2Z0SA

Crystal structure of putative exosome complex rna-binding protein
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
175
structure length
175
Chain Sequence
EIYVPQAGDVVIGLIQSVGIMNWFVDINSPYVAVLSVQDFLGRPFNPAVDDMQSLLKVGDYIKAKVVAFDKTRSPLLTVQGEGLGRIVRGKIVEISPAKVPRVIGRKMSMLKTLEEKTECKIFVARNGRIHLECPNEDLEAIAVMAIKIIDEEAYTSGLTKRIIKFIEEERRIRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of putative exosome complex RNA-binding protein
rcsb
source organism Aeropyrum pernix
molecule tags Rna binding protein
molecule keywords Probable exosome complex RNA-binding protein 1
total genus 42
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 2007-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2z0sA01
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 2z0sA02
1JMCA 1K8AC 3S1MH 2R6GA 1Y1WG 2WB1E 4YHHQ 4GNXA 5GROA 2IX1A 2NZOA 5M3MH 3G4SA 4NXML 1WVNA 3FP9A 3J7ZC 2A8VA 2YTYA 3HKZE 4LF8Q 3I4NG 3K0XA 1YIJA 3ULLA 3CPFA 1U5KA 4NXNL 2NVTH 2R92H 2BH8A 5GAHC 4A3BH 2K5HA 4WALA 4BY1H 1PFSA 3DM3A 3BZCA 3PUVA 2HQLA 4BA1I 3CCSA 4GOPB 1S72A 3KF8B 4NXNQ 3HOVG 4BY7G 2JEAI 4P74A 2D0OA 4P75A 2BA0A 4B3SQ 4A3FG 1N36Q 1IBLL 1GKHA 1V1QA 1DGSA 4GLAC 1IBML 2JZXA 4KLKA 5M3MG 4JI7L 4LF9L 2BH2A 2UUAQ 2XGTA 4DR4Q 4A3KH 3W5OA 1SE8A 5FJ8G 2WB1G 2XTIA 3H0GH 3PGZA 4JCVE 1VQEA 3GTJH 3RN2A 5IP9G 1LM0A 4A76A 3STBC 5ELNA 2YYZA 4TVAB 4AYBE 2VQEQ 1KQSA 1UE1A 2K5VA 5GQOA 2OQ0A 4YY3L 3KF6A 2WFWA 4DR1L 3PSIA 1WFQA 4JI8Q 2JA6G 2N49A 5IYCG 2K14A 4K0KL 1TWGH 4OWTB 4A3JH 3D31A 4R4OA 3VKEA 1GM5A 4DR6Q 1XTDA 4A4IA 3NENA 5JJIA 4R4IA 2HIXA 3U50C 4C3IH 3KYHC 4X64L 1KC8C 1J5KA 1BBWA 4JI1Q 2CFMA 4XTCS 5IYDH 1K8GA 2ZJQA 1Y1VG 3J80i 2NN6I 1LYLA 5C44G 3E0EA 1SRUA 2ZTCA 1XPOA 3I4MG 3S2HH 1X6OA 1XMOL 4ALPA 4B3MQ 1QVFA 4EQ5A 5K36G 1KAWA 1HH2P 1T9HA 4GN4B 4IPHA 4QY7A 4WANA 1AH9A 2VQFL 4IFDI 2MFIA 2BL5A 1EOVA 3UDFA 5C0XJ 4B3ML 4DUYQ 2JQOA 1HR0L 4YWMA 1D7QA 1WYDA 3RR5A 1XJVA 2I5MX 4A3LG 1EFWA 1E1TA 3EIVA 3PCOB 3AQQA 3KJOA 2ATWA 2OPVA 3GTPH 5JJKA 4AH6A 4DV3L 3G48A 1PH7A 4DV6Q 2OTLA 2B63H 1YJ9A 1OTCA 4HJ9A 1EC6A 3GTOH 4DR7Q 4DR5L 2UXCL 1CKNA 5JEAG 2A1AA 1EIYB 4POFA 1MJEA 4JC0A 4WJ4A 2E5LQ 2F52A 1VQDA 2Z0SA 1AE3A 4BBRG 3M4PA 4LF7Q 2HHHL 3FKIH 1VQLA 2ZTDA 1Y1WH 1E24A 4QGUA 5LMUQ 4LFAL 1CSPA 2JK8A 5GADC 4X66L 3MEFA 5IWAL 1TWAH 2ALYB 2PQUA 1KHIA 1X54A 3BZKA 2VUMG 4JOIC 2KENA 3S17H 4A3CG 4X6AH 4YCVA 1ZZJA 2CTEA 1PYBA 2JA5G 2QA4A 1GO3E 3F2BA 1J4WA 3J80c 5FJ8H 3CPWA 2PNHA 1L2FA 2YU9H 3HOUH 1VQFA 1RL2A 1X9NA 2HH3A 2YV5A 4HIDA 5LMNQ 4JI5Q 2UXBQ 3PO3G 2E2JH 4OXPA 3SGIA 4JI6L 1IBKL 1UWVA 1B70B 3CCJA 1JE5A 4LFCQ 3S1NH 4DUYL 1VQOA 4BBSH 1NJIC 1X3GA 2EQSA 1I94L 4L5SA 4OO1G 3CF5A 2AWOA 2F4VQ 1I5FA 4QQBX 3I4OA 4LNQA 4R4CA 4NPSA 4LF8L 1JB7A 5JJLA 2RHSB 1VQ7A 2I5HA 4IFDJ 2HT1A 2JE6I 4OONA 3H3VI 4DR3Q 1NY4A 4YHHL 4PG3A 4BXXH 1CKNB 1GVPA 2VZAA 1VQCA 3HKZG 3W1GA 5C3EG 4GN5A 3JAMi 4NXMQ 3B6YA 4JV5L 1X3FA 2QEXA 1EIFA 1WE8A 3IRBA 3I4MH 1IL2A 4L5QA 3I4NH 2I5LX 1BBUA 1VCIA 4Y7NH 4A3GH 3KDFA 1VQ4A 2YTVA 3I7FA 3ULPA 1VQ6A 3E9HA 2E3UA 3AFQA 1IBMQ 1IBLQ 2VQEL 1KRSA 2Q2IA 4B3SL 1PH3A 3PF5A 3CP0A 5HGQA 1R9TH 1IYJB 1ZZKA 3KOJA 2PY9A 4K0KQ 3ER0A 2PI2E 4JI8L 4MTNA 2Z6KA 5M5WH 1SN8A 3M4QA 2E5LL 3K7AH 1J5EL 1WCMH 4B3RL 3PIOA 2R93G 1BVSA 4IJLA 2MQHA 4A3KG 4KI0A 3S1QH 1HNXL 3H0GG 2LXKA 4A3DH 3EN2A 1PH6A 4A93H 1L0WA 1QVGA 4LUZA 1OXVA 2WAQG 4DNIA 3CC2A 1IBKQ 3J7A5 1JT8A 3CCVA 1PYSB 2MJHA 1N33Q 1N8RC 2JA5H 1X55A 3CMAA 5J3BA 4LFBL 1VIGA 2I0QA 3S24A 3MXNB 3NELA 2R93H 5EAYA 2E2IH 4JBJA 2OTJA 2R7ZG 1CUKA 2Z6KC 1H95A 2OPUA 2B3GA 3RZDH 1W2BA 4KHZA 1FJGQ 2F3IA 4IPGA 3F2DA 1P8LA 1PH5A 1TWFH 5IP7G 4IO9A 3HOWH 1LUZA 3UE1A 1KRTA 4AQYQ 3STBD 1I3QH 2E8GA 5IYCH 2KHIA 1XNQL 4DV1Q 4TQUS 5C0XG 2CTMA 1EQRA 2AKWB 1VQBA 2ZM6L 3CMEA 3M3YH 3T1YL 1K9MC 4LF7L 2N3SA 3TEHB 4A3EG 3LGJA 3ULJA 4DR1Q 3CQZH 3KFUA 5C44H 1OXXK 1PH8A 2R7DA 2RCNA 1NMFA 1Z47A 4DR2Q 4A75A 4LF4L 4B3RQ 4X66Q 4JG2A 4DV0Q 1PH4A 3CCLA 3PO2G 4DR6L 1JJGA 2CQOA 3RNUA 2HIVA 4DPGA 2KHJA 4JBMA 1EUJA 1VQKA 2AXYA 3HOWG 4QMFB 2R7ZH 4NB3A 2Y0SE 4IPCA 2UU9Q 4BBRH 5AJ3L 2ID0A 3NEMA 1XNQQ 4LFAQ 5LMUL 3HOYH 4C3JH 1JJCB 2CWPA 1MIUA 2NVQH 2WAQE 2V1CC 1B7YB 1B8AA 4P72A 4BXXG 3JAMc 1I6HH 2IHFA 3PUZA 2CTJA 5IP9H 3CD6A 2GN5A 1KXLA 1VQ8A 2UUAL 4JI0Q 4DR4L 1X4NA 4GKKL 1PH1A 1M90C 2VS1A 4IJHA 1HR0Q 4A3MG 2E2HH 2L15A 3PO2H 5BR8L 4A3IG 4GKKQ 4DV2L 3HOXG 1N32Q 3AEVB 3HOUG 1A0IA 2UU9L 2FXQA 5IYBH 2UUBL 3V69A 1KHMA 3PUYA 1UE6A 4POGA 2RHQB 4B3TQ 3HOYG 2NVXH 3A74A 4LF5L 5FLMG 3S16H 2VUMH 1SROA 2DGYA 4AYBG 3OTOL 3RLNA 3F2CA 4GOPC 1PVOA 1C9OA 1Q1BA 4A3JG 4P71A 1SFOH 4HIOA 1J5EQ 2Q2TA 3H3VH 2R7FA 4GNXC 3PF4A 5ELOA 1Q46A 3K80C 4WJ3M 4AM3A 1I94Q 2JA9A 3AYHB 3CAMA 1Y14B 3CW2C 4P73A 1EYGA 4GLXA 5C4XH 1ASZA 4LF6Q 1X3EA 4KHPQ 4B8TA 1CSQA 5IYBG 3S14H 1PH9A 4OX9L 4FDBA 3RN5A 1C7YA 1YJNA 1KIXA 1IXRA 2C35B 1HNZQ 2B63G 4DK3C 2CTLA 1K83H 5M5XH 4JYAL 3E9IA 3EBEA 5C3EH 3GTLH 3GTGH 4LW1A 2VW9A 3J81c 4GOPA 2Q2HA 2P2RA 2JA7G 4HJ7A 4AIMA 3CXCA 4Y52H 3TREA 1GD7A 3OW2A 4BY7H 4DR5Q 1X4MA 1EWIA 2PQAB 4DKAC 5C4JH 2JA8G 2AHOB 1HZ9A 1X56A 2LSSA 3PIPA 3CCUA 2UUCQ 2IY5B 1ZZIA 4R4TA 1CKOA 1XNRQ 4HJAA 1XMQQ 3F8TA 4DUZL 1FL0A 1Q8KA 3CC7A 1E3PA 1X65A 3M85A 4RG1A 1OXTA 1U0LA 1YVCA 2MNAA 1NE3A 4DV5Q 1N36L 2CCZA 4MNOA 4ME3A 3HFZB 1WJJA 2BA1A 1OXUA 3PUWA 2IT1A 4UP7A 1DTJA 3KLWA 4L5TA 4DV5L 3KF6B 4LIJA 3AFPA 4UP9A 4HIMA 1PV4A 3K81C 1YZ6A 1L1OC 4O0AA 3CCQA 1N32L 1D8LA 2N8NA 4H02A 4JI1L 3G6EA 2EXDA 4X64Q 4YY3Q 5LMNL 4C2MH 4A3CH 1Y1VH 2UXBL 4IOCA 1HNWQ 2H5XA 1O7IA 2AMCB 5AJ3Q 4RMFA 1VQHA 4X65Q 1C0AA 1NBWA 4JVHA 1HNZL 4JYAQ 2YTXA 4JI2Q 4A3DG 4NBQA 1XPRA 3TS2A 3U4ZA 2IHEA 4YWLA 1K3RA 4JI4L 1JJ2A 2Q2UA 1KD1C 4DV0L 1TWHH 3D0FA 3PV0A 3J81i 1YNXA 4DAYB 1RIPA 3L0OA 1SLJA 1L1OA 4HIKA 1A62A 4A3BG 5E7NA 4DV1L 1FGUA 4DV7Q 2ZM6Q 4BY1G 4A3IH 3W1BA 5GAGC 3GD7A 4DR2L 1QUQB 2KCMA 2VQFQ 1YHQA 4DR7L 3UDIA 1PHJA 2D0PA 3ERSX 4JI2L 4L5RC 3J81j 3U1KA 4LF5Q 3HOVH 3S2DH 3RZOH 5FLMH 1Q1EA 1YBYA 4HJ5A 2PMZE 4JI0L 3CCEA 4GN3B 1KL9A 1SR3A 1ASYA 1XNRL 1TUAA 1Q12A 3A5ZB 4JI3L 4J15A 4PZ7A 1K73C 4DV6L 5BR8Q 1PH2A 1WI5A 3M4OH 4JOIA 4APVA 4QIWE 3H15A 5IE8A 5C4XG 3FKIG 1QVCA 1S3OA 2NZHA 3HKSA 4DV4Q 1YITA 4YWKA 3AEVA 2UUCL 2ANRA 1NTGA 1E22A 1YEZA 1VIHA 2JEBI 1N33L 1P16A 5IWAQ 3CCMA 3I55A 1VQPA 2ZTEA 1QZGA 2CTKA 1EQQA 1IZ6A 3HOZG 3F1ZA 2DGRA 4X62Q 1HZBA 2OQKA 5M3FH 4OWWB 1Q7YC 4LFCL 4UPAA 4HJ8A 3DLLA 2JA8H 3CC4A 3FHWA 2KCTA 1HNXQ 1HZAA 2B29A 3M9BA 1E7ZA 3TQYA 3G71A 3CCRA 1MKHA 2K5NA 4GKJL 1VQJA 3PO3H 3I2ZA 3GDEA 3NBHB 3TRZA 1YHBA 4PMWA 5GAEC 4A3MH 5IP7H 1TWCH 4YCWA 4A93G 4JI4Q 1K0RA 4C3HH 1N9WA 1Q86C 4XIGS 2LXJA 4MZ9A 4IPDA 3WWVA 3OYYA 2RF4A 2ZJPA 2VL6A 1I50H 3BU2A 4DR3L 4PZ6A 2WP8J 4GS3A 3K8AA 3T1YQ 2AWNA 4JI7Q 4A3LH 2K52A 2UXDQ 2R92G 4LF4Q 4AQYL 5M3FG 4OX9Q 4IOAA 1VQGA 4QL5A 3TS0A 1VQ9A 4YCUA 4JBKA 1LTLA 4DAMA 4JV5Q 2OCEA 1CKMA 3ICEA 2ZJRA 4IFDG 3VDYA 4BA2I 1UEBA 1UE5A 3RLOA 2OWOA 3GO5A 3KJPA 2PQAA 1XMOQ 2PI2A 4R4QA 3ZJYC 3M7NA 1A63A 1ZTGA 4DV4L 4JVYA 4DV2Q 4DUZQ 1HNWL 1J6QA 1G51A 2VY3A 1V9PA 1Q82C 2UXCQ 2A19A 4OO1I 2YQRA 2GVAA 1V43A 4R1JA 4A3EH 4JI6Q 4GNXB 3KDFB 3GTKH 4A3GG 1AE2A 2K4KA 2NN6G 5IY0A 2QNDA 2JA6H 3A0JA 2FMRA 4B3TL 4UP8A 1YHAA 4JI3Q 1UE7A 2D62A 3GTMH 3L2PA 2F4VL 4OWXB 1E1OA 3U4VA 3A5UA 2MO1A 2CPQA 2CTFA 2CKZB 2CWAA 5HY6A 4DK6C 1NMGA 1Q81C 3I56A 5IT9c 1VQMA 1XMQL 1QZHA 1W3SA 3UDGA 1A8VA 2HH2A 1BKBA 2ASBA 1HR0W 2KBNA 4JBWA 2ES2A 4LWCA 3T1HQ 1QUQA 2JA7H 4DV7L 1G291 4LUVA 1XPUA 1YJWA 3PUXA 3L7ZC 5M5YH 1WCMG 5FLXc 4O2DA 2JJQA 2HHHQ 2QGQA 3BJUA 2GVBA 2N78A 3S1RH 1S40A 1N34Q 3JC66 1G6PA 3UDXA 4JI5L 1YI2A 1VQ5A 5H1SE 1SMXA 5IYDG 4BBSG 1VQNA 4LF9Q 1K1GA 1Z9FA 2EIFA 3HOXH 4PZ8A 4QJFA 1TXYA 4GLVB 3UE0A 2UXDL 4GKJQ 2Y0SG 4LUOA 5JEAJ 1VS0A 4DV3Q 4A3FH 2JVZA 1MJCA 2K75A 5DLQE 2MO0A 3RLFA 1FJGL 2NVYH 5C0XI 4LF6L 4KHPL 2ANNA 3S15H 4X65L 2K50A 1HJPA 4X62L 2UUBQ 2IX0A 1M1KC 3K7UC 1FVIA 1WOCA 3T1HL 1L1OB 1HZCA 1DT4A 3U58A 3HOZH 3GTQH 1VQAA 1OXSC 2DUDA 4UY8C 5LMNW 4EX5A 4LFBQ 3Q8DA 2VNUD 3OTOQ 1PA6A 1N34L 1VQIA
chains in the Genus database with same CATH superfamily
2VB2X 2R7ZB 5FLXW 1Y1WG 2WB1E 1PLFA 1X32A 3HKZE 4LF8Q 1DXMA 3ULLA 4NXNL 2R92H 3PO3B 2BH8A 5GAHC 2K5HA 1LLRD 3IKJA 1LO5D 5A35A 2DJFC 3CCSA 2HQLA 3OWEB 4ZKBB 3KF8B 1LT3D 5M3FB 3LWUA 2M6QA 5IGEA 1N36Q 1IBML 1GKHA 1DGSA 3SDZA 2BH2A 1SMYD 3J7AF 3RF2A 1A2UA 3PQIA 3SE0A 2KVMA 4JCVE 3K57A 3RN2A 3GTJH 1GUOA 4BWGB 2LTLA 4AYBE 1KQSA 1UE1A 2K5VA 2K5QA 4YY3L 3BDCA 4KD3A 4JI8Q 1Q3LA 1SJED 2NBFA 2J7ZA 1WTRA 1RHPA 1TVXA 3R2TA 4R4OA 3S1QB 4DR6Q 2EXZA 5JJIA 4MHEA 2HIXA 3D6WA 5E4WC 4C3IH 4X64L 1J5KA 4FYDA 1ZYRD 5ELCA 2FFMA 5G3LF 1LYLA 2K03A 2PZWA 1SRUA 3S2HH 1X6OA 1R9TB 2PNRC 5K36G 3V05A 1I6UA 2BL5A 2A74C 2MFIA 3OIQA 5C0XJ 1PFBA 1KNEA 1I94H 4G7HC 4S3SA 1WYDA 3QJYA 2PT7G 1M4VA 2ATWA 3GTPH 4EC5A 5JJKA 4AH6A 4DV3L 2EJFC 5EJWA 1OTCA 4HJ9A 3U9OA 4DR7Q 4H13C 4KN7C 1CKNA 4DR5L 4I7ZC 2A1AA 1EIYB 4JC0A 2F52A 1AE3A 2DJGC 3A8KE 5C3XA 5LMUQ 1AN7A 5CV4A 4JI4H 1CI3M 4L6TB 2EE1A 4YCVA 1ZZJA 1EY5A 1PYBA 2BE5C 3BDLA 4RHSA 1D1IA 5FJ8H 4KJOA 1VQFA 1TT2A 1X9NA 3W3AA 1BR9A 2UXBQ 1HTLD 2ZXRA 2O5IC 5IGCA 1V1OA 1V1PB 2KCCA 1EY7A 1B70B 4BBSH 3SK5A 2AWOA 2HQEA 3I4OA 1D2BA 4NPSA 2FJ2A 1JB7A 2RHSB 5KIXA 3FKIB 3KBXA 1LTSD 4DAYA 2EDGA 2F0QA 2JE6I 2HT1A 1S20A 3FMCA 4OONA 3OMGA 3H3VI 1LTID 2O2LD 5LMUH 3IAYA 2ZXOA 4H8AA 5C3EG 4FXGC 3JAMi 2UXCH 5FK9C 4OD6A 2NVXB 2OXPA 3T16A 1DZ1A 4J1MA 2NTTA 4HN7A 1GUTA 4Y7NH 1VQ4A 2ZQEA 4KKSA 3K0YA 3E9HA 2R61A 3AFQA 1IBLQ 2PY9A 3CP0A 5HGQA 2Z4IA 3E6ZX 5TSSA 2Z6KA 5M5WH 1VF7A 4AYBB 3K7AH 1WCMH 3Q6SA 3HKZB 4XYQA 4EQNA 4B3RL 3OTOH 4IJLA 3HOYB 2MQHA 4V0BA 3H0GG 4A3DH 1ET9A 2WAQG 4DNIA 3QIAA 1E2ZA 1N8RC 3CMAA 1VIGA 5KNBA 2I0QA 3S24A 1QNKA 2R93H 2K1HA 2R7ZG 4HMJA 3D3RA 5J39A 2B3GA 4IUUA 2XWBB 3RZDH 1BF4A 1Y8NB 2E76C 4IPGA 3SXHA 1PH5A 2M8WA 1IL8A 2Q8IB 2B2WA 1I3QB 2E8GA 4C56C 3J7YW 5ELBA 2B2YC 3BVZA 5EPLA 3M3YH 3T1YL 4BY1B 1YNNC 1PRTC 3NQIA 2E2IB 3CQZH 5C44H 1SYEA 1PH8A 2R7DA 3MHBA 3Q0AA 1EY9A 4OIJA 4B3RQ 4X66Q 2JN4A 4B3SH 3PO2G 5M3MB 1MGSA 2Z1CA 1A3TA 5KEEA 4IUQA 3HOWG 3S1MB 4NB3A 2EJGC 4IPCA 4RA8A 3J80W 1WHRA 1QNUA 1F9PA 1JE4A 4LFAQ 3K5OA 2AQ2B 4HEDA 2BDOA 1JJCB 3HEJA 4P72A 5BN5A 4BXXG 2HDLA 5IP9H 1EY6A 5CR3A 3CD6A 1VQ8A 4NKLA 4JI0Q 1D6EC 2QDBA 4GKKL 1X3QA 2E2HH 3PO2H 3FDTA 2E74C 5BR8L 3HZXA 2HCIA 1N32Q 1F2MA 3BVGA 1A0IA 5EBCA 1M8AA 3CRKC 3PUYA 1S5CD 4B3TQ 3HOYG 2KECA 3S16H 1SNMA 1SROA 4GOPC 3D4WA 1C9OA 1Q1BA 2Y0SB 2Z6BA 4RKBA 1SFOH 4HIOA 2BCOA 2R7FA 4GNXC 5ELOA 3K80C 2JA9A 2B2TC 1Y14B 4KHPQ 1ODHA 5C4XH 1X3EA 5FLXE 4J8QA 2K1BA 5DM63 4F88A 2C35B 1HNZQ 4RGNA 1KAAA 4CDFC 2CTLA 1DYQA 5A2QE 1QWYA 4FF2A 2VW9A 4OHJA 2BOSA 3GTGH 5A2QW 2YU9B 2JA8G 3CCUA 2CH4W 1XMQQ 3F8TA 1FL0A 1YNJD 3CC7A 3M85A 5I4DA 5LHY1 1NE3A 4G7ZC 3MTSA 1N36L 3QG1A 1Z6HA 2HD3A 4ME3A 2K7VA 1EZ6A 3PUWA 4UP7A 1DTJA 2B2UC 4R8IA 3N6RA 1Y69U 4DV5L 4LIJA 3AMUA 1GXDC 4UP9A 4HIMA 2L55A 3K81C 3CCQA 1B4OA 3L3OC 1D8LA 2N8NA 1IYVA 4JPBW 2ICEC 4X64Q 3GTOB 4YY3Q 4A3CH 1O7IA 1N34H 1VMPA 3MEHA 1VQHA 5I6YA 4X65Q 1UNSA 4NBQA 5D3DA 4DFAA 1K3RA 3ZYYX 5LL6S 4DV0L 3J81i 4OCHA 4YHHH 1L1OA 1XXGA 2DY8A 2UU9H 1A62A 5E7NA 3HOVB 3LWEA 1RF2D 4BY1G 5EKKA 5EGTA 4TRDA 1EIHA 5JJZA 3NQTA 2J4XA 4DR7L 4LF9H 2D0PA 3ERSX 3J81j 4LF5Q 3HOVH 3Q23A 5FLMH 2LFNA 1Q1EA 2A6HC 1BOSA 1UEAB 2EJMA 4HJ5A 1KL9A 4CDEC 4J15A 1ZYRC 2WIIB 3DEPA 4DV6L 2G9DA 1FKAH 4LF4H 1PH2A 1JB3A 1WI5A 4JOIA 2M9VA 4QIWE 3H0GB 1QVCA 1S3OA 1ICFB 1TS2A 1E22A 1YEZA 2JEBI 3I55A 1VQPA 2CH4A 2D9UA 2CW0C 2ZTEA 4I65A 2LF0A 4RFBA 4OWWB 1Q7YC 5LL6X 4DR7H 4E6IA 3DLLA 4GKKH 3FHWA 2MPMA 3FPPA 1E7ZA 1H9SB 3TQYA 3X3MA 1AZPA 4GKJL 1RCVD 3NBHB 1FYCA 2PMZB 2SNMA 2X6LA 4YCWA 5E3FA 1N9WA 2LXJA 5CBEE 3BU2A 1I50H 2WP8J 4GS3A 2C5CA 3C46A 1SNPA 2HCCA 5M3FG 4OX9Q 1Z7TA 1VQ9A 3GTQB 2PPBC 1LTLA 3HOZB 1QE6A 4PMBA 1WTPA 2N55A 4IFDG 1UEBA 4DV4H 3GTLB 4F7XA 1FNUA 3E0JA 1A63A 3ZJYC 1K83B 2WAQB 4DUZQ 2A19A 3MVVA 5KRUA 3I8ZA 4A3GG 1KTKA 2P5ZX 3A0JA 1YHAA 4B08A 2D62A 1PYWD 3GTMH 2F4VL 1E1OA 3NWTA 3U4VA 2CTFA 4DK6C 3D6CA 5IGGA 3I56A 2HH2A 1BCPF 1W3SA 1EYDA 3NTKA 1A2TA 2ES2A 3OWFA 5C4ZA 4JI2H 3MA2B 1YJWA 3L7ZC 5FLXc 2HHHQ 4O2DA 3N52A 4HSVA 4ZKCB 3JAMW 2GVBA 2N78A 3GTMB 2L0CA 1JOKA 1VQ5A 2KEEA 1K1GA 1SMXA 1IHZA 2KOLA 1Z9FA 2UXDL 3PO2B 2Y0SG 5DT9A 2IWHA 1VS0A 4A3FH 3R93A 5DLQE 3I0PA 4LF6L 1I6HB 4OELB 1OXSC 1S5ED 2DUDA 2B8FA 5LMNW 1VQOA 1HTPA 1NSNS 1I50B 2R6GA 1CFMA 5CV5A 4YHHQ 4GNXA 1EEID 2IX1A 3EJIA 1K3BC 1H9SA 5M3MH 1GJXA 1WVNA 3TMEA 2SEBD 3FP9A 2A8VA 1ZKOA 2YTYA 2IL8A 3I4NG 4CKBA 3CQZB 5BR8H 3IFTA 4BY1H 3PUVA 4GOPB 4U68A 1H9MA 4DR2H 2PZTA 4P75A 4A3FG 1WD0A 1PZKD 1PMRA 1DONA 2GA4B 2K28A 2JZXA 4JI7L 1EZ8A 4LF9L 3BS1A 4DR4Q 2SOBA 1SYFA 1SE8A 5FJ8G 3RZDB 2F1MA 3H0GH 1HFNA 1VQEA 1MHWC 5ELNA 4DR1H 2VQEQ 4KMUC 3H09A 4TSSA 3PSIA 2B2UA 4KTAA 4K0KL 1UG8A 4OWTB 4ZAIA 3S2DB 2F0KA 1V8QA 3DXJC 3GV6A 5C0XH 3VKEA 1GM5A 1XTDA 4A4IA 4JYAH 3KYHC 3VYUA 4LFCH 2DNCA 5M5WB 5EKLA 5C44G 4RGOS 4DGZA 3A7LA 1XPOA 4ALPA 1B2TA 1TWHB 2F0TA 2NUCA 1AH9A 2V4DA 1HR0H 2RDFA 2JQOA 1HR0L 1VF5C 1XJVA 3WOFA 1XYIA 2WV6D 3EIVA 4AQYH 1MSHA 4RKLA 4B9WA 1JOQA 4C2MB 4PMCA 1VBIA 2UXCL 5JEAG 1SJHD 4POFA 1VQDA 4RGTA 2Z0SA 3UI2A 3OSOA 2IW3A 3M4PA 4LF7Q 1WTHA 3FKIH 2ZTDA 4DV0H 5FO7B 4QGUA 1PRTF 3MEFA 2ALYB 2QKIC 4JVZA 2WINB 1X54A 3BZKA 5EQ0A 4JOIC 1T5EA 2KENA 1U4LA 4X6AH 1GO3E 1JICA 1E0BA 5CV6A 3J80c 3CPWA 3GKUA 2VB3X 2YU9H 1L2FA 3NHHA 2PO4A 3HOUH 2HH3A 1UAPA 5D14A 4WORA 3OW7A 2E2JH 2WKDA 4OXPA 3GTGB 2K6AA 1IBKL 2SDFA 5JPNC 1UWVA 3A54A 3JAML 1NJIC 2EQSA 4L5SA 1KDCA 5DEHA 1PXUA 1TWAB 3MWYW 2UXDH 4WFN3 4R4CA 4LF8L 1PRTB 2EY6A 1LT6D 1D5ZC 2Y3MA 5C4XB 1FJGH 1I4HA 4UAIA 1O80A 3MXNA 3U9SA 1NY4A 1F0XA 1UUPA 5FO8B 1GVPA 3HKZG 3QOJA 1DJRD 4NXMQ 1HXYD 3B6YA 1X3FA 2QEXA 1EIFA 1WE8A 3IRBA 1RTOA 3GTPB 1RODA 4NMZA 1IL2A 3I4NH 4H7BA 2ZM6H 1NR4A 4A3GH 4ILWA 3KDFA 3T51B 1STYA 4IFDH 2XNAC 1KRSA 2Q2IA 4B3SL 1U4PA 1ZZKA 1R9TH 2XVSA 5CV9A 3S2HB 1G2SA 3ER0A 1F2ZA 2PI2E 1J5EH 1AW7A 1CA6A 3NBIA 4U673 1MSGA 4QIWB 4JI1H 2XIWA 1J5EL 4NZRM 3PIOA 3PIO3 1BVSA 3VR3A 1B1ZA 4A3KG 4MIUA 4KI0A 4BBRB 2CHBD 3S1QH 4DR5H 1X0AA 4KN4C 1PH6A 1QVGA 1F9RA 1PYSB 2I07B 1EWCA 2JA5H 5ELEA 4LFBL 5J3BA 2F4VH 1G6ZA 4WJWA 3MXPA 2LRRA 3GTJB 5EAYA 2A6HD 1Q8IA 4L63B 2E2IH 2F0GA 1W2BA 1BDOA 1EY0A 4PQXA 4V190 1TWFH 3T13A 3UE1A 3LX0A 4K5VA 1I3QH 1V9NA 1IKMA 5IYCH 4F8MA 5C4HA 2KHIA 2L1BA 4FXKC 2RVLA 5K5PA 2N3SA 4DR1Q 3ULJA 3KFUA 4LJZC 1WD1A 2RQXA 2R92B 4NXNH 2CW0D 2O4XA 4A75A 4LF4L 4JG2A 4DV6H 3EROA 2JP1A 3RNUA 4CKCA 2HIVA 3I72A 4DR6H 4A93B 1VQKA 4R8NA 4A3DB 2AUJD 3NE5B 2R7ZH 2Y0SE 2UXBH 1TQOA 2ID0A 3W2DA 4C3JH 1B53A 3K7AB 3VYRA 2V1CC 1B7YB 1B8AA 1SE3A 3JAMc 3PUZA 3H94A 1X4NA 4DNRB 4DR4L 1TY0A 2M00A 4KKTA 3CHBD 4FO2A 3OIPA 4QUFA 2C9OA 4DV2L 1XWEA 3HOXG 3AEVB 4HCEA 3S1RB 3OOCA 2UUBL 3NUCA 1UE6A 5EKIA 2RHQB 1X3PA 4HR7B 4ZCKA 4CDCC 3A74A 3I3CA 2VUMH 3OTOL 2DGYA 4AYBG 1SSOA 3RLNA 1PVOA 1QJOA 4ME5A 1HNXH 1GUNA 1Q46A 4JI7H 1I94Q 3CAMA 4P73A 1EYGA 3RUZA 2A69C 4CHTB 5IYBG 3S14H 3EFXD 2JA6B 1EL0A 1G8ZD 2L9HA 1YJNA 1KIXA 1IXRA 2PQEA 4DK0A 4CJ1B 4JW0A 5M5XH 3GP7A 4IALA 4JYAL 3E9IA 1AN8A 4GOPA 2Q2HA 5JEAH 4Y52H 3TREA 4KHVA 1GD7A 4BY7H 1X4MA 1EWIA 2PQAB 4DKAC 1LTRD 2UUCQ 2LSSA 2IY5B 4R4TA 1QCBD 2B2TA 4DUZH 4IUVA 5M9OA 1X65A 3JAME 4RG1A 1OXTA 1U0LA 1YVCA 3KBGA 5ELFA 4DV5Q 2CCZA 4CJ0B 3HFZB 1WJJA 1HQRD 4RWSC 1HHVA 1W6JA 3VA5A 2B2VA 4L5TA 1PV4A 1JC7A 1N32H 1QOHA 1L1OC 4RCOA 4ZUJA 2QF7A 4JI1L 2JSOA 2EXDA 4XXEA 3VR5A 1BBXC 1Y1VH 1NAPA 1HNWQ 4J6HA 4R9WA 1VDZA 4EQOA 1NBWA 1HNZL 4JYAQ 2YTXA 1U4MA 5IT9W 4JI4L 3NTIA 3M4OB 1JJ2A 2Q2UA 4LFBH 3DWQA 5EBDA 3D0FA 2B2VC 4QUCA 3L0OA 2HUGA 4A3BG 3CKIB 3RZOB 4IUPA 1SNDA 4DV7Q 2BE5D 4A3IH 4K5WA 3GD7A 4DR2L 1QUQB 2KCMA 4EVOA 4C3IB 1PHJA 4A3IB 1IBMH 2RSNA 3PMFA 4JI0L 2PMZE 4KKUA 3CCEA 1DD2A 2JXMB 1ASYA 1XNRL 1TUAA 4K14A 3A5ZB 3K6OA 1K73C 4RCNA 4HSPA 3X3NA 5BR8Q 3M4OH 2X06A 3H15A 5C4XG 4X65H 4KHPH 4B3TH 1PFNA 4YWKA 4UDUC 3T4AC 2UUCL 3NP8A 1PTOD 3MXUA 1VIHA 4FNFA 4K5XA 1WTXA 2Q8RE 1J9OA 1P16A 3CCMA 1KDBA 1IZ6A 1JWMD 1EIGA 3HOZG 5DAUA 1HZBA 2OQKA 4I7AA 2FMMA 1MD2D 5BN3A 4HJ8A 2H1EA 5CBAE 1S03G 1SE4A 4IUNA 2UUAH 4CBVA 5CV7A 3G71A 1OO9B 1MKHA 1VQJA 3I2ZA 3GDEA 2NVTB 5GAEC 5IP7H 5A2QL 5IODA 1MI2A 1RTNA 5I2XA 4XIGS 4DV1H 3WWVA 2RF4A 2ZJPA 2VL6A 3J7AK 4PZ6A 1B3AA 1O7LA 2R92G 1GUSA 3EQLC 4AQYL 1S4ZA 4QL5A 4B3RH 2OCEA 2ZJRA 5C3EB 3M7NA 3GO5A 3S15B 2PI2A 2NVYB 4R4QA 2B2YA 4JVYA 1FR3A 1Q82C 2YQRA 2UXCQ 4OO1I 2GVAA 1JWSD 3A8IE 3KDFB 3GTKH 1AE2A 2NN6G 2FMRA 3RD4A 4UP8A 1B9MA 4JI3Q 1UE7A 3WOEA 2MO1A 2CPQA 2CKZB 2CWAA 5M5YB 1Q81C 5IT9c 1VQMA 1SDFA 1BKBA 2FMCA 2ASBA 5CGKA 2EY1A 3H3VC 4LWCA 2JA7H 1QUQA 1C48A 1SMYC 4ZRZA 1XPUA 3PUXA 2QGQA 3JC66 1G6PA 1K8MA 5C5LA 1VQNA 1JOOA 3ERQA 3MFYA 4PZ8A 1HFGA 5KYIA 2JVZA 1G2TA 2K75A 4N9TA 5IIFA 3HP3A 3S15H 4QMGA 3TS2A 2UUBQ 4DNTB 3HRZC 3U58A 3TSSA 2UUCH 1IKLA 4C3JB 3QWNA 4UY8C 2K33A 3RMHA 3OTOQ 1PA6A 3I73A 1CZGA 3ONAB 1JMCA 1K8AC 5KNCA 2KA7A 2A5HA 5GROA 1W6KA 2E2DC 1TS4A 3T53B 4Q0FA 3J7ZC 1HA6A 1ONLA 5I9PA 4XT3B 3J80L 2KUMA 2NVTH 4AM3A 4KY7A 4A3BH 1RKNA 1STEA 1E2WA 2TMPA 1PFSA 3DM3A 3BZCA 4BA1I 3ND8A 5I9OA 3HOVG 2JEAI 3P1HA 2MHVA 2D0OA 2BA0A 4B3SQ 1IBLL 1V1QA 4GLAC 1HCZA 1Q90A 2PZUA 4KLKA 1TWFB 2UUAQ 2XGTA 4C1NK 3W5OA 4A3KH 2CWFA 4DUYH 3EA6A 2WB1G 3I91A 5HGTA 1LM0A 5COYA 2YYZA 3PIP3 1EY4A 2JA5B 2OQ0A 3KF6A 5FOBB 1KABA 2K14A 3J80E 4A3JH 1WTVA 2IPKD 1LTTD 3NENA 4R4IA 1KC8C 1AZQA 4JI1Q 1JR0D 4XTCS 1XNQH 1STHA 5IYDH 5ISRA 3SHLA 2K01A 2MJ8A 4UHVA 2ZTCA 3I4MG 1XMOL 1QVFA 1N36H 4XT1B 2A68C 4GN4B 4JI3H 4QY7A 1A3UA 4WANA 2XWJB 2VQFL 2EYOA 1EFID 3TP6A 1EOVA 3UDFA 4B3ML 4DUYQ 2NTSA 1HPCA 3CRLC 3DUZA 3RR5A 5IT9L 2FINB 3MZ5A 4KK7A 3PCOB 3AQQA 2OPVA 1TR5A 5FKAC 3V96A 3G48A 2B63H 4C3HG 1CHPD 1EC6A 1EEFD 3QO2A 2E5LQ 4OO1H 2L4NA 4BBRG 1ENFA 3MAQA 3I4LA 5C3WA 2HHHH 1Y1WH 2F0SA 3J81W 4GKJH 4LFAL 1CSPA 2JK8A 5GADC 3J81L 4RHRA 5IWAL 1TWAH 4IURA 1NCVA 2VQEH 2VUMG 1STBA 3S17H 2CTEA 2NWGA 3I70A 4FF4A 2JA5G 1CTMA 3F2UA 2E2JB 1J4WA 3GQBA 3TBIB 5C4JB 3A7AB 2PNHA 1RL2A 2YV5A 4HTHA 3HOUB 3DWAA 4WRDA 3PO3G 1SAPA 1WTJA 4JI6L 2WACA 4OEMB 3SK4A 1ZXTA 1EQTA 1JE5A 3S1NH 3OPOA 4FJUA 3CF5A 4P2CB 4QQBX 4H0LC 3TP8A 3S14B 1VQ7A 3TN2A 3H91A 3O13A 4IFDJ 3SB1A 4DR3Q 3P20A 3I90A 5CC4A 4BXXH 1CKNB 1PTOC 3FPUB 4K6LA 5LL6b 2VZAA 1VQCA 2B8GA 4GN5A 3EVQA 2VUMB 4HMIA 5BN4A 1HRJA 4N9PA 1QG7A 1YNND 3NSWA 2AQ1B 2XRQD 2YTVA 4FVMA 1DCZA 2KQ3A 5J1ZA 1IBMQ 5FO9B 2RBMA 5JVG3 4L8JA 2F0JA 1SYDA 2QILA 4K0KQ 2FHTA 2K05A 4JI8L 2X6GA 2E5LL 4X3KA 4KJNA 1HNXL 3VR6A 2LXKA 3C2PA 3SK6A 4EQPA 4A93H 1L0WA 2VKCA 3KLSX 1JT8A 1BXTA 2VXWA 3GV3A 3OHXC 1ESFA 3NELA 4JBJA 1H95A 2J0TD 3VR2A 4KHZA 3ND9A 4IO9A 1LUZA 1KRTA 4AQYQ 3STBD 3HOWB 1XX8A 2DN8A 2F0PA 4IQZA 3VYSA 2AKWB 1VQBA 1HA5A 4LF7L 2A6EC 4KD4A 4A3EG 3LGJA 2E75C 2O5JC 3KUPA 1OXXK 2F0EA 4Z9CB 1O78A 1PH4A 3CCLA 5D65A 4DR6L 4YY3H 2F0WA 1KDAA 4DPGA 2KHJA 1EUJA 4CDDC 4HCSA 1TU2B 3C3LA 4K8IA 5LMNH 4BBRH 5AJ3L 5LMUL 1BO0A 4DN4M 2NVQH 1TS3A 2WAQE 1I6HH 2X69A 2IHFA 4IUTA 2GN5A 3TP7A 2UUAL 3BYTB 4A3FB 4LMQD 1XMOH 5J22A 1II3A 2EOTA 2KJXA 1ET6A 4A3GB 3HOUG 1K8OA 1CM9A 4NDXA 1KHMA 3I4NB 4POGA 3I4MB 1R4QB 4IZ8A 1PTOB 5FLMG 3MFGA 2OT2A 4TKOB 4DR3H 5KYLA 3F2CA 4FP5D 4KY6A 4A3JG 4LF7H 2F0VA 1J5EQ 2Q2TA 3H3VH 4XYOA 4WJ3M 1GUGA 3NBHA 3AYHB 4LF6Q 1IYUA 4GLXA 1JCKB 1CSQA 1PH9A 4OX9L 4FDBA 3RN5A 1Y8OB 1SBBB 2KCNA 5JAVA 1K83H 1SYGA 2H4OA 1CZWA 3GTLH 1BCPC 2DY7A 4LW1A 4OGQC 4RGMA 3J81c 4JV5H 1PTOF 1SYCA 2JA7G 4AIMA 1CK1A 3OW2A 1HZ9A 1ILQA 1X56A 1CKOA 2AUKA 4DUZL 4OL7A 1Q8KA 2MNAA 1K0SA 1TWCB 4A3MB 4DV2H 2EY5A 2BA1A 4B9XA 1OXUA 3BDOA 3QB3A 4MN3A 3KF6B 3AFPA 1WTWA 1YZ6A 3M7GA 2OEOA 1N32L 4MTKA 5LMNL 4C2MH 1N33H 4C3IG 4IOCA 1PZID 2H5XA 3OETA 5IGBA 2MUYA 2F03A 4M8AA 2F0HA 1XPRA 2IHEA 4YWLA 1HUNA 5K36H 5JVH3 4N8X1 1TWHH 1O7YA 1YNXA 4BS9A 3NXWA 1RIPA 2UUBH 1SLJA 2A6ED 1FNVA 4HIKA 4DV1L 1FGUA 1ILPA 1NNXA 2HDMA 4JI8H 4PDBA 2ZM6Q 4KY5A 5T1IA 3K58A 2IJ0A 2VQFQ 2XRSD 1YHQA 2WB1B 5D3IB 3K5NA 4L5RC 3U1KA 1AEXA 3S2DH 2QCPX 1TWGB 1YBYA 4JI6H 2MGSA 1SR3A 4G08A 4ZYSA 4PZ7A 2L5TA 4APVA 5G3LD 4QB4A 2NZHA 3AU7A 3HKSA 1YITA 1N33L 5KNDA 5IWAQ 3OSSD 2ZXPA 4K8JA 1SE2A 4XQNA 2WKCA 4LFCL 1BUVT 2JA8H 5T1GA 1I4XA 1K28A 1HNXQ 4DR4H 3CCRA 5CV8A 1VMCA 3TRZA 4JI5H 2O4CA 4PMWA 4A3MH 1TWCH 1CQFA 2AQ3B 1O7ZA 4XQQA 1Q86C 3DHQA 4MZ9A 4IPDA 2DNEA 4DR3L 5CORA 2F0UA 3K8AA 4A3LH 2K52A 3HG9A 1VQGA 3TS0A 4JBKA 2A68D 4YCUA 2L12A 4DAMA 3ICEA 4LK1C 2LTMA 1GOZA 4BA2I 2OWOA 3KJPA 2G9HD 1HNZH 4GZYC 1ZTGA 1C4QA 3GABA 1XNRH 1HNWL 1J6QA 1G51A 2VY3A 1LACA 3Q22A 1B3QA 4GNXB 3VR4A 2QNDA 2K4KA 3CU7A 5IY0A 3HOXB 3R2IA 1EU3A 3ITPA 4B3TL 5E4XA 1STNA 3L2PA 1H9KA 4OWXB 4YIJA 2RKSA 2F0MA 4X64H 1QZHA 3UDGA 1A8VA 4ZLTF 2FPHX 2F0LA 3NWSA 4JBWA 1G91A 1I6VC 3V2TA 3S16B 4DV7L 1F2LA 4K6DA 1G291 4LUVA 5ELDA 1WCMG 4XDXA 4DV7H 2JJQA 3DWPA 3BJUA 2NN6H 1ICWA 2PW5A 3UDXA 1YI2A 4X3UA 1KNAA 3HOXH 1XTCD 1GHKA 3UE0A 5DNFA 4GKJQ 4LUOA 5JEAJ 4EGVA 4DV3Q 2MO0A 2OF1A 1FJGL 2IX3A 5C0XI 4KHPL 1EWHA 2ANNA 4X65L 2K50A 2IX0A 1M1KC 1WOCA 5I6WA 1L1OB 4O1NA 2NVQB 1DT4A 3HOZH 3GTQH 1VQAA 2CVRA 4ID6A 1QB5D 2VNUD 4LFBQ 3Q8DA 4X3SA 3S1MH 1DOKA 3EZJA 1TY2A 1ENCA 3K59A 2EY2A 2NZOA 3BVMA 4OIKA 3G4SA 4NXML 2KEDA 2Z8LA 1JORA 3K0XA 1YIJA 3E3XA 3CPFA 1CT1D 1U5KA 5C44B 4WALA 3C1EA 2EZVA 1S72A 3KDKA 5IGDA 2JA8B 1GUWA 5EPKA 3SK8A 4NXNQ 4BY7G 4P74A 2A73B 4X62H 4ABNA 5IT9E 1LT5D 5CMDA 5M3MG 3HS0C 2XTIA 3PGZA 2N88A 4E9JA 1AP0A 5IP9G 4A76A 3STBC 4ULLA 3TZDA 2NZ1D 4TVAB 1KLUD 4H44C 4NW2A 5GQOA 2WFWA 4DR1L 1J8IA 1WFQA 4X66H 2JA6G 2N49A 5IYCG 1TWGH 3D31A 1Z2IA 1A15A 5CYUA 4KV6A 3U50C 1BNZA 1BBWA 2CFMA 4RAUC 3KDGA 1WCMB 1D1KA 1K8GA 1R4PB 2ZJQA 1Y1VG 3J80i 2NN6I 5JOBA 2EYFA 4QCLA 3E0EA 3LNNA 2KHSA 4B3MQ 4EQ5A 1KAWA 1HH2P 1T9HA 4IPHA 2QEJC 4PV1C 3SR1A 4IFDI 1FGBD 2G8YA 1T5XD 4YWMA 1D7QA 2I5MX 4A3LG 4LF5H 2G5DA 1EFWA 1E1TA 3KJOA 4DXFA 2A1SA 1CHQD 1PH7A 3H6MA 4DV6Q 2QW7A 2OTLA 1YJ9A 3GTOH 3J7AV 1MJEA 4WJ4A 1RJTA 3M4YA 2CQAA 2F3VA 2HHHL 2M2LA 1VQLA 1LTAD 5EPJA 1E24A 1I4QA 4X66L 1KLGD 2PQUA 4NXMH 1KHIA 4M1UB 3TZUA 3FRPB 3TP5A 4A3CG 1S5DD 4BBSB 3QOLA 2QA4A 3F2BA 3WDNA 1PDQA 2F0NA 4QF4A 4DF7A 4HIDA 5LMNQ 4JI5Q 1SNQA 2CPMA 3Q24A 2NYZD 4XQJA 3SGIA 4JI0H 2TSSA 3CCJA 1WTQA 4LFCQ 3URYA 4DUYL 5AFWA 4OO1G 1X3GA 1STGA 2PW7A 2F4VQ 1I5FA 1SYBA 3VYTA 4LNQA 5JJLA 1F9SA 3T56B 4LFAH 2I5HA 1F2YA 3BZDB 2F0DA 4YHHL 4PG3A 1SFOB 3SEBA 3W1GA 3FEWX 4JV5L 1PTOH 3HGBA 3I4MH 2MP1A 4L5QA 1EOTA 1IW7C 2I5LX 1BBUA 4F87A 1VCIA 2D9IA 1S5FD 3D4RA 3I7FA 3ULPA 1VQ6A 1LT4D 1SEBD 1CA5A 2E3UA 2PYKA 2E2HB 2VQEL 4NZTM 2LMCB 1PH3A 3PF5A 3S9WA 1IYJB 4B8CD 1PZJD 3KOJA 3AB9A 3BG3A 4JK1C 4MTNA 4G57A 5IGFA 4DV5H 1SN8A 3M4QA 2R93G 1L0XB 4K2LA 2F3WA 2RDGA 3K5MA 3J81E 3DEOA 3EN2A 2ICIA 4LUZA 1OXVA 1TS5A 3R8BA 3CC2A 1IBKQ 3J7A5 3CCVA 2MJHA 1FNWA 1N33Q 3E5SA 4O42A 2LS01 1X55A 1MSZA 3MC0B 1A3VA 1RDPD 3MXNB 3UOEA 2OTJA 1CUKA 2Z6KC 1GHJA 2OPUA 5HURA 3M3YB 4G7OC 1FJGQ 2F3IA 1I4GA 3F2DA 1P8LA 2ZT9C 5IP7G 3HOWH 5C5MA 1BQQT 2D5DA 2EPBA 1XNQL 4DV1Q 4TQUS 5C0XG 2CTMA 4ODGA 1EQRA 4G4KA 2ZM6L 2F0OA 2NB0A 3CMEA 1K9MC 3TEHB 1PQXA 2R93B 4A3BB 2BDNA 2A69D 2RCNA 4DR2Q 1NMFA 1Z47A 5F2DA 3GR5A 3NCVA 4DV0Q 1JJGA 2CQOA 2B39A 1DM0B 4JBMA 3KF8A 2AXYA 4QMFB 4IN3A 1NUCA 2UU9Q 1BCPD 3A8JE 3NEMA 1XNQQ 1I4PA 3HOYH 2XSCA 2CWPA 1MIUA 1SNCA 4LAAA 3G6JB 1ML0D 2CTJA 1KXLA 2CWHA 2EYMA 1LV9A 1PH1A 3VA7A 1M90C 2VS1A 4IJHA 1ZEQX 1B9NA 1EU4A 4ZK9B 5JPMC 4A3MG 1HR0Q 2L15A 4N8FA 1AFPA 1EQVA 4A3IG 1U9RA 4GKKQ 3MXGA 3SVMA 4Y7NB 2UU9L 2FXQA 5IYBH 3V69A 1HQMC 2RSOA 2RA4A 1XMQH 2JYOA 5FLXL 2NVXH 4LF5L 2JA7B 4RH6A 4DA2A 1SNOA 1ESRA 2E5LH 1D5MC 1B50A 4P71A 3NPPA 1MBYA 3PF4A 3T1YH 5I2YA 3P75A 3CW2C 3G7LA 1ASZA 2SNSA 3GTKB 3P7JA 1C7YA 1LABA 4FF1A 5IWAH 1FD7D 2B63G 1IW7D 2D2CC 4DK3C 4X3TA 3S1NB 3EBEA 5C3EH 5E1FA 1E2VA 2P2RA 4HJ7A 3CXCA 3KLSA 4DR5Q 5C4JH 2AHOB 3PIPA 4FXDA 1ZZIA 1XNRQ 4HJAA 3DM1A 1E3PA 3S17B 4CGYB 4C3HB 2K5DA 4MNOA 2EYJA 4FJSA 2IT1A 3D8GA 4OX9H 2VQFH 1Y1WB 3KLWA 3K5LA 4O0AA 4FF3A 2LKVA 2K32A 3QD7X 3BYYB 4H02A 3G6EA 2UXBL 2B63B 2F4IA 4DV3H 1SXTA 2LY7A 4C1NI 1V1PA 2AMCB 3TDQA 5AJ3Q 4RMFA 2L11A 1C0AA 4JVHA 1SEIA 1TKWB 4JI2Q 4A3DG 1Y8PB 2I46A 3U4ZA 3L9AX 3IFDA 1KD1C 1D5XC 3PV0A 1LTBD 2EVBA 2EYPA 4DAYB 5C6AA 2RDHA 2XN9C 1PRTD 4DXGA 4B3MH 1L0YB 5IOCA 1QILA 3A56A 3W1BA 5GAGC 3OMCA 3C1FA 3UDIA 4JI2L 1IBLH 1CQVA 3FAUA 1TIID 4DK1A 4A3JB 3RZOH 1IBKH 2RCFA 1WVLA 3KLRA 2EYHA 4GN3B 1PFMA 1H9RA 1Q12A 4JI3L 3QR8A 3NTHA 5IE8A 1U4RA 2Z9HA 3FKIG 4LF6H 2K5WA 4DV4Q 4A3KB 3AEVA 2ANRA 1NTGA 3T1HH 3D4DA 1Y1VB 1NR2A 1QZGA 2CTKA 1EQQA 3F1ZA 2DGRA 4X62Q 5M3FH 4UPAA 2Z4HA 3CC4A 2KCTA 4DAPA 1HZAA 2B29A 1JQYD 3M9BA 4C3JG 5KGUA 2K5NA 3PO3H 4CKEA 1HUMA 1YHBA 2R3ZA 4DU9A 3A55A 1DOLA 4NP5A 4A93G 4JI4Q 1B44D 1K0RA 4ZUIA 4C3HH 1DOMA 3OYYA 1I94L 3T1YQ 1LTGD 4JI7Q 1BCPB 2AWNA 2UXDQ 2QDLA 4LF4Q 1JWUD 1H9JA 4BY7B 4IOAA 4JV5Q 5NUCA 1CKMA 3VDYA 1UE5A 3RLOA 1XMOQ 2PQAA 5L37A 5M5XB 1F9QA 4DV4L 4DV2Q 1I4RA 1V9PA 4LF8H 1V8CA 4B8TA 4JI6Q 1V43A 4R1JA 4A3EH 2F0FA 5DM73 1HNWH 2JA6H 1F77A 3DMUA 3A5UA 4ZQ3A 5HY6A 1NMGA 1XMQL 4CJ2C 2Q8TA 1HR0W 2KBNA 2PCFB 3KK7A 2ENBA 3T1HQ 1S5BD 3R3OA 4HAEA 4K2KA 1NXUA 1C8CA 1RD9D 4PNYA 2EYLA 5M5YH 1WTOA 3S1RH 1S40A 1EYAA 1N34Q 4BBSG 1ENAA 1EY8A 2K04A 3FVQA 3IL8A 4JI5L 5H1SE 5IYDG 4LF9Q 1A6XA 2EIFA 4QJFA 1TXYA 4GLVB 4A3EB 1EYCA 1MJCA 3RLFA 2NVYH 4DAVA 1XRHA 1STAA 1HJPA 4X62L 1YNJC 2B2WC 3K7UC 1FVIA 3NK9A 3T1HL 1X9ZA 4K0KH 1HZCA 2F0IA 4EX5A 4Q5VA 2FFKB 1N34L 1VQIA
chains in the Genus database with same CATH topology
1JMCA 1K8AC 3S1MH 2R6GA 1Y1WG 2WB1E 4YHHQ 4GNXA 5GROA 2IX1A 2NZOA 5M3MH 3G4SA 4NXML 1WVNA 3FP9A 3J7ZC 2A8VA 2YTYA 3HKZE 4LF8Q 3I4NG 3K0XA 1YIJA 3ULLA 3CPFA 1U5KA 4NXNL 2NVTH 2R92H 2BH8A 5GAHC 4A3BH 2K5HA 4WALA 4BY1H 1PFSA 3DM3A 3BZCA 3PUVA 2HQLA 4BA1I 3CCSA 4GOPB 1S72A 3KF8B 4NXNQ 3HOVG 4BY7G 2JEAI 4P74A 2D0OA 4P75A 2BA0A 4B3SQ 4A3FG 1N36Q 1IBLL 1GKHA 1V1QA 1DGSA 4GLAC 1IBML 2JZXA 4KLKA 5M3MG 4JI7L 4LF9L 2BH2A 2UUAQ 2XGTA 4DR4Q 4A3KH 3W5OA 1SE8A 5FJ8G 2WB1G 2XTIA 3H0GH 3PGZA 4JCVE 1VQEA 3GTJH 3RN2A 5IP9G 1LM0A 4A76A 3STBC 5ELNA 2YYZA 4TVAB 4AYBE 2VQEQ 1KQSA 1UE1A 2K5VA 5GQOA 2OQ0A 4YY3L 3KF6A 2WFWA 4DR1L 3PSIA 1WFQA 4JI8Q 2JA6G 2N49A 5IYCG 2K14A 4K0KL 1TWGH 4OWTB 4A3JH 3D31A 4R4OA 3VKEA 1GM5A 4DR6Q 1XTDA 4A4IA 3NENA 5JJIA 4R4IA 2HIXA 3U50C 4C3IH 3KYHC 4X64L 1KC8C 1J5KA 1BBWA 4JI1Q 2CFMA 4XTCS 5IYDH 1K8GA 2ZJQA 1Y1VG 3J80i 2NN6I 1LYLA 5C44G 3E0EA 1SRUA 2ZTCA 1XPOA 3I4MG 3S2HH 1X6OA 1XMOL 4ALPA 4B3MQ 1QVFA 4EQ5A 5K36G 1KAWA 1HH2P 1T9HA 4GN4B 4IPHA 4QY7A 4WANA 1AH9A 2VQFL 4IFDI 2MFIA 2BL5A 1EOVA 3UDFA 5C0XJ 4B3ML 4DUYQ 2JQOA 1HR0L 4YWMA 1D7QA 1WYDA 3RR5A 1XJVA 2I5MX 4A3LG 1EFWA 1E1TA 3EIVA 3PCOB 3AQQA 3KJOA 2ATWA 2OPVA 3GTPH 5JJKA 4AH6A 4DV3L 3G48A 1PH7A 4DV6Q 2OTLA 2B63H 1YJ9A 1OTCA 4HJ9A 1EC6A 3GTOH 4DR7Q 4DR5L 2UXCL 1CKNA 5JEAG 2A1AA 1EIYB 4POFA 1MJEA 4JC0A 4WJ4A 2E5LQ 2F52A 1VQDA 2Z0SA 1AE3A 4BBRG 3M4PA 4LF7Q 2HHHL 3FKIH 1VQLA 2ZTDA 1Y1WH 1E24A 4QGUA 5LMUQ 4LFAL 1CSPA 2JK8A 5GADC 4X66L 3MEFA 5IWAL 1TWAH 2ALYB 2PQUA 1KHIA 1X54A 3BZKA 2VUMG 4JOIC 2KENA 3S17H 4A3CG 4X6AH 4YCVA 1ZZJA 2CTEA 1PYBA 2JA5G 2QA4A 1GO3E 3F2BA 1J4WA 3J80c 5FJ8H 3CPWA 2PNHA 1L2FA 2YU9H 3HOUH 1VQFA 1RL2A 1X9NA 2HH3A 2YV5A 4HIDA 5LMNQ 4JI5Q 2UXBQ 3PO3G 2E2JH 4OXPA 3SGIA 4JI6L 1IBKL 1UWVA 1B70B 3CCJA 1JE5A 4LFCQ 3S1NH 4DUYL 1VQOA 4BBSH 1NJIC 1X3GA 2EQSA 1I94L 4L5SA 4OO1G 3CF5A 2AWOA 2F4VQ 1I5FA 4QQBX 3I4OA 4LNQA 4R4CA 4NPSA 4LF8L 1JB7A 5JJLA 2RHSB 1VQ7A 2I5HA 4IFDJ 2HT1A 2JE6I 4OONA 3H3VI 4DR3Q 1NY4A 4YHHL 4PG3A 4BXXH 1CKNB 1GVPA 2VZAA 1VQCA 3HKZG 3W1GA 5C3EG 4GN5A 3JAMi 4NXMQ 3B6YA 4JV5L 1X3FA 2QEXA 1EIFA 1WE8A 3IRBA 3I4MH 1IL2A 4L5QA 3I4NH 2I5LX 1BBUA 1VCIA 4Y7NH 4A3GH 3KDFA 1VQ4A 2YTVA 3I7FA 3ULPA 1VQ6A 3E9HA 2E3UA 3AFQA 1IBMQ 1IBLQ 2VQEL 1KRSA 2Q2IA 4B3SL 1PH3A 3PF5A 3CP0A 5HGQA 1R9TH 1IYJB 1ZZKA 3KOJA 2PY9A 4K0KQ 3ER0A 2PI2E 4JI8L 4MTNA 2Z6KA 5M5WH 1SN8A 3M4QA 2E5LL 3K7AH 1J5EL 1WCMH 4B3RL 3PIOA 2R93G 1BVSA 4IJLA 2MQHA 4A3KG 4KI0A 3S1QH 1HNXL 3H0GG 2LXKA 4A3DH 3EN2A 1PH6A 4A93H 1L0WA 1QVGA 4LUZA 1OXVA 2WAQG 4DNIA 3CC2A 1IBKQ 3J7A5 1JT8A 3CCVA 1PYSB 2MJHA 1N33Q 1N8RC 2JA5H 1X55A 3CMAA 5J3BA 4LFBL 1VIGA 2I0QA 3S24A 3MXNB 3NELA 2R93H 5EAYA 2E2IH 4JBJA 2OTJA 2R7ZG 1CUKA 2Z6KC 1H95A 2OPUA 2B3GA 3RZDH 1W2BA 4KHZA 1FJGQ 2F3IA 4IPGA 3F2DA 1P8LA 1PH5A 1TWFH 5IP7G 4IO9A 3HOWH 1LUZA 3UE1A 1KRTA 4AQYQ 3STBD 1I3QH 2E8GA 5IYCH 2KHIA 1XNQL 4DV1Q 4TQUS 5C0XG 2CTMA 1EQRA 2AKWB 1VQBA 2ZM6L 3CMEA 3M3YH 3T1YL 1K9MC 4LF7L 2N3SA 3TEHB 4A3EG 3LGJA 3ULJA 4DR1Q 3CQZH 3KFUA 5C44H 1OXXK 1PH8A 2R7DA 2RCNA 1NMFA 1Z47A 4DR2Q 4A75A 4LF4L 4B3RQ 4X66Q 4JG2A 4DV0Q 1PH4A 3CCLA 3PO2G 4DR6L 1JJGA 2CQOA 3RNUA 2HIVA 4DPGA 2KHJA 4JBMA 1EUJA 1VQKA 2AXYA 3HOWG 4QMFB 2R7ZH 4NB3A 2Y0SE 4IPCA 2UU9Q 4BBRH 5AJ3L 2ID0A 3NEMA 1XNQQ 4LFAQ 5LMUL 3HOYH 4C3JH 1JJCB 2CWPA 1MIUA 2NVQH 2WAQE 2V1CC 1B7YB 1B8AA 4P72A 4BXXG 3JAMc 1I6HH 2IHFA 3PUZA 2CTJA 5IP9H 3CD6A 2GN5A 1KXLA 1VQ8A 2UUAL 4JI0Q 4DR4L 1X4NA 4GKKL 1PH1A 1M90C 2VS1A 4IJHA 1HR0Q 4A3MG 2E2HH 2L15A 3PO2H 5BR8L 4A3IG 4GKKQ 4DV2L 3HOXG 1N32Q 3AEVB 3HOUG 1A0IA 2UU9L 2FXQA 5IYBH 2UUBL 3V69A 1KHMA 3PUYA 1UE6A 4POGA 2RHQB 4B3TQ 3HOYG 2NVXH 3A74A 4LF5L 5FLMG 3S16H 2VUMH 1SROA 2DGYA 4AYBG 3OTOL 3RLNA 3F2CA 4GOPC 1PVOA 1C9OA 1Q1BA 4A3JG 4P71A 1SFOH 4HIOA 1J5EQ 2Q2TA 3H3VH 2R7FA 4GNXC 3PF4A 5ELOA 1Q46A 3K80C 4WJ3M 4AM3A 1I94Q 2JA9A 3AYHB 3CAMA 1Y14B 3CW2C 4P73A 1EYGA 4GLXA 5C4XH 1ASZA 4LF6Q 1X3EA 4KHPQ 4B8TA 1CSQA 5IYBG 3S14H 1PH9A 4OX9L 4FDBA 3RN5A 1C7YA 1YJNA 1KIXA 1IXRA 2C35B 1HNZQ 2B63G 4DK3C 2CTLA 1K83H 5M5XH 4JYAL 3E9IA 3EBEA 5C3EH 3GTLH 3GTGH 4LW1A 2VW9A 3J81c 4GOPA 2Q2HA 2P2RA 2JA7G 4HJ7A 4AIMA 3CXCA 4Y52H 3TREA 1GD7A 3OW2A 4BY7H 4DR5Q 1X4MA 1EWIA 2PQAB 4DKAC 5C4JH 2JA8G 2AHOB 1HZ9A 1X56A 2LSSA 3PIPA 3CCUA 2UUCQ 2IY5B 1ZZIA 4R4TA 1CKOA 1XNRQ 4HJAA 1XMQQ 3F8TA 4DUZL 1FL0A 1Q8KA 3CC7A 1E3PA 1X65A 3M85A 4RG1A 1OXTA 1U0LA 1YVCA 2MNAA 1NE3A 4DV5Q 1N36L 2CCZA 4MNOA 4ME3A 3HFZB 1WJJA 2BA1A 1OXUA 3PUWA 2IT1A 4UP7A 1DTJA 3KLWA 4L5TA 4DV5L 3KF6B 4LIJA 3AFPA 4UP9A 4HIMA 1PV4A 3K81C 1YZ6A 1L1OC 4O0AA 3CCQA 1N32L 1D8LA 2N8NA 4H02A 4JI1L 3G6EA 2EXDA 4X64Q 4YY3Q 5LMNL 4C2MH 4A3CH 1Y1VH 2UXBL 4IOCA 1HNWQ 2H5XA 1O7IA 2AMCB 5AJ3Q 4RMFA 1VQHA 4X65Q 1C0AA 1NBWA 4JVHA 1HNZL 4JYAQ 2YTXA 4JI2Q 4A3DG 4NBQA 1XPRA 3TS2A 3U4ZA 2IHEA 4YWLA 1K3RA 4JI4L 1JJ2A 2Q2UA 1KD1C 4DV0L 1TWHH 3D0FA 3PV0A 3J81i 1YNXA 4DAYB 1RIPA 3L0OA 1SLJA 1L1OA 4HIKA 1A62A 4A3BG 5E7NA 4DV1L 1FGUA 4DV7Q 2ZM6Q 4BY1G 4A3IH 3W1BA 5GAGC 3GD7A 4DR2L 1QUQB 2KCMA 2VQFQ 1YHQA 4DR7L 3UDIA 1PHJA 2D0PA 3ERSX 4JI2L 4L5RC 3J81j 3U1KA 4LF5Q 3HOVH 3S2DH 3RZOH 5FLMH 1Q1EA 1YBYA 4HJ5A 2PMZE 4JI0L 3CCEA 4GN3B 1KL9A 1SR3A 1ASYA 1XNRL 1TUAA 1Q12A 3A5ZB 4JI3L 4J15A 4PZ7A 1K73C 4DV6L 5BR8Q 1PH2A 1WI5A 3M4OH 4JOIA 4APVA 4QIWE 3H15A 5IE8A 5C4XG 3FKIG 1QVCA 1S3OA 2NZHA 3HKSA 4DV4Q 1YITA 4YWKA 3AEVA 2UUCL 2ANRA 1NTGA 1E22A 1YEZA 1VIHA 2JEBI 1N33L 1P16A 5IWAQ 3CCMA 3I55A 1VQPA 2ZTEA 1QZGA 2CTKA 1EQQA 1IZ6A 3HOZG 3F1ZA 2DGRA 4X62Q 1HZBA 2OQKA 5M3FH 4OWWB 1Q7YC 4LFCL 4UPAA 4HJ8A 3DLLA 2JA8H 3CC4A 3FHWA 2KCTA 1HNXQ 1HZAA 2B29A 3M9BA 1E7ZA 3TQYA 3G71A 3CCRA 1MKHA 2K5NA 4GKJL 1VQJA 3PO3H 3I2ZA 3GDEA 3NBHB 3TRZA 1YHBA 4PMWA 5GAEC 4A3MH 5IP7H 1TWCH 4YCWA 4A93G 4JI4Q 1K0RA 4C3HH 1N9WA 1Q86C 4XIGS 2LXJA 4MZ9A 4IPDA 3WWVA 3OYYA 2RF4A 2ZJPA 2VL6A 1I50H 3BU2A 4DR3L 4PZ6A 2WP8J 4GS3A 3K8AA 3T1YQ 2AWNA 4JI7Q 4A3LH 2K52A 2UXDQ 2R92G 4LF4Q 4AQYL 5M3FG 4OX9Q 4IOAA 1VQGA 4QL5A 3TS0A 1VQ9A 4YCUA 4JBKA 1LTLA 4DAMA 4JV5Q 2OCEA 1CKMA 3ICEA 2ZJRA 4IFDG 3VDYA 4BA2I 1UEBA 1UE5A 3RLOA 2OWOA 3GO5A 3KJPA 2PQAA 1XMOQ 2PI2A 4R4QA 3ZJYC 3M7NA 1A63A 1ZTGA 4DV4L 4JVYA 4DV2Q 4DUZQ 1HNWL 1J6QA 1G51A 2VY3A 1V9PA 1Q82C 2UXCQ 2A19A 4OO1I 2YQRA 2GVAA 1V43A 4R1JA 4A3EH 4JI6Q 4GNXB 3KDFB 3GTKH 4A3GG 1AE2A 2K4KA 2NN6G 5IY0A 2QNDA 2JA6H 3A0JA 2FMRA 4B3TL 4UP8A 1YHAA 4JI3Q 1UE7A 2D62A 3GTMH 3L2PA 2F4VL 4OWXB 1E1OA 3U4VA 3A5UA 2MO1A 2CPQA 2CTFA 2CKZB 2CWAA 5HY6A 4DK6C 1NMGA 1Q81C 3I56A 5IT9c 1VQMA 1XMQL 1QZHA 1W3SA 3UDGA 1A8VA 2HH2A 1BKBA 2ASBA 1HR0W 2KBNA 4JBWA 2ES2A 4LWCA 3T1HQ 1QUQA 2JA7H 4DV7L 1G291 4LUVA 1XPUA 1YJWA 3PUXA 3L7ZC 5M5YH 1WCMG 5FLXc 4O2DA 2JJQA 2HHHQ 2QGQA 3BJUA 2GVBA 2N78A 3S1RH 1S40A 1N34Q 3JC66 1G6PA 3UDXA 4JI5L 1YI2A 1VQ5A 5H1SE 1SMXA 5IYDG 4BBSG 1VQNA 4LF9Q 1K1GA 1Z9FA 2EIFA 3HOXH 4PZ8A 4QJFA 1TXYA 4GLVB 3UE0A 2UXDL 4GKJQ 2Y0SG 4LUOA 5JEAJ 1VS0A 4DV3Q 4A3FH 2JVZA 1MJCA 2K75A 5DLQE 2MO0A 3RLFA 1FJGL 2NVYH 5C0XI 4LF6L 4KHPL 2ANNA 3S15H 4X65L 2K50A 1HJPA 4X62L 2UUBQ 2IX0A 1M1KC 3K7UC 1FVIA 1WOCA 3T1HL 1L1OB 1HZCA 1DT4A 3U58A 3HOZH 3GTQH 1VQAA 1OXSC 2DUDA 4UY8C 5LMNW 4EX5A 4LFBQ 3Q8DA 2VNUD 3OTOQ 1PA6A 1N34L 1VQIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JMC A;  1K8A C;  3S1M H;  2R6G A;  1Y1W G;  2WB1 E;  4YHH Q;  4GNX A;  5GRO A;  2IX1 A;  2NZO A;  5M3M H;  3G4S A;  4NXM L;  1WVN A;  3FP9 A;  3J7Z C;  2A8V A;  2YTY A;  3HKZ E;  4LF8 Q;  3I4N G;  3K0X A;  1YIJ A;  3ULL A;  3CPF A;  1U5K A;  4NXN L;  2NVT H;  2R92 H;  2BH8 A;  5GAH C;  4A3B H;  2K5H A;  4WAL A;  4BY1 H;  1PFS A;  3DM3 A;  3BZC A;  3PUV A;  2HQL A;  4BA1 I;  3CCS A;  4GOP B;  1S72 A;  3KF8 B;  4NXN Q;  3HOV G;  4BY7 G;  2JEA I;  4P74 A;  2D0O A;  4P75 A;  2BA0 A;  4B3S Q;  4A3F G;  1N36 Q;  1IBL L;  1GKH A;  1V1Q A;  1DGS A;  4GLA C;  1IBM L;  2JZX A;  4KLK A;  5M3M G;  4JI7 L;  4LF9 L;  2BH2 A;  2UUA Q;  2XGT A;  4DR4 Q;  4A3K H;  3W5O A;  1SE8 A;  5FJ8 G;  2WB1 G;  2XTI A;  3H0G H;  3PGZ A;  4JCV E;  1VQE A;  3GTJ H;  3RN2 A;  5IP9 G;  1LM0 A;  4A76 A;  3STB C;  5ELN A;  2YYZ A;  4TVA B;  4AYB E;  2VQE Q;  1KQS A;  1UE1 A;  2K5V A;  5GQO A;  2OQ0 A;  4YY3 L;  3KF6 A;  2WFW A;  4DR1 L;  3PSI A;  1WFQ A;  4JI8 Q;  2JA6 G;  2N49 A;  5IYC G;  2K14 A;  4K0K L;  1TWG H;  4OWT B;  4A3J H;  3D31 A;  4R4O A;  3VKE A;  1GM5 A;  4DR6 Q;  1XTD A;  4A4I A;  3NEN A;  5JJI A;  4R4I A;  2HIX A;  3U50 C;  4C3I H;  3KYH C;  4X64 L;  1KC8 C;  1J5K A;  1BBW A;  4JI1 Q;  2CFM A;  4XTC S;  5IYD H;  1K8G A;  2ZJQ A;  1Y1V G;  3J80 i;  2NN6 I;  1LYL A;  5C44 G;  3E0E A;  1SRU A;  2ZTC A;  1XPO A;  3I4M G;  3S2H H;  1X6O A;  1XMO L;  4ALP A;  4B3M Q;  1QVF A;  4EQ5 A;  5K36 G;  1KAW A;  1HH2 P;  1T9H A;  4GN4 B;  4IPH A;  4QY7 A;  4WAN A;  1AH9 A;  2VQF L;  4IFD I;  2MFI A;  2BL5 A;  1EOV A;  3UDF A;  5C0X J;  4B3M L;  4DUY Q;  2JQO A;  1HR0 L;  4YWM A;  1D7Q A;  1WYD A;  3RR5 A;  1XJV A;  2I5M X;  4A3L G;  1EFW A;  1E1T A;  3EIV A;  3PCO B;  3AQQ A;  3KJO A;  2ATW A;  2OPV A;  3GTP H;  5JJK A;  4AH6 A;  4DV3 L;  3G48 A;  1PH7 A;  4DV6 Q;  2OTL A;  2B63 H;  1YJ9 A;  1OTC A;  4HJ9 A;  1EC6 A;  3GTO H;  4DR7 Q;  4DR5 L;  2UXC L;  1CKN A;  5JEA G;  2A1A A;  1EIY B;  4POF A;  1MJE A;  4JC0 A;  4WJ4 A;  2E5L Q;  2F52 A;  1VQD A;  2Z0S A;  1AE3 A;  4BBR G;  3M4P A;  4LF7 Q;  2HHH L;  3FKI H;  1VQL A;  2ZTD A;  1Y1W H;  1E24 A;  4QGU A;  5LMU Q;  4LFA L;  1CSP A;  2JK8 A;  5GAD C;  4X66 L;  3MEF A;  5IWA L;  1TWA H;  2ALY B;  2PQU A;  1KHI A;  1X54 A;  3BZK A;  2VUM G;  4JOI C;  2KEN A;  3S17 H;  4A3C G;  4X6A H;  4YCV A;  1ZZJ A;  2CTE A;  1PYB A;  2JA5 G;  2QA4 A;  1GO3 E;  3F2B A;  1J4W A;  3J80 c;  5FJ8 H;  3CPW A;  2PNH A;  1L2F A;  2YU9 H;  3HOU H;  1VQF A;  1RL2 A;  1X9N A;  2HH3 A;  2YV5 A;  4HID A;  5LMN Q;  4JI5 Q;  2UXB Q;  3PO3 G;  2E2J H;  4OXP A;  3SGI A;  4JI6 L;  1IBK L;  1UWV A;  1B70 B;  3CCJ A;  1JE5 A;  4LFC Q;  3S1N H;  4DUY L;  1VQO A;  4BBS H;  1NJI C;  1X3G A;  2EQS A;  1I94 L;  4L5S A;  4OO1 G;  3CF5 A;  2AWO A;  2F4V Q;  1I5F A;  4QQB X;  3I4O A;  4LNQ A;  4R4C A;  4NPS A;  4LF8 L;  1JB7 A;  5JJL A;  2RHS B;  1VQ7 A;  2I5H A;  4IFD J;  2HT1 A;  2JE6 I;  4OON A;  3H3V I;  4DR3 Q;  1NY4 A;  4YHH L;  4PG3 A;  4BXX H;  1CKN B;  1GVP A;  2VZA A;  1VQC A;  3HKZ G;  3W1G A;  5C3E G;  4GN5 A;  3JAM i;  4NXM Q;  3B6Y A;  4JV5 L;  1X3F A;  2QEX A;  1EIF A;  1WE8 A;  3IRB A;  3I4M H;  1IL2 A;  4L5Q A;  3I4N H;  2I5L X;  1BBU A;  1VCI A;  4Y7N H;  4A3G H;  3KDF A;  1VQ4 A;  2YTV A;  3I7F A;  3ULP A;  1VQ6 A;  3E9H A;  2E3U A;  3AFQ A;  1IBM Q;  1IBL Q;  2VQE L;  1KRS A;  2Q2I A;  4B3S L;  1PH3 A;  3PF5 A;  3CP0 A;  5HGQ A;  1R9T H;  1IYJ B;  1ZZK A;  3KOJ A;  2PY9 A;  4K0K Q;  3ER0 A;  2PI2 E;  4JI8 L;  4MTN A;  2Z6K A;  5M5W H;  1SN8 A;  3M4Q A;  2E5L L;  3K7A H;  1J5E L;  1WCM H;  4B3R L;  3PIO A;  2R93 G;  1BVS A;  4IJL A;  2MQH A;  4A3K G;  4KI0 A;  3S1Q H;  1HNX L;  3H0G G;  2LXK A;  4A3D H;  3EN2 A;  1PH6 A;  4A93 H;  1L0W A;  1QVG A;  4LUZ A;  1OXV A;  2WAQ G;  4DNI A;  3CC2 A;  1IBK Q;  3J7A 5;  1JT8 A;  3CCV A;  1PYS B;  2MJH A;  1N33 Q;  1N8R C;  2JA5 H;  1X55 A;  3CMA A;  5J3B A;  4LFB L;  1VIG A;  2I0Q A;  3S24 A;  3MXN B;  3NEL A;  2R93 H;  5EAY A;  2E2I H;  4JBJ A;  2OTJ A;  2R7Z G;  1CUK A;  2Z6K C;  1H95 A;  2OPU A;  2B3G A;  3RZD H;  1W2B A;  4KHZ A;  1FJG Q;  2F3I A;  4IPG A;  3F2D A;  1P8L A;  1PH5 A;  1TWF H;  5IP7 G;  4IO9 A;  3HOW H;  1LUZ A;  3UE1 A;  1KRT A;  4AQY Q;  3STB D;  1I3Q H;  2E8G A;  5IYC H;  2KHI A;  1XNQ L;  4DV1 Q;  4TQU S;  5C0X G;  2CTM A;  1EQR A;  2AKW B;  1VQB A;  2ZM6 L;  3CME A;  3M3Y H;  3T1Y L;  1K9M C;  4LF7 L;  2N3S A;  3TEH B;  4A3E G;  3LGJ A;  3ULJ A;  4DR1 Q;  3CQZ H;  3KFU A;  5C44 H;  1OXX K;  1PH8 A;  2R7D A;  2RCN A;  1NMF A;  1Z47 A;  4DR2 Q;  4A75 A;  4LF4 L;  4B3R Q;  4X66 Q;  4JG2 A;  4DV0 Q;  1PH4 A;  3CCL A;  3PO2 G;  4DR6 L;  1JJG A;  2CQO A;  3RNU A;  2HIV A;  4DPG A;  2KHJ A;  4JBM A;  1EUJ A;  1VQK A;  2AXY A;  3HOW G;  4QMF B;  2R7Z H;  4NB3 A;  2Y0S E;  4IPC A;  2UU9 Q;  4BBR H;  5AJ3 L;  2ID0 A;  3NEM A;  1XNQ Q;  4LFA Q;  5LMU L;  3HOY H;  4C3J H;  1JJC B;  2CWP A;  1MIU A;  2NVQ H;  2WAQ E;  2V1C C;  1B7Y B;  1B8A A;  4P72 A;  4BXX G;  3JAM c;  1I6H H;  2IHF A;  3PUZ A;  2CTJ A;  5IP9 H;  3CD6 A;  2GN5 A;  1KXL A;  1VQ8 A;  2UUA L;  4JI0 Q;  4DR4 L;  1X4N A;  4GKK L;  1PH1 A;  1M90 C;  2VS1 A;  4IJH A;  1HR0 Q;  4A3M G;  2E2H H;  2L15 A;  3PO2 H;  5BR8 L;  4A3I G;  4GKK Q;  4DV2 L;  3HOX G;  1N32 Q;  3AEV B;  3HOU G;  1A0I A;  2UU9 L;  2FXQ A;  5IYB H;  2UUB L;  3V69 A;  1KHM A;  3PUY A;  1UE6 A;  4POG A;  2RHQ B;  4B3T Q;  3HOY G;  2NVX H;  3A74 A;  4LF5 L;  5FLM G;  3S16 H;  2VUM H;  1SRO A;  2DGY A;  4AYB G;  3OTO L;  3RLN A;  3F2C A;  4GOP C;  1PVO A;  1C9O A;  1Q1B A;  4A3J G;  4P71 A;  1SFO H;  4HIO A;  1J5E Q;  2Q2T A;  3H3V H;  2R7F A;  4GNX C;  3PF4 A;  5ELO A;  1Q46 A;  3K80 C;  4WJ3 M;  4AM3 A;  1I94 Q;  2JA9 A;  3AYH B;  3CAM A;  1Y14 B;  3CW2 C;  4P73 A;  1EYG A;  4GLX A;  5C4X H;  1ASZ A;  4LF6 Q;  1X3E A;  4KHP Q;  4B8T A;  1CSQ A;  5IYB G;  3S14 H;  1PH9 A;  4OX9 L;  4FDB A;  3RN5 A;  1C7Y A;  1YJN A;  1KIX A;  1IXR A;  2C35 B;  1HNZ Q;  2B63 G;  4DK3 C;  2CTL A;  1K83 H;  5M5X H;  4JYA L;  3E9I A;  3EBE A;  5C3E H;  3GTL H;  3GTG H;  4LW1 A;  2VW9 A;  3J81 c;  4GOP A;  2Q2H A;  2P2R A;  2JA7 G;  4HJ7 A;  4AIM A;  3CXC A;  4Y52 H;  3TRE A;  1GD7 A;  3OW2 A;  4BY7 H;  4DR5 Q;  1X4M A;  1EWI A;  2PQA B;  4DKA C;  5C4J H;  2JA8 G;  2AHO B;  1HZ9 A;  1X56 A;  2LSS A;  3PIP A;  3CCU A;  2UUC Q;  2IY5 B;  1ZZI A;  4R4T A;  1CKO A;  1XNR Q;  4HJA A;  1XMQ Q;  3F8T A;  4DUZ L;  1FL0 A;  1Q8K A;  3CC7 A;  1E3P A;  1X65 A;  3M85 A;  4RG1 A;  1OXT A;  1U0L A;  1YVC A;  2MNA A;  1NE3 A;  4DV5 Q;  1N36 L;  2CCZ A;  4MNO A;  4ME3 A;  3HFZ B;  1WJJ A;  2BA1 A;  1OXU A;  3PUW A;  2IT1 A;  4UP7 A;  1DTJ A;  3KLW A;  4L5T A;  4DV5 L;  3KF6 B;  4LIJ A;  3AFP A;  4UP9 A;  4HIM A;  1PV4 A;  3K81 C;  1YZ6 A;  1L1O C;  4O0A A;  3CCQ A;  1N32 L;  1D8L A;  2N8N A;  4H02 A;  4JI1 L;  3G6E A;  2EXD A;  4X64 Q;  4YY3 Q;  5LMN L;  4C2M H;  4A3C H;  1Y1V H;  2UXB L;  4IOC A;  1HNW Q;  2H5X A;  1O7I A;  2AMC B;  5AJ3 Q;  4RMF A;  1VQH A;  4X65 Q;  1C0A A;  1NBW A;  4JVH A;  1HNZ L;  4JYA Q;  2YTX A;  4JI2 Q;  4A3D G;  4NBQ A;  1XPR A;  3TS2 A;  3U4Z A;  2IHE A;  4YWL A;  1K3R A;  4JI4 L;  1JJ2 A;  2Q2U A;  1KD1 C;  4DV0 L;  1TWH H;  3D0F A;  3PV0 A;  3J81 i;  1YNX A;  4DAY B;  1RIP A;  3L0O A;  1SLJ A;  1L1O A;  4HIK A;  1A62 A;  4A3B G;  5E7N A;  4DV1 L;  1FGU A;  4DV7 Q;  2ZM6 Q;  4BY1 G;  4A3I H;  3W1B A;  5GAG C;  3GD7 A;  4DR2 L;  1QUQ B;  2KCM A;  2VQF Q;  1YHQ A;  4DR7 L;  3UDI A;  1PHJ A;  2D0P A;  3ERS X;  4JI2 L;  4L5R C;  3J81 j;  3U1K A;  4LF5 Q;  3HOV H;  3S2D H;  3RZO H;  5FLM H;  1Q1E A;  1YBY A;  4HJ5 A;  2PMZ E;  4JI0 L;  3CCE A;  4GN3 B;  1KL9 A;  1SR3 A;  1ASY A;  1XNR L;  1TUA A;  1Q12 A;  3A5Z B;  4JI3 L;  4J15 A;  4PZ7 A;  1K73 C;  4DV6 L;  5BR8 Q;  1PH2 A;  1WI5 A;  3M4O H;  4JOI A;  4APV A;  4QIW E;  3H15 A;  5IE8 A;  5C4X G;  3FKI G;  1QVC A;  1S3O A;  2NZH A;  3HKS A;  4DV4 Q;  1YIT A;  4YWK A;  3AEV A;  2UUC L;  2ANR A;  1NTG A;  1E22 A;  1YEZ A;  1VIH A;  2JEB I;  1N33 L;  1P16 A;  5IWA Q;  3CCM A;  3I55 A;  1VQP A;  2ZTE A;  1QZG A;  2CTK A;  1EQQ A;  1IZ6 A;  3HOZ G;  3F1Z A;  2DGR A;  4X62 Q;  1HZB A;  2OQK A;  5M3F H;  4OWW B;  1Q7Y C;  4LFC L;  4UPA A;  4HJ8 A;  3DLL A;  2JA8 H;  3CC4 A;  3FHW A;  2KCT A;  1HNX Q;  1HZA A;  2B29 A;  3M9B A;  1E7Z A;  3TQY A;  3G71 A;  3CCR A;  1MKH A;  2K5N A;  4GKJ L;  1VQJ A;  3PO3 H;  3I2Z A;  3GDE A;  3NBH B;  3TRZ A;  1YHB A;  4PMW A;  5GAE C;  4A3M H;  5IP7 H;  1TWC H;  4YCW A;  4A93 G;  4JI4 Q;  1K0R A;  4C3H H;  1N9W A;  1Q86 C;  4XIG S;  2LXJ A;  4MZ9 A;  4IPD A;  3WWV A;  3OYY A;  2RF4 A;  2ZJP A;  2VL6 A;  1I50 H;  3BU2 A;  4DR3 L;  4PZ6 A;  2WP8 J;  4GS3 A;  3K8A A;  3T1Y Q;  2AWN A;  4JI7 Q;  4A3L H;  2K52 A;  2UXD Q;  2R92 G;  4LF4 Q;  4AQY L;  5M3F G;  4OX9 Q;  4IOA A;  1VQG A;  4QL5 A;  3TS0 A;  1VQ9 A;  4YCU A;  4JBK A;  1LTL A;  4DAM A;  4JV5 Q;  2OCE A;  1CKM A;  3ICE A;  2ZJR A;  4IFD G;  3VDY A;  4BA2 I;  1UEB A;  1UE5 A;  3RLO A;  2OWO A;  3GO5 A;  3KJP A;  2PQA A;  1XMO Q;  2PI2 A;  4R4Q A;  3ZJY C;  3M7N A;  1A63 A;  1ZTG A;  4DV4 L;  4JVY A;  4DV2 Q;  4DUZ Q;  1HNW L;  1J6Q A;  1G51 A;  2VY3 A;  1V9P A;  1Q82 C;  2UXC Q;  2A19 A;  4OO1 I;  2YQR A;  2GVA A;  1V43 A;  4R1J A;  4A3E H;  4JI6 Q;  4GNX B;  3KDF B;  3GTK H;  4A3G G;  1AE2 A;  2K4K A;  2NN6 G;  5IY0 A;  2QND A;  2JA6 H;  3A0J A;  2FMR A;  4B3T L;  4UP8 A;  1YHA A;  4JI3 Q;  1UE7 A;  2D62 A;  3GTM H;  3L2P A;  2F4V L;  4OWX B;  1E1O A;  3U4V A;  3A5U A;  2MO1 A;  2CPQ A;  2CTF A;  2CKZ B;  2CWA A;  5HY6 A;  4DK6 C;  1NMG A;  1Q81 C;  3I56 A;  5IT9 c;  1VQM A;  1XMQ L;  1QZH A;  1W3S A;  3UDG A;  1A8V A;  2HH2 A;  1BKB A;  2ASB A;  1HR0 W;  2KBN A;  4JBW A;  2ES2 A;  4LWC A;  3T1H Q;  1QUQ A;  2JA7 H;  4DV7 L;  1G29 1;  4LUV A;  1XPU A;  1YJW A;  3PUX A;  3L7Z C;  5M5Y H;  1WCM G;  5FLX c;  4O2D A;  2JJQ A;  2HHH Q;  2QGQ A;  3BJU A;  2GVB A;  2N78 A;  3S1R H;  1S40 A;  1N34 Q;  3JC6 6;  1G6P A;  3UDX A;  4JI5 L;  1YI2 A;  1VQ5 A;  5H1S E;  1SMX A;  5IYD G;  4BBS G;  1VQN A;  4LF9 Q;  1K1G A;  1Z9F A;  2EIF A;  3HOX H;  4PZ8 A;  4QJF A;  1TXY A;  4GLV B;  3UE0 A;  2UXD L;  4GKJ Q;  2Y0S G;  4LUO A;  5JEA J;  1VS0 A;  4DV3 Q;  4A3F H;  2JVZ A;  1MJC A;  2K75 A;  5DLQ E;  2MO0 A;  3RLF A;  1FJG L;  2NVY H;  5C0X I;  4LF6 L;  4KHP L;  2ANN A;  3S15 H;  4X65 L;  2K50 A;  1HJP A;  4X62 L;  2UUB Q;  2IX0 A;  1M1K C;  3K7U C;  1FVI A;  1WOC A;  3T1H L;  1L1O B;  1HZC A;  1DT4 A;  3U58 A;  3HOZ H;  3GTQ H;  1VQA A;  1OXS C;  2DUD A;  4UY8 C;  5LMN W;  4EX5 A;  4LFB Q;  3Q8D A;  2VNU D;  3OTO Q;  1PA6 A;  1N34 L;  1VQI A; 
#chains in the Genus database with same CATH topology
 2VB2 X;  2R7Z B;  5FLX W;  1Y1W G;  2WB1 E;  1PLF A;  1X32 A;  3HKZ E;  4LF8 Q;  1DXM A;  3ULL A;  4NXN L;  2R92 H;  3PO3 B;  2BH8 A;  5GAH C;  2K5H A;  1LLR D;  3IKJ A;  1LO5 D;  5A35 A;  2DJF C;  3CCS A;  2HQL A;  3OWE B;  4ZKB B;  3KF8 B;  1LT3 D;  5M3F B;  3LWU A;  2M6Q A;  5IGE A;  1N36 Q;  1IBM L;  1GKH A;  1DGS A;  3SDZ A;  2BH2 A;  1SMY D;  3J7A F;  3RF2 A;  1A2U A;  3PQI A;  3SE0 A;  2KVM A;  4JCV E;  3K57 A;  3RN2 A;  3GTJ H;  1GUO A;  4BWG B;  2LTL A;  4AYB E;  1KQS A;  1UE1 A;  2K5V A;  2K5Q A;  4YY3 L;  3BDC A;  4KD3 A;  4JI8 Q;  1Q3L A;  1SJE D;  2NBF A;  2J7Z A;  1WTR A;  1RHP A;  1TVX A;  3R2T A;  4R4O A;  3S1Q B;  4DR6 Q;  2EXZ A;  5JJI A;  4MHE A;  2HIX A;  3D6W A;  5E4W C;  4C3I H;  4X64 L;  1J5K A;  4FYD A;  1ZYR D;  5ELC A;  2FFM A;  5G3L F;  1LYL A;  2K03 A;  2PZW A;  1SRU A;  3S2H H;  1X6O A;  1R9T B;  2PNR C;  5K36 G;  3V05 A;  1I6U A;  2BL5 A;  2A74 C;  2MFI A;  3OIQ A;  5C0X J;  1PFB A;  1KNE A;  1I94 H;  4G7H C;  4S3S A;  1WYD A;  3QJY A;  2PT7 G;  1M4V A;  2ATW A;  3GTP H;  4EC5 A;  5JJK A;  4AH6 A;  4DV3 L;  2EJF C;  5EJW A;  1OTC A;  4HJ9 A;  3U9O A;  4DR7 Q;  4H13 C;  4KN7 C;  1CKN A;  4DR5 L;  4I7Z C;  2A1A A;  1EIY B;  4JC0 A;  2F52 A;  1AE3 A;  2DJG C;  3A8K E;  5C3X A;  5LMU Q;  1AN7 A;  5CV4 A;  4JI4 H;  1CI3 M;  4L6T B;  2EE1 A;  4YCV A;  1ZZJ A;  1EY5 A;  1PYB A;  2BE5 C;  3BDL A;  4RHS A;  1D1I A;  5FJ8 H;  4KJO A;  1VQF A;  1TT2 A;  1X9N A;  3W3A A;  1BR9 A;  2UXB Q;  1HTL D;  2ZXR A;  2O5I C;  5IGC A;  1V1O A;  1V1P B;  2KCC A;  1EY7 A;  1B70 B;  4BBS H;  3SK5 A;  2AWO A;  2HQE A;  3I4O A;  1D2B A;  4NPS A;  2FJ2 A;  1JB7 A;  2RHS B;  5KIX A;  3FKI B;  3KBX A;  1LTS D;  4DAY A;  2EDG A;  2F0Q A;  2JE6 I;  2HT1 A;  1S20 A;  3FMC A;  4OON A;  3OMG A;  3H3V I;  1LTI D;  2O2L D;  5LMU H;  3IAY A;  2ZXO A;  4H8A A;  5C3E G;  4FXG C;  3JAM i;  2UXC H;  5FK9 C;  4OD6 A;  2NVX B;  2OXP A;  3T16 A;  1DZ1 A;  4J1M A;  2NTT A;  4HN7 A;  1GUT A;  4Y7N H;  1VQ4 A;  2ZQE A;  4KKS A;  3K0Y A;  3E9H A;  2R61 A;  3AFQ A;  1IBL Q;  2PY9 A;  3CP0 A;  5HGQ A;  2Z4I A;  3E6Z X;  5TSS A;  2Z6K A;  5M5W H;  1VF7 A;  4AYB B;  3K7A H;  1WCM H;  3Q6S A;  3HKZ B;  4XYQ A;  4EQN A;  4B3R L;  3OTO H;  4IJL A;  3HOY B;  2MQH A;  4V0B A;  3H0G G;  4A3D H;  1ET9 A;  2WAQ G;  4DNI A;  3QIA A;  1E2Z A;  1N8R C;  3CMA A;  1VIG A;  5KNB A;  2I0Q A;  3S24 A;  1QNK A;  2R93 H;  2K1H A;  2R7Z G;  4HMJ A;  3D3R A;  5J39 A;  2B3G A;  4IUU A;  2XWB B;  3RZD H;  1BF4 A;  1Y8N B;  2E76 C;  4IPG A;  3SXH A;  1PH5 A;  2M8W A;  1IL8 A;  2Q8I B;  2B2W A;  1I3Q B;  2E8G A;  4C56 C;  3J7Y W;  5ELB A;  2B2Y C;  3BVZ A;  5EPL A;  3M3Y H;  3T1Y L;  4BY1 B;  1YNN C;  1PRT C;  3NQI A;  2E2I B;  3CQZ H;  5C44 H;  1SYE A;  1PH8 A;  2R7D A;  3MHB A;  3Q0A A;  1EY9 A;  4OIJ A;  4B3R Q;  4X66 Q;  2JN4 A;  4B3S H;  3PO2 G;  5M3M B;  1MGS A;  2Z1C A;  1A3T A;  5KEE A;  4IUQ A;  3HOW G;  3S1M B;  4NB3 A;  2EJG C;  4IPC A;  4RA8 A;  3J80 W;  1WHR A;  1QNU A;  1F9P A;  1JE4 A;  4LFA Q;  3K5O A;  2AQ2 B;  4HED A;  2BDO A;  1JJC B;  3HEJ A;  4P72 A;  5BN5 A;  4BXX G;  2HDL A;  5IP9 H;  1EY6 A;  5CR3 A;  3CD6 A;  1VQ8 A;  4NKL A;  4JI0 Q;  1D6E C;  2QDB A;  4GKK L;  1X3Q A;  2E2H H;  3PO2 H;  3FDT A;  2E74 C;  5BR8 L;  3HZX A;  2HCI A;  1N32 Q;  1F2M A;  3BVG A;  1A0I A;  5EBC A;  1M8A A;  3CRK C;  3PUY A;  1S5C D;  4B3T Q;  3HOY G;  2KEC A;  3S16 H;  1SNM A;  1SRO A;  4GOP C;  3D4W A;  1C9O A;  1Q1B A;  2Y0S B;  2Z6B A;  4RKB A;  1SFO H;  4HIO A;  2BCO A;  2R7F A;  4GNX C;  5ELO A;  3K80 C;  2JA9 A;  2B2T C;  1Y14 B;  4KHP Q;  1ODH A;  5C4X H;  1X3E A;  5FLX E;  4J8Q A;  2K1B A;  5DM6 3;  4F88 A;  2C35 B;  1HNZ Q;  4RGN A;  1KAA A;  4CDF C;  2CTL A;  1DYQ A;  5A2Q E;  1QWY A;  4FF2 A;  2VW9 A;  4OHJ A;  2BOS A;  3GTG H;  5A2Q W;  2YU9 B;  2JA8 G;  3CCU A;  2CH4 W;  1XMQ Q;  3F8T A;  1FL0 A;  1YNJ D;  3CC7 A;  3M85 A;  5I4D A;  5LHY 1;  1NE3 A;  4G7Z C;  3MTS A;  1N36 L;  3QG1 A;  1Z6H A;  2HD3 A;  4ME3 A;  2K7V A;  1EZ6 A;  3PUW A;  4UP7 A;  1DTJ A;  2B2U C;  4R8I A;  3N6R A;  1Y69 U;  4DV5 L;  4LIJ A;  3AMU A;  1GXD C;  4UP9 A;  4HIM A;  2L55 A;  3K81 C;  3CCQ A;  1B4O A;  3L3O C;  1D8L A;  2N8N A;  1IYV A;  4JPB W;  2ICE C;  4X64 Q;  3GTO B;  4YY3 Q;  4A3C H;  1O7I A;  1N34 H;  1VMP A;  3MEH A;  1VQH A;  5I6Y A;  4X65 Q;  1UNS A;  4NBQ A;  5D3D A;  4DFA A;  1K3R A;  3ZYY X;  5LL6 S;  4DV0 L;  3J81 i;  4OCH A;  4YHH H;  1L1O A;  1XXG A;  2DY8 A;  2UU9 H;  1A62 A;  5E7N A;  3HOV B;  3LWE A;  1RF2 D;  4BY1 G;  5EKK A;  5EGT A;  4TRD A;  1EIH A;  5JJZ A;  3NQT A;  2J4X A;  4DR7 L;  4LF9 H;  2D0P A;  3ERS X;  3J81 j;  4LF5 Q;  3HOV H;  3Q23 A;  5FLM H;  2LFN A;  1Q1E A;  2A6H C;  1BOS A;  1UEA B;  2EJM A;  4HJ5 A;  1KL9 A;  4CDE C;  4J15 A;  1ZYR C;  2WII B;  3DEP A;  4DV6 L;  2G9D A;  1FKA H;  4LF4 H;  1PH2 A;  1JB3 A;  1WI5 A;  4JOI A;  2M9V A;  4QIW E;  3H0G B;  1QVC A;  1S3O A;  1ICF B;  1TS2 A;  1E22 A;  1YEZ A;  2JEB I;  3I55 A;  1VQP A;  2CH4 A;  2D9U A;  2CW0 C;  2ZTE A;  4I65 A;  2LF0 A;  4RFB A;  4OWW B;  1Q7Y C;  5LL6 X;  4DR7 H;  4E6I A;  3DLL A;  4GKK H;  3FHW A;  2MPM A;  3FPP A;  1E7Z A;  1H9S B;  3TQY A;  3X3M A;  1AZP A;  4GKJ L;  1RCV D;  3NBH B;  1FYC A;  2PMZ B;  2SNM A;  2X6L A;  4YCW A;  5E3F A;  1N9W A;  2LXJ A;  5CBE E;  3BU2 A;  1I50 H;  2WP8 J;  4GS3 A;  2C5C A;  3C46 A;  1SNP A;  2HCC A;  5M3F G;  4OX9 Q;  1Z7T A;  1VQ9 A;  3GTQ B;  2PPB C;  1LTL A;  3HOZ B;  1QE6 A;  4PMB A;  1WTP A;  2N55 A;  4IFD G;  1UEB A;  4DV4 H;  3GTL B;  4F7X A;  1FNU A;  3E0J A;  1A63 A;  3ZJY C;  1K83 B;  2WAQ B;  4DUZ Q;  2A19 A;  3MVV A;  5KRU A;  3I8Z A;  4A3G G;  1KTK A;  2P5Z X;  3A0J A;  1YHA A;  4B08 A;  2D62 A;  1PYW D;  3GTM H;  2F4V L;  1E1O A;  3NWT A;  3U4V A;  2CTF A;  4DK6 C;  3D6C A;  5IGG A;  3I56 A;  2HH2 A;  1BCP F;  1W3S A;  1EYD A;  3NTK A;  1A2T A;  2ES2 A;  3OWF A;  5C4Z A;  4JI2 H;  3MA2 B;  1YJW A;  3L7Z C;  5FLX c;  2HHH Q;  4O2D A;  3N52 A;  4HSV A;  4ZKC B;  3JAM W;  2GVB A;  2N78 A;  3GTM B;  2L0C A;  1JOK A;  1VQ5 A;  2KEE A;  1K1G A;  1SMX A;  1IHZ A;  2KOL A;  1Z9F A;  2UXD L;  3PO2 B;  2Y0S G;  5DT9 A;  2IWH A;  1VS0 A;  4A3F H;  3R93 A;  5DLQ E;  3I0P A;  4LF6 L;  1I6H B;  4OEL B;  1OXS C;  1S5E D;  2DUD A;  2B8F A;  5LMN W;  1VQO A;  1HTP A;  1NSN S;  1I50 B;  2R6G A;  1CFM A;  5CV5 A;  4YHH Q;  4GNX A;  1EEI D;  2IX1 A;  3EJI A;  1K3B C;  1H9S A;  5M3M H;  1GJX A;  1WVN A;  3TME A;  2SEB D;  3FP9 A;  2A8V A;  1ZKO A;  2YTY A;  2IL8 A;  3I4N G;  4CKB A;  3CQZ B;  5BR8 H;  3IFT A;  4BY1 H;  3PUV A;  4GOP B;  4U68 A;  1H9M A;  4DR2 H;  2PZT A;  4P75 A;  4A3F G;  1WD0 A;  1PZK D;  1PMR A;  1DON A;  2GA4 B;  2K28 A;  2JZX A;  4JI7 L;  1EZ8 A;  4LF9 L;  3BS1 A;  4DR4 Q;  2SOB A;  1SYF A;  1SE8 A;  5FJ8 G;  3RZD B;  2F1M A;  3H0G H;  1HFN A;  1VQE A;  1MHW C;  5ELN A;  4DR1 H;  2VQE Q;  4KMU C;  3H09 A;  4TSS A;  3PSI A;  2B2U A;  4KTA A;  4K0K L;  1UG8 A;  4OWT B;  4ZAI A;  3S2D B;  2F0K A;  1V8Q A;  3DXJ C;  3GV6 A;  5C0X H;  3VKE A;  1GM5 A;  1XTD A;  4A4I A;  4JYA H;  3KYH C;  3VYU A;  4LFC H;  2DNC A;  5M5W B;  5EKL A;  5C44 G;  4RGO S;  4DGZ A;  3A7L A;  1XPO A;  4ALP A;  1B2T A;  1TWH B;  2F0T A;  2NUC A;  1AH9 A;  2V4D A;  1HR0 H;  2RDF A;  2JQO A;  1HR0 L;  1VF5 C;  1XJV A;  3WOF A;  1XYI A;  2WV6 D;  3EIV A;  4AQY H;  1MSH A;  4RKL A;  4B9W A;  1JOQ A;  4C2M B;  4PMC A;  1VBI A;  2UXC L;  5JEA G;  1SJH D;  4POF A;  1VQD A;  4RGT A;  2Z0S A;  3UI2 A;  3OSO A;  2IW3 A;  3M4P A;  4LF7 Q;  1WTH A;  3FKI H;  2ZTD A;  4DV0 H;  5FO7 B;  4QGU A;  1PRT F;  3MEF A;  2ALY B;  2QKI C;  4JVZ A;  2WIN B;  1X54 A;  3BZK A;  5EQ0 A;  4JOI C;  1T5E A;  2KEN A;  1U4L A;  4X6A H;  1GO3 E;  1JIC A;  1E0B A;  5CV6 A;  3J80 c;  3CPW A;  3GKU A;  2VB3 X;  2YU9 H;  1L2F A;  3NHH A;  2PO4 A;  3HOU H;  2HH3 A;  1UAP A;  5D14 A;  4WOR A;  3OW7 A;  2E2J H;  2WKD A;  4OXP A;  3GTG B;  2K6A A;  1IBK L;  2SDF A;  5JPN C;  1UWV A;  3A54 A;  3JAM L;  1NJI C;  2EQS A;  4L5S A;  1KDC A;  5DEH A;  1PXU A;  1TWA B;  3MWY W;  2UXD H;  4WFN 3;  4R4C A;  4LF8 L;  1PRT B;  2EY6 A;  1LT6 D;  1D5Z C;  2Y3M A;  5C4X B;  1FJG H;  1I4H A;  4UAI A;  1O80 A;  3MXN A;  3U9S A;  1NY4 A;  1F0X A;  1UUP A;  5FO8 B;  1GVP A;  3HKZ G;  3QOJ A;  1DJR D;  4NXM Q;  1HXY D;  3B6Y A;  1X3F A;  2QEX A;  1EIF A;  1WE8 A;  3IRB A;  1RTO A;  3GTP B;  1ROD A;  4NMZ A;  1IL2 A;  3I4N H;  4H7B A;  2ZM6 H;  1NR4 A;  4A3G H;  4ILW A;  3KDF A;  3T51 B;  1STY A;  4IFD H;  2XNA C;  1KRS A;  2Q2I A;  4B3S L;  1U4P A;  1ZZK A;  1R9T H;  2XVS A;  5CV9 A;  3S2H B;  1G2S A;  3ER0 A;  1F2Z A;  2PI2 E;  1J5E H;  1AW7 A;  1CA6 A;  3NBI A;  4U67 3;  1MSG A;  4QIW B;  4JI1 H;  2XIW A;  1J5E L;  4NZR M;  3PIO A;  3PIO 3;  1BVS A;  3VR3 A;  1B1Z A;  4A3K G;  4MIU A;  4KI0 A;  4BBR B;  2CHB D;  3S1Q H;  4DR5 H;  1X0A A;  4KN4 C;  1PH6 A;  1QVG A;  1F9R A;  1PYS B;  2I07 B;  1EWC A;  2JA5 H;  5ELE A;  4LFB L;  5J3B A;  2F4V H;  1G6Z A;  4WJW A;  3MXP A;  2LRR A;  3GTJ B;  5EAY A;  2A6H D;  1Q8I A;  4L63 B;  2E2I H;  2F0G A;  1W2B A;  1BDO A;  1EY0 A;  4PQX A;  4V19 0;  1TWF H;  3T13 A;  3UE1 A;  3LX0 A;  4K5V A;  1I3Q H;  1V9N A;  1IKM A;  5IYC H;  4F8M A;  5C4H A;  2KHI A;  2L1B A;  4FXK C;  2RVL A;  5K5P A;  2N3S A;  4DR1 Q;  3ULJ A;  3KFU A;  4LJZ C;  1WD1 A;  2RQX A;  2R92 B;  4NXN H;  2CW0 D;  2O4X A;  4A75 A;  4LF4 L;  4JG2 A;  4DV6 H;  3ERO A;  2JP1 A;  3RNU A;  4CKC A;  2HIV A;  3I72 A;  4DR6 H;  4A93 B;  1VQK A;  4R8N A;  4A3D B;  2AUJ D;  3NE5 B;  2R7Z H;  2Y0S E;  2UXB H;  1TQO A;  2ID0 A;  3W2D A;  4C3J H;  1B53 A;  3K7A B;  3VYR A;  2V1C C;  1B7Y B;  1B8A A;  1SE3 A;  3JAM c;  3PUZ A;  3H94 A;  1X4N A;  4DNR B;  4DR4 L;  1TY0 A;  2M00 A;  4KKT A;  3CHB D;  4FO2 A;  3OIP A;  4QUF A;  2C9O A;  4DV2 L;  1XWE A;  3HOX G;  3AEV B;  4HCE A;  3S1R B;  3OOC A;  2UUB L;  3NUC A;  1UE6 A;  5EKI A;  2RHQ B;  1X3P A;  4HR7 B;  4ZCK A;  4CDC C;  3A74 A;  3I3C A;  2VUM H;  3OTO L;  2DGY A;  4AYB G;  1SSO A;  3RLN A;  1PVO A;  1QJO A;  4ME5 A;  1HNX H;  1GUN A;  1Q46 A;  4JI7 H;  1I94 Q;  3CAM A;  4P73 A;  1EYG A;  3RUZ A;  2A69 C;  4CHT B;  5IYB G;  3S14 H;  3EFX D;  2JA6 B;  1EL0 A;  1G8Z D;  2L9H A;  1YJN A;  1KIX A;  1IXR A;  2PQE A;  4DK0 A;  4CJ1 B;  4JW0 A;  5M5X H;  3GP7 A;  4IAL A;  4JYA L;  3E9I A;  1AN8 A;  4GOP A;  2Q2H A;  5JEA H;  4Y52 H;  3TRE A;  4KHV A;  1GD7 A;  4BY7 H;  1X4M A;  1EWI A;  2PQA B;  4DKA C;  1LTR D;  2UUC Q;  2LSS A;  2IY5 B;  4R4T A;  1QCB D;  2B2T A;  4DUZ H;  4IUV A;  5M9O A;  1X65 A;  3JAM E;  4RG1 A;  1OXT A;  1U0L A;  1YVC A;  3KBG A;  5ELF A;  4DV5 Q;  2CCZ A;  4CJ0 B;  3HFZ B;  1WJJ A;  1HQR D;  4RWS C;  1HHV A;  1W6J A;  3VA5 A;  2B2V A;  4L5T A;  1PV4 A;  1JC7 A;  1N32 H;  1QOH A;  1L1O C;  4RCO A;  4ZUJ A;  2QF7 A;  4JI1 L;  2JSO A;  2EXD A;  4XXE A;  3VR5 A;  1BBX C;  1Y1V H;  1NAP A;  1HNW Q;  4J6H A;  4R9W A;  1VDZ A;  4EQO A;  1NBW A;  1HNZ L;  4JYA Q;  2YTX A;  1U4M A;  5IT9 W;  4JI4 L;  3NTI A;  3M4O B;  1JJ2 A;  2Q2U A;  4LFB H;  3DWQ A;  5EBD A;  3D0F A;  2B2V C;  4QUC A;  3L0O A;  2HUG A;  4A3B G;  3CKI B;  3RZO B;  4IUP A;  1SND A;  4DV7 Q;  2BE5 D;  4A3I H;  4K5W A;  3GD7 A;  4DR2 L;  1QUQ B;  2KCM A;  4EVO A;  4C3I B;  1PHJ A;  4A3I B;  1IBM H;  2RSN A;  3PMF A;  4JI0 L;  2PMZ E;  4KKU A;  3CCE A;  1DD2 A;  2JXM B;  1ASY A;  1XNR L;  1TUA A;  4K14 A;  3A5Z B;  3K6O A;  1K73 C;  4RCN A;  4HSP A;  3X3N A;  5BR8 Q;  3M4O H;  2X06 A;  3H15 A;  5C4X G;  4X65 H;  4KHP H;  4B3T H;  1PFN A;  4YWK A;  4UDU C;  3T4A C;  2UUC L;  3NP8 A;  1PTO D;  3MXU A;  1VIH A;  4FNF A;  4K5X A;  1WTX A;  2Q8R E;  1J9O A;  1P16 A;  3CCM A;  1KDB A;  1IZ6 A;  1JWM D;  1EIG A;  3HOZ G;  5DAU A;  1HZB A;  2OQK A;  4I7A A;  2FMM A;  1MD2 D;  5BN3 A;  4HJ8 A;  2H1E A;  5CBA E;  1S03 G;  1SE4 A;  4IUN A;  2UUA H;  4CBV A;  5CV7 A;  3G71 A;  1OO9 B;  1MKH A;  1VQJ A;  3I2Z A;  3GDE A;  2NVT B;  5GAE C;  5IP7 H;  5A2Q L;  5IOD A;  1MI2 A;  1RTN A;  5I2X A;  4XIG S;  4DV1 H;  3WWV A;  2RF4 A;  2ZJP A;  2VL6 A;  3J7A K;  4PZ6 A;  1B3A A;  1O7L A;  2R92 G;  1GUS A;  3EQL C;  4AQY L;  1S4Z A;  4QL5 A;  4B3R H;  2OCE A;  2ZJR A;  5C3E B;  3M7N A;  3GO5 A;  3S15 B;  2PI2 A;  2NVY B;  4R4Q A;  2B2Y A;  4JVY A;  1FR3 A;  1Q82 C;  2YQR A;  2UXC Q;  4OO1 I;  2GVA A;  1JWS D;  3A8I E;  3KDF B;  3GTK H;  1AE2 A;  2NN6 G;  2FMR A;  3RD4 A;  4UP8 A;  1B9M A;  4JI3 Q;  1UE7 A;  3WOE A;  2MO1 A;  2CPQ A;  2CKZ B;  2CWA A;  5M5Y B;  1Q81 C;  5IT9 c;  1VQM A;  1SDF A;  1BKB A;  2FMC A;  2ASB A;  5CGK A;  2EY1 A;  3H3V C;  4LWC A;  2JA7 H;  1QUQ A;  1C48 A;  1SMY C;  4ZRZ A;  1XPU A;  3PUX A;  2QGQ A;  3JC6 6;  1G6P A;  1K8M A;  5C5L A;  1VQN A;  1JOO A;  3ERQ A;  3MFY A;  4PZ8 A;  1HFG A;  5KYI A;  2JVZ A;  1G2T A;  2K75 A;  4N9T A;  5IIF A;  3HP3 A;  3S15 H;  4QMG A;  3TS2 A;  2UUB Q;  4DNT B;  3HRZ C;  3U58 A;  3TSS A;  2UUC H;  1IKL A;  4C3J B;  3QWN A;  4UY8 C;  2K33 A;  3RMH A;  3OTO Q;  1PA6 A;  3I73 A;  1CZG A;  3ONA B;  1JMC A;  1K8A C;  5KNC A;  2KA7 A;  2A5H A;  5GRO A;  1W6K A;  2E2D C;  1TS4 A;  3T53 B;  4Q0F A;  3J7Z C;  1HA6 A;  1ONL A;  5I9P A;  4XT3 B;  3J80 L;  2KUM A;  2NVT H;  4AM3 A;  4KY7 A;  4A3B H;  1RKN A;  1STE A;  1E2W A;  2TMP A;  1PFS A;  3DM3 A;  3BZC A;  4BA1 I;  3ND8 A;  5I9O A;  3HOV G;  2JEA I;  3P1H A;  2MHV A;  2D0O A;  2BA0 A;  4B3S Q;  1IBL L;  1V1Q A;  4GLA C;  1HCZ A;  1Q90 A;  2PZU A;  4KLK A;  1TWF B;  2UUA Q;  2XGT A;  4C1N K;  3W5O A;  4A3K H;  2CWF A;  4DUY H;  3EA6 A;  2WB1 G;  3I91 A;  5HGT A;  1LM0 A;  5COY A;  2YYZ A;  3PIP 3;  1EY4 A;  2JA5 B;  2OQ0 A;  3KF6 A;  5FOB B;  1KAB A;  2K14 A;  3J80 E;  4A3J H;  1WTV A;  2IPK D;  1LTT D;  3NEN A;  4R4I A;  1KC8 C;  1AZQ A;  4JI1 Q;  1JR0 D;  4XTC S;  1XNQ H;  1STH A;  5IYD H;  5ISR A;  3SHL A;  2K01 A;  2MJ8 A;  4UHV A;  2ZTC A;  3I4M G;  1XMO L;  1QVF A;  1N36 H;  4XT1 B;  2A68 C;  4GN4 B;  4JI3 H;  4QY7 A;  1A3U A;  4WAN A;  2XWJ B;  2VQF L;  2EYO A;  1EFI D;  3TP6 A;  1EOV A;  3UDF A;  4B3M L;  4DUY Q;  2NTS A;  1HPC A;  3CRL C;  3DUZ A;  3RR5 A;  5IT9 L;  2FIN B;  3MZ5 A;  4KK7 A;  3PCO B;  3AQQ A;  2OPV A;  1TR5 A;  5FKA C;  3V96 A;  3G48 A;  2B63 H;  4C3H G;  1CHP D;  1EC6 A;  1EEF D;  3QO2 A;  2E5L Q;  4OO1 H;  2L4N A;  4BBR G;  1ENF A;  3MAQ A;  3I4L A;  5C3W A;  2HHH H;  1Y1W H;  2F0S A;  3J81 W;  4GKJ H;  4LFA L;  1CSP A;  2JK8 A;  5GAD C;  3J81 L;  4RHR A;  5IWA L;  1TWA H;  4IUR A;  1NCV A;  2VQE H;  2VUM G;  1STB A;  3S17 H;  2CTE A;  2NWG A;  3I70 A;  4FF4 A;  2JA5 G;  1CTM A;  3F2U A;  2E2J B;  1J4W A;  3GQB A;  3TBI B;  5C4J B;  3A7A B;  2PNH A;  1RL2 A;  2YV5 A;  4HTH A;  3HOU B;  3DWA A;  4WRD A;  3PO3 G;  1SAP A;  1WTJ A;  4JI6 L;  2WAC A;  4OEM B;  3SK4 A;  1ZXT A;  1EQT A;  1JE5 A;  3S1N H;  3OPO A;  4FJU A;  3CF5 A;  4P2C B;  4QQB X;  4H0L C;  3TP8 A;  3S14 B;  1VQ7 A;  3TN2 A;  3H91 A;  3O13 A;  4IFD J;  3SB1 A;  4DR3 Q;  3P20 A;  3I90 A;  5CC4 A;  4BXX H;  1CKN B;  1PTO C;  3FPU B;  4K6L A;  5LL6 b;  2VZA A;  1VQC A;  2B8G A;  4GN5 A;  3EVQ A;  2VUM B;  4HMI A;  5BN4 A;  1HRJ A;  4N9P A;  1QG7 A;  1YNN D;  3NSW A;  2AQ1 B;  2XRQ D;  2YTV A;  4FVM A;  1DCZ A;  2KQ3 A;  5J1Z A;  1IBM Q;  5FO9 B;  2RBM A;  5JVG 3;  4L8J A;  2F0J A;  1SYD A;  2QIL A;  4K0K Q;  2FHT A;  2K05 A;  4JI8 L;  2X6G A;  2E5L L;  4X3K A;  4KJN A;  1HNX L;  3VR6 A;  2LXK A;  3C2P A;  3SK6 A;  4EQP A;  4A93 H;  1L0W A;  2VKC A;  3KLS X;  1JT8 A;  1BXT A;  2VXW A;  3GV3 A;  3OHX C;  1ESF A;  3NEL A;  4JBJ A;  1H95 A;  2J0T D;  3VR2 A;  4KHZ A;  3ND9 A;  4IO9 A;  1LUZ A;  1KRT A;  4AQY Q;  3STB D;  3HOW B;  1XX8 A;  2DN8 A;  2F0P A;  4IQZ A;  3VYS A;  2AKW B;  1VQB A;  1HA5 A;  4LF7 L;  2A6E C;  4KD4 A;  4A3E G;  3LGJ A;  2E75 C;  2O5J C;  3KUP A;  1OXX K;  2F0E A;  4Z9C B;  1O78 A;  1PH4 A;  3CCL A;  5D65 A;  4DR6 L;  4YY3 H;  2F0W A;  1KDA A;  4DPG A;  2KHJ A;  1EUJ A;  4CDD C;  4HCS A;  1TU2 B;  3C3L A;  4K8I A;  5LMN H;  4BBR H;  5AJ3 L;  5LMU L;  1BO0 A;  4DN4 M;  2NVQ H;  1TS3 A;  2WAQ E;  1I6H H;  2X69 A;  2IHF A;  4IUT A;  2GN5 A;  3TP7 A;  2UUA L;  3BYT B;  4A3F B;  4LMQ D;  1XMO H;  5J22 A;  1II3 A;  2EOT A;  2KJX A;  1ET6 A;  4A3G B;  3HOU G;  1K8O A;  1CM9 A;  4NDX A;  1KHM A;  3I4N B;  4POG A;  3I4M B;  1R4Q B;  4IZ8 A;  1PTO B;  5FLM G;  3MFG A;  2OT2 A;  4TKO B;  4DR3 H;  5KYL A;  3F2C A;  4FP5 D;  4KY6 A;  4A3J G;  4LF7 H;  2F0V A;  1J5E Q;  2Q2T A;  3H3V H;  4XYO A;  4WJ3 M;  1GUG A;  3NBH A;  3AYH B;  4LF6 Q;  1IYU A;  4GLX A;  1JCK B;  1CSQ A;  1PH9 A;  4OX9 L;  4FDB A;  3RN5 A;  1Y8O B;  1SBB B;  2KCN A;  5JAV A;  1K83 H;  1SYG A;  2H4O A;  1CZW A;  3GTL H;  1BCP C;  2DY7 A;  4LW1 A;  4OGQ C;  4RGM A;  3J81 c;  4JV5 H;  1PTO F;  1SYC A;  2JA7 G;  4AIM A;  1CK1 A;  3OW2 A;  1HZ9 A;  1ILQ A;  1X56 A;  1CKO A;  2AUK A;  4DUZ L;  4OL7 A;  1Q8K A;  2MNA A;  1K0S A;  1TWC B;  4A3M B;  4DV2 H;  2EY5 A;  2BA1 A;  4B9X A;  1OXU A;  3BDO A;  3QB3 A;  4MN3 A;  3KF6 B;  3AFP A;  1WTW A;  1YZ6 A;  3M7G A;  2OEO A;  1N32 L;  4MTK A;  5LMN L;  4C2M H;  1N33 H;  4C3I G;  4IOC A;  1PZI D;  2H5X A;  3OET A;  5IGB A;  2MUY A;  2F03 A;  4M8A A;  2F0H A;  1XPR A;  2IHE A;  4YWL A;  1HUN A;  5K36 H;  5JVH 3;  4N8X 1;  1TWH H;  1O7Y A;  1YNX A;  4BS9 A;  3NXW A;  1RIP A;  2UUB H;  1SLJ A;  2A6E D;  1FNV A;  4HIK A;  4DV1 L;  1FGU A;  1ILP A;  1NNX A;  2HDM A;  4JI8 H;  4PDB A;  2ZM6 Q;  4KY5 A;  5T1I A;  3K58 A;  2IJ0 A;  2VQF Q;  2XRS D;  1YHQ A;  2WB1 B;  5D3I B;  3K5N A;  4L5R C;  3U1K A;  1AEX A;  3S2D H;  2QCP X;  1TWG B;  1YBY A;  4JI6 H;  2MGS A;  1SR3 A;  4G08 A;  4ZYS A;  4PZ7 A;  2L5T A;  4APV A;  5G3L D;  4QB4 A;  2NZH A;  3AU7 A;  3HKS A;  1YIT A;  1N33 L;  5KND A;  5IWA Q;  3OSS D;  2ZXP A;  4K8J A;  1SE2 A;  4XQN A;  2WKC A;  4LFC L;  1BUV T;  2JA8 H;  5T1G A;  1I4X A;  1K28 A;  1HNX Q;  4DR4 H;  3CCR A;  5CV8 A;  1VMC A;  3TRZ A;  4JI5 H;  2O4C A;  4PMW A;  4A3M H;  1TWC H;  1CQF A;  2AQ3 B;  1O7Z A;  4XQQ A;  1Q86 C;  3DHQ A;  4MZ9 A;  4IPD A;  2DNE A;  4DR3 L;  5COR A;  2F0U A;  3K8A A;  4A3L H;  2K52 A;  3HG9 A;  1VQG A;  3TS0 A;  4JBK A;  2A68 D;  4YCU A;  2L12 A;  4DAM A;  3ICE A;  4LK1 C;  2LTM A;  1GOZ A;  4BA2 I;  2OWO A;  3KJP A;  2G9H D;  1HNZ H;  4GZY C;  1ZTG A;  1C4Q A;  3GAB A;  1XNR H;  1HNW L;  1J6Q A;  1G51 A;  2VY3 A;  1LAC A;  3Q22 A;  1B3Q A;  4GNX B;  3VR4 A;  2QND A;  2K4K A;  3CU7 A;  5IY0 A;  3HOX B;  3R2I A;  1EU3 A;  3ITP A;  4B3T L;  5E4X A;  1STN A;  3L2P A;  1H9K A;  4OWX B;  4YIJ A;  2RKS A;  2F0M A;  4X64 H;  1QZH A;  3UDG A;  1A8V A;  4ZLT F;  2FPH X;  2F0L A;  3NWS A;  4JBW A;  1G91 A;  1I6V C;  3V2T A;  3S16 B;  4DV7 L;  1F2L A;  4K6D A;  1G29 1;  4LUV A;  5ELD A;  1WCM G;  4XDX A;  4DV7 H;  2JJQ A;  3DWP A;  3BJU A;  2NN6 H;  1ICW A;  2PW5 A;  3UDX A;  1YI2 A;  4X3U A;  1KNA A;  3HOX H;  1XTC D;  1GHK A;  3UE0 A;  5DNF A;  4GKJ Q;  4LUO A;  5JEA J;  4EGV A;  4DV3 Q;  2MO0 A;  2OF1 A;  1FJG L;  2IX3 A;  5C0X I;  4KHP L;  1EWH A;  2ANN A;  4X65 L;  2K50 A;  2IX0 A;  1M1K C;  1WOC A;  5I6W A;  1L1O B;  4O1N A;  2NVQ B;  1DT4 A;  3HOZ H;  3GTQ H;  1VQA A;  2CVR A;  4ID6 A;  1QB5 D;  2VNU D;  4LFB Q;  3Q8D A;  4X3S A;  3S1M H;  1DOK A;  3EZJ A;  1TY2 A;  1ENC A;  3K59 A;  2EY2 A;  2NZO A;  3BVM A;  4OIK A;  3G4S A;  4NXM L;  2KED A;  2Z8L A;  1JOR A;  3K0X A;  1YIJ A;  3E3X A;  3CPF A;  1CT1 D;  1U5K A;  5C44 B;  4WAL A;  3C1E A;  2EZV A;  1S72 A;  3KDK A;  5IGD A;  2JA8 B;  1GUW A;  5EPK A;  3SK8 A;  4NXN Q;  4BY7 G;  4P74 A;  2A73 B;  4X62 H;  4ABN A;  5IT9 E;  1LT5 D;  5CMD A;  5M3M G;  3HS0 C;  2XTI A;  3PGZ A;  2N88 A;  4E9J A;  1AP0 A;  5IP9 G;  4A76 A;  3STB C;  4ULL A;  3TZD A;  2NZ1 D;  4TVA B;  1KLU D;  4H44 C;  4NW2 A;  5GQO A;  2WFW A;  4DR1 L;  1J8I A;  1WFQ A;  4X66 H;  2JA6 G;  2N49 A;  5IYC G;  1TWG H;  3D31 A;  1Z2I A;  1A15 A;  5CYU A;  4KV6 A;  3U50 C;  1BNZ A;  1BBW A;  2CFM A;  4RAU C;  3KDG A;  1WCM B;  1D1K A;  1K8G A;  1R4P B;  2ZJQ A;  1Y1V G;  3J80 i;  2NN6 I;  5JOB A;  2EYF A;  4QCL A;  3E0E A;  3LNN A;  2KHS A;  4B3M Q;  4EQ5 A;  1KAW A;  1HH2 P;  1T9H A;  4IPH A;  2QEJ C;  4PV1 C;  3SR1 A;  4IFD I;  1FGB D;  2G8Y A;  1T5X D;  4YWM A;  1D7Q A;  2I5M X;  4A3L G;  4LF5 H;  2G5D A;  1EFW A;  1E1T A;  3KJO A;  4DXF A;  2A1S A;  1CHQ D;  1PH7 A;  3H6M A;  4DV6 Q;  2QW7 A;  2OTL A;  1YJ9 A;  3GTO H;  3J7A V;  1MJE A;  4WJ4 A;  1RJT A;  3M4Y A;  2CQA A;  2F3V A;  2HHH L;  2M2L A;  1VQL A;  1LTA D;  5EPJ A;  1E24 A;  1I4Q A;  4X66 L;  1KLG D;  2PQU A;  4NXM H;  1KHI A;  4M1U B;  3TZU A;  3FRP B;  3TP5 A;  4A3C G;  1S5D D;  4BBS B;  3QOL A;  2QA4 A;  3F2B A;  3WDN A;  1PDQ A;  2F0N A;  4QF4 A;  4DF7 A;  4HID A;  5LMN Q;  4JI5 Q;  1SNQ A;  2CPM A;  3Q24 A;  2NYZ D;  4XQJ A;  3SGI A;  4JI0 H;  2TSS A;  3CCJ A;  1WTQ A;  4LFC Q;  3URY A;  4DUY L;  5AFW A;  4OO1 G;  1X3G A;  1STG A;  2PW7 A;  2F4V Q;  1I5F A;  1SYB A;  3VYT A;  4LNQ A;  5JJL A;  1F9S A;  3T56 B;  4LFA H;  2I5H A;  1F2Y A;  3BZD B;  2F0D A;  4YHH L;  4PG3 A;  1SFO B;  3SEB A;  3W1G A;  3FEW X;  4JV5 L;  1PTO H;  3HGB A;  3I4M H;  2MP1 A;  4L5Q A;  1EOT A;  1IW7 C;  2I5L X;  1BBU A;  4F87 A;  1VCI A;  2D9I A;  1S5F D;  3D4R A;  3I7F A;  3ULP A;  1VQ6 A;  1LT4 D;  1SEB D;  1CA5 A;  2E3U A;  2PYK A;  2E2H B;  2VQE L;  4NZT M;  2LMC B;  1PH3 A;  3PF5 A;  3S9W A;  1IYJ B;  4B8C D;  1PZJ D;  3KOJ A;  3AB9 A;  3BG3 A;  4JK1 C;  4MTN A;  4G57 A;  5IGF A;  4DV5 H;  1SN8 A;  3M4Q A;  2R93 G;  1L0X B;  4K2L A;  2F3W A;  2RDG A;  3K5M A;  3J81 E;  3DEO A;  3EN2 A;  2ICI A;  4LUZ A;  1OXV A;  1TS5 A;  3R8B A;  3CC2 A;  1IBK Q;  3J7A 5;  3CCV A;  2MJH A;  1FNW A;  1N33 Q;  3E5S A;  4O42 A;  2LS0 1;  1X55 A;  1MSZ A;  3MC0 B;  1A3V A;  1RDP D;  3MXN B;  3UOE A;  2OTJ A;  1CUK A;  2Z6K C;  1GHJ A;  2OPU A;  5HUR A;  3M3Y B;  4G7O C;  1FJG Q;  2F3I A;  1I4G A;  3F2D A;  1P8L A;  2ZT9 C;  5IP7 G;  3HOW H;  5C5M A;  1BQQ T;  2D5D A;  2EPB A;  1XNQ L;  4DV1 Q;  4TQU S;  5C0X G;  2CTM A;  4ODG A;  1EQR A;  4G4K A;  2ZM6 L;  2F0O A;  2NB0 A;  3CME A;  1K9M C;  3TEH B;  1PQX A;  2R93 B;  4A3B B;  2BDN A;  2A69 D;  2RCN A;  4DR2 Q;  1NMF A;  1Z47 A;  5F2D A;  3GR5 A;  3NCV A;  4DV0 Q;  1JJG A;  2CQO A;  2B39 A;  1DM0 B;  4JBM A;  3KF8 A;  2AXY A;  4QMF B;  4IN3 A;  1NUC A;  2UU9 Q;  1BCP D;  3A8J E;  3NEM A;  1XNQ Q;  1I4P A;  3HOY H;  2XSC A;  2CWP A;  1MIU A;  1SNC A;  4LAA A;  3G6J B;  1ML0 D;  2CTJ A;  1KXL A;  2CWH A;  2EYM A;  1LV9 A;  1PH1 A;  3VA7 A;  1M90 C;  2VS1 A;  4IJH A;  1ZEQ X;  1B9N A;  1EU4 A;  4ZK9 B;  5JPM C;  4A3M G;  1HR0 Q;  2L15 A;  4N8F A;  1AFP A;  1EQV A;  4A3I G;  1U9R A;  4GKK Q;  3MXG A;  3SVM A;  4Y7N B;  2UU9 L;  2FXQ A;  5IYB H;  3V69 A;  1HQM C;  2RSO A;  2RA4 A;  1XMQ H;  2JYO A;  5FLX L;  2NVX H;  4LF5 L;  2JA7 B;  4RH6 A;  4DA2 A;  1SNO A;  1ESR A;  2E5L H;  1D5M C;  1B50 A;  4P71 A;  3NPP A;  1MBY A;  3PF4 A;  3T1Y H;  5I2Y A;  3P75 A;  3CW2 C;  3G7L A;  1ASZ A;  2SNS A;  3GTK B;  3P7J A;  1C7Y A;  1LAB A;  4FF1 A;  5IWA H;  1FD7 D;  2B63 G;  1IW7 D;  2D2C C;  4DK3 C;  4X3T A;  3S1N B;  3EBE A;  5C3E H;  5E1F A;  1E2V A;  2P2R A;  4HJ7 A;  3CXC A;  3KLS A;  4DR5 Q;  5C4J H;  2AHO B;  3PIP A;  4FXD A;  1ZZI A;  1XNR Q;  4HJA A;  3DM1 A;  1E3P A;  3S17 B;  4CGY B;  4C3H B;  2K5D A;  4MNO A;  2EYJ A;  4FJS A;  2IT1 A;  3D8G A;  4OX9 H;  2VQF H;  1Y1W B;  3KLW A;  3K5L A;  4O0A A;  4FF3 A;  2LKV A;  2K32 A;  3QD7 X;  3BYY B;  4H02 A;  3G6E A;  2UXB L;  2B63 B;  2F4I A;  4DV3 H;  1SXT A;  2LY7 A;  4C1N I;  1V1P A;  2AMC B;  3TDQ A;  5AJ3 Q;  4RMF A;  2L11 A;  1C0A A;  4JVH A;  1SEI A;  1TKW B;  4JI2 Q;  4A3D G;  1Y8P B;  2I46 A;  3U4Z A;  3L9A X;  3IFD A;  1KD1 C;  1D5X C;  3PV0 A;  1LTB D;  2EVB A;  2EYP A;  4DAY B;  5C6A A;  2RDH A;  2XN9 C;  1PRT D;  4DXG A;  4B3M H;  1L0Y B;  5IOC A;  1QIL A;  3A56 A;  3W1B A;  5GAG C;  3OMC A;  3C1F A;  3UDI A;  4JI2 L;  1IBL H;  1CQV A;  3FAU A;  1TII D;  4DK1 A;  4A3J B;  3RZO H;  1IBK H;  2RCF A;  1WVL A;  3KLR A;  2EYH A;  4GN3 B;  1PFM A;  1H9R A;  1Q12 A;  4JI3 L;  3QR8 A;  3NTH A;  5IE8 A;  1U4R A;  2Z9H A;  3FKI G;  4LF6 H;  2K5W A;  4DV4 Q;  4A3K B;  3AEV A;  2ANR A;  1NTG A;  3T1H H;  3D4D A;  1Y1V B;  1NR2 A;  1QZG A;  2CTK A;  1EQQ A;  3F1Z A;  2DGR A;  4X62 Q;  5M3F H;  4UPA A;  2Z4H A;  3CC4 A;  2KCT A;  4DAP A;  1HZA A;  2B29 A;  1JQY D;  3M9B A;  4C3J G;  5KGU A;  2K5N A;  3PO3 H;  4CKE A;  1HUM A;  1YHB A;  2R3Z A;  4DU9 A;  3A55 A;  1DOL A;  4NP5 A;  4A93 G;  4JI4 Q;  1B44 D;  1K0R A;  4ZUI A;  4C3H H;  1DOM A;  3OYY A;  1I94 L;  3T1Y Q;  1LTG D;  4JI7 Q;  1BCP B;  2AWN A;  2UXD Q;  2QDL A;  4LF4 Q;  1JWU D;  1H9J A;  4BY7 B;  4IOA A;  4JV5 Q;  5NUC A;  1CKM A;  3VDY A;  1UE5 A;  3RLO A;  1XMO Q;  2PQA A;  5L37 A;  5M5X B;  1F9Q A;  4DV4 L;  4DV2 Q;  1I4R A;  1V9P A;  4LF8 H;  1V8C A;  4B8T A;  4JI6 Q;  1V43 A;  4R1J A;  4A3E H;  2F0F A;  5DM7 3;  1HNW H;  2JA6 H;  1F77 A;  3DMU A;  3A5U A;  4ZQ3 A;  5HY6 A;  1NMG A;  1XMQ L;  4CJ2 C;  2Q8T A;  1HR0 W;  2KBN A;  2PCF B;  3KK7 A;  2ENB A;  3T1H Q;  1S5B D;  3R3O A;  4HAE A;  4K2K A;  1NXU A;  1C8C A;  1RD9 D;  4PNY A;  2EYL A;  5M5Y H;  1WTO A;  3S1R H;  1S40 A;  1EYA A;  1N34 Q;  4BBS G;  1ENA A;  1EY8 A;  2K04 A;  3FVQ A;  3IL8 A;  4JI5 L;  5H1S E;  5IYD G;  4LF9 Q;  1A6X A;  2EIF A;  4QJF A;  1TXY A;  4GLV B;  4A3E B;  1EYC A;  1MJC A;  3RLF A;  2NVY H;  4DAV A;  1XRH A;  1STA A;  1HJP A;  4X62 L;  1YNJ C;  2B2W C;  3K7U C;  1FVI A;  3NK9 A;  3T1H L;  1X9Z A;  4K0K H;  1HZC A;  2F0I A;  4EX5 A;  4Q5V A;  2FFK B;  1N34 L;  1VQI A; 
#chains in the Genus database with same CATH homology
 1JMC A;  1K8A C;  3S1M H;  2R6G A;  1Y1W G;  2WB1 E;  4YHH Q;  4GNX A;  5GRO A;  2IX1 A;  2NZO A;  5M3M H;  3G4S A;  4NXM L;  1WVN A;  3FP9 A;  3J7Z C;  2A8V A;  2YTY A;  3HKZ E;  4LF8 Q;  3I4N G;  3K0X A;  1YIJ A;  3ULL A;  3CPF A;  1U5K A;  4NXN L;  2NVT H;  2R92 H;  2BH8 A;  5GAH C;  4A3B H;  2K5H A;  4WAL A;  4BY1 H;  1PFS A;  3DM3 A;  3BZC A;  3PUV A;  2HQL A;  4BA1 I;  3CCS A;  4GOP B;  1S72 A;  3KF8 B;  4NXN Q;  3HOV G;  4BY7 G;  2JEA I;  4P74 A;  2D0O A;  4P75 A;  2BA0 A;  4B3S Q;  4A3F G;  1N36 Q;  1IBL L;  1GKH A;  1V1Q A;  1DGS A;  4GLA C;  1IBM L;  2JZX A;  4KLK A;  5M3M G;  4JI7 L;  4LF9 L;  2BH2 A;  2UUA Q;  2XGT A;  4DR4 Q;  4A3K H;  3W5O A;  1SE8 A;  5FJ8 G;  2WB1 G;  2XTI A;  3H0G H;  3PGZ A;  4JCV E;  1VQE A;  3GTJ H;  3RN2 A;  5IP9 G;  1LM0 A;  4A76 A;  3STB C;  5ELN A;  2YYZ A;  4TVA B;  4AYB E;  2VQE Q;  1KQS A;  1UE1 A;  2K5V A;  5GQO A;  2OQ0 A;  4YY3 L;  3KF6 A;  2WFW A;  4DR1 L;  3PSI A;  1WFQ A;  4JI8 Q;  2JA6 G;  2N49 A;  5IYC G;  2K14 A;  4K0K L;  1TWG H;  4OWT B;  4A3J H;  3D31 A;  4R4O A;  3VKE A;  1GM5 A;  4DR6 Q;  1XTD A;  4A4I A;  3NEN A;  5JJI A;  4R4I A;  2HIX A;  3U50 C;  4C3I H;  3KYH C;  4X64 L;  1KC8 C;  1J5K A;  1BBW A;  4JI1 Q;  2CFM A;  4XTC S;  5IYD H;  1K8G A;  2ZJQ A;  1Y1V G;  3J80 i;  2NN6 I;  1LYL A;  5C44 G;  3E0E A;  1SRU A;  2ZTC A;  1XPO A;  3I4M G;  3S2H H;  1X6O A;  1XMO L;  4ALP A;  4B3M Q;  1QVF A;  4EQ5 A;  5K36 G;  1KAW A;  1HH2 P;  1T9H A;  4GN4 B;  4IPH A;  4QY7 A;  4WAN A;  1AH9 A;  2VQF L;  4IFD I;  2MFI A;  2BL5 A;  1EOV A;  3UDF A;  5C0X J;  4B3M L;  4DUY Q;  2JQO A;  1HR0 L;  4YWM A;  1D7Q A;  1WYD A;  3RR5 A;  1XJV A;  2I5M X;  4A3L G;  1EFW A;  1E1T A;  3EIV A;  3PCO B;  3AQQ A;  3KJO A;  2ATW A;  2OPV A;  3GTP H;  5JJK A;  4AH6 A;  4DV3 L;  3G48 A;  1PH7 A;  4DV6 Q;  2OTL A;  2B63 H;  1YJ9 A;  1OTC A;  4HJ9 A;  1EC6 A;  3GTO H;  4DR7 Q;  4DR5 L;  2UXC L;  1CKN A;  5JEA G;  2A1A A;  1EIY B;  4POF A;  1MJE A;  4JC0 A;  4WJ4 A;  2E5L Q;  2F52 A;  1VQD A;  2Z0S A;  1AE3 A;  4BBR G;  3M4P A;  4LF7 Q;  2HHH L;  3FKI H;  1VQL A;  2ZTD A;  1Y1W H;  1E24 A;  4QGU A;  5LMU Q;  4LFA L;  1CSP A;  2JK8 A;  5GAD C;  4X66 L;  3MEF A;  5IWA L;  1TWA H;  2ALY B;  2PQU A;  1KHI A;  1X54 A;  3BZK A;  2VUM G;  4JOI C;  2KEN A;  3S17 H;  4A3C G;  4X6A H;  4YCV A;  1ZZJ A;  2CTE A;  1PYB A;  2JA5 G;  2QA4 A;  1GO3 E;  3F2B A;  1J4W A;  3J80 c;  5FJ8 H;  3CPW A;  2PNH A;  1L2F A;  2YU9 H;  3HOU H;  1VQF A;  1RL2 A;  1X9N A;  2HH3 A;  2YV5 A;  4HID A;  5LMN Q;  4JI5 Q;  2UXB Q;  3PO3 G;  2E2J H;  4OXP A;  3SGI A;  4JI6 L;  1IBK L;  1UWV A;  1B70 B;  3CCJ A;  1JE5 A;  4LFC Q;  3S1N H;  4DUY L;  1VQO A;  4BBS H;  1NJI C;  1X3G A;  2EQS A;  1I94 L;  4L5S A;  4OO1 G;  3CF5 A;  2AWO A;  2F4V Q;  1I5F A;  4QQB X;  3I4O A;  4LNQ A;  4R4C A;  4NPS A;  4LF8 L;  1JB7 A;  5JJL A;  2RHS B;  1VQ7 A;  2I5H A;  4IFD J;  2HT1 A;  2JE6 I;  4OON A;  3H3V I;  4DR3 Q;  1NY4 A;  4YHH L;  4PG3 A;  4BXX H;  1CKN B;  1GVP A;  2VZA A;  1VQC A;  3HKZ G;  3W1G A;  5C3E G;  4GN5 A;  3JAM i;  4NXM Q;  3B6Y A;  4JV5 L;  1X3F A;  2QEX A;  1EIF A;  1WE8 A;  3IRB A;  3I4M H;  1IL2 A;  4L5Q A;  3I4N H;  2I5L X;  1BBU A;  1VCI A;  4Y7N H;  4A3G H;  3KDF A;  1VQ4 A;  2YTV A;  3I7F A;  3ULP A;  1VQ6 A;  3E9H A;  2E3U A;  3AFQ A;  1IBM Q;  1IBL Q;  2VQE L;  1KRS A;  2Q2I A;  4B3S L;  1PH3 A;  3PF5 A;  3CP0 A;  5HGQ A;  1R9T H;  1IYJ B;  1ZZK A;  3KOJ A;  2PY9 A;  4K0K Q;  3ER0 A;  2PI2 E;  4JI8 L;  4MTN A;  2Z6K A;  5M5W H;  1SN8 A;  3M4Q A;  2E5L L;  3K7A H;  1J5E L;  1WCM H;  4B3R L;  3PIO A;  2R93 G;  1BVS A;  4IJL A;  2MQH A;  4A3K G;  4KI0 A;  3S1Q H;  1HNX L;  3H0G G;  2LXK A;  4A3D H;  3EN2 A;  1PH6 A;  4A93 H;  1L0W A;  1QVG A;  4LUZ A;  1OXV A;  2WAQ G;  4DNI A;  3CC2 A;  1IBK Q;  3J7A 5;  1JT8 A;  3CCV A;  1PYS B;  2MJH A;  1N33 Q;  1N8R C;  2JA5 H;  1X55 A;  3CMA A;  5J3B A;  4LFB L;  1VIG A;  2I0Q A;  3S24 A;  3MXN B;  3NEL A;  2R93 H;  5EAY A;  2E2I H;  4JBJ A;  2OTJ A;  2R7Z G;  1CUK A;  2Z6K C;  1H95 A;  2OPU A;  2B3G A;  3RZD H;  1W2B A;  4KHZ A;  1FJG Q;  2F3I A;  4IPG A;  3F2D A;  1P8L A;  1PH5 A;  1TWF H;  5IP7 G;  4IO9 A;  3HOW H;  1LUZ A;  3UE1 A;  1KRT A;  4AQY Q;  3STB D;  1I3Q H;  2E8G A;  5IYC H;  2KHI A;  1XNQ L;  4DV1 Q;  4TQU S;  5C0X G;  2CTM A;  1EQR A;  2AKW B;  1VQB A;  2ZM6 L;  3CME A;  3M3Y H;  3T1Y L;  1K9M C;  4LF7 L;  2N3S A;  3TEH B;  4A3E G;  3LGJ A;  3ULJ A;  4DR1 Q;  3CQZ H;  3KFU A;  5C44 H;  1OXX K;  1PH8 A;  2R7D A;  2RCN A;  1NMF A;  1Z47 A;  4DR2 Q;  4A75 A;  4LF4 L;  4B3R Q;  4X66 Q;  4JG2 A;  4DV0 Q;  1PH4 A;  3CCL A;  3PO2 G;  4DR6 L;  1JJG A;  2CQO A;  3RNU A;  2HIV A;  4DPG A;  2KHJ A;  4JBM A;  1EUJ A;  1VQK A;  2AXY A;  3HOW G;  4QMF B;  2R7Z H;  4NB3 A;  2Y0S E;  4IPC A;  2UU9 Q;  4BBR H;  5AJ3 L;  2ID0 A;  3NEM A;  1XNQ Q;  4LFA Q;  5LMU L;  3HOY H;  4C3J H;  1JJC B;  2CWP A;  1MIU A;  2NVQ H;  2WAQ E;  2V1C C;  1B7Y B;  1B8A A;  4P72 A;  4BXX G;  3JAM c;  1I6H H;  2IHF A;  3PUZ A;  2CTJ A;  5IP9 H;  3CD6 A;  2GN5 A;  1KXL A;  1VQ8 A;  2UUA L;  4JI0 Q;  4DR4 L;  1X4N A;  4GKK L;  1PH1 A;  1M90 C;  2VS1 A;  4IJH A;  1HR0 Q;  4A3M G;  2E2H H;  2L15 A;  3PO2 H;  5BR8 L;  4A3I G;  4GKK Q;  4DV2 L;  3HOX G;  1N32 Q;  3AEV B;  3HOU G;  1A0I A;  2UU9 L;  2FXQ A;  5IYB H;  2UUB L;  3V69 A;  1KHM A;  3PUY A;  1UE6 A;  4POG A;  2RHQ B;  4B3T Q;  3HOY G;  2NVX H;  3A74 A;  4LF5 L;  5FLM G;  3S16 H;  2VUM H;  1SRO A;  2DGY A;  4AYB G;  3OTO L;  3RLN A;  3F2C A;  4GOP C;  1PVO A;  1C9O A;  1Q1B A;  4A3J G;  4P71 A;  1SFO H;  4HIO A;  1J5E Q;  2Q2T A;  3H3V H;  2R7F A;  4GNX C;  3PF4 A;  5ELO A;  1Q46 A;  3K80 C;  4WJ3 M;  4AM3 A;  1I94 Q;  2JA9 A;  3AYH B;  3CAM A;  1Y14 B;  3CW2 C;  4P73 A;  1EYG A;  4GLX A;  5C4X H;  1ASZ A;  4LF6 Q;  1X3E A;  4KHP Q;  4B8T A;  1CSQ A;  5IYB G;  3S14 H;  1PH9 A;  4OX9 L;  4FDB A;  3RN5 A;  1C7Y A;  1YJN A;  1KIX A;  1IXR A;  2C35 B;  1HNZ Q;  2B63 G;  4DK3 C;  2CTL A;  1K83 H;  5M5X H;  4JYA L;  3E9I A;  3EBE A;  5C3E H;  3GTL H;  3GTG H;  4LW1 A;  2VW9 A;  3J81 c;  4GOP A;  2Q2H A;  2P2R A;  2JA7 G;  4HJ7 A;  4AIM A;  3CXC A;  4Y52 H;  3TRE A;  1GD7 A;  3OW2 A;  4BY7 H;  4DR5 Q;  1X4M A;  1EWI A;  2PQA B;  4DKA C;  5C4J H;  2JA8 G;  2AHO B;  1HZ9 A;  1X56 A;  2LSS A;  3PIP A;  3CCU A;  2UUC Q;  2IY5 B;  1ZZI A;  4R4T A;  1CKO A;  1XNR Q;  4HJA A;  1XMQ Q;  3F8T A;  4DUZ L;  1FL0 A;  1Q8K A;  3CC7 A;  1E3P A;  1X65 A;  3M85 A;  4RG1 A;  1OXT A;  1U0L A;  1YVC A;  2MNA A;  1NE3 A;  4DV5 Q;  1N36 L;  2CCZ A;  4MNO A;  4ME3 A;  3HFZ B;  1WJJ A;  2BA1 A;  1OXU A;  3PUW A;  2IT1 A;  4UP7 A;  1DTJ A;  3KLW A;  4L5T A;  4DV5 L;  3KF6 B;  4LIJ A;  3AFP A;  4UP9 A;  4HIM A;  1PV4 A;  3K81 C;  1YZ6 A;  1L1O C;  4O0A A;  3CCQ A;  1N32 L;  1D8L A;  2N8N A;  4H02 A;  4JI1 L;  3G6E A;  2EXD A;  4X64 Q;  4YY3 Q;  5LMN L;  4C2M H;  4A3C H;  1Y1V H;  2UXB L;  4IOC A;  1HNW Q;  2H5X A;  1O7I A;  2AMC B;  5AJ3 Q;  4RMF A;  1VQH A;  4X65 Q;  1C0A A;  1NBW A;  4JVH A;  1HNZ L;  4JYA Q;  2YTX A;  4JI2 Q;  4A3D G;  4NBQ A;  1XPR A;  3TS2 A;  3U4Z A;  2IHE A;  4YWL A;  1K3R A;  4JI4 L;  1JJ2 A;  2Q2U A;  1KD1 C;  4DV0 L;  1TWH H;  3D0F A;  3PV0 A;  3J81 i;  1YNX A;  4DAY B;  1RIP A;  3L0O A;  1SLJ A;  1L1O A;  4HIK A;  1A62 A;  4A3B G;  5E7N A;  4DV1 L;  1FGU A;  4DV7 Q;  2ZM6 Q;  4BY1 G;  4A3I H;  3W1B A;  5GAG C;  3GD7 A;  4DR2 L;  1QUQ B;  2KCM A;  2VQF Q;  1YHQ A;  4DR7 L;  3UDI A;  1PHJ A;  2D0P A;  3ERS X;  4JI2 L;  4L5R C;  3J81 j;  3U1K A;  4LF5 Q;  3HOV H;  3S2D H;  3RZO H;  5FLM H;  1Q1E A;  1YBY A;  4HJ5 A;  2PMZ E;  4JI0 L;  3CCE A;  4GN3 B;  1KL9 A;  1SR3 A;  1ASY A;  1XNR L;  1TUA A;  1Q12 A;  3A5Z B;  4JI3 L;  4J15 A;  4PZ7 A;  1K73 C;  4DV6 L;  5BR8 Q;  1PH2 A;  1WI5 A;  3M4O H;  4JOI A;  4APV A;  4QIW E;  3H15 A;  5IE8 A;  5C4X G;  3FKI G;  1QVC A;  1S3O A;  2NZH A;  3HKS A;  4DV4 Q;  1YIT A;  4YWK A;  3AEV A;  2UUC L;  2ANR A;  1NTG A;  1E22 A;  1YEZ A;  1VIH A;  2JEB I;  1N33 L;  1P16 A;  5IWA Q;  3CCM A;  3I55 A;  1VQP A;  2ZTE A;  1QZG A;  2CTK A;  1EQQ A;  1IZ6 A;  3HOZ G;  3F1Z A;  2DGR A;  4X62 Q;  1HZB A;  2OQK A;  5M3F H;  4OWW B;  1Q7Y C;  4LFC L;  4UPA A;  4HJ8 A;  3DLL A;  2JA8 H;  3CC4 A;  3FHW A;  2KCT A;  1HNX Q;  1HZA A;  2B29 A;  3M9B A;  1E7Z A;  3TQY A;  3G71 A;  3CCR A;  1MKH A;  2K5N A;  4GKJ L;  1VQJ A;  3PO3 H;  3I2Z A;  3GDE A;  3NBH B;  3TRZ A;  1YHB A;  4PMW A;  5GAE C;  4A3M H;  5IP7 H;  1TWC H;  4YCW A;  4A93 G;  4JI4 Q;  1K0R A;  4C3H H;  1N9W A;  1Q86 C;  4XIG S;  2LXJ A;  4MZ9 A;  4IPD A;  3WWV A;  3OYY A;  2RF4 A;  2ZJP A;  2VL6 A;  1I50 H;  3BU2 A;  4DR3 L;  4PZ6 A;  2WP8 J;  4GS3 A;  3K8A A;  3T1Y Q;  2AWN A;  4JI7 Q;  4A3L H;  2K52 A;  2UXD Q;  2R92 G;  4LF4 Q;  4AQY L;  5M3F G;  4OX9 Q;  4IOA A;  1VQG A;  4QL5 A;  3TS0 A;  1VQ9 A;  4YCU A;  4JBK A;  1LTL A;  4DAM A;  4JV5 Q;  2OCE A;  1CKM A;  3ICE A;  2ZJR A;  4IFD G;  3VDY A;  4BA2 I;  1UEB A;  1UE5 A;  3RLO A;  2OWO A;  3GO5 A;  3KJP A;  2PQA A;  1XMO Q;  2PI2 A;  4R4Q A;  3ZJY C;  3M7N A;  1A63 A;  1ZTG A;  4DV4 L;  4JVY A;  4DV2 Q;  4DUZ Q;  1HNW L;  1J6Q A;  1G51 A;  2VY3 A;  1V9P A;  1Q82 C;  2UXC Q;  2A19 A;  4OO1 I;  2YQR A;  2GVA A;  1V43 A;  4R1J A;  4A3E H;  4JI6 Q;  4GNX B;  3KDF B;  3GTK H;  4A3G G;  1AE2 A;  2K4K A;  2NN6 G;  5IY0 A;  2QND A;  2JA6 H;  3A0J A;  2FMR A;  4B3T L;  4UP8 A;  1YHA A;  4JI3 Q;  1UE7 A;  2D62 A;  3GTM H;  3L2P A;  2F4V L;  4OWX B;  1E1O A;  3U4V A;  3A5U A;  2MO1 A;  2CPQ A;  2CTF A;  2CKZ B;  2CWA A;  5HY6 A;  4DK6 C;  1NMG A;  1Q81 C;  3I56 A;  5IT9 c;  1VQM A;  1XMQ L;  1QZH A;  1W3S A;  3UDG A;  1A8V A;  2HH2 A;  1BKB A;  2ASB A;  1HR0 W;  2KBN A;  4JBW A;  2ES2 A;  4LWC A;  3T1H Q;  1QUQ A;  2JA7 H;  4DV7 L;  1G29 1;  4LUV A;  1XPU A;  1YJW A;  3PUX A;  3L7Z C;  5M5Y H;  1WCM G;  5FLX c;  4O2D A;  2JJQ A;  2HHH Q;  2QGQ A;  3BJU A;  2GVB A;  2N78 A;  3S1R H;  1S40 A;  1N34 Q;  3JC6 6;  1G6P A;  3UDX A;  4JI5 L;  1YI2 A;  1VQ5 A;  5H1S E;  1SMX A;  5IYD G;  4BBS G;  1VQN A;  4LF9 Q;  1K1G A;  1Z9F A;  2EIF A;  3HOX H;  4PZ8 A;  4QJF A;  1TXY A;  4GLV B;  3UE0 A;  2UXD L;  4GKJ Q;  2Y0S G;  4LUO A;  5JEA J;  1VS0 A;  4DV3 Q;  4A3F H;  2JVZ A;  1MJC A;  2K75 A;  5DLQ E;  2MO0 A;  3RLF A;  1FJG L;  2NVY H;  5C0X I;  4LF6 L;  4KHP L;  2ANN A;  3S15 H;  4X65 L;  2K50 A;  1HJP A;  4X62 L;  2UUB Q;  2IX0 A;  1M1K C;  3K7U C;  1FVI A;  1WOC A;  3T1H L;  1L1O B;  1HZC A;  1DT4 A;  3U58 A;  3HOZ H;  3GTQ H;  1VQA A;  1OXS C;  2DUD A;  4UY8 C;  5LMN W;  4EX5 A;  4LFB Q;  3Q8D A;  2VNU D;  3OTO Q;  1PA6 A;  1N34 L;  1VQI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...