4EC5A

Crystal structure of the s210c (dimer) mutant from the n-terminal domain of the secretin xcpq from pseudomonas aeruginosa
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
234
structure length
218
Chain Sequence
b'AFVPAAHWTINLKDADIREFIDQISEITGETFVVDPRVKGQVSVVSKAQLSLSEVYQLFLSVMSTHGFTVVAQGDQARIVPNAAPDRLETRVIQVQQSPVSELIPLIRPLVPQYGHLAAVPSANALIISDRSANIARIEDVIRQLDQKGSHDYCVINLRYGWVMDAAEVLNNAMSRGQAKGAAGAQVIADARTNRLIILGPPQARAKLVQLAQSLDTP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords General secretion pathway protein D
molecule tags Protein transport
source organism Pseudomonas aeruginosa
publication title New Insights into the Assembly of Bacterial Secretins: STRUCTURAL STUDIES OF THE PERIPLASMIC DOMAIN OF XcpQ FROM PSEUDOMONAS AERUGINOSA.
pubmed doi rcsb
total genus 56
structure length 218
sequence length 234
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03958 Secretin_N Bacterial type II/III secretion system short domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.120 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 4ec5A02
3.30.1370.120 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 4ec5A01
4G08A 3GR5A 4E9JA 2Y3MA 4EC5A 3OSSD 3EZJA
chains in the Genus database with same CATH superfamily
4DV5H 4GKJH 2VQEH 2E5LH 4DV6H 2HHHH 1XNRH 1J4WA 1ZZIA 4LF7H 4GKKH 4DV4H 4K0KH 1ZZKA 3OSSD 2Z0SA 1F0XA 4OO1G 4DV0H 4B8TA 2VKCA 4H8AA 4JYAH 5K36G 4IFDG 2JE6I 2JVZA 4DR3H 1FJGH 2FFMA 2CTKA 4QMFB 1K1GA 4LFCH 4LF4H 4DR7H 1WTJA 3T1HH 1DTJA 2ZM6H 4X65H 1SEIA 3I0PA 4EC5A 2FMRA 4DR1H 2M8WA 4DV2H 5FLXW 2A1SA 4DUZH 1N36H 1HNZH 3GR5A 4WALA 2E3UA 2LF0A 2OPUA 4JI5H 2G8YA 2CTLA 1VIHA 3RF2A 1EC6A 5LMUH 2CPQA 1S20A 1VIGA 2DGRA 3OTOH 1V8CA 3SB1A 4JI8H 2NN6G 2BA0A 1IBMH 2X06A 2CTFA 2YQRA 1AN7A 1V9NA 4YY3H 3V69A 5LMNH 2Y3MA 1X0AA 3UOEA 1MSZA 2PT7G 2JA9A 4JV5H 4LFBH 3GKUA 3OETA 4JI7H 4LF9H 4NZTM 1ZTGA 1XMOH 2JZXA 4DV7H 1UG8A 1J5KA 2JEAI 4JI4H 1DT4A 1TUAA 2UUCH 4JVYA 5A2QW 4B3TH 2UUBH 4FJUA 3GABA 1S03G 2M6QA 2LTMA 1N33H 1IBKH 1I6UA 2LRRA 1X4MA 3J80W 4B8CD 2CPMA 3U1KA 4JVHA 2F4VH 2CTJA 3QD7X 1ZZJA 1XRHA 2CWHA 5BR8H 2ANRA 4DR4H 4X64H 2AXYA 4OX9H 2P2RA 5DT9A 5JEAG 1XNQH 4X66H 4DV1H 5IWAH 4NZRM 2LTLA 2JEBI 5LL6b 4NXNH 1XMQH 1VBIA 1ODHA 4KHPH 3JAMW 4LF5H 4LIJA 1WHRA 4AM3A 1WE8A 4DR5H 4G08A 1HNWH 2FPHX 4DR6H 2UXDH 3J81W 4LF6H 3KDKA 4B3RH 2CWFA 3J7AK 1X9ZA 2K1HA 1J5EH 1HNXH 2OPVA 2UUAH 4B3MH 2PY9A 2D9IA 4JI6H 2VQFH 4NXMH 4AIMA 2ANNA 4PDBA 1HR0H 4AQYH 4FJSA 2CTEA 1X4NA 4B3SH 1I94H 3NCVA 2UXBH 2UXCH 1KHMA 4DR2H 3VKEA 1FKAH 1N34H 4X62H 1N32H 4BA2I 2ZQEA 5C0XG 3AEVB 4JI3H 4LFAH 3FAUA 2O4CA 2PQUA 4JI1H 2BL5A 2HH3A 4OD6A 4E9JA 2QNDA 4NBQA 4OCHA 4DV3H 5IT9W 3EZJA 4JI0H 1PQXA 4WANA 4JI2H 1IBLH 2MJHA 3KDGA 3T1YH 2UU9H 1WVNA 1Z2IA 4BA1I 4YHHH 4LF8H 2HH2A 2CTMA 4DUYH 3L7ZC 1NXUA
chains in the Genus database with same CATH topology
4DV5H 4GKJH 2VQEH 2E5LH 4DV6H 2HHHH 1XNRH 4LF7H 4GKKH 4K0KH 3OSSD 1F0XA 4DV0H 2VKCA 4JYAH 4DR3H 1FJGH 4LFCH 4LF4H 4DR7H 3T1HH 2ZM6H 4X65H 1SEIA 4EC5A 4DR1H 4DV2H 5FLXW 4DUZH 1N36H 1HNZH 3GR5A 2LF0A 4JI5H 3RF2A 5LMUH 3SB1A 4JI8H 1IBMH 1AN7A 4YY3H 5LMNH 2Y3MA 2PT7G 4JV5H 4LFBH 3OETA 4JI7H 4LF9H 4NZTM 1XMOH 4DV7H 4JI4H 2UUCH 5A2QW 4B3TH 2UUBH 3GABA 1S03G 1N33H 1IBKH 1I6UA 3J80W 4B8CD 2F4VH 3QD7X 5BR8H 4DR4H 4X64H 4OX9H 5DT9A 1XNQH 4X66H 4DV1H 5IWAH 4NZRM 4NXNH 5LL6b 1XMQH 1ODHA 4KHPH 3JAMW 4LF5H 4DUYH 4DR5H 4G08A 1HNWH 2FPHX 4DR6H 2UXDH 3J81W 4LF6H 3KDKA 4B3RH 3J7AK 1X9ZA 1J5EH 2UUAH 1HNXH 4B3MH 4PDBA 2D9IA 4JI6H 2VQFH 4NXMH 1HR0H 4AQYH 4B3SH 1I94H 3NCVA 2UXBH 2UXCH 4DR2H 1FKAH 1N34H 4X62H 1N32H 2ZQEA 4JI3H 4LFAH 3FAUA 2O4CA 4JI1H 4OD6A 4E9JA 4OCHA 4DV3H 5IT9W 3EZJA 4JI0H 4JI2H 1IBLH 3KDGA 3T1YH 2UU9H 4YHHH 4LF8H 4DV4H 3OTOH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G08 A;  3GR5 A;  4E9J A;  2Y3M A;  4EC5 A;  3OSS D;  3EZJ A; 
#chains in the Genus database with same CATH topology
 4DV5 H;  4GKJ H;  2VQE H;  2E5L H;  4DV6 H;  2HHH H;  1XNR H;  1J4W A;  1ZZI A;  4LF7 H;  4GKK H;  4DV4 H;  4K0K H;  1ZZK A;  3OSS D;  2Z0S A;  1F0X A;  4OO1 G;  4DV0 H;  4B8T A;  2VKC A;  4H8A A;  4JYA H;  5K36 G;  4IFD G;  2JE6 I;  2JVZ A;  4DR3 H;  1FJG H;  2FFM A;  2CTK A;  4QMF B;  1K1G A;  4LFC H;  4LF4 H;  4DR7 H;  1WTJ A;  3T1H H;  1DTJ A;  2ZM6 H;  4X65 H;  1SEI A;  3I0P A;  4EC5 A;  2FMR A;  4DR1 H;  2M8W A;  4DV2 H;  5FLX W;  2A1S A;  4DUZ H;  1N36 H;  1HNZ H;  3GR5 A;  4WAL A;  2E3U A;  2LF0 A;  2OPU A;  4JI5 H;  2G8Y A;  2CTL A;  1VIH A;  3RF2 A;  1EC6 A;  5LMU H;  2CPQ A;  1S20 A;  1VIG A;  2DGR A;  3OTO H;  1V8C A;  3SB1 A;  4JI8 H;  2NN6 G;  2BA0 A;  1IBM H;  2X06 A;  2CTF A;  2YQR A;  1AN7 A;  1V9N A;  4YY3 H;  3V69 A;  5LMN H;  2Y3M A;  1X0A A;  3UOE A;  1MSZ A;  2PT7 G;  2JA9 A;  4JV5 H;  4LFB H;  3GKU A;  3OET A;  4JI7 H;  4LF9 H;  4NZT M;  1ZTG A;  1XMO H;  2JZX A;  4DV7 H;  1UG8 A;  1J5K A;  2JEA I;  4JI4 H;  1DT4 A;  1TUA A;  2UUC H;  4JVY A;  5A2Q W;  4B3T H;  2UUB H;  4FJU A;  3GAB A;  1S03 G;  2M6Q A;  2LTM A;  1N33 H;  1IBK H;  1I6U A;  2LRR A;  1X4M A;  3J80 W;  4B8C D;  2CPM A;  3U1K A;  4JVH A;  2F4V H;  2CTJ A;  3QD7 X;  1ZZJ A;  1XRH A;  2CWH A;  5BR8 H;  2ANR A;  4DR4 H;  4X64 H;  2AXY A;  4OX9 H;  2P2R A;  5DT9 A;  5JEA G;  1XNQ H;  4X66 H;  4DV1 H;  5IWA H;  4NZR M;  2LTL A;  2JEB I;  5LL6 b;  4NXN H;  1XMQ H;  1VBI A;  1ODH A;  4KHP H;  3JAM W;  4LF5 H;  4LIJ A;  1WHR A;  4AM3 A;  1WE8 A;  4DR5 H;  4G08 A;  1HNW H;  2FPH X;  4DR6 H;  2UXD H;  3J81 W;  4LF6 H;  3KDK A;  4B3R H;  2CWF A;  3J7A K;  1X9Z A;  2K1H A;  1J5E H;  1HNX H;  2OPV A;  2UUA H;  4B3M H;  2PY9 A;  2D9I A;  4JI6 H;  2VQF H;  4NXM H;  4AIM A;  2ANN A;  4PDB A;  1HR0 H;  4AQY H;  4FJS A;  2CTE A;  1X4N A;  4B3S H;  1I94 H;  3NCV A;  2UXB H;  2UXC H;  1KHM A;  4DR2 H;  3VKE A;  1FKA H;  1N34 H;  4X62 H;  1N32 H;  4BA2 I;  2ZQE A;  5C0X G;  3AEV B;  4JI3 H;  4LFA H;  3FAU A;  2O4C A;  2PQU A;  4JI1 H;  2BL5 A;  2HH3 A;  4OD6 A;  4E9J A;  2QND A;  4NBQ A;  4OCH A;  4DV3 H;  5IT9 W;  3EZJ A;  4JI0 H;  1PQX A;  4WAN A;  4JI2 H;  1IBL H;  2MJH A;  3KDG A;  3T1Y H;  2UU9 H;  1WVN A;  1Z2I A;  4BA1 I;  4YHH H;  4LF8 H;  2HH2 A;  2CTM A;  4DUY H;  3L7Z C;  1NXU A; 
#chains in the Genus database with same CATH homology
 4DV5 H;  4GKJ H;  2VQE H;  2E5L H;  4DV6 H;  2HHH H;  1XNR H;  4LF7 H;  4GKK H;  4K0K H;  3OSS D;  1F0X A;  4DV0 H;  2VKC A;  4JYA H;  4DR3 H;  1FJG H;  4LFC H;  4LF4 H;  4DR7 H;  3T1H H;  2ZM6 H;  4X65 H;  1SEI A;  4EC5 A;  4DR1 H;  4DV2 H;  5FLX W;  4DUZ H;  1N36 H;  1HNZ H;  3GR5 A;  2LF0 A;  4JI5 H;  3RF2 A;  5LMU H;  3SB1 A;  4JI8 H;  1IBM H;  1AN7 A;  4YY3 H;  5LMN H;  2Y3M A;  2PT7 G;  4JV5 H;  4LFB H;  3OET A;  4JI7 H;  4LF9 H;  4NZT M;  1XMO H;  4DV7 H;  4JI4 H;  2UUC H;  5A2Q W;  4B3T H;  2UUB H;  3GAB A;  1S03 G;  1N33 H;  1IBK H;  1I6U A;  3J80 W;  4B8C D;  2F4V H;  3QD7 X;  5BR8 H;  4DR4 H;  4X64 H;  4OX9 H;  5DT9 A;  1XNQ H;  4X66 H;  4DV1 H;  5IWA H;  4NZR M;  4NXN H;  5LL6 b;  1XMQ H;  1ODH A;  4KHP H;  3JAM W;  4LF5 H;  4DUY H;  4DR5 H;  4G08 A;  1HNW H;  2FPH X;  4DR6 H;  2UXD H;  3J81 W;  4LF6 H;  3KDK A;  4B3R H;  3J7A K;  1X9Z A;  1J5E H;  2UUA H;  1HNX H;  4B3M H;  4PDB A;  2D9I A;  4JI6 H;  2VQF H;  4NXM H;  1HR0 H;  4AQY H;  4B3S H;  1I94 H;  3NCV A;  2UXB H;  2UXC H;  4DR2 H;  1FKA H;  1N34 H;  4X62 H;  1N32 H;  2ZQE A;  4JI3 H;  4LFA H;  3FAU A;  2O4C A;  4JI1 H;  4OD6 A;  4E9J A;  4OCH A;  4DV3 H;  5IT9 W;  3EZJ A;  4JI0 H;  4JI2 H;  1IBL H;  3KDG A;  3T1Y H;  2UU9 H;  4YHH H;  4LF8 H;  4DV4 H;  3OTO H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...