4EC5A

Crystal structure of the s210c (dimer) mutant from the n-terminal domain of the secretin xcpq from pseudomonas aeruginosa
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
234
structure length
218
Chain Sequence
b'AFVPAAHWTINLKDADIREFIDQISEITGETFVVDPRVKGQVSVVSKAQLSLSEVYQLFLSVMSTHGFTVVAQGDQARIVPNAAPDRLETRVIQVQQSPVSELIPLIRPLVPQYGHLAAVPSANALIISDRSANIARIEDVIRQLDQKGSHDYCVINLRYGWVMDAAEVLNNAMSRGQAKGAAGAQVIADARTNRLIILGPPQARAKLVQLAQSLDTP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords General secretion pathway protein D
publication title New Insights into the Assembly of Bacterial Secretins: STRUCTURAL STUDIES OF THE PERIPLASMIC DOMAIN OF XcpQ FROM PSEUDOMONAS AERUGINOSA.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Protein transport
total genus 56
structure length 218
sequence length 234
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03958 Secretin_N Bacterial type II/III secretion system short domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.120 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 4ec5A02
3.30.1370.120 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 4ec5A01
4E9JA 3OSSD 4G08A 3EZJA 3GR5A 4EC5A 2Y3MA
chains in the Genus database with same CATH superfamily
1WE8A 4OX9H 4FJSA 2M6QA 4DR5H 4JI6H 4KHPH 5JEAG 2VKCA 1FJGH 3L7ZC 5LMUH 2D9IA 4LF8H 1S20A 1F0XA 4AIMA 3JAMW 4B3RH 4YY3H 1AN7A 2DGRA 2HHHH 4B8TA 2HH3A 2BA0A 1FKAH 2LTMA 2UU9H 2PQUA 4G08A 1ZZIA 4LFAH 1DTJA 5LMNH 1N36H 1J5KA 2UXBH 4AM3A 2HH2A 3GKUA 2ANNA 4YHHH 5A2QW 4JI8H 1X4MA 4DV3H 2NN6G 4DUZH 4K0KH 1Z2IA 4LFCH 2AXYA 4JVHA 1VIHA 4DR2H 2VQEH 5IT9W 2QNDA 3OETA 4DR6H 2UXDH 2MJHA 2G8YA 4BA2I 3OTOH 2VQFH 1HNXH 4JI3H 4LF9H 4GKJH 4B8CD 4E9JA 4OO1G 2M8WA 1MSZA 2FFMA 2CPQA 1K1GA 2E3UA 3AEVB 3J7AK 1ZZJA 4H8AA 3UOEA 4DUYH 4DV1H 1IBKH 2JEAI 2K1HA 1TUAA 3V69A 4WANA 4GKKH 2JA9A 1XMQH 3J81W 2UUBH 1HNWH 4X64H 2CPMA 2PT7G 3NCVA 3GR5A 4JI1H 3I0PA 1EC6A 4B3SH 5IWAH 4OCHA 1WTJA 5FLXW 2F4VH 3VKEA 4DR4H 3FAUA 1S03G 4LF6H 2O4CA 4NZTM 1XNRH 2E5LH 1DT4A 3T1YH 1IBLH 4X66H 1J5EH 2JZXA 4JI5H 1VIGA 2CTLA 1HNZH 4DR1H 3KDKA 1X4NA 2FMRA 4LFBH 5K36G 4FJUA 4X62H 3T1HH 4NXMH 2OPVA 2CTJA 4NXNH 2JE6I 1XRHA 4B3MH 4OD6A 3U1KA 4LF5H 1ZZKA 1UG8A 3OSSD 4LF4H 3EZJA 2JEBI 4QMFB 2YQRA 2LTLA 1N33H 1X0AA 1NXUA 2CWFA 3KDGA 2X06A 2ANRA 4JVYA 2LRRA 2CTMA 2CTEA 4JI0H 1HR0H 1X9ZA 3QD7X 1I94H 2ZM6H 4DV5H 1N34H 2JVZA 4LIJA 1J4WA 4IFDG 1ZTGA 4LF7H 2PY9A 5BR8H 1WHRA 2LF0A 1XMOH 4DR3H 1ODHA 1IBMH 1KHMA 1WVNA 2Y3MA 2ZQEA 2A1SA 4B3TH 5C0XG 4DV6H 1SEIA 2UXCH 4JI4H 5LL6b 1I6UA 2CWHA 5DT9A 3SB1A 4JYAH 1XNQH 4JI7H 4NBQA 2OPUA 2Z0SA 3RF2A 1PQXA 1VBIA 4AQYH 4JV5H 4DV7H 4DV0H 4DR7H 1V8CA 2CTFA 3J80W 1V9NA 2UUAH 4BA1I 2CTKA 2UUCH 2P2RA 4DV4H 4WALA 2FPHX 4JI2H 4EC5A 4DV2H 3GABA 4X65H 4PDBA 1N32H 4NZRM 2BL5A
chains in the Genus database with same CATH topology
4OX9H 4DR5H 4JI6H 4KHPH 2VKCA 1FJGH 5LMUH 2D9IA 4LF8H 1F0XA 3JAMW 4B3RH 4YY3H 1AN7A 2HHHH 1FKAH 2UU9H 4G08A 4LFAH 5LMNH 1N36H 2UXBH 4YHHH 5A2QW 4JI8H 4DV3H 4K0KH 4DUZH 4LFCH 4DR2H 2VQEH 5IT9W 3OETA 4DR6H 2UXDH 3OTOH 2VQFH 1HNXH 4JI3H 4LF9H 4GKJH 4B8CD 4E9JA 3J7AK 4DUYH 4DV1H 1IBKH 4GKKH 1XMQH 3J81W 2UUBH 1HNWH 4X64H 2PT7G 3NCVA 4JI1H 3GR5A 4B3SH 5IWAH 4OCHA 5FLXW 4DR4H 2F4VH 3FAUA 1S03G 4LF6H 4NZTM 2O4CA 1XNRH 2E5LH 3T1YH 1IBLH 4X66H 1J5EH 4JI5H 1HNZH 4DR1H 3KDKA 4LFBH 4X62H 3T1HH 4NXMH 4NXNH 4B3MH 4OD6A 4LF5H 4LF4H 3OSSD 3EZJA 1N33H 3KDGA 4JI0H 1HR0H 1X9ZA 3QD7X 1I94H 2ZM6H 4DV5H 1N34H 4LF7H 5BR8H 2LF0A 1XMOH 4DR3H 1ODHA 1IBMH 2Y3MA 2ZQEA 4B3TH 4DV6H 1SEIA 2UXCH 4JI4H 5LL6b 1I6UA 5DT9A 3SB1A 4JYAH 1XNQH 4JI7H 4AQYH 3RF2A 4JV5H 4DV7H 4DV0H 4DR7H 3J80W 2UUAH 2UUCH 4DV4H 2FPHX 4JI2H 4EC5A 4DV2H 3GABA 4X65H 4PDBA 1N32H 4NZRM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E9J A;  3OSS D;  4G08 A;  3EZJ A;  3GR5 A;  4EC5 A;  2Y3M A; 
#chains in the Genus database with same CATH topology
 1WE8 A;  4OX9 H;  4FJS A;  2M6Q A;  4DR5 H;  4JI6 H;  4KHP H;  5JEA G;  2VKC A;  1FJG H;  3L7Z C;  5LMU H;  2D9I A;  4LF8 H;  1S20 A;  1F0X A;  4AIM A;  3JAM W;  4B3R H;  4YY3 H;  1AN7 A;  2DGR A;  2HHH H;  4B8T A;  2HH3 A;  2BA0 A;  1FKA H;  2LTM A;  2UU9 H;  2PQU A;  4G08 A;  1ZZI A;  4LFA H;  1DTJ A;  5LMN H;  1N36 H;  1J5K A;  2UXB H;  4AM3 A;  2HH2 A;  3GKU A;  2ANN A;  4YHH H;  5A2Q W;  4JI8 H;  1X4M A;  4DV3 H;  2NN6 G;  4DUZ H;  4K0K H;  1Z2I A;  4LFC H;  2AXY A;  4JVH A;  1VIH A;  4DR2 H;  2VQE H;  5IT9 W;  2QND A;  3OET A;  4DR6 H;  2UXD H;  2MJH A;  2G8Y A;  4BA2 I;  3OTO H;  2VQF H;  1HNX H;  4JI3 H;  4LF9 H;  4GKJ H;  4B8C D;  4E9J A;  4OO1 G;  2M8W A;  1MSZ A;  2FFM A;  2CPQ A;  1K1G A;  2E3U A;  3AEV B;  3J7A K;  1ZZJ A;  4H8A A;  3UOE A;  4DUY H;  4DV1 H;  1IBK H;  2JEA I;  2K1H A;  1TUA A;  3V69 A;  4WAN A;  4GKK H;  2JA9 A;  1XMQ H;  3J81 W;  2UUB H;  1HNW H;  4X64 H;  2CPM A;  2PT7 G;  3NCV A;  3GR5 A;  4JI1 H;  3I0P A;  1EC6 A;  4B3S H;  5IWA H;  4OCH A;  1WTJ A;  5FLX W;  2F4V H;  3VKE A;  4DR4 H;  3FAU A;  1S03 G;  4LF6 H;  2O4C A;  4NZT M;  1XNR H;  2E5L H;  1DT4 A;  3T1Y H;  1IBL H;  4X66 H;  1J5E H;  2JZX A;  4JI5 H;  1VIG A;  2CTL A;  1HNZ H;  4DR1 H;  3KDK A;  1X4N A;  2FMR A;  4LFB H;  5K36 G;  4FJU A;  4X62 H;  3T1H H;  4NXM H;  2OPV A;  2CTJ A;  4NXN H;  2JE6 I;  1XRH A;  4B3M H;  4OD6 A;  3U1K A;  4LF5 H;  1ZZK A;  1UG8 A;  3OSS D;  4LF4 H;  3EZJ A;  2JEB I;  4QMF B;  2YQR A;  2LTL A;  1N33 H;  1X0A A;  1NXU A;  2CWF A;  3KDG A;  2X06 A;  2ANR A;  4JVY A;  2LRR A;  2CTM A;  2CTE A;  4JI0 H;  1HR0 H;  1X9Z A;  3QD7 X;  1I94 H;  2ZM6 H;  4DV5 H;  1N34 H;  2JVZ A;  4LIJ A;  1J4W A;  4IFD G;  1ZTG A;  4LF7 H;  2PY9 A;  5BR8 H;  1WHR A;  2LF0 A;  1XMO H;  4DR3 H;  1ODH A;  1IBM H;  1KHM A;  1WVN A;  2Y3M A;  2ZQE A;  2A1S A;  4B3T H;  5C0X G;  4DV6 H;  1SEI A;  2UXC H;  4JI4 H;  5LL6 b;  1I6U A;  2CWH A;  5DT9 A;  3SB1 A;  4JYA H;  1XNQ H;  4JI7 H;  4NBQ A;  2OPU A;  2Z0S A;  3RF2 A;  1PQX A;  1VBI A;  4AQY H;  4JV5 H;  4DV7 H;  4DV0 H;  4DR7 H;  1V8C A;  2CTF A;  3J80 W;  1V9N A;  2UUA H;  4BA1 I;  2CTK A;  2UUC H;  2P2R A;  4DV4 H;  4WAL A;  2FPH X;  4JI2 H;  4EC5 A;  4DV2 H;  3GAB A;  4X65 H;  4PDB A;  1N32 H;  4NZR M;  2BL5 A; 
#chains in the Genus database with same CATH homology
 4OX9 H;  4DR5 H;  4JI6 H;  4KHP H;  2VKC A;  1FJG H;  5LMU H;  2D9I A;  4LF8 H;  1F0X A;  3JAM W;  4B3R H;  4YY3 H;  1AN7 A;  2HHH H;  1FKA H;  2UU9 H;  4G08 A;  4LFA H;  5LMN H;  1N36 H;  2UXB H;  4YHH H;  5A2Q W;  4JI8 H;  4DV3 H;  4K0K H;  4DUZ H;  4LFC H;  4DR2 H;  2VQE H;  5IT9 W;  3OET A;  4DR6 H;  2UXD H;  3OTO H;  2VQF H;  1HNX H;  4JI3 H;  4LF9 H;  4GKJ H;  4B8C D;  4E9J A;  3J7A K;  4DUY H;  4DV1 H;  1IBK H;  4GKK H;  1XMQ H;  3J81 W;  2UUB H;  1HNW H;  4X64 H;  2PT7 G;  3NCV A;  4JI1 H;  3GR5 A;  4B3S H;  5IWA H;  4OCH A;  5FLX W;  4DR4 H;  2F4V H;  3FAU A;  1S03 G;  4LF6 H;  4NZT M;  2O4C A;  1XNR H;  2E5L H;  3T1Y H;  1IBL H;  4X66 H;  1J5E H;  4JI5 H;  1HNZ H;  4DR1 H;  3KDK A;  4LFB H;  4X62 H;  3T1H H;  4NXM H;  4NXN H;  4B3M H;  4OD6 A;  4LF5 H;  4LF4 H;  3OSS D;  3EZJ A;  1N33 H;  3KDG A;  4JI0 H;  1HR0 H;  1X9Z A;  3QD7 X;  1I94 H;  2ZM6 H;  4DV5 H;  1N34 H;  4LF7 H;  5BR8 H;  2LF0 A;  1XMO H;  4DR3 H;  1ODH A;  1IBM H;  2Y3M A;  2ZQE A;  4B3T H;  4DV6 H;  1SEI A;  2UXC H;  4JI4 H;  5LL6 b;  1I6U A;  5DT9 A;  3SB1 A;  4JYA H;  1XNQ H;  4JI7 H;  4AQY H;  3RF2 A;  4JV5 H;  4DV7 H;  4DV0 H;  4DR7 H;  3J80 W;  2UUA H;  2UUC H;  4DV4 H;  2FPH X;  4JI2 H;  4EC5 A;  4DV2 H;  3GAB A;  4X65 H;  4PDB A;  1N32 H;  4NZR M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...