA 4YWMA 3KYUA 1J5EH 1B2OA 4DUZH 4DR3H 2P1OB 2XOTA 3WPHA 4U671 4LFAH 3KYYA 4Q62A 4GLPA 3J7AK 1RDGA 3RJ0A 2H12A 4NXNH 1DFJI 2UUBH 4DR6H 3BZ5A 4KXFB 4JYAH 4H09A 5DT9A 5GADc 1A9NA 1E8JA 4M7EA 4C2BB 4YWLA 4DV1H 4DR2H 1SMWA 4AI2A 5MFPA 2XJTA 3OETA 3ZYOA 4R0AA 4FS7A 3KYWA 3RZ6A 3O53A 3RIZA 1M0ZA 4R09A 4LF5H 4TZHA 4LFBH 1NNQA 2Q4GW 2P1QB 4LXSA 4AHWA 4POGA 4LF7H 3KYVA 4ME3A 3J7Z1 3KJ4A 2LF0A 4B3RH 4YY3H 4B3MH 3M18A 5LL6b 2F4VH 4NXMH 4X64H 5A5CA 2JI2A 2CKCA 1XCDA 5GQRK 3UN9A 3G06A 1ZIWA 3RF2A 4DV6H 1IRNA 5JVH1 2C6BA 1DCEA 1R0GA 3ULAA 2GMGA 5H1Sc 4R6JA 3W3LA 2OMWA 4P91A 1G9UA 4AHZA 2WFHA 1KOOA 4G6BA 4Q3GA 1OWCA 4JI6H 5GMHA 5GAHc 4WYKA 1LKOA 2O6QA 4DV2H 1B2JA 1N34H 2KN9A 5DM61 1LTXA 2ASSB 2AYJA 2IFGA 3E2JA 4OQTA 2XJUA 3W3JA 4PKIG 1AN7A 1XNQH 3P2AA 4YHHH 2RA8A 3UL7A 4JAFA 4L3FA 4EZGA 4NKHA 4LFCH 4MN8B 4JI0H 3G39A 2KKDA 3OTOH 1S03G 4V2CA 1P8TA 4U09A 1CADA 5IJDA 4R6GA 5CMNA 2PSMC 1YRGA 3UL9A 2Y3MA 4LHLA 3JAMW 4AR5A 1H6UA 3GOZA 1FO1A 4DR5H 3E6JA 2Z7XB 4XOSA 4DV7H 3J81W 4OX9H 7RXNA 2NYDA 4KT1A 4BSUA 1FS2A 4XGOA 4B3TH 1XNRH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XEC A;  3OGL B;  1D0B A;  4FMZ A;  3ULU A;  3WPI A;  3OGK B;  4LI1 A;  2OMX A;  1QYY A;  3TSR E;  4AY9 X;  1A4Y A;  3VQ1 A;  4V2E A;  4PQ8 A;  2V9T B;  1GWB A;  4R58 A;  3WPE A;  2CA6 A;  1M10 B;  4G8A A;  1O6V A;  4P8S A;  5GS0 A;  4LI2 A;  1O6S A;  2P1N B;  3WPF A;  2JE1 A;  3ZYJ A;  2Z82 A;  2OMZ A;  4ECO A;  3E3Z A;  1OTM A;  1XWD C;  4RCW A;  2BEX A;  4HQ1 A;  3C6P B;  4CP6 A;  4I6J B;  2P1P B;  1OZN A;  2O6R A;  4UFR A;  4KNG A;  2WQU A;  2A0Z A;  4LXR A;  4ARR A;  2WQW A;  1W8A A;  3VQ2 A;  1OOK G;  4Q3I A;  3E4G A;  3WPB A;  3W3G A;  2P1M B;  3C6O B;  2R9U A;  3ULV A;  1M9L A;  4CC4 C;  4Z79 A;  4BSR A;  4GT6 A;  3C6N B;  1K5D C;  2Z63 A;  2O6S A;  2UZY A;  4Z61 C;  1OTO A;  4IM6 A;  3RGX A;  3WPG A;  5AWC A;  2WQV A;  3UL8 A;  3W3M A;  4CC4 A;  2JE0 A;  4YEB B;  4RCA B;  4Z94 G;  3RGZ A;  5B0N A;  3M19 A;  5AWD A;  5LFN A;  2Z81 A;  2Z62 A;  4Z8G A;  3OJA A;  4J4L A;  5GMG A;  1XKU A;  2RR6 A;  3JB9 j;  3WPD A;  4AW4 A;  5HDH A;  4FDW A;  1Z7X W;  1O6T A;  5GMF A;  3FXI A;  4R6A A;  4B8C D;  4R5D A;  3G3B A;  4XSQ A;  1XEU A;  1JL5 A;  4J0M A;  2JQD A;  2Z66 A;  4WP6 A;  5IYX C;  5AWA A;  4LSX C;  3RW6 A;  4R08 A;  2AST B;  3RFS A;  5CMP A;  1U0N D;  4PER A;  1FQV A;  4U08 A;  4Y61 B;  3OJA B;  4R6F A;  2BNH A;  4ARN A;  5GS2 B;  2OMU A;  3CIY A;  4ECN A;  4NKG A;  4PSJ A;  2Y5Q A;  4PEQ B;  4K17 A;  3REZ A;  1P8V A;  3W3K A;  1OGQ A;  4LSX A;  2FT3 A;  4Z64 C;  1OTN A;  4R5C A;  4RWT C;  1SQ0 B;  3WN4 A;  4CIL A;  1IO0 A;  2Z65 A;  4U06 A;  5B0T A;  2Z7X A;  3SB4 A;  1PGV A;  3RFJ A;  4CNC A;  3W3N A;  4U7L A;  4V2D A;  3ZYI A;  4LSC A;  3DZE A;  5FTT B;  4BV4 R;  4R07 A;  2V70 A;  1K5G C;  1P9A G;  3ZYN A;  1H6T A;  5AZ5 A;  4FD0 A;  2ID5 A;  3O6N A;  3CIG A;  2Z64 A;  2OMT A;  3G04 C;  2UZX A;  3P72 A;  5IJC A;  1DS9 A;  4QXE A;  2XWT C;  3PMH G;  4FCG A;  4BSS A;  5IJB A;  5D3I A;  1KOH A;  1FT8 A;  3CVR A;  3RFE A;  1M9S A;  3OGM B;  3A79 B;  3RW7 A;  4QC0 A;  4M7E C;  5AWB A;  4MQW X;  3WPC A;  1WWL A;  4FHO A;  2WQX A;  2OMY A;  2ELL A;  4LSA A;  5HZL B;  4CNM A;  4L3A A;  5B4P A;  2V9S A;  4C2A B;  2OMV A;  4QBZ A;  2P1O B;  2XOT A;  3WPH A;  4Q62 A;  4GLP A;  3RJ0 A;  1DFJ I;  3BZ5 A;  4KXF B;  4H09 A;  1A9N A;  4M7E A;  4C2B B;  3ZYO A;  4R0A A;  4FS7 A;  3O53 A;  3RIZ A;  1M0Z A;  4R09 A;  4TZH A;  2Q4G W;  2P1Q B;  4LXS A;  3KJ4 A;  3M18 A;  5A5C A;  1XCD A;  5GQR K;  3UN9 A;  3G06 A;  1ZIW A;  1DCE A;  3ULA A;  4R6J A;  3W3L A;  2OMW A;  4P91 A;  1G9U A;  2WFH A;  1KOO A;  4Q3G A;  5GMH A;  4WYK A;  2O6Q A;  1LTX A;  2ASS B;  2IFG A;  3E2J A;  4OQT A;  3W3J A;  4PKI G;  2RA8 A;  3UL7 A;  4L3F A;  4EZG A;  4NKH A;  4MN8 B;  3G39 A;  4V2C A;  1P8T A;  4U09 A;  5IJD A;  4R6G A;  5CMN A;  1YRG A;  3UL9 A;  1H6U A;  3GOZ A;  1FO1 A;  3E6J A;  2Z7X B;  4XOS A;  4KT1 A;  4BSU A;  1FS2 A;  4XGO A;  3G3A A; 
#chains in the Genus database with same CATH topology
 2M6P A;  3VPB E;  1BRF A;  1XEC A;  4JAE A;  1SMU A;  2ANN A;  2PY9 A;  1RYQ A;  1TWH L;  3OGL B;  1D0B A;  5MGN A;  2ERS A;  4FMZ A;  3QD7 X;  4LF8 H;  4ZN3 B;  3ULU A;  3WPI A;  5JEA G;  1LKP A;  4TPU A;  4K0K H;  3OGK B;  1F0X A;  2BE5 D;  4LI1 A;  2FFM A;  2JEB I;  4DR7 H;  2OMX A;  5EIN C;  3GTL L;  1HNX H;  1V9N A;  2OPU A;  3HAX C;  2UUC H;  3SB1 A;  1QYY A;  3GKU A;  3TSR E;  4AY9 X;  3K7A L;  3HOV L;  3FDJ A;  4X62 H;  4X66 H;  3HKZ P;  1A4Y A;  3VQ1 A;  4BA2 I;  4V2E A;  1J4W A;  1MSZ A;  3U1K A;  3WWL A;  2UXC H;  4PQ8 A;  2V9T B;  3I4M L;  2CTL A;  3S14 L;  2PYA A;  1S24 A;  5IYB L;  3S2D L;  1GWB A;  1RWD A;  1QQT A;  1ZTG A;  4R58 A;  3WPE A;  2CA6 A;  1M10 B;  3T1H H;  4A3M L;  2JA6 L;  2JVZ A;  4G8A A;  1S30 A;  2WB1 P;  4DV5 H;  4BXX L;  1O6V A;  4AR3 A;  4P8S A;  5GS0 A;  4DV0 H;  1ZZI A;  4XXB B;  5BR8 H;  1FJG H;  2MS3 A;  4KHP H;  4AQY H;  4LI2 A;  2EY4 E;  3B08 B;  1O6S A;  2P1N B;  3WPF A;  2G8Y A;  2D9I A;  2NN6 G;  4B8T A;  2JE1 A;  1PQX A;  1OWB A;  5MF6 A;  1IW7 D;  2K1H A;  4BA1 I;  2FPH X;  2O4C A;  3ZYJ A;  5C4X L;  2Z82 A;  2CKA A;  3S1M L;  2OMZ A;  5GAG c;  4ECO A;  4BBR L;  3GTJ L;  3E3Z A;  4BY1 L;  1K1G A;  4A3K L;  1OTM A;  1XWD C;  4RCW A;  3T1Y H;  2BEX A;  4HQ1 A;  5JVG 1;  3S17 L;  3C6P B;  4LHN A;  4CP6 A;  2M4Y A;  4I6J B;  1CAA A;  1BQ9 A;  4WFN 1;  2P1P B;  1J5K A;  1ZZJ A;  1HNZ H;  4GKK H;  1OZN A;  1FKA H;  2O6R A;  2BA0 A;  4KNG A;  4UFR A;  5MFZ A;  3HOX L;  2WQU A;  2K2D A;  2A0Z A;  5C0X G;  4FJS A;  1YK4 A;  1YV1 A;  4LXR A;  2UXB H;  4ARR A;  1N33 H;  2WQW A;  3PKJ A;  1W8A A;  3VQ2 A;  4IFD G;  4AR6 A;  2QND A;  1OOK G;  5FJ8 L;  4AI1 A;  5RXN A;  4Q3I A;  1RDV A;  2ERJ A;  2PVX A;  4AYB P;  2NVT L;  4G08 A;  3E4G A;  1IU5 A;  3WPB A;  4NZR M;  3W3G A;  2E3U A;  2PMZ P;  5GAE c;  2P1M B;  1BQ8 A;  4GS7 D;  8RXN A;  2B5I D;  1I50 L;  2E2H L;  4AHX A;  1KHM A;  4BY7 L;  3PWF A;  1SMM A;  3C6O B;  4A3F L;  3P8B A;  2ZM6 H;  3GTM L;  5C44 L;  3WWN B;  4A3G L;  2R9U A;  3ULV A;  1M9L A;  2V0E A;  2V0F A;  5M5Y L;  4CC4 C;  1BFY A;  4Z79 A;  2JI3 A;  2HR5 A;  3ZG6 A;  4DUY H;  3LWO B;  4BSR A;  1B71 A;  4GT6 A;  1RB9 A;  1S2Z A;  3C6N B;  2UXD H;  3HOY L;  1K5D C;  1NXE A;  5M3M L;  2BL5 A;  2AQC A;  5IT9 W;  1JYB A;  2Z63 A;  3FAU A;  5MLC 3;  4B3T H;  3QVD A;  4A93 L;  2PPT A;  2O6S A;  2UZY A;  4Z61 C;  3GAB A;  2P2R A;  1VBI A;  3NFP I;  3AEV B;  1OTO A;  4RXN A;  4AI3 A;  1DVB A;  3S1R L;  2HHH H;  3HJY B;  4IM6 A;  3RGX A;  2A6E D;  4OD6 A;  3RYG A;  3WPG A;  5AWC A;  3S2H L;  1I6H L;  4K9F A;  3GTQ L;  3KDK A;  2R93 L;  1I94 H;  2WQV A;  4OO1 G;  3UL8 A;  2JE6 I;  1R0I A;  3K35 A;  1I3Q L;  1BE7 A;  5IY0 A;  2ZIX A;  3W3M A;  4UY8 1;  4Y7N L;  4DR4 H;  3V69 A;  1EC6 A;  4CC4 A;  1Z2I A;  2JE0 A;  1TWG L;  1LTL A;  3SS2 A;  3KYX A;  4YEB B;  3LWP B;  4JI2 H;  1IU6 A;  2JI1 A;  5FLX W;  2RDV A;  3RZO L;  4RCA B;  1K83 L;  4A3J L;  3MSU A;  4Z94 G;  1VCX A;  5B0N A;  1V8C A;  4QIW P;  3RGZ A;  2CPQ A;  4AR4 A;  2XJV A;  2L0Z A;  4JI4 H;  1LKM A;  3M19 A;  5IWA H;  5LFN A;  5AWD A;  2A68 D;  2Z81 A;  2QL0 A;  1ZRP A;  2Z62 A;  3OJA A;  4J4L A;  4TVM A;  4JVH A;  1XKU A;  4AI0 A;  2RR6 A;  4Z8G A;  5GMG A;  3WPD A;  5AN9 H;  3JB9 j;  1RYT A;  4AW4 A;  5HDH A;  1FHM A;  4FDW A;  1X9Z A;  1T9P A;  2V3B B;  1S20 A;  1Z7X W;  1NXG A;  2VQE H;  5LMN H;  3J80 W;  4PDB A;  2M4V A;  1Y1W L;  1R0H A;  1DX8 A;  1Z92 B;  4POF A;  3MPS A;  3HOU L;  5EIO C;  4EC5 A;  1YUZ A;  4X65 H;  1O6T A;  5GMF A;  3FXI A;  4R6A A;  4B8C D;  4R5D A;  1Y1V L;  3G3B A;  4XSQ A;  1NXU A;  2JA7 L;  2AXY A;  1XEU A;  3J7Y 1;  1JL5 A;  4J0M A;  2JQD A;  3CQZ L;  2Z66 A;  2JA8 L;  4JVY A;  5LMU H;  1R0J A;  5M5X L;  2VKC A;  4WP6 A;  3S1Q L;  5IYX C;  5AWA A;  2YU9 L;  3UOE A;  4LSX C;  3RW6 A;  4R08 A;  2R92 L;  4NBQ A;  2Z3Q B;  2AST B;  3RFS A;  3H3V M;  5CMP A;  4X6A L;  3H99 A;  1U0N D;  4PER A;  2WAQ P;  3QQC E;  1FQV A;  1YUX A;  4U08 A;  4Y61 B;  1N36 H;  3OJA B;  2CWH A;  1XMO H;  1C09 A;  1H7V A;  2LTM A;  2JA5 L;  5AI2 A;  4H8A A;  4JV5 H;  4R6F A;  2BNH A;  4LF4 H;  4A3C L;  5A2Q W;  4ARN A;  2J9U B;  5GS2 B;  2DSX A;  2OMU A;  4C3I L;  3OSS D;  2XJQ A;  2C6A A;  6RXN A;  2A6H D;  3CIY A;  4ECN A;  3B0A B;  5AI3 A;  4NKG A;  2A1S A;  2JEA I;  4PSJ A;  1ODH A;  2Y5Q A;  1WCM L;  2Y0S P;  4DV3 H;  5M3F L;  4PEQ B;  4E6Y A;  4A3L L;  3RZT A;  4K17 A;  2A69 D;  3REZ A;  1P8V A;  3GTK L;  1PZX A;  2APO B;  3W3K A;  1OGQ A;  4LSX A;  4JI3 H;  1TUA A;  2FT3 A;  4Z64 C;  1YK5 A;  4V19 6;  2LTL A;  2R7Z L;  1TWF L;  4DR1 H;  1OTN A;  3S16 L;  4R5C A;  3PL5 A;  1VZH A;  1WJV A;  1DTJ A;  4RWT C;  1SQ0 B;  1IBK H;  4C3J L;  2CR8 A;  3A44 A;  2PVE A;  3H9C A;  3JR7 A;  3WN4 A;  3I0P A;  4CIL A;  1IO0 A;  4A3E L;  1TWC L;  2Z65 A;  1B13 A;  2O5J D;  4JI5 H;  1VZI A;  2PT7 G;  4U06 A;  1I6U A;  5B0T A;  2Z7X A;  3SB4 A;  1PGV A;  1T9Q A;  2CTF A;  4LF9 H;  2M6O A;  1FHH A;  1X4M A;  3RFJ A;  4CNC A;  3W3N A;  4U7L A;  2XJR A;  3G3A A;  1VZG A;  5IP9 L;  3HOZ L;  4ZN1 B;  2UU9 H;  4V2D A;  4JAG A;  1SEI A;  2XJP A;  3ZYI A;  3PZA A;  4LSC A;  3DZE A;  5FTT B;  4BV4 R;  4R07 A;  2V70 A;  1K5G C;  3M3Y L;  2PQU A;  1P9A G;  1IRO A;  3ZYN A;  2AUS B;  1H6T A;  4OCH A;  5AZ5 A;  2M6Q A;  2VQF H;  4FD0 A;  2ID5 A;  4B3S H;  1QYB A;  1IBM H;  4GKJ H;  3O6N A;  5K2M E;  3CIG A;  2Z64 A;  2VL6 A;  1HNW H;  2OMT A;  3G04 C;  2UZX A;  4XGH A;  3P72 A;  1R0F A;  5IJC A;  1DS9 A;  5M5W L;  3LNL A;  4QXE A;  2XWT C;  3PMH G;  2Z3R B;  1WTJ A;  4JI8 H;  4JI1 H;  3S15 L;  3GTP L;  1N32 H;  4FCG A;  4BSS A;  5IJB A;  1UG8 A;  3PIO 1;  1VIG A;  2CTM A;  5D3I A;  1KOH A;  1FT8 A;  2XJS A;  3CVR A;  1R9T L;  3RFE A;  1XMQ H;  2YQR A;  1M9S A;  3EZJ A;  3OGM B;  5DM7 1;  3A79 B;  2UUA H;  4JAD A;  1IBL H;  3RW7 A;  4QC0 A;  1PFY A;  2Z0S A;  4BBS L;  3KDG A;  2ZQE A;  2OPV A;  1F4L A;  4M7E C;  4AHY A;  5IYD L;  2NVQ L;  5AWB A;  2LCQ A;  2E5L H;  4AM3 A;  4MQW X;  3PKI A;  1WWL A;  3WPC A;  1QCV A;  4FHO A;  2WQX A;  3LPE B;  3IU3 I;  3PIP 1;  1WHR A;  1TWA L;  1HR0 H;  2OMY A;  2ELL A;  4LSA A;  5HZL B;  2E2J L;  3NCV A;  4NZT M;  4DV4 H;  4LF6 H;  4CNM A;  4L3A A;  3GR5 A;  3GTO L;  1PFV A;  4E9J A;  2V9S A;  4JI7 H;  1T9O A;  5B4P A;  5C4J L;  2OMV A;  4C2A B;  2DGR A;  4QBZ A;  4YWM A;  3KYU A;  2CPM A;  1J5E H;  1B2O A;  4DUZ H;  4DR3 H;  2P1O B;  1DT4 A;  5IP7 L;  2XOT A;  2X06 A;  3WPH A;  3S1N L;  1VIH A;  2B63 L;  4U67 1;  1P7P A;  4LFA H;  3KYY A;  2NVY L;  4Q62 A;  4GLP A;  3J7A K;  1RDG A;  3RJ0 A;  3H9B A;  2H12 A;  4NXN H;  1DFJ I;  2UUB H;  4DR6 H;  2MJH A;  3BZ5 A;  4FJU A;  3I4N L;  4KXF B;  4JYA H;  1PFU A;  4H09 A;  5DT9 A;  5GAD c;  1A9N A;  1E8J A;  4M7E A;  5IYC L;  2HH3 A;  4YWL A;  4DV1 H;  4DR2 H;  4C2B B;  1SMW A;  4AI2 A;  5MFP A;  2XJT A;  3OET A;  3ZYO A;  4R0A A;  4FS7 A;  3KYW A;  5K36 G;  3H97 A;  1WE8 A;  3LWQ B;  3RZ6 A;  3PO3 L;  1X4N A;  3O53 A;  3RIZ A;  1M0Z A;  4R09 A;  4LF5 H;  4TZH A;  4LFB H;  1NNQ A;  2RFK B;  2Q4G W;  2P1Q B;  4LXS A;  2CTE A;  4AHW A;  4POG A;  4LF7 H;  3KYV A;  2CTK A;  1XRH A;  4ME3 A;  3J7Z 1;  3KJ4 A;  2LF0 A;  4B3R H;  3HOW L;  2HH2 A;  4YY3 H;  4B3M H;  3M18 A;  5LL6 b;  2F4V H;  4NXM H;  4X64 H;  5A5C A;  2JI2 A;  2CKC A;  1XCD A;  5GQR K;  3UN9 A;  2ANR A;  3G06 A;  1ZIW A;  3RF2 A;  4DV6 H;  1IRN A;  2JZX A;  5JVH 1;  2C6B A;  1DCE A;  1R0G A;  3ULA A;  4A3D L;  2GMG A;  5H1S c;  2FMR A;  4R6J A;  3W3L A;  2OMW A;  5C3E L;  4P91 A;  2E2I L;  1G9U A;  4AHZ A;  2WFH A;  1KOO A;  4G6B A;  4Q3G A;  4LIJ A;  1OWC A;  4JI6 H;  4C3H L;  1SFO L;  2CWF A;  5GMH A;  5GAH c;  4WYK A;  1LKO A;  2HVY C;  3L7Z C;  4QMF B;  3LWR B;  2O6Q A;  4AIM A;  4DV2 H;  1B2J A;  2NVX L;  1N34 H;  2KN9 A;  5DM6 1;  1WVN A;  1LTX A;  2AYJ A;  2M8W A;  2ASS B;  2IFG A;  3E2J A;  2XJU A;  4OQT A;  3W3J A;  4PKI G;  1AN7 A;  1XNQ H;  3P2A A;  4A3I L;  4YHH H;  2RA8 A;  3UL7 A;  2LRR A;  4JAF A;  4L3F A;  4EZG A;  4NKH A;  4LFC H;  4MN8 B;  4JI0 H;  3G39 A;  3FKI L;  2VUM L;  2KKD A;  3OTO H;  1S03 G;  4WAL A;  4Y52 L;  4V2C A;  1P8T A;  4U09 A;  1CAD A;  4C2M 1;  4WAN A;  4R6G A;  3PO2 L;  5IJD A;  5CMN A;  2PSM C;  1YRG A;  3UL9 A;  2Y3M A;  4LHL A;  3JAM W;  1X0A A;  4AR5 A;  5FLM L;  2CTJ A;  1H6U A;  3GOZ A;  1FO1 A;  1ZZK A;  4DR5 H;  3GTG L;  3E6J A;  2Z7X B;  4XOS A;  3M4O L;  3VKE A;  3H0G L;  4DV7 H;  3J81 W;  4OX9 H;  3LWV B;  3MQK B;  1PFW A;  7RXN A;  2NYD A;  4KT1 A;  4BSU A;  4A3B L;  3RZD L;  3HJW B;  1FS2 A;  4XGO A;  2JA9 A;  1XNR H; 
#chains in the Genus database with same CATH homology
 2M6P A;  3VPB E;  1BRF A;  1XEC A;  4JAE A;  1SMU A;  1RYQ A;  3OGL B;  1D0B A;  5MGN A;  2ERS A;  4FMZ A;  3QD7 X;  4LF8 H;  4ZN3 B;  3ULU A;  3WPI A;  3OGK B;  1LKP A;  4TPU A;  4K0K H;  1F0X A;  2BE5 D;  4LI1 A;  4DR7 H;  2OMX A;  5EIN C;  1HNX H;  2UUC H;  3SB1 A;  1QYY A;  3TSR E;  4AY9 X;  4X62 H;  4X66 H;  1A4Y A;  3VQ1 A;  4V2E A;  3WWL A;  2UXC H;  4PQ8 A;  2V9T B;  2PYA A;  1S24 A;  1GWB A;  1RWD A;  4R58 A;  3WPE A;  2CA6 A;  1M10 B;  3T1H H;  4G8A A;  1S30 A;  4DV5 H;  1O6V A;  4AR3 A;  4P8S A;  5GS0 A;  4DV0 H;  4XXB B;  5BR8 H;  1FJG H;  2MS3 A;  4KHP H;  4AQY H;  4LI2 A;  3B08 B;  1O6S A;  2P1N B;  3WPF A;  2D9I A;  2JE1 A;  1OWB A;  5MF6 A;  1IW7 D;  2FPH X;  2O4C A;  3ZYJ A;  2Z82 A;  2CKA A;  2OMZ A;  5GAG c;  4ECO A;  3E3Z A;  1OTM A;  1XWD C;  4RCW A;  3T1Y H;  2BEX A;  4HQ1 A;  5JVG 1;  3C6P B;  4LHN A;  4CP6 A;  2M4Y A;  4I6J B;  1CAA A;  1BQ9 A;  4WFN 1;  2P1P B;  1HNZ H;  4GKK H;  1OZN A;  1FKA H;  2O6R A;  4UFR A;  4KNG A;  5MFZ A;  2WQU A;  2K2D A;  2A0Z A;  1YK4 A;  1YV1 A;  4LXR A;  2UXB H;  4ARR A;  1N33 H;  2WQW A;  3PKJ A;  1W8A A;  3VQ2 A;  4AR6 A;  1OOK G;  4AI1 A;  5RXN A;  4Q3I A;  1RDV A;  2ERJ A;  2PVX A;  4G08 A;  3E4G A;  1IU5 A;  3WPB A;  4NZR M;  3W3G A;  5GAE c;  2P1M B;  1BQ8 A;  4GS7 D;  8RXN A;  2B5I D;  4AHX A;  3C6O B;  3PWF A;  1SMM A;  3P8B A;  2ZM6 H;  3WWN B;  2R9U A;  3ULV A;  1M9L A;  2V0E A;  2V0F A;  4CC4 C;  1BFY A;  4Z79 A;  2JI3 A;  2HR5 A;  3ZG6 A;  4DUY H;  4BSR A;  1B71 A;  4GT6 A;  1RB9 A;  1S2Z A;  3C6N B;  2UXD H;  1K5D C;  1NXE A;  5IT9 W;  1JYB A;  2Z63 A;  3FAU A;  5MLC 3;  3QVD A;  2PPT A;  2O6S A;  2UZY A;  4Z61 C;  3GAB A;  3NFP I;  1OTO A;  4RXN A;  4AI3 A;  1DVB A;  2HHH H;  4IM6 A;  3RGX A;  2A6E D;  4OD6 A;  3RYG A;  3WPG A;  5AWC A;  4K9F A;  3KDK A;  1I94 H;  2WQV A;  3UL8 A;  1R0I A;  3K35 A;  1BE7 A;  5IY0 A;  2ZIX A;  3W3M A;  4UY8 1;  4DR4 H;  4CC4 A;  2JE0 A;  1LTL A;  3SS2 A;  3KYX A;  4YEB B;  4JI2 H;  1IU6 A;  2JI1 A;  5FLX W;  2RDV A;  4RCA B;  3MSU A;  4Z94 G;  1VCX A;  5B0N A;  3RGZ A;  4AR4 A;  2XJV A;  2L0Z A;  4JI4 H;  1LKM A;  3M19 A;  5IWA H;  5LFN A;  5AWD A;  2A68 D;  2Z81 A;  2QL0 A;  1ZRP A;  2Z62 A;  3OJA A;  4J4L A;  4TVM A;  1XKU A;  2RR6 A;  4AI0 A;  4Z8G A;  5GMG A;  3JB9 j;  3WPD A;  5AN9 H;  1RYT A;  4AW4 A;  5HDH A;  1FHM A;  4FDW A;  1X9Z A;  1T9P A;  2V3B B;  1Z7X W;  1NXG A;  2VQE H;  5LMN H;  3J80 W;  4PDB A;  2M4V A;  1R0H A;  1DX8 A;  1Z92 B;  4POF A;  3MPS A;  4EC5 A;  5EIO C;  4X65 H;  1YUZ A;  1O6T A;  5GMF A;  3FXI A;  4R6A A;  4B8C D;  4R5D A;  3G3B A;  4XSQ A;  1XEU A;  3J7Y 1;  1JL5 A;  4J0M A;  2JQD A;  2Z66 A;  5LMU H;  1R0J A;  2VKC A;  4WP6 A;  5IYX C;  5AWA A;  4LSX C;  3RW6 A;  4R08 A;  2Z3Q B;  2AST B;  3RFS A;  5CMP A;  1U0N D;  4PER A;  1FQV A;  3QQC E;  1YUX A;  4U08 A;  4Y61 B;  1N36 H;  3OJA B;  1XMO H;  1C09 A;  1H7V A;  5AI2 A;  4JV5 H;  4R6F A;  2BNH A;  4LF4 H;  5A2Q W;  4ARN A;  2J9U B;  5GS2 B;  2DSX A;  2OMU A;  3OSS D;  2XJQ A;  2C6A A;  6RXN A;  2A6H D;  3CIY A;  4ECN A;  3B0A B;  5AI3 A;  4NKG A;  4PSJ A;  1ODH A;  2Y5Q A;  4DV3 H;  4PEQ B;  4E6Y A;  4K17 A;  3RZT A;  2A69 D;  3REZ A;  1P8V A;  3W3K A;  1OGQ A;  4LSX A;  4JI3 H;  2FT3 A;  4Z64 C;  1YK5 A;  4V19 6;  4DR1 H;  1OTN A;  4R5C A;  1VZH A;  1WJV A;  4RWT C;  1SQ0 B;  1IBK H;  2CR8 A;  3A44 A;  2PVE A;  3WN4 A;  4CIL A;  1IO0 A;  2Z65 A;  1B13 A;  2O5J D;  4JI5 H;  1VZI A;  2PT7 G;  4U06 A;  1I6U A;  5B0T A;  2Z7X A;  3SB4 A;  1PGV A;  1T9Q A;  4LF9 H;  2M6O A;  1FHH A;  3RFJ A;  4CNC A;  3W3N A;  4U7L A;  2XJR A;  3G3A A;  1VZG A;  4ZN1 B;  2UU9 H;  4V2D A;  4JAG A;  1SEI A;  2XJP A;  3ZYI A;  3PZA A;  4LSC A;  3DZE A;  5FTT B;  4BV4 R;  4R07 A;  2V70 A;  1K5G C;  1P9A G;  1IRO A;  3ZYN A;  1H6T A;  4OCH A;  5AZ5 A;  2VQF H;  4FD0 A;  2ID5 A;  4B3S H;  1QYB A;  1IBM H;  4GKJ H;  3O6N A;  5K2M E;  3CIG A;  2Z64 A;  2VL6 A;  1HNW H;  2OMT A;  3G04 C;  2UZX A;  4XGH A;  3P72 A;  1R0F A;  5IJC A;  1DS9 A;  3LNL A;  4QXE A;  2XWT C;  3PMH G;  2Z3R B;  4JI8 H;  4JI1 H;  1N32 H;  4FCG A;  4BSS A;  5IJB A;  3PIO 1;  5D3I A;  1KOH A;  1FT8 A;  2XJS A;  3CVR A;  3RFE A;  1XMQ H;  1M9S A;  3EZJ A;  3OGM B;  5DM7 1;  3A79 B;  2UUA H;  4JAD A;  1IBL H;  3RW7 A;  4QC0 A;  3KDG A;  2ZQE A;  4M7E C;  4AHY A;  5AWB A;  2LCQ A;  2E5L H;  4MQW X;  3WPC A;  3PKI A;  1WWL A;  1QCV A;  4FHO A;  2WQX A;  3LPE B;  3IU3 I;  3PIP 1;  1HR0 H;  2OMY A;  2ELL A;  4LSA A;  5HZL B;  3NCV A;  4CNM A;  4NZT M;  4DV4 H;  4LF6 H;  4L3A A;  3GR5 A;  4E9J A;  2V9S A;  5B4P A;  4JI7 H;  1T9O A;  4C2A B;  2OMV A;  4QBZ A;  4YWM A;  3KYU A;  1J5E H;  1B2O A;  4DUZ H;  4DR3 H;  2P1O B;  2XOT A;  3WPH A;  4U67 1;  4LFA H;  3KYY A;  4Q62 A;  4GLP A;  3J7A K;  1RDG A;  3RJ0 A;  2H12 A;  4NXN H;  1DFJ I;  2UUB H;  4DR6 H;  3BZ5 A;  4KXF B;  4JYA H;  4H09 A;  5DT9 A;  5GAD c;  1A9N A;  1E8J A;  4M7E A;  4C2B B;  4YWL A;  4DV1 H;  4DR2 H;  1SMW A;  4AI2 A;  5MFP A;  2XJT A;  3OET A;  3ZYO A;  4R0A A;  4FS7 A;  3KYW A;  3RZ6 A;  3O53 A;  3RIZ A;  1M0Z A;  4R09 A;  4LF5 H;  4TZH A;  4LFB H;  1NNQ A;  2Q4G W;  2P1Q B;  4LXS A;  4AHW A;  4POG A;  4LF7 H;  3KYV A;  4ME3 A;  3J7Z 1;  3KJ4 A;  2LF0 A;  4B3R H;  4YY3 H;  4B3M H;  3M18 A;  5LL6 b;  2F4V H;  4NXM H;  4X64 H;  5A5C A;  2JI2 A;  2CKC A;  1XCD A;  5GQR K;  3UN9 A;  3G06 A;  1ZIW A;  3RF2 A;  4DV6 H;  1IRN A;  5JVH 1;  2C6B A;  1DCE A;  1R0G A;  3ULA A;  2GMG A;  5H1S c;  4R6J A;  3W3L A;  2OMW A;  4P91 A;  1G9U A;  4AHZ A;  2WFH A;  1KOO A;  4G6B A;  4Q3G A;  1OWC A;  4JI6 H;  5GMH A;  5GAH c;  4WYK A;  1LKO A;  2O6Q A;  4DV2 H;  1B2J A;  1N34 H;  2KN9 A;  5DM6 1;  1LTX A;  2ASS B;  2AYJ A;  2IFG A;  3E2J A;  4OQT A;  2XJU A;  3W3J A;  4PKI G;  1AN7 A;  1XNQ H;  3P2A A;  4YHH H;  2RA8 A;  3UL7 A;  4JAF A;  4L3F A;  4EZG A;  4NKH A;  4LFC H;  4MN8 B;  4JI0 H;  3G39 A;  2KKD A;  3OTO H;  1S03 G;  4V2C A;  1P8T A;  4U09 A;  1CAD A;  5IJD A;  4R6G A;  5CMN A;  2PSM C;  1YRG A;  3UL9 A;  2Y3M A;  4LHL A;  3JAM W;  4AR5 A;  1H6U A;  3GOZ A;  1FO1 A;  4DR5 H;  3E6J A;  2Z7X B;  4XOS A;  4DV7 H;  3J81 W;  4OX9 H;  7RXN A;  2NYD A;  4KT1 A;  4BSU A;  1FS2 A;  4XGO A;  4B3T H;  1XNR H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...