4B8CD

Nuclease module of the yeast ccr4-not complex
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
686
structure length
318
Chain Sequence
VNASNPLLHPHLDDPSLLNNPIWKLQLHLAAVSAQSLGQPNIYARQNAMKKYLCTKQALMEMADTLTDSKTAKDDQLWHALDLSNLQIFNISANIFKYDFLTRLYLNGNSLTELPAEIKNLSNLRVLDLSHNRLTSLPAELGSCFQLKYFYFFDNMVTTLPWEFGNLCNLQFLGVEGNPLEKQFLKILTEKSVTGLIFYLRDNRPEIPLPHETLCQHYATPKMYRYTPSWALSWDYRRNKLKEQILSYDSDLLCLQVESKTFEEYWVPTGIFVDGCCIFFLPFTNFTPSFTDVIEVDPEYVSKFIGFPNDKFPSDHIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Architecture of the Nuclease Module of the Yeast Ccr4-not Complex: The not1-Caf1-Ccr4 Interaction.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/cell cycle
molecule keywords POLY(A) RIBONUCLEASE POP2
total genus 68
structure length 318
sequence length 686
chains with identical sequence J, K, L
ec nomenclature ec 3.1.13.4: Poly(A)-specific ribonuclease.
pdb deposition date 2012-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF03372 Exo_endo_phos Endonuclease/Exonuclease/phosphatase family
D PF12799 LRR_4 Leucine Rich repeats (2 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.210 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 4b8cD03
3.30.1370.190 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 4b8cD02
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4b8cD01
2JQDA 2Z65A 4LSXA 2Y5QA 4P91A 4PQ8A 3W3NA 3RFJA 4CNMA 4KXFB 4LXSA 5HZLB 3TSRE 4R6JA 3JB9j 2RR6A 4XGOA 5GS0A 1IO0A 5B0TA 2OMZA 3RW7A 4ECNA 4GLPA 4U09A 2Z7XA 3PMHG 4CP6A 4FD0A 1XWDC 4KNGA 5GMHA 1WWLA 4MQWX 3UL8A 1P9AG 4AY9X 4CILA 2P1OB 1G9UA 2OMTA 4H09A 3ULUA 4U7LA 3BZ5A 4J0MA 4LI1A 2RA8A 4U06A 1XECA 3G3BA 1O6VA 3ZYNA 4NKGA 2R9UA 2CA6A 3C6NB 3OGMB 4R6FA 4WYKA 3UL9A 2Z64A 5B0NA 2A0ZA 3WPGA 4EZGA 2P1PB 2UZXA 1M9SA 1YRGA 4FHOA 1A4YA 2WQXA 4HQ1A 5GMGA 4M7EA 4RCWA 2IFGA 3OGLB 4WP6A 3CIYA 1DS9A 1FT8A 4XOSA 4Q3GA 2Z81A 4C2BB 3RGXA 1XCDA 3RIZA 2OMWA 4XSQA 5IJBA 2OMYA 3A79B 4FCGA 1JL5A 1A9NA 3WPHA 3O6NA 2OMXA 3CVRA 4AW4A 2Z66A 2P1NB 5FTTB 4TZHA 4R6GA 2Z63A 4KT1A 4Q3IA 1M10B 1XKUA 3FXIA 4Y61B 4Z94G 3WPFA 3ZYJA 5A5CA 4B8CD 4P8SA 4Z79A 3CIGA 4BV4R 1OTMA 3E2JA 4L3AA 4LSXC 4LI2A 4NKHA 3M18A 4PKIG 2XWTC 2OMUA 4PERA 3ZYIA 4BSUA 4CC4C 1GWBA 1H6TA 2Z7XB 4IM6A 1FQVA 1KOOA 2V70A 4LSCA 4Z61C 1O6TA 4QXEA 1P8TA 5CMNA 4R0AA 3WPEA 2Z62A 3O53A 2P1MB 3REZA 1U0ND 2BNHA 2WQWA 4R58A 4UFRA 5CMPA 4C2AB 5AWBA 3SB4A 4R08A 2WFHA 4FS7A 4V2CA 1OTNA 4R09A 3C6OB 4RCAB 2JE1A 4OQTA 3C6PB 4V2EA 3ULAA 3ULVA 4PEQB 2UZYA 1OGQA 4J4LA 4FMZA 3OGKB 1OOKG 5B4PA 1H6UA 4QC0A 3W3MA 3E4GA 3W3KA 1LTXA 2WQUA 5GS2B 4RWTC 1Z7XW 4CC4A 4U08A 4YEBB 2P1QB 1P8VA 3G04C 2ASSB 3WN4A 4LSAA 1K5GC 1M0ZA 2FT3A 1M9LA 3E6JA 3KJ4A 3RFSA 3VQ1A 3ZYOA 4ARRA 4I6JB 3G3AA 1FO1A 4G8AA 4K17A 4BSRA 2OMVA 5AWCA 3P72A 4FDWA 4Q62A 4CNCA 4R6AA 4R5CA 1FS2A 2XOTA 1OZNA 3UN9A 4BSSA 4ECOA 4M7EC 3RFEA 5HDHA 3W3LA 3OJAB 5AZ5A 4Z8GA 4L3FA 3W3JA 3OJAA 4Z64C 4GT6A 1ZIWA 3E3ZA 5AWDA 2Q4GW 2V9TB 4ARNA 3RJ0A 5GMFA 1SQ0B 1W8AA 2Z82A 4PSJA 2BEXA 4V2DA 2ASTB 2WQVA 5D3IA 5LFNA 5GQRK 1O6SA 1XEUA 2ID5A 3UL7A 3RW6A 3VQ2A 2O6QA 4LXRA 1PGVA 2O6RA 5IJDA 1DFJI 1K5DC 2O6SA 4MN8B 1QYYA 4R5DA 3W3GA 3WPBA 3GOZA 3G06A 5IYXC 4QBZA 5IJCA 1KOHA 3WPIA 3M19A 3WPCA 2V9SA 1DCEA 1OTOA 3RGZA 3DZEA 5AWAA 3WPDA 2ELLA 2JE0A 4R07A 3G39A 1D0BA
chains in the Genus database with same CATH superfamily
4WALA 2Z65A 1V9NA 1ZZKA 2KN9A 4AI2A 4LSXA 4A3GL 2VKCA 2Y5QA 2HR5A 3H9CA 4LF7H 3H97A 4PQ8A 4A3FL 4KXFB 4LXSA 2F4VH 4OD6A 5HZLB 1TWCL 1H7VA 1AN7A 1IBKH 2RR6A 3FAUA 1Z2IA 2Z0SA 1IO0A 1S20A 2OMZA 1TWAL 3RW7A 4ECNA 2RFKB 4GS7D 3EZJA 2E2HL 2Z7XA 4CP6A 4NXMH 4KNGA 1RWDA 4QIWP 4YWMA 3UL8A 3LWRB 1P9AG 1G9UA 5DM71 1BQ8A 4AR3A 1RYTA 3LWQB 4U7LA 3BZ5A 4QMFB 2CKAA 2ANRA 1O6VA 2WAQP 3GTJL 2VQEH 5FLXW 4XXBB 3UOEA 2Z64A 2JEAI 2APOB 5JVH1 4DR7H 2UZXA 4DV2H 4A3DL 5IYDL 4M7EA 4G08A 1YK5A 2JI2A 3WWNB 1DS9A 1FJGH 4XOSA 4Q3GA 1WVNA 4C2BB 3RGXA 4OCHA 2OMYA 1WCML 2GMGA 4C3HL 1A9NA 1ZRPA 2OMXA 2Z66A 2RDVA 2P1NB 3HOWL 4R6GA 4H8AA 4AHYA 2Z63A 4KT1A 5A5CA 3KYUA 4JV5H 3WPFA 4P8SA 3H9BA 2XJRA 5GAGc 3S2HL 4BV4R 1OTMA 3CIGA 5FLML 4NKHA 4M7EC 4BBRL 1NNQA 3ZYIA 3HOXL 4A3EL 2XJUA 1ZZIA 4ME3A 3GR5A 1X4NA 3MPSA 1P8TA 4JI3H 2V0FA 4OX9H 3I0PA 1FKAH 2QNDA 2LTMA 3REZA 2WQWA 1LKPA 2A69D 2K2DA 4R58A 4UFRA 1WE8A 3SB4A 4V2CA 1VZIA 2E2JL 3KYWA 3ULAA 2NYDA 5M3ML 4FMZA 3KDGA 3OGKB 3I4NL 4LF9H 5B4PA 4BY7L 2ERJA 5IY0A 3HOZL 1YV1A 3PIP1 2A68D 3E4GA 2JA6L 5GS2B 2ZIXA 1Z7XW 3M3YL 4CC4A 3LWVB 4POGA 3G04C 2AUSB 2Z3QB 3WN4A 1T9OA 2CPQA 3RFSA 4IFDG 3ZYOA 3VQ1A 4B3TH 1F4LA 3G3AA 4G8AA 5AWCA 3LNLA 4DV3H 1FS2A 4ECOA 4JAFA 3NFPI 1FHHA 3W3JA 2NVXL 3OJAA 4Z64C 2VQFH 5AWDA 5GMFA 2PPTA 4X62H 4DV5H 2Z82A 1WJVA 2PT7G 1IBMH 4GKJH 2WQVA 1LKOA 2ID5A 3UL7A 4A93L 3OETA 2O6QA 3HJYB 2O6SA 2V3BB 4MN8B 4R5DA 3WPBA 5IYXC 3G06A 2CWFA 1QYBA 5IJCA 3M19A 1QCVA 3PKJA 3IU3I 3WWLA 1X4MA 1OTOA 1V8CA 4JAGA 3RGZA 1RYQA 2K1HA 3G39A 3I4ML 3HOUL 3KYVA 1IW7D 5JEAG 4P91A 1NXUA 3RZ6A 4GKKH 4DV1H 4LF6H 1J5KA 1I3QL 2D9IA 4U09A 3S17L 1XWDC 5GMHA 3SS2A 2PQUA 4MQWX 2NVYL 2CTJA 4CILA 3S2DL 3GTQL 3J81W 4LIJA 3H0GL 4A3ML 4LI1A 4U06A 4C2M1 3HKZP 5MGNA 3G3BA 4KHPH 1OWBA 3ZG6A 3OGMB 4TVMA 4B3MH 4UY81 2NVQL 4EZGA 1PFVA 1F0XA 2P1PB 3KYYA 1SEIA 3JAMW 4B8TA 1A4YA 2M6QA 1QQTA 3S16L 4RCWA 2IFGA 5M5YL 4DUYH 2JA9A 3OGLB 3CIYA 5FJ8L 1XCDA 5LMUH 2OMWA 1BE7A 2PMZP 3A79B 1CADA 4LHLA 3WPHA 3CVRA 3L7ZC 3HJWB 2DSXA 1ODHA 3LPEB 5BR8H 5FTTB 3GTML 1HNXH 2UUAH 4K9FA 1ZZJA 4Z94G 4AIMA 4JI4H 5DT9A 4B8CD 4B3RH 3A44A 3B08B 4Z8GA 4BSUA 4PKIG 4PERA 1BFYA 3HAXC 3PWFA 1N33H 2ANNA 1H6TA 2Z7XB 2Z3RB 1WHRA 1O6TA 2L0ZA 3WPEA 4LFAH 4C2AB 1DVBA 5CMPA 1LKMA 1VBIA 3P8BA 4DUZH 4FS7A 2H12A 4A3JL 3C6OB 4RCAB 5MF6A 3VKEA 5MFPA 4OQTA 4V2EA 1N32H 2Y3MA 5IP9L 1R0HA 3PO3L 2J9UB 1OOKG 1IROA 2O4CA 4C3IL 1ZTGA 2ZM6H 4QC0A 3W3MA 3W3KA 3QQCE 2CTFA 1PFYA 1N34H 2WQUA 4AQYH 3GTOL 2C6BA 1S24A 1S30A 2QL0A 5C3EL 4DR4H 1IU6A 1P8VA 1P7PA 1K5GC 3PL5A 4ZN1B 1M9LA 3KJ4A 4AI3A 3GTGL 2LF0A 5RXNA 2M4YA 4ARRA 4I6JB 2JA5L 1FO1A 4NZRM 3P72A 4Q62A 4R6AA 4NXNH 1RDGA 4AHXA 4AR4A 4AHWA 5H1Sc 2XOTA 4RXNA 4DR3H 1XNRH 1B2JA 1BRFA 2UXCH 5GAHc 3RF2A 2UXBH 3PKIA 1ZIWA 2CKCA 2CTLA 2G8YA 4ARNA 2A6ED 4JI8H 1W8AA 2BEXA 7RXNA 4V2DA 4WFN1 2PY9A 5D3IA 1XEUA 3S1RL 2NN6G 5LL6b 1PGVA 4G6BA 1DTJA 1T9QA 2FPHX 2LTLA 1K5DC 1QYYA 1T9PA 2CWHA 3W3GA 3K35A 5IWAH 5GADc 3WPIA 4A3IL 4EC5A 4FJSA 4BXXL 1PQXA 3GTKL 2E3UA 1EC6A 2ELLA 2JE0A 2JQDA 1KHMA 3W3NA 1LTLA 2WB1P 4LHNA 4NZTM 2OPUA 4OO1G 4A3BL 1JYBA 4DV4H 5AN9H 3GTLL 5B0TA 5M3FL 1NXEA 4GLPA 2NVTL 4BA2I 5IYBL 3T1YH 4AY9X 4H09A 2OMTA 4AI1A 1B13A 1J4WA 4AM3A 1R0GA 3S1ML 3ZYNA 4NKGA 2CA6A 3WPGA 2A0ZA 4V196 5GMGA 5M5WL 1NXGA 2HVYC 4YY3H 4C3JL 2A1SA 2PVXA 5K36G 1TWFL 3RIZA 4JAEA 1Y1WL 5C4XL 2O5JD 4FCGA 1JL5A 5IJBA 4POFA 3O6NA 2YU9L 3FKIL 4DV6H 4LFCH 2Y0SP 2BL5A 2KKDA 4WANA 4YWLA 1IBLH 5JVG1 5C4JL 5LMNH 4JVHA 1M10B 1X9ZA 4AI0A 1B71A 4AR6A 2VUML 1XKUA 2M4VA 5IYCL 4Z79A 3E2JA 4JI7H 4LI2A 3QVDA 1GWBA 4PDBA 3FDJA 4QXEA 5CMNA 2UUBH 1RDVA 2Z62A 2P1MB 1U0ND 5AWBA 2XJSA 6RXNA 3GTPL 4R08A 1Z92B 2WFHA 2JI1A 2ZQEA 4A3CL 2B5ID 3C6PB 3JR7A 2LRRA 4JYAH 4TPUA 4PEQB 2UZYA 1OGQA 4FJUA 3HOVL 4J4LA 4LF8H 3S1NL 1SFOL 1B2OA 2M8WA 2CTKA 1LTXA 2JA8L 2ERSA 5GAEc 3S15L 4DR6H 1IRNA 5A2QW 4U08A 1BQ9A 4A3LL 2ASSB 3MQKB 4LSAA 2CTMA 2AQCA 3E6JA 1DX8A 5K2ME 4K17A 1XRHA 3LWPB 2B63L 8RXNA 1TWGL 3GKUA 4FDWA 3GABA 4BSRA 1OWCA 4R5CA 4DV0H 4BSSA 1OZNA 3UN9A 3RFEA 3W3LA 1S03G 1R0JA 2C6AA 3K7AL 3OTOH 5C0XG 3KYXA 1HNWH 4L3FA 4GT6A 1DT4A 3E3ZA 5AI2A 2Q4GW 4Y61B 2HH2A 1X0AA 2V9TB 3RJ0A 2JA7L 2HHHH 1R9TL 2P2RA 1XMQH 4PSJA 1CAAA 5M5XL 4U671 3PO2L 5IP7L 5LFNA 5GQRK 1O6SA 1TUAA 2JE6I 4AR5A 4LF4H 2XJVA 3PZAA 2UXDH 5IJDA 3T1HH 2JEBI 3J80W 1PFWA 4JVYA 3GOZA 4AHZA 2YQRA 1KOHA 4QBZA 4Q3IA 5DM61 3S1QL 2V9SA 2XJTA 3RZOL 3DZEA 5AWAA 2CR8A 4Y7NL 3WPDA 2X06A 4JI0H 1K83L 4R07A 5MLC3 4A3KL 1K1GA 2OPVA 3H3VM 3RFJA 4CNMA 2AXYA 4B3SH 3TSRE 4R6JA 3JB9j 4XGOA 5C44L 5GS0A 3MSUA 1PFUA 4BY1L 2BA0A 1PZXA 1I6HL 1VCXA 3PMHG 4FD0A 4X65H 2CTEA 3LWOB 1WWLA 2P1OB 1IU5A 3ULUA 2JVZA 4XGHA 1I94H 2EY4E 3P2AA 4J0MA 2RA8A 3J7AK 1XECA 5EINC 4R6FA 2R9UA 4DR5H 3C6NB 4WYKA 4Y52L 3UL9A 5B0NA 1J5EH 2R7ZL 2PVEA 3SB1A 2PSMC 4NBQA 1M9SA 1YRGA 4FHOA 2WQXA 4HQ1A 1FHMA 4BA1I 1SMUA 3QD7X 3U1KA 4WP6A 1R0FA 1MSZA 2FMRA 1RB9A 1FT8A 2Z81A 4XSQA 2BE5D 4AW4A 4BBSL 3H99A 4TZHA 3ZYJA 3FXIA 5EIOC 1VIGA 2JZXA 2UUCH 4YHHH 3RYGA 4DR2H 2FFMA 4X66H 4L3AA 4LSXC 3M18A 4CC4C 2E5LH 2OMUA 2XWTC 2PYAA 4IM6A 1FQVA 1KOOA 4E9JA 2V70A 4X64H 4LSCA 4Z61C 1I50L 3RZDL 4JADA 3J7Z1 2JI3A 3CQZL 1XMOH 1VZGA 1Y1VL 4LF5H 3O53A 4R0AA 2LCQA 2BNHA 2AYJA 5AI3A 1OTNA 1VIHA 4R09A 1UG8A 3KDKA 2JE1A 1HNZH 3ULVA 4K0KH 5IT9W 4AYBP 1SMMA 1H6UA 1R0IA 3NCVA 2HH3A 5MFZA 3PIO1 1YUXA 4JI6H 4RWTC 4LFBH 1TWHL 3M4OL 1HR0H 4JI5H 2P1QB 4YEBB 3AEVB 4X6AL 1M0ZA 1XNQH 1VZHA 1YUZA 2FT3A 3S14L 4JI2H 1WTJA 2CPMA 3V69A 2OMVA 2M6OA 3B0AB 2DGRA 2R92L 1E8JA 4CNCA 1SMWA 2A6HD 5HDHA 4JI1H 3OJAB 5AZ5A 4DV7H 3VPBE 3HOYL 3RZTA 2MS3A 4DR1H 1SQ0B 2R93L 2ASTB 2XJPA 3RW6A 2XJQA 3J7Y1 3VQ2A 4LXRA 2O6RA 2VL6A 1S2ZA 1DFJI 2M6PA 1YK4A 2UU9H 3OSSD 4ZN3B 2V0EA 1N36H 3WPCA 2MJHA 2E2IL 1I6UA 1DCEA 1C09A 4E6YA 1D0BA
chains in the Genus database with same CATH topology
2Z65A 4LSXA 2KN9A 4AI2A 2VKCA 2Y5QA 2HR5A 4LF7H 4PQ8A 4KXFB 4LXSA 2F4VH 4OD6A 5HZLB 1AN7A 1H7VA 1IBKH 2RR6A 3FAUA 1IO0A 2OMZA 3RW7A 4ECNA 4GS7D 3EZJA 2Z7XA 4CP6A 4NXMH 4KNGA 1RWDA 4YWMA 3UL8A 1P9AG 1G9UA 5DM71 1BQ8A 4AR3A 1RYTA 4U7LA 3BZ5A 2CKAA 1O6VA 2VQEH 5FLXW 4XXBB 2Z64A 4DR7H 5JVH1 2UZXA 4DV2H 4M7EA 4G08A 1YK5A 2JI2A 3WWNB 1DS9A 1FJGH 4XOSA 4Q3GA 4C2BB 3RGXA 4OCHA 2OMYA 2GMGA 1A9NA 1ZRPA 2OMXA 2Z66A 2RDVA 2P1NB 4R6GA 2Z63A 4AHYA 4KT1A 5A5CA 3KYUA 4JV5H 3WPFA 4P8SA 3CIGA 2XJRA 5GAGc 4BV4R 1OTMA 4NKHA 4M7EC 3ZYIA 1NNQA 2XJUA 4ME3A 3GR5A 3MPSA 1P8TA 4JI3H 2V0FA 4OX9H 1FKAH 3REZA 2WQWA 1LKPA 2A69D 2K2DA 4R58A 4UFRA 3SB4A 4V2CA 1VZIA 3KYWA 3ULAA 2NYDA 4FMZA 3KDGA 3OGKB 4LF9H 5B4PA 2ERJA 5IY0A 1YV1A 3PIP1 2A68D 3E4GA 5GS2B 2ZIXA 1Z7XW 4CC4A 4POGA 3G04C 2Z3QB 3WN4A 1T9OA 3RFSA 3VQ1A 3ZYOA 4B3TH 3G3AA 4G8AA 5AWCA 3LNLA 4DV3H 1FS2A 4ECOA 4JAFA 3NFPI 1FHHA 3W3JA 3OJAA 4Z64C 2VQFH 5AWDA 5GMFA 2PPTA 4X62H 4DV5H 2Z82A 1WJVA 2PT7G 1IBMH 4GKJH 2WQVA 1LKOA 2ID5A 3UL7A 3OETA 2O6QA 2O6SA 2V3BB 4MN8B 4R5DA 3WPBA 5IYXC 3G06A 5IJCA 1QYBA 3M19A 1QCVA 3PKJA 3IU3I 3WWLA 1OTOA 4JAGA 3RGZA 1RYQA 3G39A 3KYVA 1IW7D 4P91A 3RZ6A 4GKKH 4DV1H 4LF6H 2D9IA 4U09A 1XWDC 5GMHA 3SS2A 4MQWX 4CILA 3J81W 4LI1A 4U06A 5MGNA 3G3BA 4KHPH 1OWBA 3ZG6A 3OGMB 4TVMA 4B3MH 4UY81 4EZGA 1F0XA 2P1PB 3KYYA 1SEIA 3JAMW 1A4YA 4RCWA 2IFGA 4DUYH 3OGLB 3CIYA 1XCDA 5LMUH 2OMWA 1BE7A 3A79B 1CADA 4LHLA 3WPHA 3CVRA 2DSXA 1ODHA 3LPEB 5BR8H 5FTTB 1HNXH 2UUAH 4K9FA 4Z94G 4JI4H 5DT9A 4B8CD 4B3RH 3A44A 3B08B 4Z8GA 4BSUA 4PKIG 4PERA 1BFYA 3PWFA 1N33H 1H6TA 2Z7XB 2Z3RB 1O6TA 2L0ZA 3WPEA 4LFAH 4C2AB 1DVBA 5CMPA 1LKMA 3P8BA 4DUZH 4FS7A 2H12A 3C6OB 4RCAB 5MF6A 5MFPA 4OQTA 4V2EA 1N32H 2Y3MA 1R0HA 2J9UB 1OOKG 1IROA 2O4CA 2ZM6H 4QC0A 3W3MA 3W3KA 3QQCE 1N34H 2WQUA 4AQYH 2C6BA 1S24A 1S30A 2QL0A 4DR4H 1P8VA 1IU6A 1K5GC 3KJ4A 4ZN1B 1M9LA 4AI3A 2LF0A 5RXNA 2M4YA 4ARRA 4I6JB 1FO1A 4NZRM 3P72A 4Q62A 4R6AA 4NXNH 1RDGA 4AHXA 4AR4A 4AHWA 5H1Sc 2XOTA 4RXNA 4DR3H 1XNRH 1B2JA 1BRFA 2UXCH 5GAHc 3RF2A 2UXBH 3PKIA 1ZIWA 2CKCA 4ARNA 2A6ED 4JI8H 1W8AA 2BEXA 7RXNA 4V2DA 4WFN1 5D3IA 1XEUA 5LL6b 1PGVA 4G6BA 1T9QA 2FPHX 1K5DC 1QYYA 1T9PA 3W3GA 3K35A 5IWAH 5GADc 3WPIA 4EC5A 2ELLA 2JE0A 2JQDA 3W3NA 1LTLA 4LHNA 4NZTM 1JYBA 4DV4H 5AN9H 5B0TA 1NXEA 4GLPA 3T1YH 4AY9X 4H09A 2OMTA 4AI1A 1B13A 1R0GA 3ZYNA 4NKGA 2CA6A 3WPGA 2A0ZA 4V196 5GMGA 1NXGA 4YY3H 2PVXA 3RIZA 4JAEA 5IJBA 2O5JD 4FCGA 1JL5A 4POFA 3O6NA 4DV6H 4LFCH 2KKDA 4YWLA 1IBLH 5JVG1 5LMNH 1M10B 1XKUA 4Q3IA 1X9ZA 4AI0A 1B71A 4AR6A 2M4VA 4Z79A 3E2JA 4JI7H 4LI2A 3QVDA 1GWBA 4PDBA 4QXEA 5CMNA 2UUBH 1RDVA 2Z62A 2P1MB 1U0ND 5AWBA 2XJSA 6RXNA 4R08A 1Z92B 2WFHA 2JI1A 2ZQEA 2B5ID 3C6PB 4JYAH 4TPUA 4PEQB 2UZYA 1OGQA 4J4LA 4LF8H 1B2OA 1LTXA 2ERSA 5GAEc 4DR6H 1IRNA 5A2QW 4U08A 1BQ9A 2ASSB 4LSAA 3E6JA 1DX8A 5K2ME 4K17A 4BSRA 8RXNA 4FDWA 3GABA 1OWCA 4R5CA 4DV0H 4BSSA 1OZNA 3UN9A 3RFEA 3W3LA 1S03G 1R0JA 2C6AA 3OTOH 3KYXA 1HNWH 4L3FA 4GT6A 3E3ZA 5AI2A 2Q4GW 4Y61B 2V9TB 3RJ0A 2HHHH 1XMQH 4PSJA 1CAAA 4U671 5LFNA 5GQRK 1O6SA 4AR5A 4LF4H 2XJVA 3PZAA 2UXDH 5IJDA 3T1HH 3J80W 3GOZA 4AHZA 4QBZA 1KOHA 5DM61 2V9SA 2XJTA 3DZEA 5AWAA 2CR8A 3WPDA 4JI0H 4R07A 5MLC3 3RFJA 4CNMA 4B3SH 3TSRE 4R6JA 3JB9j 4XGOA 5GS0A 3MSUA 1VCXA 3PMHG 4FD0A 4X65H 1WWLA 2P1OB 1IU5A 3ULUA 4XGHA 1I94H 3P2AA 4J0MA 2RA8A 3J7AK 1XECA 5EINC 4R6FA 2R9UA 4DR5H 3C6NB 4WYKA 3UL9A 5B0NA 1J5EH 2PVEA 3SB1A 2PSMC 1M9SA 1YRGA 4FHOA 2WQXA 4HQ1A 1FHMA 1SMUA 3QD7X 4WP6A 1R0FA 1FT8A 1RB9A 2Z81A 4XSQA 2BE5D 4AW4A 4TZHA 3ZYJA 3FXIA 5EIOC 2UUCH 4YHHH 3RYGA 4DR2H 4X66H 4L3AA 4LSXC 3M18A 4CC4C 2E5LH 2OMUA 2XWTC 2PYAA 4IM6A 1FQVA 1KOOA 4E9JA 2V70A 4X64H 4LSCA 4Z61C 4JADA 3J7Z1 2JI3A 1XMOH 4R0AA 1VZGA 4LF5H 3O53A 2LCQA 2BNHA 2AYJA 5AI3A 1OTNA 4R09A 3KDKA 2JE1A 1HNZH 3ULVA 4K0KH 5IT9W 1SMMA 1H6UA 1R0IA 3NCVA 5MFZA 3PIO1 1YUXA 4JI6H 4RWTC 4LFBH 1HR0H 4JI5H 2P1QB 4YEBB 1M0ZA 1XNQH 1VZHA 1YUZA 2FT3A 4JI2H 2OMVA 2M6OA 3B0AB 1E8JA 4CNCA 1SMWA 2A6HD 5HDHA 4JI1H 3OJAB 5AZ5A 4DV7H 3VPBE 3RZTA 2MS3A 4DR1H 1SQ0B 2ASTB 2XJPA 3RW6A 2XJQA 3J7Y1 3VQ2A 4LXRA 2O6RA 2VL6A 1S2ZA 1DFJI 2M6PA 1YK4A 2UU9H 3OSSD 4ZN3B 1N36H 2V0EA 3WPCA 1I6UA 1DCEA 1C09A 4E6YA 1D0BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JQD A;  2Z65 A;  4LSX A;  2Y5Q A;  4P91 A;  4PQ8 A;  3W3N A;  3RFJ A;  4CNM A;  4KXF B;  4LXS A;  5HZL B;  3TSR E;  4R6J A;  3JB9 j;  2RR6 A;  4XGO A;  5GS0 A;  1IO0 A;  5B0T A;  2OMZ A;  3RW7 A;  4ECN A;  4GLP A;  4U09 A;  2Z7X A;  3PMH G;  4CP6 A;  4FD0 A;  1XWD C;  4KNG A;  5GMH A;  1WWL A;  4MQW X;  3UL8 A;  1P9A G;  4AY9 X;  4CIL A;  2P1O B;  1G9U A;  2OMT A;  4H09 A;  3ULU A;  4U7L A;  3BZ5 A;  4J0M A;  4LI1 A;  2RA8 A;  4U06 A;  1XEC A;  3G3B A;  1O6V A;  3ZYN A;  4NKG A;  2R9U A;  2CA6 A;  3C6N B;  3OGM B;  4R6F A;  4WYK A;  3UL9 A;  2Z64 A;  5B0N A;  2A0Z A;  3WPG A;  4EZG A;  2P1P B;  2UZX A;  1M9S A;  1YRG A;  4FHO A;  1A4Y A;  2WQX A;  4HQ1 A;  5GMG A;  4M7E A;  4RCW A;  2IFG A;  3OGL B;  4WP6 A;  3CIY A;  1DS9 A;  1FT8 A;  4XOS A;  4Q3G A;  2Z81 A;  4C2B B;  3RGX A;  1XCD A;  3RIZ A;  2OMW A;  4XSQ A;  5IJB A;  2OMY A;  3A79 B;  4FCG A;  1JL5 A;  1A9N A;  3WPH A;  3O6N A;  2OMX A;  3CVR A;  4AW4 A;  2Z66 A;  2P1N B;  5FTT B;  4TZH A;  4R6G A;  2Z63 A;  4KT1 A;  4Q3I A;  1M10 B;  1XKU A;  3FXI A;  4Y61 B;  4Z94 G;  3WPF A;  3ZYJ A;  5A5C A;  4B8C D;  4P8S A;  4Z79 A;  3CIG A;  4BV4 R;  1OTM A;  3E2J A;  4L3A A;  4LSX C;  4LI2 A;  4NKH A;  3M18 A;  4PKI G;  2XWT C;  2OMU A;  4PER A;  3ZYI A;  4BSU A;  4CC4 C;  1GWB A;  1H6T A;  2Z7X B;  4IM6 A;  1FQV A;  1KOO A;  2V70 A;  4LSC A;  4Z61 C;  1O6T A;  4QXE A;  1P8T A;  5CMN A;  4R0A A;  3WPE A;  2Z62 A;  3O53 A;  2P1M B;  3REZ A;  1U0N D;  2BNH A;  2WQW A;  4R58 A;  4UFR A;  5CMP A;  4C2A B;  5AWB A;  3SB4 A;  4R08 A;  2WFH A;  4FS7 A;  4V2C A;  1OTN A;  4R09 A;  3C6O B;  4RCA B;  2JE1 A;  4OQT A;  3C6P B;  4V2E A;  3ULA A;  3ULV A;  4PEQ B;  2UZY A;  1OGQ A;  4J4L A;  4FMZ A;  3OGK B;  1OOK G;  5B4P A;  1H6U A;  4QC0 A;  3W3M A;  3E4G A;  3W3K A;  1LTX A;  2WQU A;  5GS2 B;  4RWT C;  1Z7X W;  4CC4 A;  4U08 A;  4YEB B;  2P1Q B;  1P8V A;  3G04 C;  2ASS B;  3WN4 A;  4LSA A;  1K5G C;  1M0Z A;  2FT3 A;  1M9L A;  3E6J A;  3KJ4 A;  3RFS A;  3VQ1 A;  3ZYO A;  4ARR A;  4I6J B;  3G3A A;  1FO1 A;  4G8A A;  4K17 A;  4BSR A;  2OMV A;  5AWC A;  3P72 A;  4FDW A;  4Q62 A;  4CNC A;  4R6A A;  4R5C A;  1FS2 A;  2XOT A;  1OZN A;  3UN9 A;  4BSS A;  4ECO A;  4M7E C;  3RFE A;  5HDH A;  3W3L A;  3OJA B;  5AZ5 A;  4Z8G A;  4L3F A;  3W3J A;  3OJA A;  4Z64 C;  4GT6 A;  1ZIW A;  3E3Z A;  5AWD A;  2Q4G W;  2V9T B;  4ARN A;  3RJ0 A;  5GMF A;  1SQ0 B;  1W8A A;  2Z82 A;  4PSJ A;  2BEX A;  4V2D A;  2AST B;  2WQV A;  5D3I A;  5LFN A;  5GQR K;  1O6S A;  1XEU A;  2ID5 A;  3UL7 A;  3RW6 A;  3VQ2 A;  2O6Q A;  4LXR A;  1PGV A;  2O6R A;  5IJD A;  1DFJ I;  1K5D C;  2O6S A;  4MN8 B;  1QYY A;  4R5D A;  3W3G A;  3WPB A;  3GOZ A;  3G06 A;  5IYX C;  4QBZ A;  5IJC A;  1KOH A;  3WPI A;  3M19 A;  3WPC A;  2V9S A;  1DCE A;  1OTO A;  3RGZ A;  3DZE A;  5AWA A;  3WPD A;  2ELL A;  2JE0 A;  4R07 A;  3G39 A;  1D0B A; 
#chains in the Genus database with same CATH topology
 4WAL A;  2Z65 A;  1V9N A;  1ZZK A;  2KN9 A;  4AI2 A;  4LSX A;  4A3G L;  2VKC A;  2Y5Q A;  2HR5 A;  3H9C A;  4LF7 H;  3H97 A;  4PQ8 A;  4A3F L;  4KXF B;  4LXS A;  2F4V H;  4OD6 A;  5HZL B;  1TWC L;  1H7V A;  1AN7 A;  1IBK H;  2RR6 A;  3FAU A;  1Z2I A;  2Z0S A;  1IO0 A;  1S20 A;  2OMZ A;  1TWA L;  3RW7 A;  4ECN A;  2RFK B;  4GS7 D;  3EZJ A;  2E2H L;  2Z7X A;  4CP6 A;  4NXM H;  4KNG A;  1RWD A;  4QIW P;  4YWM A;  3UL8 A;  3LWR B;  1P9A G;  1G9U A;  5DM7 1;  1BQ8 A;  4AR3 A;  1RYT A;  3LWQ B;  4U7L A;  3BZ5 A;  4QMF B;  2CKA A;  2ANR A;  1O6V A;  2WAQ P;  3GTJ L;  2VQE H;  5FLX W;  4XXB B;  3UOE A;  2Z64 A;  2JEA I;  2APO B;  5JVH 1;  4DR7 H;  2UZX A;  4DV2 H;  4A3D L;  5IYD L;  4M7E A;  4G08 A;  1YK5 A;  2JI2 A;  3WWN B;  1DS9 A;  1FJG H;  4XOS A;  4Q3G A;  1WVN A;  4C2B B;  3RGX A;  4OCH A;  2OMY A;  1WCM L;  2GMG A;  4C3H L;  1A9N A;  1ZRP A;  2OMX A;  2Z66 A;  2RDV A;  2P1N B;  3HOW L;  4R6G A;  4H8A A;  4AHY A;  2Z63 A;  4KT1 A;  5A5C A;  3KYU A;  4JV5 H;  3WPF A;  4P8S A;  3H9B A;  2XJR A;  5GAG c;  3S2H L;  4BV4 R;  1OTM A;  3CIG A;  5FLM L;  4NKH A;  4M7E C;  4BBR L;  1NNQ A;  3ZYI A;  3HOX L;  4A3E L;  2XJU A;  1ZZI A;  4ME3 A;  3GR5 A;  1X4N A;  3MPS A;  1P8T A;  4JI3 H;  2V0F A;  4OX9 H;  3I0P A;  1FKA H;  2QND A;  2LTM A;  3REZ A;  2WQW A;  1LKP A;  2A69 D;  2K2D A;  4R58 A;  4UFR A;  1WE8 A;  3SB4 A;  4V2C A;  1VZI A;  2E2J L;  3KYW A;  3ULA A;  2NYD A;  5M3M L;  4FMZ A;  3KDG A;  3OGK B;  3I4N L;  4LF9 H;  5B4P A;  4BY7 L;  2ERJ A;  5IY0 A;  3HOZ L;  1YV1 A;  3PIP 1;  2A68 D;  3E4G A;  2JA6 L;  5GS2 B;  2ZIX A;  1Z7X W;  3M3Y L;  4CC4 A;  3LWV B;  4POG A;  3G04 C;  2AUS B;  2Z3Q B;  3WN4 A;  1T9O A;  2CPQ A;  3RFS A;  4IFD G;  3ZYO A;  3VQ1 A;  4B3T H;  1F4L A;  3G3A A;  4G8A A;  5AWC A;  3LNL A;  4DV3 H;  1FS2 A;  4ECO A;  4JAF A;  3NFP I;  1FHH A;  3W3J A;  2NVX L;  3OJA A;  4Z64 C;  2VQF H;  5AWD A;  5GMF A;  2PPT A;  4X62 H;  4DV5 H;  2Z82 A;  1WJV A;  2PT7 G;  1IBM H;  4GKJ H;  2WQV A;  1LKO A;  2ID5 A;  3UL7 A;  4A93 L;  3OET A;  2O6Q A;  3HJY B;  2O6S A;  2V3B B;  4MN8 B;  4R5D A;  3WPB A;  5IYX C;  3G06 A;  2CWF A;  1QYB A;  5IJC A;  3M19 A;  1QCV A;  3PKJ A;  3IU3 I;  3WWL A;  1X4M A;  1OTO A;  1V8C A;  4JAG A;  3RGZ A;  1RYQ A;  2K1H A;  3G39 A;  3I4M L;  3HOU L;  3KYV A;  1IW7 D;  5JEA G;  4P91 A;  1NXU A;  3RZ6 A;  4GKK H;  4DV1 H;  4LF6 H;  1J5K A;  1I3Q L;  2D9I A;  4U09 A;  3S17 L;  1XWD C;  5GMH A;  3SS2 A;  2PQU A;  4MQW X;  2NVY L;  2CTJ A;  4CIL A;  3S2D L;  3GTQ L;  3J81 W;  4LIJ A;  3H0G L;  4A3M L;  4LI1 A;  4U06 A;  4C2M 1;  3HKZ P;  5MGN A;  3G3B A;  4KHP H;  1OWB A;  3ZG6 A;  3OGM B;  4TVM A;  4B3M H;  4UY8 1;  2NVQ L;  4EZG A;  1PFV A;  1F0X A;  2P1P B;  3KYY A;  1SEI A;  3JAM W;  4B8T A;  1A4Y A;  2M6Q A;  1QQT A;  3S16 L;  4RCW A;  2IFG A;  5M5Y L;  4DUY H;  2JA9 A;  3OGL B;  3CIY A;  5FJ8 L;  1XCD A;  5LMU H;  2OMW A;  1BE7 A;  2PMZ P;  3A79 B;  1CAD A;  4LHL A;  3WPH A;  3CVR A;  3L7Z C;  3HJW B;  2DSX A;  1ODH A;  3LPE B;  5BR8 H;  5FTT B;  3GTM L;  1HNX H;  2UUA H;  4K9F A;  1ZZJ A;  4Z94 G;  4AIM A;  4JI4 H;  5DT9 A;  4B8C D;  4B3R H;  3A44 A;  3B08 B;  4Z8G A;  4BSU A;  4PKI G;  4PER A;  1BFY A;  3HAX C;  3PWF A;  1N33 H;  2ANN A;  1H6T A;  2Z7X B;  2Z3R B;  1WHR A;  1O6T A;  2L0Z A;  3WPE A;  4LFA H;  4C2A B;  1DVB A;  5CMP A;  1LKM A;  1VBI A;  3P8B A;  4DUZ H;  4FS7 A;  2H12 A;  4A3J L;  3C6O B;  4RCA B;  5MF6 A;  3VKE A;  5MFP A;  4OQT A;  4V2E A;  1N32 H;  2Y3M A;  5IP9 L;  1R0H A;  3PO3 L;  2J9U B;  1OOK G;  1IRO A;  2O4C A;  4C3I L;  1ZTG A;  2ZM6 H;  4QC0 A;  3W3M A;  3W3K A;  3QQC E;  2CTF A;  1PFY A;  1N34 H;  2WQU A;  4AQY H;  3GTO L;  2C6B A;  1S24 A;  1S30 A;  2QL0 A;  5C3E L;  4DR4 H;  1IU6 A;  1P8V A;  1P7P A;  1K5G C;  3PL5 A;  4ZN1 B;  1M9L A;  3KJ4 A;  4AI3 A;  3GTG L;  2LF0 A;  5RXN A;  2M4Y A;  4ARR A;  4I6J B;  2JA5 L;  1FO1 A;  4NZR M;  3P72 A;  4Q62 A;  4R6A A;  4NXN H;  1RDG A;  4AHX A;  4AR4 A;  4AHW A;  5H1S c;  2XOT A;  4RXN A;  4DR3 H;  1XNR H;  1B2J A;  1BRF A;  2UXC H;  5GAH c;  3RF2 A;  2UXB H;  3PKI A;  1ZIW A;  2CKC A;  2CTL A;  2G8Y A;  4ARN A;  2A6E D;  4JI8 H;  1W8A A;  2BEX A;  7RXN A;  4V2D A;  4WFN 1;  2PY9 A;  5D3I A;  1XEU A;  3S1R L;  2NN6 G;  5LL6 b;  1PGV A;  4G6B A;  1DTJ A;  1T9Q A;  2FPH X;  2LTL A;  1K5D C;  1QYY A;  1T9P A;  2CWH A;  3W3G A;  3K35 A;  5IWA H;  5GAD c;  3WPI A;  4A3I L;  4EC5 A;  4FJS A;  4BXX L;  1PQX A;  3GTK L;  2E3U A;  1EC6 A;  2ELL A;  2JE0 A;  2JQD A;  1KHM A;  3W3N A;  1LTL A;  2WB1 P;  4LHN A;  4NZT M;  2OPU A;  4OO1 G;  4A3B L;  1JYB A;  4DV4 H;  5AN9 H;  3GTL L;  5B0T A;  5M3F L;  1NXE A;  4GLP A;  2NVT L;  4BA2 I;  5IYB L;  3T1Y H;  4AY9 X;  4H09 A;  2OMT A;  4AI1 A;  1B13 A;  1J4W A;  4AM3 A;  1R0G A;  3S1M L;  3ZYN A;  4NKG A;  2CA6 A;  3WPG A;  2A0Z A;  4V19 6;  5GMG A;  5M5W L;  1NXG A;  2HVY C;  4YY3 H;  4C3J L;  2A1S A;  2PVX A;  5K36 G;  1TWF L;  3RIZ A;  4JAE A;  1Y1W L;  5C4X L;  2O5J D;  4FCG A;  1JL5 A;  5IJB A;  4POF A;  3O6N A;  2YU9 L;  3FKI L;  4DV6 H;  4LFC H;  2Y0S P;  2BL5 A;  2KKD A;  4WAN A;  4YWL A;  1IBL H;  5JVG 1;  5C4J L;  5LMN H;  4JVH A;  1M10 B;  1X9Z A;  4AI0 A;  1B71 A;  4AR6 A;  2VUM L;  1XKU A;  2M4V A;  5IYC L;  4Z79 A;  3E2J A;  4JI7 H;  4LI2 A;  3QVD A;  1GWB A;  4PDB A;  3FDJ A;  4QXE A;  5CMN A;  2UUB H;  1RDV A;  2Z62 A;  2P1M B;  1U0N D;  5AWB A;  2XJS A;  6RXN A;  3GTP L;  4R08 A;  1Z92 B;  2WFH A;  2JI1 A;  2ZQE A;  4A3C L;  2B5I D;  3C6P B;  3JR7 A;  2LRR A;  4JYA H;  4TPU A;  4PEQ B;  2UZY A;  1OGQ A;  4FJU A;  3HOV L;  4J4L A;  4LF8 H;  3S1N L;  1SFO L;  1B2O A;  2M8W A;  2CTK A;  1LTX A;  2JA8 L;  2ERS A;  5GAE c;  3S15 L;  4DR6 H;  1IRN A;  5A2Q W;  4U08 A;  1BQ9 A;  4A3L L;  2ASS B;  3MQK B;  4LSA A;  2CTM A;  2AQC A;  3E6J A;  1DX8 A;  5K2M E;  4K17 A;  1XRH A;  3LWP B;  2B63 L;  8RXN A;  1TWG L;  3GKU A;  4FDW A;  3GAB A;  4BSR A;  1OWC A;  4R5C A;  4DV0 H;  4BSS A;  1OZN A;  3UN9 A;  3RFE A;  3W3L A;  1S03 G;  1R0J A;  2C6A A;  3K7A L;  3OTO H;  5C0X G;  3KYX A;  1HNW H;  4L3F A;  4GT6 A;  1DT4 A;  3E3Z A;  5AI2 A;  2Q4G W;  4Y61 B;  2HH2 A;  1X0A A;  2V9T B;  3RJ0 A;  2JA7 L;  2HHH H;  1R9T L;  2P2R A;  1XMQ H;  4PSJ A;  1CAA A;  5M5X L;  4U67 1;  3PO2 L;  5IP7 L;  5LFN A;  5GQR K;  1O6S A;  1TUA A;  2JE6 I;  4AR5 A;  4LF4 H;  2XJV A;  3PZA A;  2UXD H;  5IJD A;  3T1H H;  2JEB I;  3J80 W;  1PFW A;  4JVY A;  3GOZ A;  4AHZ A;  2YQR A;  1KOH A;  4QBZ A;  4Q3I A;  5DM6 1;  3S1Q L;  2V9S A;  2XJT A;  3RZO L;  3DZE A;  5AWA A;  2CR8 A;  4Y7N L;  3WPD A;  2X06 A;  4JI0 H;  1K83 L;  4R07 A;  5MLC 3;  4A3K L;  1K1G A;  2OPV A;  3H3V M;  3RFJ A;  4CNM A;  2AXY A;  4B3S H;  3TSR E;  4R6J A;  3JB9 j;  4XGO A;  5C44 L;  5GS0 A;  3MSU A;  1PFU A;  4BY1 L;  2BA0 A;  1PZX A;  1I6H L;  1VCX A;  3PMH G;  4FD0 A;  4X65 H;  2CTE A;  3LWO B;  1WWL A;  2P1O B;  1IU5 A;  3ULU A;  2JVZ A;  4XGH A;  1I94 H;  2EY4 E;  3P2A A;  4J0M A;  2RA8 A;  3J7A K;  1XEC A;  5EIN C;  4R6F A;  2R9U A;  4DR5 H;  3C6N B;  4WYK A;  4Y52 L;  3UL9 A;  5B0N A;  1J5E H;  2R7Z L;  2PVE A;  3SB1 A;  2PSM C;  4NBQ A;  1M9S A;  1YRG A;  4FHO A;  2WQX A;  4HQ1 A;  1FHM A;  4BA1 I;  1SMU A;  3QD7 X;  3U1K A;  4WP6 A;  1R0F A;  1MSZ A;  2FMR A;  1RB9 A;  1FT8 A;  2Z81 A;  4XSQ A;  2BE5 D;  4AW4 A;  4BBS L;  3H99 A;  4TZH A;  3ZYJ A;  3FXI A;  5EIO C;  1VIG A;  2JZX A;  2UUC H;  4YHH H;  3RYG A;  4DR2 H;  2FFM A;  4X66 H;  4L3A A;  4LSX C;  3M18 A;  4CC4 C;  2E5L H;  2OMU A;  2XWT C;  2PYA A;  4IM6 A;  1FQV A;  1KOO A;  4E9J A;  2V70 A;  4X64 H;  4LSC A;  4Z61 C;  1I50 L;  3RZD L;  4JAD A;  3J7Z 1;  2JI3 A;  3CQZ L;  1XMO H;  1VZG A;  1Y1V L;  4LF5 H;  3O53 A;  4R0A A;  2LCQ A;  2BNH A;  2AYJ A;  5AI3 A;  1OTN A;  1VIH A;  4R09 A;  1UG8 A;  3KDK A;  2JE1 A;  1HNZ H;  3ULV A;  4K0K H;  5IT9 W;  4AYB P;  1SMM A;  1H6U A;  1R0I A;  3NCV A;  2HH3 A;  5MFZ A;  3PIO 1;  1YUX A;  4JI6 H;  4RWT C;  4LFB H;  1TWH L;  3M4O L;  1HR0 H;  4JI5 H;  2P1Q B;  4YEB B;  3AEV B;  4X6A L;  1M0Z A;  1XNQ H;  1VZH A;  1YUZ A;  2FT3 A;  3S14 L;  4JI2 H;  1WTJ A;  2CPM A;  3V69 A;  2OMV A;  2M6O A;  3B0A B;  2DGR A;  2R92 L;  1E8J A;  4CNC A;  1SMW A;  2A6H D;  5HDH A;  4JI1 H;  3OJA B;  5AZ5 A;  4DV7 H;  3VPB E;  3HOY L;  3RZT A;  2MS3 A;  4DR1 H;  1SQ0 B;  2R93 L;  2AST B;  2XJP A;  3RW6 A;  2XJQ A;  3J7Y 1;  3VQ2 A;  4LXR A;  2O6R A;  2VL6 A;  1S2Z A;  1DFJ I;  2M6P A;  1YK4 A;  2UU9 H;  3OSS D;  4ZN3 B;  2V0E A;  1N36 H;  3WPC A;  2MJH A;  2E2I L;  1I6U A;  1DCE A;  1C09 A;  4E6Y A;  1D0B A; 
#chains in the Genus database with same CATH homology
 2Z65 A;  4LSX A;  2KN9 A;  4AI2 A;  2VKC A;  2Y5Q A;  2HR5 A;  4LF7 H;  4PQ8 A;  4KXF B;  4LXS A;  2F4V H;  4OD6 A;  5HZL B;  1AN7 A;  1H7V A;  1IBK H;  2RR6 A;  3FAU A;  1IO0 A;  2OMZ A;  3RW7 A;  4ECN A;  4GS7 D;  3EZJ A;  2Z7X A;  4CP6 A;  4NXM H;  4KNG A;  1RWD A;  4YWM A;  3UL8 A;  1P9A G;  1G9U A;  5DM7 1;  1BQ8 A;  4AR3 A;  1RYT A;  4U7L A;  3BZ5 A;  2CKA A;  1O6V A;  2VQE H;  5FLX W;  4XXB B;  2Z64 A;  4DR7 H;  5JVH 1;  2UZX A;  4DV2 H;  4M7E A;  4G08 A;  1YK5 A;  2JI2 A;  3WWN B;  1DS9 A;  1FJG H;  4XOS A;  4Q3G A;  4C2B B;  3RGX A;  4OCH A;  2OMY A;  2GMG A;  1A9N A;  1ZRP A;  2OMX A;  2Z66 A;  2RDV A;  2P1N B;  4R6G A;  2Z63 A;  4AHY A;  4KT1 A;  5A5C A;  3KYU A;  4JV5 H;  3WPF A;  4P8S A;  3CIG A;  2XJR A;  5GAG c;  4BV4 R;  1OTM A;  4NKH A;  4M7E C;  3ZYI A;  1NNQ A;  2XJU A;  4ME3 A;  3GR5 A;  3MPS A;  1P8T A;  4JI3 H;  2V0F A;  4OX9 H;  1FKA H;  3REZ A;  2WQW A;  1LKP A;  2A69 D;  2K2D A;  4R58 A;  4UFR A;  3SB4 A;  4V2C A;  1VZI A;  3KYW A;  3ULA A;  2NYD A;  4FMZ A;  3KDG A;  3OGK B;  4LF9 H;  5B4P A;  2ERJ A;  5IY0 A;  1YV1 A;  3PIP 1;  2A68 D;  3E4G A;  5GS2 B;  2ZIX A;  1Z7X W;  4CC4 A;  4POG A;  3G04 C;  2Z3Q B;  3WN4 A;  1T9O A;  3RFS A;  3VQ1 A;  3ZYO A;  4B3T H;  3G3A A;  4G8A A;  5AWC A;  3LNL A;  4DV3 H;  1FS2 A;  4ECO A;  4JAF A;  3NFP I;  1FHH A;  3W3J A;  3OJA A;  4Z64 C;  2VQF H;  5AWD A;  5GMF A;  2PPT A;  4X62 H;  4DV5 H;  2Z82 A;  1WJV A;  2PT7 G;  1IBM H;  4GKJ H;  2WQV A;  1LKO A;  2ID5 A;  3UL7 A;  3OET A;  2O6Q A;  2O6S A;  2V3B B;  4MN8 B;  4R5D A;  3WPB A;  5IYX C;  3G06 A;  5IJC A;  1QYB A;  3M19 A;  1QCV A;  3PKJ A;  3IU3 I;  3WWL A;  1OTO A;  4JAG A;  3RGZ A;  1RYQ A;  3G39 A;  3KYV A;  1IW7 D;  4P91 A;  3RZ6 A;  4GKK H;  4DV1 H;  4LF6 H;  2D9I A;  4U09 A;  1XWD C;  5GMH A;  3SS2 A;  4MQW X;  4CIL A;  3J81 W;  4LI1 A;  4U06 A;  5MGN A;  3G3B A;  4KHP H;  1OWB A;  3ZG6 A;  3OGM B;  4TVM A;  4B3M H;  4UY8 1;  4EZG A;  1F0X A;  2P1P B;  3KYY A;  1SEI A;  3JAM W;  1A4Y A;  4RCW A;  2IFG A;  4DUY H;  3OGL B;  3CIY A;  1XCD A;  5LMU H;  2OMW A;  1BE7 A;  3A79 B;  1CAD A;  4LHL A;  3WPH A;  3CVR A;  2DSX A;  1ODH A;  3LPE B;  5BR8 H;  5FTT B;  1HNX H;  2UUA H;  4K9F A;  4Z94 G;  4JI4 H;  5DT9 A;  4B8C D;  4B3R H;  3A44 A;  3B08 B;  4Z8G A;  4BSU A;  4PKI G;  4PER A;  1BFY A;  3PWF A;  1N33 H;  1H6T A;  2Z7X B;  2Z3R B;  1O6T A;  2L0Z A;  3WPE A;  4LFA H;  4C2A B;  1DVB A;  5CMP A;  1LKM A;  3P8B A;  4DUZ H;  4FS7 A;  2H12 A;  3C6O B;  4RCA B;  5MF6 A;  5MFP A;  4OQT A;  4V2E A;  1N32 H;  2Y3M A;  1R0H A;  2J9U B;  1OOK G;  1IRO A;  2O4C A;  2ZM6 H;  4QC0 A;  3W3M A;  3W3K A;  3QQC E;  1N34 H;  2WQU A;  4AQY H;  2C6B A;  1S24 A;  1S30 A;  2QL0 A;  4DR4 H;  1P8V A;  1IU6 A;  1K5G C;  3KJ4 A;  4ZN1 B;  1M9L A;  4AI3 A;  2LF0 A;  5RXN A;  2M4Y A;  4ARR A;  4I6J B;  1FO1 A;  4NZR M;  3P72 A;  4Q62 A;  4R6A A;  4NXN H;  1RDG A;  4AHX A;  4AR4 A;  4AHW A;  5H1S c;  2XOT A;  4RXN A;  4DR3 H;  1XNR H;  1B2J A;  1BRF A;  2UXC H;  5GAH c;  3RF2 A;  2UXB H;  3PKI A;  1ZIW A;  2CKC A;  4ARN A;  2A6E D;  4JI8 H;  1W8A A;  2BEX A;  7RXN A;  4V2D A;  4WFN 1;  5D3I A;  1XEU A;  5LL6 b;  1PGV A;  4G6B A;  1T9Q A;  2FPH X;  1K5D C;  1QYY A;  1T9P A;  3W3G A;  3K35 A;  5IWA H;  5GAD c;  3WPI A;  4EC5 A;  2ELL A;  2JE0 A;  2JQD A;  3W3N A;  1LTL A;  4LHN A;  4NZT M;  1JYB A;  4DV4 H;  5AN9 H;  5B0T A;  1NXE A;  4GLP A;  3T1Y H;  4AY9 X;  4H09 A;  2OMT A;  4AI1 A;  1B13 A;  1R0G A;  3ZYN A;  4NKG A;  2CA6 A;  3WPG A;  2A0Z A;  4V19 6;  5GMG A;  1NXG A;  4YY3 H;  2PVX A;  3RIZ A;  4JAE A;  5IJB A;  2O5J D;  4FCG A;  1JL5 A;  4POF A;  3O6N A;  4DV6 H;  4LFC H;  2KKD A;  4YWL A;  1IBL H;  5JVG 1;  5LMN H;  1M10 B;  1XKU A;  4Q3I A;  1X9Z A;  4AI0 A;  1B71 A;  4AR6 A;  2M4V A;  4Z79 A;  3E2J A;  4JI7 H;  4LI2 A;  3QVD A;  1GWB A;  4PDB A;  4QXE A;  5CMN A;  2UUB H;  1RDV A;  2Z62 A;  2P1M B;  1U0N D;  5AWB A;  2XJS A;  6RXN A;  4R08 A;  1Z92 B;  2WFH A;  2JI1 A;  2ZQE A;  2B5I D;  3C6P B;  4JYA H;  4TPU A;  4PEQ B;  2UZY A;  1OGQ A;  4J4L A;  4LF8 H;  1B2O A;  1LTX A;  2ERS A;  5GAE c;  4DR6 H;  1IRN A;  5A2Q W;  4U08 A;  1BQ9 A;  2ASS B;  4LSA A;  3E6J A;  1DX8 A;  5K2M E;  4K17 A;  4BSR A;  8RXN A;  4FDW A;  3GAB A;  1OWC A;  4R5C A;  4DV0 H;  4BSS A;  1OZN A;  3UN9 A;  3RFE A;  3W3L A;  1S03 G;  1R0J A;  2C6A A;  3OTO H;  3KYX A;  1HNW H;  4L3F A;  4GT6 A;  3E3Z A;  5AI2 A;  2Q4G W;  4Y61 B;  2V9T B;  3RJ0 A;  2HHH H;  1XMQ H;  4PSJ A;  1CAA A;  4U67 1;  5LFN A;  5GQR K;  1O6S A;  4AR5 A;  4LF4 H;  2XJV A;  3PZA A;  2UXD H;  5IJD A;  3T1H H;  3J80 W;  3GOZ A;  4AHZ A;  4QBZ A;  1KOH A;  5DM6 1;  2V9S A;  2XJT A;  3DZE A;  5AWA A;  2CR8 A;  3WPD A;  4JI0 H;  4R07 A;  5MLC 3;  3RFJ A;  4CNM A;  4B3S H;  3TSR E;  4R6J A;  3JB9 j;  4XGO A;  5GS0 A;  3MSU A;  1VCX A;  3PMH G;  4FD0 A;  4X65 H;  1WWL A;  2P1O B;  1IU5 A;  3ULU A;  4XGH A;  1I94 H;  3P2A A;  4J0M A;  2RA8 A;  3J7A K;  1XEC A;  5EIN C;  4R6F A;  2R9U A;  4DR5 H;  3C6N B;  4WYK A;  3UL9 A;  5B0N A;  1J5E H;  2PVE A;  3SB1 A;  2PSM C;  1M9S A;  1YRG A;  4FHO A;  2WQX A;  4HQ1 A;  1FHM A;  1SMU A;  3QD7 X;  4WP6 A;  1R0F A;  1FT8 A;  1RB9 A;  2Z81 A;  4XSQ A;  2BE5 D;  4AW4 A;  4TZH A;  3ZYJ A;  3FXI A;  5EIO C;  2UUC H;  4YHH H;  3RYG A;  4DR2 H;  4X66 H;  4L3A A;  4LSX C;  3M18 A;  4CC4 C;  2E5L H;  2OMU A;  2XWT C;  2PYA A;  4IM6 A;  1FQV A;  1KOO A;  4E9J A;  2V70 A;  4X64 H;  4LSC A;  4Z61 C;  4JAD A;  3J7Z 1;  2JI3 A;  1XMO H;  4R0A A;  1VZG A;  4LF5 H;  3O53 A;  2LCQ A;  2BNH A;  2AYJ A;  5AI3 A;  1OTN A;  4R09 A;  3KDK A;  2JE1 A;  1HNZ H;  3ULV A;  4K0K H;  5IT9 W;  1SMM A;  1H6U A;  1R0I A;  3NCV A;  5MFZ A;  3PIO 1;  1YUX A;  4JI6 H;  4RWT C;  4LFB H;  1HR0 H;  4JI5 H;  2P1Q B;  4YEB B;  1M0Z A;  1XNQ H;  1VZH A;  1YUZ A;  2FT3 A;  4JI2 H;  2OMV A;  2M6O A;  3B0A B;  1E8J A;  4CNC A;  1SMW A;  2A6H D;  5HDH A;  4JI1 H;  3OJA B;  5AZ5 A;  4DV7 H;  3VPB E;  3RZT A;  2MS3 A;  4DR1 H;  1SQ0 B;  2AST B;  2XJP A;  3RW6 A;  2XJQ A;  3J7Y 1;  3VQ2 A;  4LXR A;  2O6R A;  2VL6 A;  1S2Z A;  1DFJ I;  2M6P A;  1YK4 A;  2UU9 H;  3OSS D;  4ZN3 B;  1N36 H;  2V0E A;  3WPC A;  1I6U A;  1DCE A;  1C09 A;  4E6Y A;  1D0B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...