4EC5A

Crystal structure of the s210c (dimer) mutant from the n-terminal domain of the secretin xcpq from pseudomonas aeruginosa
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
234
structure length
218
Chain Sequence
AFVPAAHWTINLKDADIREFIDQISEITGETFVVDPRVKGQVSVVSKAQLSLSEVYQLFLSVMSTHGFTVVAQGDQARIVPNAAPDRLETRVIQVQQSPVSELIPLIRPLVPQYGHLAAVPSANALIISDRSANIARIEDVIRQLDQKGSHDYCVINLRYGWVMDAAEVLNNAMSRGQAKGAAGAQVIADARTNRLIILGPPQARAKLVQLAQSLDTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords General secretion pathway protein D
publication title New Insights into the Assembly of Bacterial Secretins: STRUCTURAL STUDIES OF THE PERIPLASMIC DOMAIN OF XcpQ FROM PSEUDOMONAS AERUGINOSA.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 56
structure length 218
sequence length 234
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03958 Secretin_N Bacterial type II/III secretion system short domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.120 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 4ec5A02
3.30.1370.120 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 4ec5A01
3GR5A 4G08A 4EC5A 3OSSD 4E9JA 3EZJA 2Y3MA
chains in the Genus database with same CATH superfamily
4JI4H 1N34H 4LF8H 1WTJA 4GKJH 4QMFB 2CTMA 4DV5H 2CPMA 1XMQH 1VIGA 4OX9H 3GKUA 1ZZIA 2M6QA 2Y3MA 2VQFH 4LFAH 1WHRA 4KHPH 1VIHA 3GABA 3GR5A 2CTEA 2G8YA 1ZTGA 4H8AA 3RF2A 4K0KH 2AXYA 1ZZJA 4JI1H 2NN6G 1ODHA 1S03G 4B8CD 2UUCH 2UXDH 2JE6I 2OPUA 1DTJA 2X06A 1NXUA 4LIJA 4NXMH 1DT4A 1XNQH 1Z2IA 4G08A 2ANNA 4JYAH 4X66H 5IT9W 1IBMH 2LRRA 2BL5A 5C0XG 4LF9H 1ZZKA 5LMUH 4JVYA 3J80W 4AQYH 4DR7H 3I0PA 2UUAH 4LF7H 1N33H 2DGRA 3NCVA 3FAUA 4B3SH 2JEBI 3KDKA 1X0AA 4FJUA 2E3UA 2VQEH 1PQXA 1VBIA 2QNDA 3OSSD 4AIMA 4B3MH 1FJGH 4BA2I 5LMNH 4YY3H 1N32H 3OTOH 1J5KA 1FKAH 2K1HA 2FFMA 4DR5H 2MJHA 2UUBH 1KHMA 5DT9A 3T1HH 2VKCA 4OCHA 1X4NA 2P2RA 4JI8H 4FJSA 2LTLA 4NXNH 1F0XA 3KDGA 2LF0A 2F4VH 2CTKA 5FLXW 5BR8H 5A2QW 4JI5H 2PQUA 2FPHX 4LFCH 1J4WA 4OO1G 4DR2H 1X4MA 4DR3H 1XNRH 2PT7G 4PDBA 2BA0A 1S20A 2PY9A 4DR1H 4LF5H 2Z0SA 2ZM6H 2ZQEA 4BA1I 2CPQA 1XMOH 2FMRA 2UU9H 4JVHA 4B3TH 2YQRA 4DUZH 2A1SA 4JI6H 1IBKH 1MSZA 1WE8A 4JV5H 4DV3H 4JI0H 3EZJA 4DV6H 1EC6A 2E5LH 2CTFA 4B3RH 1I94H 1UG8A 4JI3H 1HNXH 1TUAA 3V69A 2D9IA 4DV7H 1HNZH 1HR0H 3OETA 4WANA 2ANRA 1WVNA 1V9NA 4B8TA 1I6UA 2JEAI 2JVZA 3L7ZC 4X64H 3J81W 1IBLH 4JI2H 4DUYH 4DV0H 2CTLA 2OPVA 3JAMW 5K36G 4JI7H 4NBQA 1SEIA 2HH2A 1X9ZA 2UXCH 4GKKH 3VKEA 2O4CA 4IFDG 3SB1A 4AM3A 4DV1H 2HHHH 4LF6H 1XRHA 4NZTM 1HNWH 2UXBH 3UOEA 4X65H 4DV4H 4DR4H 4DR6H 3AEVB 3QD7X 3U1KA 4X62H 1AN7A 2M8WA 4LF4H 3J7AK 4OD6A 5JEAG 4LFBH 1K1GA 2HH3A 2CWFA 1V8CA 2JZXA 2CWHA 2LTMA 5LL6b 4WALA 3T1YH 4NZRM 2JA9A 4EC5A 2CTJA 4E9JA 5IWAH 4DV2H 1J5EH 4YHHH 1N36H
chains in the Genus database with same CATH topology
4JI4H 1N34H 4LF8H 4GKJH 4DV5H 1XMQH 4OX9H 2Y3MA 2VQFH 4LFAH 4KHPH 3GABA 3GR5A 3RF2A 4K0KH 4JI1H 1ODHA 1S03G 4B8CD 2UUCH 2UXDH 4NXMH 1XNQH 4G08A 4JYAH 4X66H 5IT9W 1IBMH 4LF9H 5LMUH 4AQYH 3J80W 4DR7H 2UUAH 1N33H 4LF7H 3NCVA 3FAUA 4B3SH 2VQEH 3KDKA 1FJGH 4PDBA 3OSSD 4B3MH 5LMNH 4YY3H 1N32H 3OTOH 1FKAH 4DR5H 2UUBH 5DT9A 3T1HH 2VKCA 4OCHA 4JI8H 4NXNH 1F0XA 3KDGA 2LF0A 2F4VH 5FLXW 5BR8H 5A2QW 4JI5H 2FPHX 4LFCH 4DR2H 4DR3H 1XNRH 2PT7G 4DR1H 4LF5H 2ZM6H 2ZQEA 1XMOH 2UU9H 4B3TH 4DUZH 4JI6H 1IBKH 4JV5H 4DV3H 4JI0H 3EZJA 4DV6H 2E5LH 4B3RH 1I94H 4JI3H 1HNXH 2D9IA 4DV7H 1HNZH 1HR0H 3OETA 1I6UA 4X64H 3J81W 1IBLH 4JI2H 4DUYH 4DV0H 3JAMW 4JI7H 1SEIA 1X9ZA 2UXCH 4GKKH 2O4CA 3SB1A 4DV1H 2HHHH 4LF6H 4NZTM 1HNWH 2UXBH 4X65H 4DV4H 4DR4H 4DR6H 3QD7X 4X62H 1AN7A 4LF4H 3J7AK 4OD6A 4LFBH 5LL6b 3T1YH 4NZRM 4EC5A 4E9JA 5IWAH 4DV2H 1J5EH 4YHHH 1N36H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GR5 A;  4G08 A;  4EC5 A;  3OSS D;  4E9J A;  3EZJ A;  2Y3M A; 
#chains in the Genus database with same CATH topology
 4JI4 H;  1N34 H;  4LF8 H;  1WTJ A;  4GKJ H;  4QMF B;  2CTM A;  4DV5 H;  2CPM A;  1XMQ H;  1VIG A;  4OX9 H;  3GKU A;  1ZZI A;  2M6Q A;  2Y3M A;  2VQF H;  4LFA H;  1WHR A;  4KHP H;  1VIH A;  3GAB A;  3GR5 A;  2CTE A;  2G8Y A;  1ZTG A;  4H8A A;  3RF2 A;  4K0K H;  2AXY A;  1ZZJ A;  4JI1 H;  2NN6 G;  1ODH A;  1S03 G;  4B8C D;  2UUC H;  2UXD H;  2JE6 I;  2OPU A;  1DTJ A;  2X06 A;  1NXU A;  4LIJ A;  4NXM H;  1DT4 A;  1XNQ H;  1Z2I A;  4G08 A;  2ANN A;  4JYA H;  4X66 H;  5IT9 W;  1IBM H;  2LRR A;  2BL5 A;  5C0X G;  4LF9 H;  1ZZK A;  5LMU H;  4JVY A;  3J80 W;  4AQY H;  4DR7 H;  3I0P A;  2UUA H;  4LF7 H;  1N33 H;  2DGR A;  3NCV A;  3FAU A;  4B3S H;  2JEB I;  3KDK A;  1X0A A;  4FJU A;  2E3U A;  2VQE H;  1PQX A;  1VBI A;  2QND A;  3OSS D;  4AIM A;  4B3M H;  1FJG H;  4BA2 I;  5LMN H;  4YY3 H;  1N32 H;  3OTO H;  1J5K A;  1FKA H;  2K1H A;  2FFM A;  4DR5 H;  2MJH A;  2UUB H;  1KHM A;  5DT9 A;  3T1H H;  2VKC A;  4OCH A;  1X4N A;  2P2R A;  4JI8 H;  4FJS A;  2LTL A;  4NXN H;  1F0X A;  3KDG A;  2LF0 A;  2F4V H;  2CTK A;  5FLX W;  5BR8 H;  5A2Q W;  4JI5 H;  2PQU A;  2FPH X;  4LFC H;  1J4W A;  4OO1 G;  4DR2 H;  1X4M A;  4DR3 H;  1XNR H;  2PT7 G;  4PDB A;  2BA0 A;  1S20 A;  2PY9 A;  4DR1 H;  4LF5 H;  2Z0S A;  2ZM6 H;  2ZQE A;  4BA1 I;  2CPQ A;  1XMO H;  2FMR A;  2UU9 H;  4JVH A;  4B3T H;  2YQR A;  4DUZ H;  2A1S A;  4JI6 H;  1IBK H;  1MSZ A;  1WE8 A;  4JV5 H;  4DV3 H;  4JI0 H;  3EZJ A;  4DV6 H;  1EC6 A;  2E5L H;  2CTF A;  4B3R H;  1I94 H;  1UG8 A;  4JI3 H;  1HNX H;  1TUA A;  3V69 A;  2D9I A;  4DV7 H;  1HNZ H;  1HR0 H;  3OET A;  4WAN A;  2ANR A;  1WVN A;  1V9N A;  4B8T A;  1I6U A;  2JEA I;  2JVZ A;  3L7Z C;  4X64 H;  3J81 W;  1IBL H;  4JI2 H;  4DUY H;  4DV0 H;  2CTL A;  2OPV A;  3JAM W;  5K36 G;  4JI7 H;  4NBQ A;  1SEI A;  2HH2 A;  1X9Z A;  2UXC H;  4GKK H;  3VKE A;  2O4C A;  4IFD G;  3SB1 A;  4AM3 A;  4DV1 H;  2HHH H;  4LF6 H;  1XRH A;  4NZT M;  1HNW H;  2UXB H;  3UOE A;  4X65 H;  4DV4 H;  4DR4 H;  4DR6 H;  3AEV B;  3QD7 X;  3U1K A;  4X62 H;  1AN7 A;  2M8W A;  4LF4 H;  3J7A K;  4OD6 A;  5JEA G;  4LFB H;  1K1G A;  2HH3 A;  2CWF A;  1V8C A;  2JZX A;  2CWH A;  2LTM A;  5LL6 b;  4WAL A;  3T1Y H;  4NZR M;  2JA9 A;  4EC5 A;  2CTJ A;  4E9J A;  5IWA H;  4DV2 H;  1J5E H;  4YHH H;  1N36 H; 
#chains in the Genus database with same CATH homology
 4JI4 H;  1N34 H;  4LF8 H;  4GKJ H;  4DV5 H;  1XMQ H;  4OX9 H;  2Y3M A;  2VQF H;  4LFA H;  4KHP H;  3GAB A;  3GR5 A;  3RF2 A;  4K0K H;  4JI1 H;  1ODH A;  1S03 G;  4B8C D;  2UUC H;  2UXD H;  4NXM H;  1XNQ H;  4G08 A;  4JYA H;  4X66 H;  5IT9 W;  1IBM H;  4LF9 H;  5LMU H;  4AQY H;  3J80 W;  4DR7 H;  2UUA H;  1N33 H;  4LF7 H;  3NCV A;  3FAU A;  4B3S H;  2VQE H;  3KDK A;  1FJG H;  4PDB A;  3OSS D;  4B3M H;  5LMN H;  4YY3 H;  1N32 H;  3OTO H;  1FKA H;  4DR5 H;  2UUB H;  5DT9 A;  3T1H H;  2VKC A;  4OCH A;  4JI8 H;  4NXN H;  1F0X A;  3KDG A;  2LF0 A;  2F4V H;  5FLX W;  5BR8 H;  5A2Q W;  4JI5 H;  2FPH X;  4LFC H;  4DR2 H;  4DR3 H;  1XNR H;  2PT7 G;  4DR1 H;  4LF5 H;  2ZM6 H;  2ZQE A;  1XMO H;  2UU9 H;  4B3T H;  4DUZ H;  4JI6 H;  1IBK H;  4JV5 H;  4DV3 H;  4JI0 H;  3EZJ A;  4DV6 H;  2E5L H;  4B3R H;  1I94 H;  4JI3 H;  1HNX H;  2D9I A;  4DV7 H;  1HNZ H;  1HR0 H;  3OET A;  1I6U A;  4X64 H;  3J81 W;  1IBL H;  4JI2 H;  4DUY H;  4DV0 H;  3JAM W;  4JI7 H;  1SEI A;  1X9Z A;  2UXC H;  4GKK H;  2O4C A;  3SB1 A;  4DV1 H;  2HHH H;  4LF6 H;  4NZT M;  1HNW H;  2UXB H;  4X65 H;  4DV4 H;  4DR4 H;  4DR6 H;  3QD7 X;  4X62 H;  1AN7 A;  4LF4 H;  3J7A K;  4OD6 A;  4LFB H;  5LL6 b;  3T1Y H;  4NZR M;  4EC5 A;  4E9J A;  5IWA H;  4DV2 H;  1J5E H;  4YHH H;  1N36 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...