4EC5A

Crystal structure of the s210c (dimer) mutant from the n-terminal domain of the secretin xcpq from pseudomonas aeruginosa
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
234
structure length
218
Chain Sequence
AFVPAAHWTINLKDADIREFIDQISEITGETFVVDPRVKGQVSVVSKAQLSLSEVYQLFLSVMSTHGFTVVAQGDQARIVPNAAPDRLETRVIQVQQSPVSELIPLIRPLVPQYGHLAAVPSANALIISDRSANIARIEDVIRQLDQKGSHDYCVINLRYGWVMDAAEVLNNAMSRGQAKGAAGAQVIADARTNRLIILGPPQARAKLVQLAQSLDTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords General secretion pathway protein D
publication title New Insights into the Assembly of Bacterial Secretins: STRUCTURAL STUDIES OF THE PERIPLASMIC DOMAIN OF XcpQ FROM PSEUDOMONAS AERUGINOSA.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Protein transport
total genus 56
structure length 218
sequence length 234
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03958 Secretin_N Bacterial type II/III secretion system short domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.120 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 4ec5A02
3.30.1370.120 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 4ec5A01
4EC5A 4E9JA 3OSSD 3GR5A 3EZJA 2Y3MA 4G08A
chains in the Genus database with same CATH superfamily
2QNDA 2CTMA 1HNZH 2HH3A 4OCHA 2NN6G 4JI3H 2VQFH 4AIMA 4JI0H 4X64H 4JI1H 1MSZA 2LTLA 1N33H 2K1HA 4DV3H 1HR0H 2BA0A 2JZXA 3OETA 2LTMA 1NXUA 4JI7H 2UXBH 2Z0SA 4DR4H 3OSSD 2M8WA 4LFCH 1XMQH 4JI2H 3L7ZC 4DR3H 1TUAA 3U1KA 1XMOH 2UXCH 5FLXW 4B3TH 4B3MH 1J4WA 1N36H 4B3SH 4QMFB 4GKKH 2BL5A 4DR7H 4B8CD 1J5EH 4OX9H 4LF4H 4DV5H 2JEAI 4NZTM 4PDBA 1SEIA 2HH2A 5LMUH 1X4MA 1I94H 2JVZA 2UUAH 3T1YH 1VBIA 2F4VH 3SB1A 4DV6H 1IBKH 2E5LH 2P2RA 4JI5H 1DTJA 5A2QW 3QD7X 3V69A 2YQRA 1HNXH 1IBMH 1HNWH 1KHMA 4JVHA 4H8AA 2O4CA 1N32H 3AEVB 3GKUA 1VIGA 1ZZKA 4X66H 1ZZJA 4AM3A 3OTOH 4IFDG 1WVNA 2ZQEA 4LF8H 2CTJA 4YY3H 4K0KH 1J5KA 3VKEA 4DV4H 4DV7H 2CTEA 4DV1H 2PQUA 3J80W 2CWHA 1DT4A 4NXMH 1XNQH 3JAMW 2ZM6H 4YHHH 2E3UA 4LF5H 3KDGA 1FKAH 1Z2IA 2D9IA 4NBQA 3J81W 2UU9H 1I6UA 5DT9A 4X62H 2VKCA 3GR5A 4DR2H 4OD6A 4KHPH 2X06A 5C0XG 2OPUA 4LFAH 4BA2I 1UG8A 2ANNA 4DV0H 4JV5H 1PQXA 4LF6H 1ZZIA 2JEBI 1K1GA 4OO1G 1WE8A 5JEAG 1XNRH 2AXYA 4DR5H 2PY9A 2FFMA 2CWFA 4B8TA 3GABA 4JVYA 2MJHA 4DR6H 1S03G 1V9NA 1IBLH 2JE6I 2A1SA 1X4NA 3KDKA 2CPMA 5BR8H 2UUCH 3NCVA 1ODHA 2CPQA 1X0AA 4WANA 2HHHH 3UOEA 1F0XA 3T1HH 2LF0A 1N34H 2UUBH 4LFBH 2PT7G 1VIHA 2LRRA 2DGRA 4BA1I 2Y3MA 2M6QA 4NXNH 3RF2A 2FMRA 4DUZH 2CTFA 4AQYH 3J7AK 1WHRA 1S20A 2FPHX 2VQEH 4JYAH 2G8YA 2CTKA 5K36G 2JA9A 4EC5A 5IWAH 4NZRM 4FJSA 3I0PA 4E9JA 1V8CA 1XRHA 2UXDH 4DV2H 4X65H 1EC6A 1FJGH 5IT9W 4JI8H 2CTLA 4LF9H 4JI4H 5LL6b 4LF7H 1ZTGA 5LMNH 2ANRA 4FJUA 3FAUA 1AN7A 4WALA 4DR1H 4GKJH 4B3RH 3EZJA 4LIJA 4JI6H 4G08A 4DUYH 1WTJA 1X9ZA 2OPVA
chains in the Genus database with same CATH topology
1HNZH 4OCHA 4JI3H 2VQFH 4JI0H 4X64H 4JI1H 1N33H 4DV3H 1HR0H 3OETA 4JI7H 2UXBH 4DR4H 3OSSD 4LFCH 1XMQH 4JI2H 4DR3H 1XMOH 2UXCH 5FLXW 4B3TH 4B3MH 1N36H 4B3SH 4GKKH 4DR7H 4B8CD 1J5EH 4OX9H 4LF4H 4DV5H 4NZTM 4PDBA 1SEIA 5LMUH 1I94H 2UUAH 3T1YH 2F4VH 3SB1A 4DV6H 1IBKH 2E5LH 4JI5H 5A2QW 3QD7X 1HNXH 1IBMH 1HNWH 2O4CA 1N32H 4X66H 3OTOH 4LF8H 2ZQEA 4YY3H 4K0KH 4DV4H 4DV7H 4DV1H 3J80W 4NXMH 1XNQH 3JAMW 2ZM6H 4YHHH 4LF5H 3KDGA 1FKAH 2D9IA 2UU9H 1I6UA 3J81W 4DR2H 5DT9A 2VKCA 3GR5A 4X62H 4OD6A 4KHPH 4LFAH 4JV5H 4DV0H 4LF6H 1XNRH 4DR5H 3GABA 4DR6H 1S03G 1IBLH 5BR8H 2UUCH 3NCVA 1ODHA 2HHHH 3T1HH 2LF0A 1N34H 2UUBH 4LFBH 2PT7G 2Y3MA 1X9ZA 4NXNH 3RF2A 4DUZH 4AQYH 3J7AK 2VQEH 2FPHX 4JYAH 4EC5A 5IWAH 4NZRM 4E9JA 2UXDH 4DV2H 4X65H 1FJGH 5IT9W 4JI8H 4LF9H 4JI4H 5LL6b 4LF7H 5LMNH 3FAUA 1AN7A 4DR1H 4GKJH 4B3RH 3EZJA 4JI6H 4G08A 4DUYH 3KDKA 1F0XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EC5 A;  4E9J A;  3OSS D;  3GR5 A;  3EZJ A;  2Y3M A;  4G08 A; 
#chains in the Genus database with same CATH topology
 2QND A;  2CTM A;  1HNZ H;  2HH3 A;  4OCH A;  2NN6 G;  4JI3 H;  2VQF H;  4AIM A;  4JI0 H;  4X64 H;  4JI1 H;  1MSZ A;  2LTL A;  1N33 H;  2K1H A;  4DV3 H;  1HR0 H;  2BA0 A;  2JZX A;  3OET A;  2LTM A;  1NXU A;  4JI7 H;  2UXB H;  2Z0S A;  4DR4 H;  3OSS D;  2M8W A;  4LFC H;  1XMQ H;  4JI2 H;  3L7Z C;  4DR3 H;  1TUA A;  3U1K A;  1XMO H;  2UXC H;  5FLX W;  4B3T H;  4B3M H;  1J4W A;  1N36 H;  4B3S H;  4QMF B;  4GKK H;  2BL5 A;  4DR7 H;  4B8C D;  1J5E H;  4OX9 H;  4LF4 H;  4DV5 H;  2JEA I;  4NZT M;  4PDB A;  1SEI A;  2HH2 A;  5LMU H;  1X4M A;  1I94 H;  2JVZ A;  2UUA H;  3T1Y H;  1VBI A;  2F4V H;  3SB1 A;  4DV6 H;  1IBK H;  2E5L H;  2P2R A;  4JI5 H;  1DTJ A;  5A2Q W;  3QD7 X;  3V69 A;  2YQR A;  1HNX H;  1IBM H;  1HNW H;  1KHM A;  4JVH A;  4H8A A;  2O4C A;  1N32 H;  3AEV B;  3GKU A;  1VIG A;  1ZZK A;  4X66 H;  1ZZJ A;  4AM3 A;  3OTO H;  4IFD G;  1WVN A;  2ZQE A;  4LF8 H;  2CTJ A;  4YY3 H;  4K0K H;  1J5K A;  3VKE A;  4DV4 H;  4DV7 H;  2CTE A;  4DV1 H;  2PQU A;  3J80 W;  2CWH A;  1DT4 A;  4NXM H;  1XNQ H;  3JAM W;  2ZM6 H;  4YHH H;  2E3U A;  4LF5 H;  3KDG A;  1FKA H;  1Z2I A;  2D9I A;  4NBQ A;  3J81 W;  2UU9 H;  1I6U A;  5DT9 A;  4X62 H;  2VKC A;  3GR5 A;  4DR2 H;  4OD6 A;  4KHP H;  2X06 A;  5C0X G;  2OPU A;  4LFA H;  4BA2 I;  1UG8 A;  2ANN A;  4DV0 H;  4JV5 H;  1PQX A;  4LF6 H;  1ZZI A;  2JEB I;  1K1G A;  4OO1 G;  1WE8 A;  5JEA G;  1XNR H;  2AXY A;  4DR5 H;  2PY9 A;  2FFM A;  2CWF A;  4B8T A;  3GAB A;  4JVY A;  2MJH A;  4DR6 H;  1S03 G;  1V9N A;  1IBL H;  2JE6 I;  2A1S A;  1X4N A;  3KDK A;  2CPM A;  5BR8 H;  2UUC H;  3NCV A;  1ODH A;  2CPQ A;  1X0A A;  4WAN A;  2HHH H;  3UOE A;  1F0X A;  3T1H H;  2LF0 A;  1N34 H;  2UUB H;  4LFB H;  2PT7 G;  1VIH A;  2LRR A;  2DGR A;  4BA1 I;  2Y3M A;  2M6Q A;  4NXN H;  3RF2 A;  2FMR A;  4DUZ H;  2CTF A;  4AQY H;  3J7A K;  1WHR A;  1S20 A;  2FPH X;  2VQE H;  4JYA H;  2G8Y A;  2CTK A;  5K36 G;  2JA9 A;  4EC5 A;  5IWA H;  4NZR M;  4FJS A;  3I0P A;  4E9J A;  1V8C A;  1XRH A;  2UXD H;  4DV2 H;  4X65 H;  1EC6 A;  1FJG H;  5IT9 W;  4JI8 H;  2CTL A;  4LF9 H;  4JI4 H;  5LL6 b;  4LF7 H;  1ZTG A;  5LMN H;  2ANR A;  4FJU A;  3FAU A;  1AN7 A;  4WAL A;  4DR1 H;  4GKJ H;  4B3R H;  3EZJ A;  4LIJ A;  4JI6 H;  4G08 A;  4DUY H;  1WTJ A;  1X9Z A;  2OPV A; 
#chains in the Genus database with same CATH homology
 1HNZ H;  4OCH A;  4JI3 H;  2VQF H;  4JI0 H;  4X64 H;  4JI1 H;  1N33 H;  4DV3 H;  1HR0 H;  3OET A;  4JI7 H;  2UXB H;  4DR4 H;  3OSS D;  4LFC H;  1XMQ H;  4JI2 H;  4DR3 H;  1XMO H;  2UXC H;  5FLX W;  4B3T H;  4B3M H;  1N36 H;  4B3S H;  4GKK H;  4DR7 H;  4B8C D;  1J5E H;  4OX9 H;  4LF4 H;  4DV5 H;  4NZT M;  4PDB A;  1SEI A;  5LMU H;  1I94 H;  2UUA H;  3T1Y H;  2F4V H;  3SB1 A;  4DV6 H;  1IBK H;  2E5L H;  4JI5 H;  5A2Q W;  3QD7 X;  1HNX H;  1IBM H;  1HNW H;  2O4C A;  1N32 H;  4X66 H;  3OTO H;  4LF8 H;  2ZQE A;  4YY3 H;  4K0K H;  4DV4 H;  4DV7 H;  4DV1 H;  3J80 W;  4NXM H;  1XNQ H;  3JAM W;  2ZM6 H;  4YHH H;  4LF5 H;  3KDG A;  1FKA H;  2D9I A;  2UU9 H;  1I6U A;  3J81 W;  4DR2 H;  5DT9 A;  2VKC A;  3GR5 A;  4X62 H;  4OD6 A;  4KHP H;  4LFA H;  4JV5 H;  4DV0 H;  4LF6 H;  1XNR H;  4DR5 H;  3GAB A;  4DR6 H;  1S03 G;  1IBL H;  5BR8 H;  2UUC H;  3NCV A;  1ODH A;  2HHH H;  3T1H H;  2LF0 A;  1N34 H;  2UUB H;  4LFB H;  2PT7 G;  2Y3M A;  1X9Z A;  4NXN H;  3RF2 A;  4DUZ H;  4AQY H;  3J7A K;  2VQE H;  2FPH X;  4JYA H;  4EC5 A;  5IWA H;  4NZR M;  4E9J A;  2UXD H;  4DV2 H;  4X65 H;  1FJG H;  5IT9 W;  4JI8 H;  4LF9 H;  4JI4 H;  5LL6 b;  4LF7 H;  5LMN H;  3FAU A;  1AN7 A;  4DR1 H;  4GKJ H;  4B3R H;  3EZJ A;  4JI6 H;  4G08 A;  4DUY H;  3KDK A;  1F0X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...