4B8CD

Nuclease module of the yeast ccr4-not complex
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
686
structure length
318
Chain Sequence
VNASNPLLHPHLDDPSLLNNPIWKLQLHLAAVSAQSLGQPNIYARQNAMKKYLCTKQALMEMADTLTDSKTAKDDQLWHALDLSNLQIFNISANIFKYDFLTRLYLNGNSLTELPAEIKNLSNLRVLDLSHNRLTSLPAELGSCFQLKYFYFFDNMVTTLPWEFGNLCNLQFLGVEGNPLEKQFLKILTEKSVTGLIFYLRDNRPEIPLPHETLCQHYATPKMYRYTPSWALSWDYRRNKLKEQILSYDSDLLCLQVESKTFEEYWVPTGIFVDGCCIFFLPFTNFTPSFTDVIEVDPEYVSKFIGFPNDKFPSDHIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/cell cycle
molecule keywords POLY(A) RIBONUCLEASE POP2
publication title Architecture of the Nuclease Module of the Yeast Ccr4-not Complex: The not1-Caf1-Ccr4 Interaction.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 68
structure length 318
sequence length 686
chains with identical sequence J, K, L
ec nomenclature ec 3.1.13.4: Poly(A)-specific ribonuclease.
pdb deposition date 2012-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF03372 Exo_endo_phos Endonuclease/Exonuclease/phosphatase family
D PF12799 LRR_4 Leucine Rich repeats (2 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.210 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 4b8cD03
3.30.1370.190 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 4b8cD02
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4b8cD01
4V2CA 5IYXC 3O6NA 4U7LA 2OMZA 1K5GC 3M19A 1OZNA 2WQWA 4G8AA 4WP6A 4R09A 3ULUA 4CNCA 4PSJA 3KJ4A 1O6TA 4U09A 2Z7XB 3WPBA 3M18A 1O6VA 3UN9A 1YRGA 4PEQB 1A4YA 4RWTC 1OTOA 3P72A 2UZYA 2O6QA 5D3IA 4R58A 3WPCA 1SQ0B 2O6RA 3ZYJA 4FMZA 4LI1A 3CIGA 2Z63A 3RFEA 4R6AA 1H6UA 2P1PB 1XCDA 3W3GA 2ELLA 2WQUA 4L3AA 2Z66A 3RW6A 1M10B 1WWLA 2OMUA 3G3BA 1KOOA 3VQ2A 4NKGA 2Z64A 2IFGA 4LXRA 4LSXA 4Z64C 3OJAA 2ID5A 4B8CD 3REZA 2Z65A 1FQVA 5CMPA 3GOZA 4GT6A 4AW4A 5B0TA 3WPIA 2XOTA 4QC0A 3WN4A 2OMYA 1PGVA 3E4GA 2OMXA 5GS0A 3RFSA 4P91A 4ECNA 3RGZA 2JE0A 1QYYA 4NKHA 4V2EA 4CNMA 1XKUA 3G04C 2R9UA 4CILA 4M7EA 1M0ZA 4J4LA 4Y61B 3E2JA 3OGLB 4FS7A 2BNHA 1XECA 2Z7XA 4CP6A 1M9LA 2Z81A 4C2BB 4IM6A 4RCAB 4R08A 4U08A 5FTTB 5AWDA 2RR6A 2P1OB 2BEXA 1M9SA 4Z61C 1OTMA 2P1QB 2P1MB 4YEBB 1D0BA 5LFNA 3OGKB 4R6FA 2OMTA 1LTXA 1GWBA 4PERA 4LSXC 1DCEA 1G9UA 2Z62A 4FHOA 4R0AA 4LXSA 2JE1A 3UL9A 3C6OB 1OOKG 4Z8GA 3C6PB 1U0ND 3BZ5A 4LSAA 4KNGA 4ARRA 5HDHA 3RW7A 3ULAA 2WQVA 5HZLB 2FT3A 3DZEA 1FS2A 3W3KA 3PMHG 4Q3IA 4R5DA 3A79B 5AZ5A 3WPDA 3CIYA 2OMWA 5GQRK 3W3NA 1IO0A 2XWTC 4Q3GA 3WPEA 3RFJA 4ECOA 1W8AA 4WYKA 3RJ0A 3W3LA 4R6JA 1DFJI 4R6GA 4K17A 4Q62A 3OJAB 4EZGA 4AY9X 3G06A 2UZXA 4ARNA 4CC4A 5IJCA 5A5CA 4R5CA 2ASTB 1DS9A 4HQ1A 3OGMB 4LSCA 5CMNA 4KT1A 2Z82A 4FDWA 3SB4A 4BSSA 4H09A 5B4PA 3W3JA 4R07A 4MQWX 3G39A 3UL7A 4PQ8A 3ZYIA 5GS2B 5AWBA 1XEUA 3RIZA 2A0ZA 3CVRA 4XGOA 1P8TA 3C6NB 2V70A 4MN8B 4L3FA 5AWCA 4J0MA 4U06A 5B0NA 4LI2A 1H6TA 3W3MA 4XOSA 1FT8A 1O6SA 2P1NB 4FCGA 3UL8A 4BSUA 4RCWA 2O6SA 1P8VA 4OQTA 1OGQA 4V2DA 3FXIA 1KOHA 4FD0A 1FO1A 1ZIWA 4BV4R 3RGXA 4XSQA 2OMVA 3WPGA 4M7EC 2V9TB 4GLPA 3E3ZA 4Z79A 4CC4C 1Z7XW 3VQ1A 5AWAA 4Z94G 4QBZA 3ZYNA 1OTNA 2JQDA 2V9SA 2Q4GW 5IJBA 3O53A 3TSRE 4UFRA 3ZYOA 4KXFB 1XWDC 2RA8A 3JB9j 2Y5QA 3E6JA 4P8SA 4BSRA 4QXEA 1A9NA 3ULVA 1P9AG 5GMGA 2WFHA 2ASSB 5IJDA 5GMFA 4I6JB 5GMHA 4TZHA 3WPHA 4C2AB 2CA6A 1JL5A 1K5DC 4PKIG 3WPFA 2WQXA 3G3AA
chains in the Genus database with same CATH superfamily
4V2CA 1RYQA 1ZZKA 5IYXC 2JZXA 3O6NA 3RZTA 1VZGA 2OMZA 2A69D 1K5GC 4U7LA 2PVEA 2CKCA 1NXEA 4LF6H 3M19A 2K2DA 1OZNA 3S17L 4JI8H 2WQWA 1Z92B 1T9QA 2PPTA 4DR2H 4G8AA 5IP7L 2VQFH 4WP6A 4A3CL 1I6HL 3S15L 4R09A 1VCXA 2XJVA 2RFKB 3ULUA 1B71A 1VIGA 4PSJA 3KJ4A 4CNCA 3H3VM 1SMWA 1J4WA 1O6TA 4U09A 2Z7XB 3JR7A 3GTPL 1XMQH 2ANRA 4A3JL 4DV6H 2DSXA 1SEIA 3WPBA 3M18A 4C3IL 1O6VA 3UN9A 4C3JL 3WWNB 2M8WA 4JI0H 1YRGA 4PEQB 3HKZP 4G6BA 3B08B 1K83L 2CPMA 3KYVA 3S1QL 2PMZP 1A4YA 4AI1A 5LL6b 4RWTC 3RYGA 2NVQL 1OTOA 3HJWB 3P72A 2UZYA 1MSZA 2Z3RB 2CPQA 2O6QA 5D3IA 1YK5A 3QQCE 4UY81 1XRHA 3S2HL 3MSUA 2M6QA 5EINC 4JAFA 2WB1P 3KYUA 1ODHA 2ANNA 4R58A 3WPCA 4A3LL 3RZ6A 4OX9H 2J9UB 1SQ0B 1PFVA 3P2AA 2O6RA 3ZYJA 2BE5D 4FMZA 4LI1A 3GTJL 3CIGA 5C4JL 1HR0H 4NXMH 2Z63A 3RFEA 4R6AA 1H6UA 2ZM6H 2P1PB 4LHNA 2O4CA 2M6PA 1R0IA 4BBRL 1XCDA 3W3GA 3VPBE 1C09A 3J7Y1 2ELLA 2WQUA 1UG8A 5C0XG 4L3AA 1TWCL 1M10B 2Z66A 1WWLA 3RW6A 2VUML 2QNDA 4AI3A 2OMUA 3G3BA 2A6ED 4GKKH 3RJ0A 1KOOA 3VQ2A 1DTJA 4NKGA 2Z64A 1FHMA 2Y3MA 2JE6I 2G8YA 3PO3L 4B8TA 3H9CA 4BY1L 2IFGA 2JA6L 4LXRA 2V0FA 1RB9A 2NN6G 2VL6A 4AYBP 4LSXA 4OO1G 4YWMA 4Z64C 3HAXC 1ZRPA 3OJAA 1P7PA 2ID5A 4B8CD 3GKUA 3REZA 2Z65A 5RXNA 4BA1I 1CAAA 4AHYA 1FQVA 2CTKA 3GOZA 5CMPA 2R92L 4GT6A 5GAGc 4AW4A 5B0TA 3WPIA 2XOTA 2PQUA 4JV5H 2ZIXA 4QC0A 2XJTA 7RXNA 2OMYA 3WN4A 2JEBI 4JYAH 1PGVA 5M5WL 2XJPA 4Y52L 4AQYH 3LWQB 3GTML 5LMUH 4A3GL 1IW7D 3E4GA 2CTFA 2GMGA 2APOB 2OMXA 1F0XA 4NZRM 1RDVA 4JI3H 4DV5H 1Y1VL 2JEAI 5GS0A 3RFSA 3EZJA 4RXNA 2PY9A 4B3RH 4P91A 5MFZA 2CWHA 4AHZA 4ECNA 1R0JA 3RGZA 3HOWL 1X9ZA 2JE0A 1QYYA 1FKAH 1BE7A 1F4LA 3PL5A 4AR3A 4E6YA 2JA5L 4NKHA 4V2EA 4NBQA 4CNMA 4LF5H 1XKUA 4PDBA 3G04C 5MLC3 2R9UA 4OD6A 1S30A 4AHXA 1S2ZA 4CILA 1QCVA 5AI2A 4M7EA 5IYCL 5JVG1 2B63L 4X64H 4POFA 2Z0SA 1M0ZA 4J4LA 2UXBH 3PKIA 5MFPA 4A3BL 4Y61B 3E2JA 5GADc 2A6HD 3OGLB 5M5XL 4A3IL 3HOUL 1X4MA 2BNHA 4FS7A 1OWCA 3T1YH 1XECA 2Z7XA 5BR8H 1K1GA 4CP6A 1J5EH 1M9LA 2Z81A 4C2BB 1TWHL 4DR1H 4JVHA 4BXXL 4H8AA 4EC5A 4IM6A 4C3HL 2R7ZL 1S03G 1DVBA 1VBIA 4RCAB 4R08A 5DM71 2XJSA 3PKJA 5H1Sc 4LF8H 4U08A 2C6BA 5FTTB 1AN7A 4TVMA 2HH3A 2MJHA 5AWDA 1T9OA 2RR6A 2P1OB 3RF2A 2BEXA 4LF4H 3PZAA 4G08A 1M9SA 2E5LH 4Z61C 1TWFL 3I4NL 1OTMA 2E2JL 1RYTA 4YHHH 3J81W 2P1QB 4DV7H 2ERJA 2P1MB 2XJUA 3KDGA 4LF9H 4YEBB 1D0BA 5LFNA 3OGKB 2EY4E 1X0AA 4R6FA 4NXNH 2OMTA 4JI5H 2R93L 4C2M1 4BA2I 3GTGL 4DV3H 1GWBA 3H9BA 1LTXA 4PERA 5GAHc 4XXBB 3KYWA 3GTQL 2L0ZA 2KKDA 1DCEA 4LSXC 1G9UA 1IRNA 4LIJA 1R0GA 4U671 2Z62A 5JVH1 4ME3A 4B3TH 4FHOA 1B2JA 3FDJA 4BY7L 4FJSA 5FLML 2H12A 1QQTA 4R0AA 4LXSA 2DGRA 4DV0H 1EC6A 2JI1A 2UUAH 3S1ML 2JE1A 3UL9A 3C6OB 4QIWP 1OOKG 4Z8GA 5GAEc 1SMUA 3C6PB 1U0ND 5M3ML 3BZ5A 4POGA 3I0PA 4DR7H 2PT7G 3H97A 4LSAA 4KNGA 1E8JA 4ARRA 3P8BA 1IU5A 2HH2A 5HDHA 3RW7A 3ULAA 1CADA 4BBSL 1VZIA 3K7AL 3SS2A 4DV2H 2WQVA 5HZLB 2FT3A 2YU9L 1N34H 1ZTGA 1VZHA 3DZEA 1PFWA 1I50L 2JA7L 3OTOH 4V196 1FS2A 2JI3A 3W3KA 4A3ML 3MQKB 2OPVA 5AI3A 4A93L 3PMHG 4Q3IA 4R5DA 2AXYA 1NXUA 4WALA 3A79B 3B0AB 1T9PA 4LHLA 1I3QL 2AUSB 5AZ5A 3WPDA 3GR5A 3JAMW 2CKAA 2OMWA 3CIYA 5GQRK 3W3NA 1TWGL 2NVXL 1DT4A 4JI6H 3PIO1 2PYAA 1TWAL 1WCML 2BL5A 1IO0A 1BQ9A 2XWTC 2XJQA 1J5KA 4Q3GA 4X65H 2FFMA 3WPEA 1BQ8A 3RFJA 4ECOA 1W8AA 4AI2A 2CWFA 3FAUA 4AR5A 2VQEH 3S2DL 4WYKA 1RDGA 2JI2A 3L7ZC 4JI2H 4DR5H 2M6OA 1N32H 3W3LA 3GTOL 4A3DL 4R6JA 1DFJI 4JI1H 1B2OA 1BFYA 4FJUA 2E2IL 2A68D 4R6GA 2PSMC 3J7Z1 4K17A 4Q62A 6RXNA 3OJAB 2JVZA 3J7AK 4EZGA 2WAQP 2M4YA 1HNZH 2Z3QB 1V9NA 4E9JA 1PFYA 4K0KH 1HNXH 1PQXA 1FHHA 4ZN1B 3M4OL 1WHRA 2JA9A 1Y1WL 3LPEB 4GS7D 3GTLL 4AY9X 3G06A 2UZXA 3ZG6A 4ARNA 1JYBA 1I94H 3V69A 4CC4A 4OCHA 2VKCA 5IJCA 3IU3I 2LF0A 5A5CA 2A1SA 3K35A 4R5CA 2ASTB 1X4NA 4IFDG 4X66H 2LTLA 1DS9A 4JVYA 3LWPB 4B3SH 1NNQA 4DUYH 4HQ1A 1N36H 2UXDH 3OGMB 4WFN1 3U1KA 4LSCA 2CR8A 2NVYL 4AI0A 4KT1A 2LTMA 5CMNA 2Z82A 1Z2IA 2UUBH 4FDWA 3SB4A 5IYBL 1V8CA 1WTJA 1TUAA 1YUZA 3HOXL 4WANA 2RDVA 4BSSA 3GABA 3WWLA 2M4VA 5DM61 4H09A 1LKPA 1ZZJA 1QYBA 1I6UA 5B4PA 4ZN3B 3NCVA 3W3JA 1WJVA 3M3YL 4R07A 4LFCH 4DR4H 1IROA 3HOZL 3KYXA 1R9TL 2HHHH 4LF7H 4MQWX 3G39A 3UL7A 4KHPH 2D9IA 1KHMA 5C44L 3LWRB 4PQ8A 1OWBA 1XNRH 5MGNA 3ZYIA 1VIHA 5GS2B 3RZDL 1PFUA 3NFPI 5AWBA 2E2HL 1XEUA 3RIZA 2AYJA 2FMRA 4JI4H 2A0ZA 2MS3A 4AR6A 3H99A 4A3FL 3CVRA 1YK4A 4XGOA 1P8TA 3PWFA 3C6NB 4TPUA 2V70A 3CQZL 4A3EL 3S16L 4L3FA 5C3EL 4MN8B 2Y0SP 3S1RL 5AWCA 1LKMA 5LMNH 2BA0A 4J0MA 4U06A 5FLXW 4DUZH 5IY0A 1R0FA 2LRRA 1IBKH 5B0NA 4LI2A 1H6TA 3W3MA 4XOSA 1FT8A 1O6SA 3HJYB 3OSSD 2UUCH 2P1NB 4FCGA 4YY3H 2V3BB 2XJRA 3UL8A 4BSUA 2UU9H 2CTJA 3FKIL 3QD7X 2O6SA 4RCWA 4LFAH 1P8VA 5A2QW 2F4VH 1LKOA 4XGHA 1YV1A 1S20A 1OGQA 4OQTA 3KYYA 3J80W 1WE8A 1FJGH 4YWLA 4V2DA 3MPSA 5M5YL 1NXGA 3FXIA 3PO2L 3S14L 3KDKA 2P2RA 1KOHA 3QVDA 2ZQEA 4DV4H 1FO1A 4FD0A 1N33H 2LCQA 2NYDA 1ZIWA 1LTLA 1IU6A 4BV4R 3RGXA 4XSQA 1DX8A 4GKJH 2V0EA 4Y7NL 2OMVA 3WPGA 4LFBH 2CTMA 2K1HA 4AIMA 2OPUA 1ZZIA 4M7EC 5K2ME 4NZTM 5AN9H 4B3MH 2V9TB 1SFOL 4GLPA 3LWVB 3E3ZA 1S24A 4JAGA 2E3UA 1WVNA 2FPHX 1Z7XW 4CC4C 4Z79A 1YUXA 3VQ1A 2NVTL 3HOVL 1B13A 5AWAA 4Z94G 4AHWA 4QBZA 3LWOB 5FJ8L 2YQRA 2O5JD 4K9FA 3ZYNA 2PVXA 1OTNA 2CTLA 2JQDA 3VKEA 4DR3H 4JAEA 4A3KL 4X62H 2Q4GW 2V9SA 5IJBA 3O53A 1BRFA 3TSRE 4UFRA 1SMMA 4DR6H 3ZYOA 3H0GL 3A44A 5IYDL 2AQCA 1XMOH 1RWDA 2ERSA 1XWDC 2RA8A 3UOEA 4KXFB 3JB9j 2HVYC 2JA8L 3S1NL 2CTEA 4DV1H 1IBLH 1H7VA 2Y5QA 3OETA 3E6JA 5C4XL 5IT9W 5IWAH 3GTKL 2C6AA 3SB1A 4P8SA 4BSRA 4QXEA 1A9NA 3LNLA 3ULVA 1P9AG 5K36G 5GMGA 2WFHA 2ASSB 1IBMH 2HR5A 4AR4A 5IJDA 8RXNA 5IP9L 4QMFB 5GMFA 4I6JB 4AM3A 4JI7H 1XNQH 5MF6A 4JADA 5DT9A 3HOYL 2QL0A 2UXCH 5GMHA 3I4ML 1PZXA 2KN9A 5M3FL 4TZHA 4C2AB 3WPHA 3RZOL 2CA6A 5EIOC 1JL5A 5JEAG 1K5DC 2X06A 3AEVB 4PKIG 3T1HH 1HNWH 2WQXA 3WPFA 3G3AA 4X6AL 3PIP1 2B5ID 1R0HA
chains in the Genus database with same CATH topology
4V2CA 1RYQA 5IYXC 3O6NA 3RZTA 1VZGA 2OMZA 2A69D 1K5GC 4U7LA 2PVEA 2CKCA 1NXEA 4LF6H 3M19A 2K2DA 1OZNA 4JI8H 2WQWA 1Z92B 1T9QA 2PPTA 4DR2H 4G8AA 2VQFH 4WP6A 4R09A 1VCXA 2XJVA 3ULUA 1B71A 4CNCA 4PSJA 3KJ4A 1SMWA 1O6TA 4U09A 2Z7XB 1XMQH 4DV6H 2DSXA 1SEIA 3WPBA 3M18A 1O6VA 3UN9A 3WWNB 4JI0H 1YRGA 4PEQB 4G6BA 3B08B 3KYVA 1A4YA 4AI1A 5LL6b 4RWTC 3RYGA 1OTOA 3P72A 2UZYA 2Z3RB 2O6QA 5D3IA 1YK5A 3QQCE 4UY81 3MSUA 5EINC 4JAFA 3KYUA 1ODHA 4R58A 3WPCA 3RZ6A 4OX9H 2J9UB 1SQ0B 3P2AA 2O6RA 3ZYJA 2BE5D 4FMZA 4LI1A 3CIGA 1HR0H 4NXMH 2Z63A 3RFEA 4R6AA 1H6UA 2ZM6H 2P1PB 4LHNA 2O4CA 2M6PA 1R0IA 1XCDA 3W3GA 3VPBE 1C09A 3J7Y1 2ELLA 2WQUA 4L3AA 2Z66A 1M10B 3RW6A 1WWLA 4AI3A 2OMUA 3G3BA 2A6ED 4GKKH 1KOOA 3VQ2A 4NKGA 2Z64A 1FHMA 2Y3MA 2IFGA 4LXRA 2V0FA 1RB9A 2VL6A 4LSXA 4YWMA 4Z64C 1ZRPA 3OJAA 2ID5A 4B8CD 3REZA 2Z65A 5RXNA 1FQVA 1CAAA 4AHYA 3GOZA 5CMPA 4GT6A 5GAGc 4AW4A 5B0TA 3WPIA 2XOTA 4JV5H 4QC0A 2ZIXA 2XJTA 7RXNA 2OMYA 3WN4A 1PGVA 4JYAH 2XJPA 4AQYH 5LMUH 1IW7D 3E4GA 2GMGA 2OMXA 1F0XA 4NZRM 1RDVA 4JI3H 4DV5H 5GS0A 3RFSA 3EZJA 4RXNA 4B3RH 4P91A 5MFZA 4AHZA 4ECNA 1R0JA 3RGZA 1X9ZA 2JE0A 1QYYA 1FKAH 1BE7A 4AR3A 4NKHA 4E6YA 4V2EA 4CNMA 4LF5H 1XKUA 4PDBA 3G04C 5MLC3 2R9UA 4OD6A 1S30A 4AHXA 1S2ZA 4CILA 1QCVA 5AI2A 4M7EA 5JVG1 4X64H 4POFA 1M0ZA 4J4LA 2UXBH 3PKIA 5MFPA 4Y61B 3E2JA 5GADc 2A6HD 3OGLB 4FS7A 2BNHA 1OWCA 3T1YH 1XECA 2Z7XA 5BR8H 4CP6A 1J5EH 1M9LA 2Z81A 4C2BB 4DR1H 4EC5A 4IM6A 1S03G 1DVBA 4RCAB 4R08A 5DM71 2XJSA 3PKJA 5H1Sc 4LF8H 4U08A 2C6BA 5FTTB 1AN7A 4TVMA 5AWDA 1T9OA 2RR6A 2P1OB 3RF2A 2BEXA 4LF4H 3PZAA 4G08A 1M9SA 2E5LH 4Z61C 1OTMA 1RYTA 4YHHH 3J81W 2P1QB 4DV7H 2ERJA 2P1MB 2XJUA 3KDGA 4LF9H 4YEBB 1D0BA 5LFNA 3OGKB 4R6FA 4NXNH 2OMTA 4JI5H 1LTXA 1GWBA 4DV3H 4PERA 5GAHc 4XXBB 3KYWA 2L0ZA 2KKDA 1DCEA 4LSXC 1G9UA 1IRNA 1R0GA 4U671 2Z62A 5JVH1 4ME3A 4B3TH 4FHOA 1B2JA 2H12A 4R0AA 4LXSA 4DV0H 2JI1A 2UUAH 2JE1A 3UL9A 3C6OB 1OOKG 4Z8GA 5GAEc 1SMUA 3C6PB 1U0ND 3BZ5A 4POGA 4DR7H 2PT7G 4LSAA 4KNGA 1E8JA 4ARRA 3P8BA 1IU5A 5HDHA 3RW7A 3ULAA 1CADA 1VZIA 3SS2A 4DV2H 2WQVA 5HZLB 2FT3A 1N34H 3DZEA 1VZHA 3OTOH 4V196 1FS2A 2JI3A 3W3KA 5AI3A 3PMHG 4Q3IA 4R5DA 3A79B 3B0AB 1T9PA 4LHLA 5AZ5A 3WPDA 3GR5A 3JAMW 2CKAA 2OMWA 3CIYA 5GQRK 3W3NA 4JI6H 3PIO1 2PYAA 1IO0A 1BQ9A 2XWTC 2XJQA 4Q3GA 4X65H 3WPEA 1BQ8A 3RFJA 4ECOA 1W8AA 4AI2A 2VQEH 3FAUA 4AR5A 4WYKA 3RJ0A 1RDGA 2JI2A 1N32H 4JI2H 4DR5H 2M6OA 3W3LA 4R6JA 1DFJI 4JI1H 1B2OA 1BFYA 4R6GA 2A68D 2PSMC 3J7Z1 4K17A 4Q62A 6RXNA 3OJAB 3J7AK 4EZGA 2M4YA 1HNZH 2Z3QB 4E9JA 4K0KH 1HNXH 1FHHA 4ZN1B 3LPEB 4GS7D 4AY9X 3G06A 2UZXA 3ZG6A 4ARNA 1JYBA 1I94H 4CC4A 4OCHA 2VKCA 5IJCA 3IU3I 2LF0A 5A5CA 3K35A 4R5CA 2ASTB 4X66H 1DS9A 4B3SH 1NNQA 4DUYH 4HQ1A 1N36H 2UXDH 3OGMB 4WFN1 4LSCA 2CR8A 4AI0A 4KT1A 5CMNA 2Z82A 2UUBH 4FDWA 3SB4A 1YUZA 2RDVA 4BSSA 3GABA 3WWLA 2M4VA 5DM61 4H09A 1LKPA 5B4PA 1QYBA 1I6UA 4ZN3B 3NCVA 3W3JA 1WJVA 4R07A 4LFCH 4DR4H 1IROA 3KYXA 2HHHH 4LF7H 4MQWX 3G39A 3UL7A 4KHPH 2D9IA 4PQ8A 1OWBA 1XNRH 5MGNA 3ZYIA 5GS2B 5AWBA 3NFPI 1XEUA 3RIZA 2AYJA 4JI4H 2A0ZA 2MS3A 4AR6A 3CVRA 1YK4A 4XGOA 1P8TA 3PWFA 3C6NB 4TPUA 2V70A 4MN8B 4L3FA 5AWCA 1LKMA 5LMNH 4J0MA 4U06A 5FLXW 4DUZH 5IY0A 1R0FA 1IBKH 5B0NA 4LI2A 1H6TA 3W3MA 4XOSA 1FT8A 1O6SA 3OSSD 2UUCH 2P1NB 4FCGA 4YY3H 2V3BB 2XJRA 3UL8A 4BSUA 2UU9H 3QD7X 4RCWA 2O6SA 4LFAH 1P8VA 5A2QW 2F4VH 1LKOA 4XGHA 1YV1A 1OGQA 4OQTA 3KYYA 3J80W 1FJGH 4YWLA 4V2DA 3MPSA 1NXGA 3FXIA 3KDKA 1KOHA 3QVDA 2ZQEA 4DV4H 1FO1A 4FD0A 1N33H 2LCQA 2NYDA 1ZIWA 1LTLA 1IU6A 4BV4R 3RGXA 4XSQA 1DX8A 4GKJH 2V0EA 2OMVA 3WPGA 4LFBH 4M7EC 5K2ME 4NZTM 5AN9H 4B3MH 2V9TB 4GLPA 3E3ZA 4Z79A 1S24A 4JAGA 4CC4C 2FPHX 1Z7XW 3VQ1A 1YUXA 1B13A 5AWAA 4Z94G 4AHWA 4QBZA 2O5JD 4K9FA 3ZYNA 2PVXA 1OTNA 2JQDA 2V9SA 4DR3H 4JAEA 4X62H 2Q4GW 5IJBA 3O53A 1BRFA 3TSRE 4UFRA 1SMMA 4DR6H 3ZYOA 3A44A 4KXFB 1XMOH 1RWDA 2ERSA 1XWDC 2RA8A 3JB9j 4DV1H 1IBLH 1H7VA 2Y5QA 3OETA 3E6JA 5IT9W 5IWAH 2C6AA 3SB1A 4P8SA 4BSRA 4QXEA 1A9NA 3LNLA 3ULVA 1P9AG 5GMGA 2WFHA 2ASSB 1IBMH 2HR5A 4AR4A 5IJDA 8RXNA 5GMFA 4I6JB 4JI7H 1XNQH 5MF6A 4JADA 5DT9A 2QL0A 2UXCH 5GMHA 4TZHA 2KN9A 3WPHA 4C2AB 2CA6A 5EIOC 1JL5A 1K5DC 4PKIG 3T1HH 1HNWH 2WQXA 3WPFA 3G3AA 3PIP1 2B5ID 1R0HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4V2C A;  5IYX C;  3O6N A;  4U7L A;  2OMZ A;  1K5G C;  3M19 A;  1OZN A;  2WQW A;  4G8A A;  4WP6 A;  4R09 A;  3ULU A;  4CNC A;  4PSJ A;  3KJ4 A;  1O6T A;  4U09 A;  2Z7X B;  3WPB A;  3M18 A;  1O6V A;  3UN9 A;  1YRG A;  4PEQ B;  1A4Y A;  4RWT C;  1OTO A;  3P72 A;  2UZY A;  2O6Q A;  5D3I A;  4R58 A;  3WPC A;  1SQ0 B;  2O6R A;  3ZYJ A;  4FMZ A;  4LI1 A;  3CIG A;  2Z63 A;  3RFE A;  4R6A A;  1H6U A;  2P1P B;  1XCD A;  3W3G A;  2ELL A;  2WQU A;  4L3A A;  2Z66 A;  3RW6 A;  1M10 B;  1WWL A;  2OMU A;  3G3B A;  1KOO A;  3VQ2 A;  4NKG A;  2Z64 A;  2IFG A;  4LXR A;  4LSX A;  4Z64 C;  3OJA A;  2ID5 A;  4B8C D;  3REZ A;  2Z65 A;  1FQV A;  5CMP A;  3GOZ A;  4GT6 A;  4AW4 A;  5B0T A;  3WPI A;  2XOT A;  4QC0 A;  3WN4 A;  2OMY A;  1PGV A;  3E4G A;  2OMX A;  5GS0 A;  3RFS A;  4P91 A;  4ECN A;  3RGZ A;  2JE0 A;  1QYY A;  4NKH A;  4V2E A;  4CNM A;  1XKU A;  3G04 C;  2R9U A;  4CIL A;  4M7E A;  1M0Z A;  4J4L A;  4Y61 B;  3E2J A;  3OGL B;  4FS7 A;  2BNH A;  1XEC A;  2Z7X A;  4CP6 A;  1M9L A;  2Z81 A;  4C2B B;  4IM6 A;  4RCA B;  4R08 A;  4U08 A;  5FTT B;  5AWD A;  2RR6 A;  2P1O B;  2BEX A;  1M9S A;  4Z61 C;  1OTM A;  2P1Q B;  2P1M B;  4YEB B;  1D0B A;  5LFN A;  3OGK B;  4R6F A;  2OMT A;  1LTX A;  1GWB A;  4PER A;  4LSX C;  1DCE A;  1G9U A;  2Z62 A;  4FHO A;  4R0A A;  4LXS A;  2JE1 A;  3UL9 A;  3C6O B;  1OOK G;  4Z8G A;  3C6P B;  1U0N D;  3BZ5 A;  4LSA A;  4KNG A;  4ARR A;  5HDH A;  3RW7 A;  3ULA A;  2WQV A;  5HZL B;  2FT3 A;  3DZE A;  1FS2 A;  3W3K A;  3PMH G;  4Q3I A;  4R5D A;  3A79 B;  5AZ5 A;  3WPD A;  3CIY A;  2OMW A;  5GQR K;  3W3N A;  1IO0 A;  2XWT C;  4Q3G A;  3WPE A;  3RFJ A;  4ECO A;  1W8A A;  4WYK A;  3RJ0 A;  3W3L A;  4R6J A;  1DFJ I;  4R6G A;  4K17 A;  4Q62 A;  3OJA B;  4EZG A;  4AY9 X;  3G06 A;  2UZX A;  4ARN A;  4CC4 A;  5IJC A;  5A5C A;  4R5C A;  2AST B;  1DS9 A;  4HQ1 A;  3OGM B;  4LSC A;  5CMN A;  4KT1 A;  2Z82 A;  4FDW A;  3SB4 A;  4BSS A;  4H09 A;  5B4P A;  3W3J A;  4R07 A;  4MQW X;  3G39 A;  3UL7 A;  4PQ8 A;  3ZYI A;  5GS2 B;  5AWB A;  1XEU A;  3RIZ A;  2A0Z A;  3CVR A;  4XGO A;  1P8T A;  3C6N B;  2V70 A;  4MN8 B;  4L3F A;  5AWC A;  4J0M A;  4U06 A;  5B0N A;  4LI2 A;  1H6T A;  3W3M A;  4XOS A;  1FT8 A;  1O6S A;  2P1N B;  4FCG A;  3UL8 A;  4BSU A;  4RCW A;  2O6S A;  1P8V A;  4OQT A;  1OGQ A;  4V2D A;  3FXI A;  1KOH A;  4FD0 A;  1FO1 A;  1ZIW A;  4BV4 R;  3RGX A;  4XSQ A;  2OMV A;  3WPG A;  4M7E C;  2V9T B;  4GLP A;  3E3Z A;  4Z79 A;  4CC4 C;  1Z7X W;  3VQ1 A;  5AWA A;  4Z94 G;  4QBZ A;  3ZYN A;  1OTN A;  2JQD A;  2V9S A;  2Q4G W;  5IJB A;  3O53 A;  3TSR E;  4UFR A;  3ZYO A;  4KXF B;  1XWD C;  2RA8 A;  3JB9 j;  2Y5Q A;  3E6J A;  4P8S A;  4BSR A;  4QXE A;  1A9N A;  3ULV A;  1P9A G;  5GMG A;  2WFH A;  2ASS B;  5IJD A;  5GMF A;  4I6J B;  5GMH A;  4TZH A;  3WPH A;  4C2A B;  2CA6 A;  1JL5 A;  1K5D C;  4PKI G;  3WPF A;  2WQX A;  3G3A A; 
#chains in the Genus database with same CATH topology
 4V2C A;  1RYQ A;  1ZZK A;  5IYX C;  2JZX A;  3O6N A;  3RZT A;  1VZG A;  2OMZ A;  2A69 D;  1K5G C;  4U7L A;  2PVE A;  2CKC A;  1NXE A;  4LF6 H;  3M19 A;  2K2D A;  1OZN A;  3S17 L;  4JI8 H;  2WQW A;  1Z92 B;  1T9Q A;  2PPT A;  4DR2 H;  4G8A A;  5IP7 L;  2VQF H;  4WP6 A;  4A3C L;  1I6H L;  3S15 L;  4R09 A;  1VCX A;  2XJV A;  2RFK B;  3ULU A;  1B71 A;  1VIG A;  4PSJ A;  3KJ4 A;  4CNC A;  3H3V M;  1SMW A;  1J4W A;  1O6T A;  4U09 A;  2Z7X B;  3JR7 A;  3GTP L;  1XMQ H;  2ANR A;  4A3J L;  4DV6 H;  2DSX A;  1SEI A;  3WPB A;  3M18 A;  4C3I L;  1O6V A;  3UN9 A;  4C3J L;  3WWN B;  2M8W A;  4JI0 H;  1YRG A;  4PEQ B;  3HKZ P;  4G6B A;  3B08 B;  1K83 L;  2CPM A;  3KYV A;  3S1Q L;  2PMZ P;  1A4Y A;  4AI1 A;  5LL6 b;  4RWT C;  3RYG A;  2NVQ L;  1OTO A;  3HJW B;  3P72 A;  2UZY A;  1MSZ A;  2Z3R B;  2CPQ A;  2O6Q A;  5D3I A;  1YK5 A;  3QQC E;  4UY8 1;  1XRH A;  3S2H L;  3MSU A;  2M6Q A;  5EIN C;  4JAF A;  2WB1 P;  3KYU A;  1ODH A;  2ANN A;  4R58 A;  3WPC A;  4A3L L;  3RZ6 A;  4OX9 H;  2J9U B;  1SQ0 B;  1PFV A;  3P2A A;  2O6R A;  3ZYJ A;  2BE5 D;  4FMZ A;  4LI1 A;  3GTJ L;  3CIG A;  5C4J L;  1HR0 H;  4NXM H;  2Z63 A;  3RFE A;  4R6A A;  1H6U A;  2ZM6 H;  2P1P B;  4LHN A;  2O4C A;  2M6P A;  1R0I A;  4BBR L;  1XCD A;  3W3G A;  3VPB E;  1C09 A;  3J7Y 1;  2ELL A;  2WQU A;  1UG8 A;  5C0X G;  4L3A A;  1TWC L;  1M10 B;  2Z66 A;  1WWL A;  3RW6 A;  2VUM L;  2QND A;  4AI3 A;  2OMU A;  3G3B A;  2A6E D;  4GKK H;  3RJ0 A;  1KOO A;  3VQ2 A;  1DTJ A;  4NKG A;  2Z64 A;  1FHM A;  2Y3M A;  2JE6 I;  2G8Y A;  3PO3 L;  4B8T A;  3H9C A;  4BY1 L;  2IFG A;  2JA6 L;  4LXR A;  2V0F A;  1RB9 A;  2NN6 G;  2VL6 A;  4AYB P;  4LSX A;  4OO1 G;  4YWM A;  4Z64 C;  3HAX C;  1ZRP A;  3OJA A;  1P7P A;  2ID5 A;  4B8C D;  3GKU A;  3REZ A;  2Z65 A;  5RXN A;  4BA1 I;  1CAA A;  4AHY A;  1FQV A;  2CTK A;  3GOZ A;  5CMP A;  2R92 L;  4GT6 A;  5GAG c;  4AW4 A;  5B0T A;  3WPI A;  2XOT A;  2PQU A;  4JV5 H;  2ZIX A;  4QC0 A;  2XJT A;  7RXN A;  2OMY A;  3WN4 A;  2JEB I;  4JYA H;  1PGV A;  5M5W L;  2XJP A;  4Y52 L;  4AQY H;  3LWQ B;  3GTM L;  5LMU H;  4A3G L;  1IW7 D;  3E4G A;  2CTF A;  2GMG A;  2APO B;  2OMX A;  1F0X A;  4NZR M;  1RDV A;  4JI3 H;  4DV5 H;  1Y1V L;  2JEA I;  5GS0 A;  3RFS A;  3EZJ A;  4RXN A;  2PY9 A;  4B3R H;  4P91 A;  5MFZ A;  2CWH A;  4AHZ A;  4ECN A;  1R0J A;  3RGZ A;  3HOW L;  1X9Z A;  2JE0 A;  1QYY A;  1FKA H;  1BE7 A;  1F4L A;  3PL5 A;  4AR3 A;  4E6Y A;  2JA5 L;  4NKH A;  4V2E A;  4NBQ A;  4CNM A;  4LF5 H;  1XKU A;  4PDB A;  3G04 C;  5MLC 3;  2R9U A;  4OD6 A;  1S30 A;  4AHX A;  1S2Z A;  4CIL A;  1QCV A;  5AI2 A;  4M7E A;  5IYC L;  5JVG 1;  2B63 L;  4X64 H;  4POF A;  2Z0S A;  1M0Z A;  4J4L A;  2UXB H;  3PKI A;  5MFP A;  4A3B L;  4Y61 B;  3E2J A;  5GAD c;  2A6H D;  3OGL B;  5M5X L;  4A3I L;  3HOU L;  1X4M A;  2BNH A;  4FS7 A;  1OWC A;  3T1Y H;  1XEC A;  2Z7X A;  5BR8 H;  1K1G A;  4CP6 A;  1J5E H;  1M9L A;  2Z81 A;  4C2B B;  1TWH L;  4DR1 H;  4JVH A;  4BXX L;  4H8A A;  4EC5 A;  4IM6 A;  4C3H L;  2R7Z L;  1S03 G;  1DVB A;  1VBI A;  4RCA B;  4R08 A;  5DM7 1;  2XJS A;  3PKJ A;  5H1S c;  4LF8 H;  4U08 A;  2C6B A;  5FTT B;  1AN7 A;  4TVM A;  2HH3 A;  2MJH A;  5AWD A;  1T9O A;  2RR6 A;  2P1O B;  3RF2 A;  2BEX A;  4LF4 H;  3PZA A;  4G08 A;  1M9S A;  2E5L H;  4Z61 C;  1TWF L;  3I4N L;  1OTM A;  2E2J L;  1RYT A;  4YHH H;  3J81 W;  2P1Q B;  4DV7 H;  2ERJ A;  2P1M B;  2XJU A;  3KDG A;  4LF9 H;  4YEB B;  1D0B A;  5LFN A;  3OGK B;  2EY4 E;  1X0A A;  4R6F A;  4NXN H;  2OMT A;  4JI5 H;  2R93 L;  4C2M 1;  4BA2 I;  3GTG L;  4DV3 H;  1GWB A;  3H9B A;  1LTX A;  4PER A;  5GAH c;  4XXB B;  3KYW A;  3GTQ L;  2L0Z A;  2KKD A;  1DCE A;  4LSX C;  1G9U A;  1IRN A;  4LIJ A;  1R0G A;  4U67 1;  2Z62 A;  5JVH 1;  4ME3 A;  4B3T H;  4FHO A;  1B2J A;  3FDJ A;  4BY7 L;  4FJS A;  5FLM L;  2H12 A;  1QQT A;  4R0A A;  4LXS A;  2DGR A;  4DV0 H;  1EC6 A;  2JI1 A;  2UUA H;  3S1M L;  2JE1 A;  3UL9 A;  3C6O B;  4QIW P;  1OOK G;  4Z8G A;  5GAE c;  1SMU A;  3C6P B;  1U0N D;  5M3M L;  3BZ5 A;  4POG A;  3I0P A;  4DR7 H;  2PT7 G;  3H97 A;  4LSA A;  4KNG A;  1E8J A;  4ARR A;  3P8B A;  1IU5 A;  2HH2 A;  5HDH A;  3RW7 A;  3ULA A;  1CAD A;  4BBS L;  1VZI A;  3K7A L;  3SS2 A;  4DV2 H;  2WQV A;  5HZL B;  2FT3 A;  2YU9 L;  1N34 H;  1ZTG A;  1VZH A;  3DZE A;  1PFW A;  1I50 L;  2JA7 L;  3OTO H;  4V19 6;  1FS2 A;  2JI3 A;  3W3K A;  4A3M L;  3MQK B;  2OPV A;  5AI3 A;  4A93 L;  3PMH G;  4Q3I A;  4R5D A;  2AXY A;  1NXU A;  4WAL A;  3A79 B;  3B0A B;  1T9P A;  4LHL A;  1I3Q L;  2AUS B;  5AZ5 A;  3WPD A;  3GR5 A;  3JAM W;  2CKA A;  2OMW A;  3CIY A;  5GQR K;  3W3N A;  1TWG L;  2NVX L;  1DT4 A;  4JI6 H;  3PIO 1;  2PYA A;  1TWA L;  1WCM L;  2BL5 A;  1IO0 A;  1BQ9 A;  2XWT C;  2XJQ A;  1J5K A;  4Q3G A;  4X65 H;  2FFM A;  3WPE A;  1BQ8 A;  3RFJ A;  4ECO A;  1W8A A;  4AI2 A;  2CWF A;  3FAU A;  4AR5 A;  2VQE H;  3S2D L;  4WYK A;  1RDG A;  2JI2 A;  3L7Z C;  4JI2 H;  4DR5 H;  2M6O A;  1N32 H;  3W3L A;  3GTO L;  4A3D L;  4R6J A;  1DFJ I;  4JI1 H;  1B2O A;  1BFY A;  4FJU A;  2E2I L;  2A68 D;  4R6G A;  2PSM C;  3J7Z 1;  4K17 A;  4Q62 A;  6RXN A;  3OJA B;  2JVZ A;  3J7A K;  4EZG A;  2WAQ P;  2M4Y A;  1HNZ H;  2Z3Q B;  1V9N A;  4E9J A;  1PFY A;  4K0K H;  1HNX H;  1PQX A;  1FHH A;  4ZN1 B;  3M4O L;  1WHR A;  2JA9 A;  1Y1W L;  3LPE B;  4GS7 D;  3GTL L;  4AY9 X;  3G06 A;  2UZX A;  3ZG6 A;  4ARN A;  1JYB A;  1I94 H;  3V69 A;  4CC4 A;  4OCH A;  2VKC A;  5IJC A;  3IU3 I;  2LF0 A;  5A5C A;  2A1S A;  3K35 A;  4R5C A;  2AST B;  1X4N A;  4IFD G;  4X66 H;  2LTL A;  1DS9 A;  4JVY A;  3LWP B;  4B3S H;  1NNQ A;  4DUY H;  4HQ1 A;  1N36 H;  2UXD H;  3OGM B;  4WFN 1;  3U1K A;  4LSC A;  2CR8 A;  2NVY L;  4AI0 A;  4KT1 A;  2LTM A;  5CMN A;  2Z82 A;  1Z2I A;  2UUB H;  4FDW A;  3SB4 A;  5IYB L;  1V8C A;  1WTJ A;  1TUA A;  1YUZ A;  3HOX L;  4WAN A;  2RDV A;  4BSS A;  3GAB A;  3WWL A;  2M4V A;  5DM6 1;  4H09 A;  1LKP A;  1ZZJ A;  1QYB A;  1I6U A;  5B4P A;  4ZN3 B;  3NCV A;  3W3J A;  1WJV A;  3M3Y L;  4R07 A;  4LFC H;  4DR4 H;  1IRO A;  3HOZ L;  3KYX A;  1R9T L;  2HHH H;  4LF7 H;  4MQW X;  3G39 A;  3UL7 A;  4KHP H;  2D9I A;  1KHM A;  5C44 L;  3LWR B;  4PQ8 A;  1OWB A;  1XNR H;  5MGN A;  3ZYI A;  1VIH A;  5GS2 B;  3RZD L;  1PFU A;  3NFP I;  5AWB A;  2E2H L;  1XEU A;  3RIZ A;  2AYJ A;  2FMR A;  4JI4 H;  2A0Z A;  2MS3 A;  4AR6 A;  3H99 A;  4A3F L;  3CVR A;  1YK4 A;  4XGO A;  1P8T A;  3PWF A;  3C6N B;  4TPU A;  2V70 A;  3CQZ L;  4A3E L;  3S16 L;  4L3F A;  5C3E L;  4MN8 B;  2Y0S P;  3S1R L;  5AWC A;  1LKM A;  5LMN H;  2BA0 A;  4J0M A;  4U06 A;  5FLX W;  4DUZ H;  5IY0 A;  1R0F A;  2LRR A;  1IBK H;  5B0N A;  4LI2 A;  1H6T A;  3W3M A;  4XOS A;  1FT8 A;  1O6S A;  3HJY B;  3OSS D;  2UUC H;  2P1N B;  4FCG A;  4YY3 H;  2V3B B;  2XJR A;  3UL8 A;  4BSU A;  2UU9 H;  2CTJ A;  3FKI L;  3QD7 X;  2O6S A;  4RCW A;  4LFA H;  1P8V A;  5A2Q W;  2F4V H;  1LKO A;  4XGH A;  1YV1 A;  1S20 A;  1OGQ A;  4OQT A;  3KYY A;  3J80 W;  1WE8 A;  1FJG H;  4YWL A;  4V2D A;  3MPS A;  5M5Y L;  1NXG A;  3FXI A;  3PO2 L;  3S14 L;  3KDK A;  2P2R A;  1KOH A;  3QVD A;  2ZQE A;  4DV4 H;  1FO1 A;  4FD0 A;  1N33 H;  2LCQ A;  2NYD A;  1ZIW A;  1LTL A;  1IU6 A;  4BV4 R;  3RGX A;  4XSQ A;  1DX8 A;  4GKJ H;  2V0E A;  4Y7N L;  2OMV A;  3WPG A;  4LFB H;  2CTM A;  2K1H A;  4AIM A;  2OPU A;  1ZZI A;  4M7E C;  5K2M E;  4NZT M;  5AN9 H;  4B3M H;  2V9T B;  1SFO L;  4GLP A;  3LWV B;  3E3Z A;  1S24 A;  4JAG A;  2E3U A;  1WVN A;  2FPH X;  1Z7X W;  4CC4 C;  4Z79 A;  1YUX A;  3VQ1 A;  2NVT L;  3HOV L;  1B13 A;  5AWA A;  4Z94 G;  4AHW A;  4QBZ A;  3LWO B;  5FJ8 L;  2YQR A;  2O5J D;  4K9F A;  3ZYN A;  2PVX A;  1OTN A;  2CTL A;  2JQD A;  3VKE A;  4DR3 H;  4JAE A;  4A3K L;  4X62 H;  2Q4G W;  2V9S A;  5IJB A;  3O53 A;  1BRF A;  3TSR E;  4UFR A;  1SMM A;  4DR6 H;  3ZYO A;  3H0G L;  3A44 A;  5IYD L;  2AQC A;  1XMO H;  1RWD A;  2ERS A;  1XWD C;  2RA8 A;  3UOE A;  4KXF B;  3JB9 j;  2HVY C;  2JA8 L;  3S1N L;  2CTE A;  4DV1 H;  1IBL H;  1H7V A;  2Y5Q A;  3OET A;  3E6J A;  5C4X L;  5IT9 W;  5IWA H;  3GTK L;  2C6A A;  3SB1 A;  4P8S A;  4BSR A;  4QXE A;  1A9N A;  3LNL A;  3ULV A;  1P9A G;  5K36 G;  5GMG A;  2WFH A;  2ASS B;  1IBM H;  2HR5 A;  4AR4 A;  5IJD A;  8RXN A;  5IP9 L;  4QMF B;  5GMF A;  4I6J B;  4AM3 A;  4JI7 H;  1XNQ H;  5MF6 A;  4JAD A;  5DT9 A;  3HOY L;  2QL0 A;  2UXC H;  5GMH A;  3I4M L;  1PZX A;  2KN9 A;  5M3F L;  4TZH A;  4C2A B;  3WPH A;  3RZO L;  2CA6 A;  5EIO C;  1JL5 A;  5JEA G;  1K5D C;  2X06 A;  3AEV B;  4PKI G;  3T1H H;  1HNW H;  2WQX A;  3WPF A;  3G3A A;  4X6A L;  3PIP 1;  2B5I D;  1R0H A; 
#chains in the Genus database with same CATH homology
 4V2C A;  1RYQ A;  5IYX C;  3O6N A;  3RZT A;  1VZG A;  2OMZ A;  2A69 D;  1K5G C;  4U7L A;  2PVE A;  2CKC A;  1NXE A;  4LF6 H;  3M19 A;  2K2D A;  1OZN A;  4JI8 H;  2WQW A;  1Z92 B;  1T9Q A;  2PPT A;  4DR2 H;  4G8A A;  2VQF H;  4WP6 A;  4R09 A;  1VCX A;  2XJV A;  3ULU A;  1B71 A;  4CNC A;  4PSJ A;  3KJ4 A;  1SMW A;  1O6T A;  4U09 A;  2Z7X B;  1XMQ H;  4DV6 H;  2DSX A;  1SEI A;  3WPB A;  3M18 A;  1O6V A;  3UN9 A;  3WWN B;  4JI0 H;  1YRG A;  4PEQ B;  4G6B A;  3B08 B;  3KYV A;  1A4Y A;  4AI1 A;  5LL6 b;  4RWT C;  3RYG A;  1OTO A;  3P72 A;  2UZY A;  2Z3R B;  2O6Q A;  5D3I A;  1YK5 A;  3QQC E;  4UY8 1;  3MSU A;  5EIN C;  4JAF A;  3KYU A;  1ODH A;  4R58 A;  3WPC A;  3RZ6 A;  4OX9 H;  2J9U B;  1SQ0 B;  3P2A A;  2O6R A;  3ZYJ A;  2BE5 D;  4FMZ A;  4LI1 A;  3CIG A;  1HR0 H;  4NXM H;  2Z63 A;  3RFE A;  4R6A A;  1H6U A;  2ZM6 H;  2P1P B;  4LHN A;  2O4C A;  2M6P A;  1R0I A;  1XCD A;  3W3G A;  3VPB E;  1C09 A;  3J7Y 1;  2ELL A;  2WQU A;  4L3A A;  2Z66 A;  1M10 B;  3RW6 A;  1WWL A;  4AI3 A;  2OMU A;  3G3B A;  2A6E D;  4GKK H;  1KOO A;  3VQ2 A;  4NKG A;  2Z64 A;  1FHM A;  2Y3M A;  2IFG A;  4LXR A;  2V0F A;  1RB9 A;  2VL6 A;  4LSX A;  4YWM A;  4Z64 C;  1ZRP A;  3OJA A;  2ID5 A;  4B8C D;  3REZ A;  2Z65 A;  5RXN A;  1FQV A;  1CAA A;  4AHY A;  3GOZ A;  5CMP A;  4GT6 A;  5GAG c;  4AW4 A;  5B0T A;  3WPI A;  2XOT A;  4JV5 H;  4QC0 A;  2ZIX A;  2XJT A;  7RXN A;  2OMY A;  3WN4 A;  1PGV A;  4JYA H;  2XJP A;  4AQY H;  5LMU H;  1IW7 D;  3E4G A;  2GMG A;  2OMX A;  1F0X A;  4NZR M;  1RDV A;  4JI3 H;  4DV5 H;  5GS0 A;  3RFS A;  3EZJ A;  4RXN A;  4B3R H;  4P91 A;  5MFZ A;  4AHZ A;  4ECN A;  1R0J A;  3RGZ A;  1X9Z A;  2JE0 A;  1QYY A;  1FKA H;  1BE7 A;  4AR3 A;  4NKH A;  4E6Y A;  4V2E A;  4CNM A;  4LF5 H;  1XKU A;  4PDB A;  3G04 C;  5MLC 3;  2R9U A;  4OD6 A;  1S30 A;  4AHX A;  1S2Z A;  4CIL A;  1QCV A;  5AI2 A;  4M7E A;  5JVG 1;  4X64 H;  4POF A;  1M0Z A;  4J4L A;  2UXB H;  3PKI A;  5MFP A;  4Y61 B;  3E2J A;  5GAD c;  2A6H D;  3OGL B;  4FS7 A;  2BNH A;  1OWC A;  3T1Y H;  1XEC A;  2Z7X A;  5BR8 H;  4CP6 A;  1J5E H;  1M9L A;  2Z81 A;  4C2B B;  4DR1 H;  4EC5 A;  4IM6 A;  1S03 G;  1DVB A;  4RCA B;  4R08 A;  5DM7 1;  2XJS A;  3PKJ A;  5H1S c;  4LF8 H;  4U08 A;  2C6B A;  5FTT B;  1AN7 A;  4TVM A;  5AWD A;  1T9O A;  2RR6 A;  2P1O B;  3RF2 A;  2BEX A;  4LF4 H;  3PZA A;  4G08 A;  1M9S A;  2E5L H;  4Z61 C;  1OTM A;  1RYT A;  4YHH H;  3J81 W;  2P1Q B;  4DV7 H;  2ERJ A;  2P1M B;  2XJU A;  3KDG A;  4LF9 H;  4YEB B;  1D0B A;  5LFN A;  3OGK B;  4R6F A;  4NXN H;  2OMT A;  4JI5 H;  1LTX A;  1GWB A;  4DV3 H;  4PER A;  5GAH c;  4XXB B;  3KYW A;  2L0Z A;  2KKD A;  1DCE A;  4LSX C;  1G9U A;  1IRN A;  1R0G A;  4U67 1;  2Z62 A;  5JVH 1;  4ME3 A;  4B3T H;  4FHO A;  1B2J A;  2H12 A;  4R0A A;  4LXS A;  4DV0 H;  2JI1 A;  2UUA H;  2JE1 A;  3UL9 A;  3C6O B;  1OOK G;  4Z8G A;  5GAE c;  1SMU A;  3C6P B;  1U0N D;  3BZ5 A;  4POG A;  4DR7 H;  2PT7 G;  4LSA A;  4KNG A;  1E8J A;  4ARR A;  3P8B A;  1IU5 A;  5HDH A;  3RW7 A;  3ULA A;  1CAD A;  1VZI A;  3SS2 A;  4DV2 H;  2WQV A;  5HZL B;  2FT3 A;  1N34 H;  3DZE A;  1VZH A;  3OTO H;  4V19 6;  1FS2 A;  2JI3 A;  3W3K A;  5AI3 A;  3PMH G;  4Q3I A;  4R5D A;  3A79 B;  3B0A B;  1T9P A;  4LHL A;  5AZ5 A;  3WPD A;  3GR5 A;  3JAM W;  2CKA A;  2OMW A;  3CIY A;  5GQR K;  3W3N A;  4JI6 H;  3PIO 1;  2PYA A;  1IO0 A;  1BQ9 A;  2XWT C;  2XJQ A;  4Q3G A;  4X65 H;  3WPE A;  1BQ8 A;  3RFJ A;  4ECO A;  1W8A A;  4AI2 A;  2VQE H;  3FAU A;  4AR5 A;  4WYK A;  3RJ0 A;  1RDG A;  2JI2 A;  1N32 H;  4JI2 H;  4DR5 H;  2M6O A;  3W3L A;  4R6J A;  1DFJ I;  4JI1 H;  1B2O A;  1BFY A;  4R6G A;  2A68 D;  2PSM C;  3J7Z 1;  4K17 A;  4Q62 A;  6RXN A;  3OJA B;  3J7A K;  4EZG A;  2M4Y A;  1HNZ H;  2Z3Q B;  4E9J A;  4K0K H;  1HNX H;  1FHH A;  4ZN1 B;  3LPE B;  4GS7 D;  4AY9 X;  3G06 A;  2UZX A;  3ZG6 A;  4ARN A;  1JYB A;  1I94 H;  4CC4 A;  4OCH A;  2VKC A;  5IJC A;  3IU3 I;  2LF0 A;  5A5C A;  3K35 A;  4R5C A;  2AST B;  4X66 H;  1DS9 A;  4B3S H;  1NNQ A;  4DUY H;  4HQ1 A;  1N36 H;  2UXD H;  3OGM B;  4WFN 1;  4LSC A;  2CR8 A;  4AI0 A;  4KT1 A;  5CMN A;  2Z82 A;  2UUB H;  4FDW A;  3SB4 A;  1YUZ A;  2RDV A;  4BSS A;  3GAB A;  3WWL A;  2M4V A;  5DM6 1;  4H09 A;  1LKP A;  5B4P A;  1QYB A;  1I6U A;  4ZN3 B;  3NCV A;  3W3J A;  1WJV A;  4R07 A;  4LFC H;  4DR4 H;  1IRO A;  3KYX A;  2HHH H;  4LF7 H;  4MQW X;  3G39 A;  3UL7 A;  4KHP H;  2D9I A;  4PQ8 A;  1OWB A;  1XNR H;  5MGN A;  3ZYI A;  5GS2 B;  5AWB A;  3NFP I;  1XEU A;  3RIZ A;  2AYJ A;  4JI4 H;  2A0Z A;  2MS3 A;  4AR6 A;  3CVR A;  1YK4 A;  4XGO A;  1P8T A;  3PWF A;  3C6N B;  4TPU A;  2V70 A;  4MN8 B;  4L3F A;  5AWC A;  1LKM A;  5LMN H;  4J0M A;  4U06 A;  5FLX W;  4DUZ H;  5IY0 A;  1R0F A;  1IBK H;  5B0N A;  4LI2 A;  1H6T A;  3W3M A;  4XOS A;  1FT8 A;  1O6S A;  3OSS D;  2UUC H;  2P1N B;  4FCG A;  4YY3 H;  2V3B B;  2XJR A;  3UL8 A;  4BSU A;  2UU9 H;  3QD7 X;  4RCW A;  2O6S A;  4LFA H;  1P8V A;  5A2Q W;  2F4V H;  1LKO A;  4XGH A;  1YV1 A;  1OGQ A;  4OQT A;  3KYY A;  3J80 W;  1FJG H;  4YWL A;  4V2D A;  3MPS A;  1NXG A;  3FXI A;  3KDK A;  1KOH A;  3QVD A;  2ZQE A;  4DV4 H;  1FO1 A;  4FD0 A;  1N33 H;  2LCQ A;  2NYD A;  1ZIW A;  1LTL A;  1IU6 A;  4BV4 R;  3RGX A;  4XSQ A;  1DX8 A;  4GKJ H;  2V0E A;  2OMV A;  3WPG A;  4LFB H;  4M7E C;  5K2M E;  4NZT M;  5AN9 H;  4B3M H;  2V9T B;  4GLP A;  3E3Z A;  4Z79 A;  1S24 A;  4JAG A;  4CC4 C;  2FPH X;  1Z7X W;  3VQ1 A;  1YUX A;  1B13 A;  5AWA A;  4Z94 G;  4AHW A;  4QBZ A;  2O5J D;  4K9F A;  3ZYN A;  2PVX A;  1OTN A;  2JQD A;  2V9S A;  4DR3 H;  4JAE A;  4X62 H;  2Q4G W;  5IJB A;  3O53 A;  1BRF A;  3TSR E;  4UFR A;  1SMM A;  4DR6 H;  3ZYO A;  3A44 A;  4KXF B;  1XMO H;  1RWD A;  2ERS A;  1XWD C;  2RA8 A;  3JB9 j;  4DV1 H;  1IBL H;  1H7V A;  2Y5Q A;  3OET A;  3E6J A;  5IT9 W;  5IWA H;  2C6A A;  3SB1 A;  4P8S A;  4BSR A;  4QXE A;  1A9N A;  3LNL A;  3ULV A;  1P9A G;  5GMG A;  2WFH A;  2ASS B;  1IBM H;  2HR5 A;  4AR4 A;  5IJD A;  8RXN A;  5GMF A;  4I6J B;  4JI7 H;  1XNQ H;  5MF6 A;  4JAD A;  5DT9 A;  2QL0 A;  2UXC H;  5GMH A;  4TZH A;  2KN9 A;  3WPH A;  4C2A B;  2CA6 A;  5EIO C;  1JL5 A;  1K5D C;  4PKI G;  3T1H H;  1HNW H;  2WQX A;  3WPF A;  3G3A A;  3PIP 1;  2B5I D;  1R0H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...