2Z0SA

Crystal structure of putative exosome complex rna-binding protein
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
175
structure length
175
Chain Sequence
EIYVPQAGDVVIGLIQSVGIMNWFVDINSPYVAVLSVQDFLGRPFNPAVDDMQSLLKVGDYIKAKVVAFDKTRSPLLTVQGEGLGRIVRGKIVEISPAKVPRVIGRKMSMLKTLEEKTECKIFVARNGRIHLECPNEDLEAIAVMAIKIIDEEAYTSGLTKRIIKFIEEERRIRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords Probable exosome complex RNA-binding protein 1
publication title Crystal structure of putative exosome complex RNA-binding protein
rcsb
source organism Aeropyrum pernix
total genus 42
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 2007-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2z0sA01
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 2z0sA02
3GTJH 4DR3Q 1M1KC 4X62Q 4HIDA 1L0WA 1PHJA 2BL5A 1N32Q 5ELNA 2JA8G 1PH5A 2R93G 2RHQB 4GOPA 4QQBX 2MJHA 3HOZG 4A3MG 1JMCA 2ZM6Q 2ALYB 2JA7G 4JI1Q 3CF5A 1TWHH 2Z0SA 4MTNA 1WYDA 3HOWH 4C3IH 2OTLA 3FHWA 5IP7H 4JBKA 4BBSG 1YJWA 4A3FH 3S15H 3W1BA 4A3EG 4JI4L 1SR3A 1CKOA 2JA6G 4B3SL 1VQDA 1DT4A 1IBKQ 1MJEA 2H5XA 1JT8A 4UP9A 3S24A 2YYZA 3CQZH 1B70B 5GQOA 4DV2Q 1I3QH 1HZBA 1N8RC 3L0OA 3GTPH 2I5HA 4GKKL 1KAWA 2GN5A 2E5LL 2Q2IA 2HT1A 2K50A 3PO3G 1Q1BA 1V1QA 1HNWL 5C4XG 3JAMc 2I5LX 1VQOA 1L1OC 2HIVA 4A3DH 5JEAG 3U1KA 1PH1A 1SROA 4IPDA 1KXLA 1BVSA 4A3LH 2MQHA 1Q82C 2N8NA 2QGQA 3CCSA 1VQPA 1XNRQ 1XPUA 1K9MC 1HNXL 4LF7Q 4DR5Q 1TWGH 2R92H 3PCOB 2UXDQ 3M4QA 2BH2A 3PGZA 2VQFQ 1VQKA 1VQ7A 2JA5G 1UE6A 2R7DA 3S1QH 5IWAL 4IOCA 2KCTA 4LF8Q 4JV5L 2KBNA 2UUAL 4IPHA 3F2BA 1KRSA 3S1NH 2PQAB 5AJ3L 2UUCL 1EOVA 4DR4L 3ULJA 3A5UA 3T1HQ 3CCVA 4LF5L 4K0KQ 4BBRH 2PNHA 4A76A 3Q8DA 3UDFA 3M4OH 3PO2H 1VQMA 3K7UC 4LFCL 2VQEQ 5JJKA 3S14H 1XMOQ 1QUQB 2WAQE 3NELA 3L2PA 3S1RH 4HJ9A 1VQBA 4JI3Q 1E24A 1QVGA 3HOUH 2IT1A 4JI5Q 1Y1WG 3CCJA 5FJ8G 3OTOQ 2PQUA 5IYBG 1IXRA 5M3MG 4WANA 1HZCA 4P74A 2CTFA 1C7YA 3ER0A 4LNQA 3I4OA 4A3IG 2MFIA 1IL2A 4MNOA 3TS0A 1MKHA 3PSIA 2UXBQ 4GN3B 2AKWB 5DLQE 5J3BA 3U4VA 2AHOB 4OO1G 1X55A 1X65A 5IE8A 3FKIH 1T9HA 4LFAQ 2FXQA 4DUYL 1PA6A 3S17H 3CCQA 2D0OA 1VQ6A 5ELOA 2BH8A 5M3FH 4GNXA 4A3KH 2JZXA 3TRZA 5LMUQ 1PH9A 4JI7L 3RLFA 2VUMG 2Y0SE 2YQRA 1GVPA 2F52A 1E22A 4R4OA 4BBSH 2KENA 5C0XI 1FJGQ 2ES2A 5FLMH 1S72A 4GN5A 2D0PA 4ALPA 4JYAL 1FL0A 4JOIC 2AMCB 1KIXA 3B6YA 1KHIA 2RF4A 4DV4L 1KL9A 2HIXA 3G71A 2VW9A 2UUBL 2PQAA 5C3EG 1HR0W 2HHHL 1HR0L 2CCZA 4B3TQ 2IY5B 3UDXA 2LXJA 4DV6Q 1PH2A 4JI8L 2BA1A 3BU2A 4UY8C 1D7QA 1L1OB 3CW2C 4DV1Q 1N34Q 1YNXA 4OX9Q 4JI0Q 4Y52H 3J81j 4DR2L 1NTGA 4IFDI 4A3JH 2DGRA 4A93H 1DTJA 2MNAA 3J81i 4DV0L 3CPFA 1E3PA 3J80i 1J4WA 2PMZE 1PH8A 2ANNA 3HKZG 2VZAA 2CQOA 2K5HA 3AYHB 2CWPA 1E1OA 2N78A 4PG3A 4YCUA 4DV3Q 3U58A 4IOAA 1XNQL 4DV7Q 1XMQQ 2P2RA 4NXMQ 1N33Q 1WJJA 3I55A 4DR7L 1EQRA 1X3GA 3IRBA 4LFBQ 3M85A 1HZ9A 1VQCA 3I4NG 3UE0A 4RG1A 4A4IA 4A3GH 1OXUA 1IZ6A 1IBLL 1P16A 2JA9A 1KHMA 4JBMA 3ICEA 3G6EA 4DR3L 5GAEC 2CTMA 4KHPL 3CD6A 4QY7A 3HOVG 1UE7A 3WWVA 5GAGC 1YHQA 4QGUA 4WJ4A 1Q81C 4DUZQ 1YZ6A 1PFSA 3G4SA 1NMGA 4JI2L 1TWAH 2VS1A 1BKBA 1TWCH 1YI2A 4A3CG 1K83H 5IYCG 1VIHA 2B63G 3NENA 3GTQH 5JJLA 1VQ9A 2YTVA 3A0JA 5C44G 2AWOA 3SGIA 4LW1A 2EIFA 2NN6G 1OXVA 1I94Q 5LMNW 1ASYA 3J81c 5LMNL 1EC6A 1R9TH 2K14A 2IHEA 4P73A 1OXXK 3A5ZB 5BR8Q 1GO3E 1VQNA 4B3MQ 3RR5A 4GKJQ 4OWWB 3HOYG 2JEBI 2YTXA 3K81C 4X66Q 4BXXH 1VQ5A 1WE8A 4HIOA 1G6PA 1I5FA 3AEVB 4B3RQ 3U4ZA 2YV5A 1YJ9A 1EUJA 4X65Q 4O0AA 1S3OA 4UPAA 1CSPA 5IP9G 1VS0A 4DR1Q 1J5EQ 4JI6L 2OQ0A 2Z6KC 1LTLA 2K52A 4GLAC 1Q86C 3S2HH 1NBWA 3KF6B 1YITA 1W3SA 2NZOA 1OXTA 3KDFA 1B7YB 1RL2A 1SE8A 1SRUA 1AH9A 1GKHA 1YVCA 3TREA 3U50C 2QA4A 3CC2A 3K0XA 4LWCA 1X9NA 1EIFA 4FDBA 4DNIA 4XTCS 1FGUA 2UU9L 1PVOA 1JJCB 4GOPC 4A3BH 3T1HL 4DV3L 2WAQG 2NVXH 3HOXG 1SMXA 3PUXA 4IO9A 3STBC 5EAYA 4JI4Q 4IPCA 3CMAA 2E8GA 2ZTDA 4X64L 4B3SQ 4NXNQ 2VQEL 2I5MX 2YU9H 1S40A 4BY7H 1JJGA 1BBWA 1G291 5IYDH 3K80C 3M7NA 3BJUA 3RZOH 2CTLA 1PH7A 2CTJA 1IYJB 1E7ZA 2Q2HA 1N9WA 3EBEA 3GDEA 2CWAA 4IPGA 4JI5L 4O2DA 4A75A 2E5LQ 2NZHA 4GKKQ 2LXKA 1EFWA 1HNWQ 4BY1H 1OTCA 4DAYB 3EN2A 4NPSA 1WVNA 1YBYA 2HH3A 4HJAA 1HJPA 3CP0A 1NY4A 4LUVA 1ZZKA 1M90C 4LF9L 4A3GG 4WALA 3OYYA 2UXBL 2PY9A 5IY0A 3I4MG 4TQUS 1Y14B 1HNXQ 2ZJQA 3UDIA 2JJQA 1U0LA 2Y0SG 2WP8J 2PI2A 4GLXA 5C0XJ 2WB1E 1VQEA 1RIPA 2QNDA 1SFOH 3AFPA 5IWAQ 3F1ZA 1PV4A 1A8VA 2UUAQ 4LF6Q 1JE5A 4PZ7A 4HIKA 1NMFA 1Y1VG 3OW2A 1QZGA 3STBD 1CKNB 5AJ3Q 3KJOA 2UUCQ 2B63H 2JA8H 4DR4Q 3KLWA 1WCMG 4LF5Q 2R93H 2ZJPA 3H0GG 2R7ZG 1L2FA 4A3MH 1KC8C 4DPGA 1A62A 2JA7H 3HOZH 2KHIA 4LIJA 2OTJA 4LFCQ 3A74A 1MIUA 3MXNB 1X4MA 1OXSC 1J6QA 2B29A 3UDGA 5GROA 5GAHC 4A3EH 1N36L 4IFDJ 2UXCQ 2JQOA 3GTKH 1X4NA 2JA6H 2E3UA 4B3TL 1X54A 4X6AH 4QJFA 3M4PA 1K8AC 4OONA 4EX5A 4DV5L 4J15A 1CSQA 3T1YL 1W2BA 5IP7G 1HNZL 4OX9L 2RHSB 4A3FG 2R7FA 2VY3A 4JVYA 1EWIA 1K0RA 3ERSX 4UP8A 1O7IA 1PYBA 4R1JA 5C4XH 4YY3L 3PO3H 1ZZIA 4LF4L 4DUYQ 2NVYH 1LYLA 2ID0A 2FMRA 4DR6L 3PF5A 1VQ4A 2HQLA 1QUQA 1UE1A 2KHJA 4POGA 2NVQH 1Q12A 4YWKA 1XMQL 3CPWA 3RNUA 2F4VQ 3CCUA 3F2DA 4GNXC 2C35B 4LFBL 3KF8B 4L5SA 1PYSB 4A3DG 3PV0A 4AYBG 2JA5H 1J5KA 1VQJA 2XTIA 4KHZA 3W1GA 2E2JH 3PUVA 4A3LG 1VQGA 5M5XH 4NB3A 4C3JH 3M3YH 4JYAQ 1JB7A 1X6OA 4XIGS 1MJCA 4AQYL 2R92G 4HJ5A 3E9HA 3NEMA 1Q8KA 5C4JH 4DV4Q 3RN5A 1VCIA 3AFQA 4UP7A 2A1AA 3EIVA 1PH3A 2UUBQ 1QZHA 3G48A 5C0XG 2HHHQ 2ZJRA 4JG2A 1HR0Q 1FVIA 1QVFA 2R6GA 4AYBE 4X62L 1N32L 1SN8A 1VQAA 2B3GA 2EQSA 1H95A 4BBRG 3PUYA 4DR2Q 1Y1WH 1TWFH 5FJ8H 2ZM6L 5IYBH 4JI1L 5M3MH 3PO2G 3NBHB 5M5WH 1I94L 2ATWA 4JCVE 3AQQA 2BA0A 4APVA 5BR8L 1C9OA 1WI5A 4DV0Q 4B3ML 4A3IH 2A19A 3I56A 3RN2A 3F8TA 3HOUG 2LSSA 1XNQQ 1KQSA 1B8AA 2K4KA 4R4QA 4JBWA 3J80c 1IBKL 3M9BA 1P8LA 1SLJA 4YWLA 2MO1A 4DV2L 3TEHB 3I2ZA 4YHHQ 4DR1L 1GM5A 1L1OA 4BA1I 2VUMH 2CKZB 4IJHA 1IBMQ 4JBJA 2ZTEA 3FKIG 2K75A 2WFWA 4L5QA 4KHPQ 3V69A 3PIPA 5GADC 5M3FG 1KD1C 4A3KG 1EYGA 2CFMA 4B8TA 4JI2Q 1XNRL 3J7A5 1PH4A 4LF7L 4OWXB 4DR5L 2UXDL 4ME3A 3GTGH 2VQFL 3RLNA 4EQ5A 1K3RA 3RLOA 1AE3A 2F3IA 4GN4B 5C3EH 3GO5A 3H15A 4LF8L 5FLMG 3K7AH 1X3EA 2K5NA 5LMNQ 4NXNL 1Q7YC 4K0KL 1NE3A 2MO0A 3CCEA 4HJ8A 1LM0A 2EXDA 2QEXA 1VQHA 1UEBA 2CTEA 1V43A 1YHAA 4DK3C 1XMOL 1V9PA 4JI3L 4GNXB 4RMFA 1BBUA 1GD7A 1Z9FA 3W5OA 1EQQA 1CKMA 1AE2A 4JI6Q 3OTOL 2OPUA 4OO1I 4P75A 2WB1G 4C2MH 4A3JG 2IX1A 4WJ3M 4A93G 4JVHA 3CC4A 3HFZB 4P72A 4QIWE 3S16H 3I4NH 1VQLA 4HIMA 1YHBA 3K8AA 1WOCA 4PMWA 3BZCA 4MZ9A 3GTOH 1G51A 3RZDH 1JJ2A 2Q2UA 4IJLA 1Z47A 2YTYA 2UU9Q 4LF6L 4LFAL 3ULPA 3AEVA 3KFUA 1A63A 4R4TA 1Q1EA 3HOVH 1XTDA 1E1TA 1D8LA 1HH2P 1YEZA 4DKAC 3CMEA 3D0FA 5LMUL 4OXPA 3J7ZC 2IHFA 2JK8A 3ZJYC 1I50H 2KCMA 1PH6A 3TS2A 4JV5Q 4OWTB 4TVAB 4A3CH 1I6HH 2D62A 1VIGA 5IYCH 4X64Q 4PZ8A 1UWVA 1TXYA 2ZTCA 1A0IA 2ASBA 2DUDA 3KF6A 5C44H 4R4CA 4JOIA 3I7FA 1FJGL 1NJIC 1HZAA 2UXCL 2PI2E 3UE1A 4DK6C 3KYHC 4QMFB 2GVBA 1XPOA 2E2IH 3VKEA 3HOYH 1XPRA 2OWOA 2E2HH 4DAMA 4JC0A 3H3VH 4POFA 4QL5A 4LF9Q 3ULLA 2N49A 4YCVA 4AIMA 4DV6L 3JC66 3DLLA 3HOWG 4AM3A 3PF4A 1Q46A 2IX0A 4C3HH 3CCRA 4DV1L 1CUKA 1N34L 4JI0L 5IP9H 4BXXG 1XJVA 1KRTA 4L5RC 3MEFA 4L5TA 5FLXc 3F2CA 1TUAA 1ZTGA 1K1GA 3PUZA 2F4VL 4HJ7A 4YWMA 3GD7A 3S1MH 2RCNA 3PIOA 1C0AA 1VQ8A 3CXCA 2JEAI 1DGSA 4JI7Q 4AH6A 4DV7L 4NXML 2ANRA 2A8VA 5M5YH 1N33L 2AWNA 4GOPB 4LUOA 5K36G 4GLVB 4P71A 3CC7A 1VQFA 2CPQA 3HOXH 5H1SE 1N36Q 3E0EA 1YJNA 1X56A 1X3FA 4BA2I 5JJIA 2NVTH 1K73C 1ZZJA 3GTMH 1YIJA 3CAMA 2OCEA 4A3BG 4NBQA 4DV5Q 2NN6I 3T1YQ 1HNZQ 1LUZA 4H02A 4KLKA 4DUZL 1CKNA 4LUZA 5HGQA 3E9IA 4YY3Q 3VDYA 4JI8Q 5JEAJ 4LF4Q 2HH2A 4R4IA 2V1CC 2JVZA 2GVAA 4BY7G 3H3VI 2OQKA 5IYDG 1VQIA 3S2DH 4DR6Q 3BZKA 3KDFB 3KJPA 3I4MH 3CCLA 2DGYA 3KOJA 4PZ6A 2XGTA 3DM3A 4GKJL 4BY1G 5IT9c 1UE5A 2K5VA 4X66L 4Y7NH 3CCMA 1EIYB 2AXYA 4KI0A 3L7ZC 4YHHL 2L15A 2VNUD 2CTKA 2I0QA 3TQYA 4IFDG 4B3RL 4X65L 2OPVA 2Z6KA 3HKSA 1IBML 1QVCA 1Y1VH 4GS3A 1U5KA 3GTLH 3HKZE 4DR7Q 2JE6I 1K8GA 3JAMi 4AQYQ 2N3SA 1WCMH 2VL6A 3PUWA 1J5EL 3D31A 3H0GH 3LGJA 1IBLQ 5E7NA 1ASZA 2R7ZH 1WFQA 4YCWA 3FP9A 2Q2TA 5HY6A
chains in the Genus database with same CATH superfamily
3GTJH 4X62Q 1PHJA 2XN9C 1L0WA 3SK6A 1WTHA 4EQPA 5IGDA 1PH5A 4HMJA 3IL8A 3KF8A 1QWYA 4C1NI 1TWHH 2OTLA 2XIWA 2CW0C 3FHWA 1YJWA 3LWEA 2RBMA 3TBIB 1CKOA 3CHBD 1A6XA 1DT4A 1IBKQ 4RAUC 2Q8RE 4N9TA 3S24A 1LT4D 3CQZH 3GTPH 4IUNA 3R93A 2VQEH 1FKAH 2F0UA 1TIID 2F0VA 2K50A 3VR2A 1V1QA 1PH1A 4IPDA 1KXLA 1UNSA 1Q82C 5FO9B 3CCSA 1JE4A 1VQPA 4LF7Q 3VA5A 1SYBA 2UXDQ 2HDMA 3PCOB 2BH2A 3BVZA 3PGZA 2EZVA 1WTJA 2R7DA 3MWYW 1KRSA 2PQAB 5AJ3L 4DR4L 4LF5L 1D2BA 2M8WA 1EYCA 4RGOS 4KKTA 3BG3A 1PRTB 3PO2H 4NKLA 4LFCL 2VQEQ 1EL0A 3L2PA 1F2ZA 1E24A 2M00A 5AFWA 1ZEQX 3MXGA 5KIXA 4F7XA 3RF2A 2CTFA 1G8ZD 1SE3A 1PXUA 1PTOB 3ER0A 4LNQA 4PQXA 4A3IG 1IL2A 3TS0A 3K7AB 2K5DA 4OX9H 4TRDA 1XYIA 1X65A 1HNZH 3S17H 3K57A 2B2UA 2BE5C 5ELOA 2BH8A 5M3FH 5DT9A 4GNXA 3TRZA 5LMUQ 2PNRC 5DM63 3Q22A 1F2MA 5CC4A 3FEWX 4K5XA 2F52A 3ND9A 1E22A 4R4OA 5CMDA 2KENA 5C0XI 4DK0A 4BBSH 1XMQH 5FLMH 2D0PA 4J6HA 3G71A 2PQAA 2FPHX 5C3EG 2HHHL 2DY8A 5C5LA 3AB9A 4O1NA 4JI8L 3N6RA 4DV6Q 1IW7D 4OX9Q 3CW2C 1D7QA 4Y52H 1O7YA 2O4CA 1NTGA 1U4PA 2EY5A 5ELDA 4A3JH 3SK4A 5I6YA 5IODA 2DGRA 1N32H 1TS5A 2B63B 1DTJA 3J81i 3VA7A 4L63B 1PH8A 4JI1H 2VZAA 2F0GA 5C4ZA 1I94H 1GHJA 4YCUA 4ZLTF 4IUPA 5G3LD 3U58A 1XMQQ 5CV7A 4B3MH 3I55A 3HOYB 1MGSA 3NQIA 3I4NG 3UE0A 1MD2D 4A4IA 1X3PA 1IZ6A 5FLXW 1GXDC 3I72A 1O78A 2JA9A 2HUGA 2GA4B 4DV2H 3G6EA 4DR3L 5CV9A 5GAEC 4DR1H 4X3KA 4KHPL 1PZID 3KBXA 3WWVA 4MN3A 4KN7C 3G4SA 4B8CD 1TWAH 1BKBA 1K83H 2NVYB 5IYCG 3GTQH 3OSOA 1I4PA 2NN6G 1OXVA 1I94Q 1EC6A 1R9TH 5DEHA 1OXXK 3A5ZB 4B3MQ 3RR5A 1VQ5A 4LF8H 4HIOA 2E74C 1NAPA 3TP5A 1QJOA 2JYOA 1XRHA 2NVTB 1MHWC 1TY2A 2YV5A 1YJ9A 3GTMB 1CI3M 3W3AA 5TSSA 2X6GA 4O0AA 4UPAA 1RHPA 3GP7A 4J1MA 4DR1Q 1J5EQ 4JI6L 2OQ0A 2HDLA 2X06A 4DXGA 4L6TB 4GLAC 3KF6B 2NZOA 3NTKA 5K36H 3NWTA 5KEEA 1B7YB 1HFGA 5IT9L 1DXMA 1SE8A 3OTOH 3TREA 1YVCA 3CC2A 3U50C 3K0XA 3GV6A 3Q6SA 1X9NA 4HCEA 2F03A 1F2LA 1TT2A 4CJ1B 1RTNA 4RHSA 4GOPC 3T1HL 3MFGA 4DV3L 4P2CB 1SMXA 3PUXA 2ZXRA 4LFAH 2F4IA 4LF6H 3CMAA 4X64L 2YU9H 3GTLB 3K59A 1QILA 1DJRD 3M7NA 3BJUA 2VUMB 2CTLA 4JI5L 3GDEA 5KYIA 1PYWD 4O2DA 2LXKA 4FJUA 1OTCA 2EE1A 4DAYB 1WVNA 4XYOA 1FJGH 3EROA 2WKCA 4HJAA 3CP0A 4B9WA 2F3WA 1M90C 4IFDH 4IQZA 3OYYA 2TSSA 1NUCA 3BVGA 3MXUA 2JJQA 1V1PA 4JW0A 4ZRZA 3S15B 5C0XJ 2QNDA 1O7LA 3OETA 1SFOH 3AFPA 4DV1H 3HP3A 1SNPA 2K6AA 3M7GA 4LF6Q 4PZ7A 2VNUD 5JJZA 2RCFA 1QZGA 5AJ3Q 1CKNB 3S9WA 4DR4Q 2RDHA 3JAMW 3KLWA 1C48A 4LF5Q 2ZJPA 1L2FA 5I2XA 2Z4HA 1A62A 2KHIA 5E1FA 3NXWA 4LFCQ 2OTJA 1MIUA 4EQNA 3UDGA 5GAHC 1X4NA 2M2LA 4N9PA 4B3TL 1TS2A 3I4LA 2R92B 3KDKA 1E0BA 2RHSB 1B44D 4R9WA 3EQLC 3HOVB 1GUGA 3G6JB 5DAUA 1QUQA 1A3TA 4E6IA 4POGA 2K04A 1Q12A 3S14B 5ELEA 2L0CA 3F2DA 4FNFA 1EY5A 3J7AV 4A3DG 1B9MA 4AYBG 2F0WA 3W1GA 4HN7A 5M5XH 4GKJH 4DK1A 5J39A 2E2IB 1Y8PB 1JB7A 5C3WA 4XQQA 3E6ZX 3E9HA 5C4JH 3RN5A 4R8NA 2HD3A 3AFQA 2A1AA 2EY6A 5IGBA 1IBMH 3G48A 2LY7A 2HHHQ 1XX8A 2B2TC 1FVIA 2N88A 3EFXD 2R6GA 4C3HB 2OT2A 4LK1C 1LTGD 4ODGA 4O42A 4FF3A 4A3KB 1TWFH 4EQOA 3NPPA 2ZM6L 2BA0A 5BR8L 3FPPA 4A3IH 3F8TA 1FGBD 2LSSA 1SBBB 2HCCA 1BNZA 5EPLA 3NTIA 4TSSA 3Q0AA 4JI4H 3HS0C 3I2ZA 4B08A 1SNMA 1IBMQ 2ZTEA 5KRUA 1IHZA 2K75A 4KHPQ 3V69A 2JN4A 1KD1C 3EVQA 3V2TA 1SNCA 3PMFA 4B9XA 1EYGA 3KDGA 4DU9A 1XNRL 2Z6BA 4OWXB 1DONA 3AU7A 4DR5L 3EJIA 1E2WA 4EQ5A 1BCPC 1V1OA 3NQTA 4GN4B 5C3EH 1KDAA 1STEA 3KBGA 3H15A 3SEBA 3LWUA 1EQTA 5D65A 1NE3A 4K0KL 5IWAH 4HJ8A 1LM0A 4JV5H 4N8X1 5HGTA 1UEBA 2CTEA 1SEBD 1V43A 4QUFA 5HURA 4DK3C 2DNEA 1XMOL 1MSZA 3H6MA 3TMEA 3N52A 5CORA 1GD7A 1AE2A 4JI6Q 4OO1I 2CWFA 2WB1G 2N55A 1CK1A 1CQVA 3J81L 4A93G 5FKAC 4P72A 4JVHA 1HFNA 2RDGA 3I4NH 1VQLA 5JVG3 1WOCA 4PMWA 5JPMC 3GTOH 2KCCA 1BCPD 3RZDH 4ZUJA 1W6JA 2Q2UA 4IJLA 1Z47A 4CDCC 2K1HA 1BDOA 1Q1EA 2J0TD 1E1TA 1C4QA 1D8LA 3WDNA 4DV3Q 4QQBX 4X6AH 3TS2A 4JV5Q 4ZKCB 5IYCH 4X64Q 3MEHA 1A0IA 4IUVA 4R4CA 2NN6H 1NJIC 1HZAA 2PI2E 1PDQA 1AEXA 2PZUA 1SE4A 2GVBA 3I3CA 3UOEA 2OWOA 2E2HH 2M6QA 2EY1A 1SJED 3QD7X 4QL5A 2F1MA 1VDZA 4AM3A 2E2DC 3DUZA 5IGEA 2C5CA 2PW5A 5C4HA 2XNAC 4ZCKA 1S03G 1XWEA 3FVQA 5FO7B 5JOBA 3PUZA 2F4VL 2WACA 1CA5A 4BY7B 3M4OB 1LTAD 1VQ8A 3KK7A 5KGUA 1N33L 2AUJD 4GOPB 4P71A 1KLGD 4I7ZC 3BDLA 3GKUA 5DM73 2WKDA 1YJNA 1X56A 1X3FA 1SE2A 1K73C 3T4AC 1YIJA 1S5DD 3CAMA 4KLKA 1EY9A 1ODHA 4DUZL 1KABA 1Z2IA 2CHBD 3VDYA 3SK5A 2JA8B 3J81E 4JI2H 3HOZB 3S2DH 1PRTC 3I90A 1UAPA 1SNOA 3KJPA 4BY1G 1DZ1A 1EIYB 1BXTA 2XSCA 4KI0A 4YHHL 2L15A 4B3RL 4LMQD 2OPVA 3MAQA 4GS3A 3HKZE 2JE6I 1PTOC 5E3FA 1K8GA 1ASZA 3C1EA 1U4RA 4C1NK 3VYRA 5ISRA 3PO3B 2K7VA 4YCWA 3X3NA 2Q2TA 5HY6A 1RODA 1M1KC 4HIDA 2BL5A 2Q8TA 2I07B 4GOPA 1ZKOA 2ZM6Q 2JA7G 3CF5A 3H91A 4JK1C 1PRTD 4BBSG 2JA5B 4CKEA 2DNCA 1A3UA 4C3JB 3M3YB 1E2ZA 2JA6G 2RKSA 1VQDA 1MJEA 2H5XA 2ZT9C 4UP9A 2YYZA 1I3QH 2I5HA 3GQBA 4GKKL 1PTOD 2E5LL 3C46A 4MHEA 1Q1BA 5C4XG 1X9ZA 3MZ5A 1D5XC 2QILA 2HIVA 4A3DH 1CM9A 5JEAG 3F2UA 1J8IA 2NTSA 2B8GA 5M3MB 2L1BA 1XNRQ 4DR5Q 3J80L 3M4QA 1VQKA 4LF9H 2UXBH 3HGBA 4ZK9B 1HRJA 3S1QH 2KCTA 2UUAL 3F2BA 5CBEE 1SYGA 1EOVA 3A5UA 4K0KQ 4DFAA 2PNHA 4A76A 3GV3A 1X0AA 1VQMA 3ITPA 2KJXA 1XMOQ 3S1RH 1QVGA 1JB3A 2IT1A 3QB3A 3CCJA 4NZRM 2PQUA 1IXRA 5NUCA 1TU2B 4P74A 5G3LF 1HA6A 2ZQEA 2KCNA 2MFIA 2L12A 4MNOA 3QOLA 1MKHA 3D8GA 3PSIA 5CV8A 2UXBQ 5D3DA 5A2QE 1X55A 1PA6A 1DYQA 4DUYL 1LTRD 3CCQA 2JXMB 4YY3H 2JZXA 3K5OA 2VUMG 4IUUA 2Y0SE 4DXFA 3NP8A 2YQRA 4DR6H 1GVPA 1VF5C 3HKZB 4KK7A 2ES2A 1CHPD 4C2MB 3I8ZA 4ALPA 4JYAL 4LFBH 2AMCB 3QO2A 3B6YA 2RF4A 3S16B 2B2TA 1B4OA 2UUBL 1JCKB 3IKJA 4OIKA 1T5EA 1HR0L 3SXHA 4AQYH 2LXJA 2F0QA 3L3OC 4KY7A 3J81j 4DR2L 1GOZA 1RTOA 4IFDI 4X62H 2VB3X 4A93H 2BOSA 1A2TA 4DV0L 5C44B 1E3PA 1J4WA 2PMZE 3FDTA 4WORA 2K5HA 4IOAA 1XNQL 1BF4A 1N33Q 1WTWA 1K8OA 2X69A 1WJJA 4DR7L 1EQRA 1X3GA 3LX0A 4LFBQ 2CPMA 4OCHA 1BR9A 1VQCA 4V0BA 3V96A 2FFMA 1X3QA 3G7LA 4F87A 2LFNA 2K01A 2TMPA 1IBKH 4NP5A 4XYQA 4CKCA 2A5HA 4K2LA 1Y69U 3MXPA 4QY7A 3HOVG 4WJ4A 4DUZQ 1PFSA 1NMGA 3D4WA 4ZKBB 2EYPA 2VS1A 1YI2A 4A3CG 1VIHA 5JJLA 4RFBA 5A35A 2L55A 3A0JA 5C6AA 3S1MB 2KUMA 1X32A 4LF7H 2EIFA 2UXDH 2BDNA 5LMNL 2K14A 2K5WA 1VQNA 4H44C 1WE8A 3HOXB 1G6PA 4FF4A 1LLRD 3P7JA 1ML0D 4B3RQ 3U4ZA 2LTLA 4C3HG 1H9JA 1CSPA 5IP9G 5IOCA 1ET6A 1LTLA 2MUYA 3S2HH 4R8IA 2SOBA 4OD6A 2ICEC 2CH4A 3DMUA 3KDFA 3SK8A 2LF0A 5IT9W 1JWUD 1Y1WB 1SRUA 1AH9A 1STYA 4LWCA 3I4MB 4FDBA 4XQNA 4DNIA 2UU9L 2Y0SB 1JJCB 2A74C 4OELB 4Y7NB 2KEEA 1H9SB 2LS01 2WAQG 4DNTB 2CW0D 1NCVA 3STBC 5EAYA 1QNKA 2ZTDA 3SHLA 1Y1VB 5EPKA 1WTQA 3QJYA 1JJGA 5LMUH 1WCMB 1G291 3OMCA 4XQJA 3H0GB 3K80C 3RZOH 2EJFC 4IURA 3EBEA 4IPGA 3UI2A 3FRPB 4GKKQ 2A1SA 2E5LQ 3GTJB 4BY1H 2UXCH 2MP1A 2PY9A 1TWHB 5IY0A 1F0XA 2ZJQA 1HHVA 1LO5D 2WP8J 1BO0A 2PMZB 2MGSA 4DV6H 3F1ZA 4HMIA 4ME5A 1A8VA 2UUAQ 4HIKA 3OW2A 3STBD 2B63H 3CQZB 3KJOA 2R7ZG 4X3UA 1KC8C 5I6WA 4DPGA 2JA7H 4LIJA 3MXNB 1X4MA 1OXSC 2B29A 5GROA 1N36L 2UXCQ 4IFDJ 2JA6H 1X54A 3U9SA 3MVVA 4QMGA 4C3IG 4DV5L 1DOMA 2FHTA 3T1YL 4A3FG 1EWIA 1K0RA 1O7IA 1PYBA 5C4XH 2QDLA 4RCOA 1ZZIA 4LF4L 4DUYQ 5JEAH 2NVYH 2DJGC 1UE1A 3PO2B 1ONLA 2NVQH 2BE5D 4YWKA 1ESRA 5EBDA 4CDDC 1M8AA 3NK9A 1PYSB 3NTHA 2XTIA 4FXKC 4KHZA 2E2JH 4A3LG 1PQXA 1CZGA 2R3ZA 4JYAQ 4H13C 1R4QB 4XIGS 2IW3A 4HJ5A 4UP7A 1MBYA 3BS1A 3EIVA 2EJGC 2UUBQ 1CZWA 5C0XG 1HR0Q 3DWQA 2RDFA 1J5EH 4K5WA 2B2VC 1KAAA 4K14A 1R4PB 5M3FB 4DR2Q 1GUWA 4X3SA 1CHQD 3NBHB 5M5WH 2ATWA 1WI5A 4DV0Q 1ENCA 4ID6A 1Q8IA 4OEMB 4LAAA 1XNQQ 4CJ0B 1KQSA 5LL6b 1B8AA 4JBWA 2K28A 1SLJA 2B2WC 1BCPF 3TEHB 1GM5A 4BA1I 3ND8A 1B53A 1JQYD 2VUMH 2CKZB 1FNUA 5D14A 1EIHA 3DM1A 4JBJA 1AN7A 2QKIC 1QB5D 5GADC 2CFMA 4A3JB 1D5MC 1SAPA 4G4KA 4L8JA 4ME3A 2VQFL 1SYDA 1K3RA 1AE3A 1QOHA 1X3EA 2K5NA 5LMNQ 4NXNL 1DOKA 1BOSA 4U673 1EU4A 1STNA 4KTAA 5KYLA 1KNAA 4S3SA 3A7AB 4DR4H 4LF5H 4JI3L 4RMFA 5LHY1 1Z9FA 5EBCA 3W5OA 3NBHA 2B8FA 2RSNA 4LFCH 3VR4A 4DA2A 1TWAB 4P75A 1B3QA 3VR6A 4WJ3M 4DN4M 5CGKA 3GTQB 3E3XA 4RA8A 4HIMA 1KDCA 3K8AA 3P1HA 3BZDB 3HOWB 1G51A 1ICFB 2G9HD 2YTYA 2UU9Q 3ULPA 2VXWA 3HOVH 3D0FA 2IHFA 2SNSA 1I50H 1I6HH 4OWTB 4TVAB 4A3CH 2PT7G 1CQFA 2D62A 4PZ8A 1PFNA 4ZYSA 3A56A 3KF6A 1SNQA 5IIFA 3UE1A 4NZTM 4CJ2C 1XPOA 2E2IH 4POFA 3ULLA 2EYOA 4AIMA 3JC66 3PF4A 2IX0A 4C3HH 1N34L 1CUKA 4JI0L 5IP9H 1XJVA 2HHHH 5FLXc 4L5TA 1ZTGA 1H9RA 4JI8H 2CH4W 2YU9B 2FMMA 4BBRB 3KLRA 4KKUA 4DAYA 3PIOA 4AH6A 4DV7L 3J7AK 4NXML 2ANRA 2A8VA 3MA2B 2AWNA 4LUOA 3CC7A 3HOUB 1PFMA 4CDFC 4FJSA 1PRTF 1K8MA 1LT5D 1N36Q 5JJIA 4A3BG 4NBQA 4DV5Q 3T1YQ 4XXEA 4H02A 1CKNA 4LUZA 1W6KA 3E9IA 4DR3H 3FKIB 4KHPH 2F3VA 3H09A 2PO4A 4JI8Q 4LF4Q 1PTOF 2K03A 5IYDG 3H3VI 2SNMA 2Q8IB 3CCLA 5I9PA 3AMUA 2K5VA 4X66L 1F9QA 2CVRA 3CCMA 1ENFA 2ICIA 4J8QA 2CTKA 1E2VA 3KUPA 4X65L 5FLXL 3HKSA 1U5KA 4KY6A 1V8CA 2VL6A 3PUWA 2R7ZH 2JP1A 3LGJA 1PZKD 1TVXA 5E7NA 4CGYB 2KHSA 1WFQA 3CRLC 4UAIA 1G2TA 2ZXOA 4DR3Q 4CDEC 2F0MA 4JI6H 4KMUC 2R93G 1V8QA 2MJHA 4PMBA 2ALYB 4MTNA 4C3IH 3RD4A 4A3FH 3W1BA 1OO9B 2L5TA 2SEBD 4A3EG 1I4GA 2NB0A 4B3SL 3J7AF 1FR3A 3T1HH 4DV3H 1EU3A 5C4JB 4A3GB 1N8RC 3L0OA 4NDXA 4X64H 1CFMA 4YIJA 2HCIA 5JPNC 1HNWL 2OEOA 3JAMc 1GUNA 3U1KA 1EQVA 1JOQA 4JI5H 1SROA 4IUQA 1H9KA 2D2CC 2O2LD 4IN3A 1TWFB 2MQHA 2QGQA 4A3LH 1IYUA 1TWCB 1B3AA 3OOCA 1HNXL 3J80W 1TWGH 1Q90A 4A3IB 2VQFQ 1KLUD 5C0XH 5FK9C 3S1NH 1BQQT 2UUCL 3ULJA 2BDOA 3T1HQ 3CCVA 4G7OC 3H3VC 3Q8DA 1CTMA 3M4OH 2EVBA 3K7UC 1ILQA 5JJKA 3NBIA 2QW7A 4JI3Q 1A3VA 2G9DA 1SSOA 4JI5Q 1Y1WG 4WANA 1F9PA 3HZXA 1C7YA 5FLXE 1AP0A 3R8BA 3H94A 5C3EB 3OSSD 1LTBD 4B3TH 3WOFA 2KVMA 4G7HC 2AKWB 5DLQE 5J3BA 1WTRA 1UG8A 1IKLA 2AHOB 4OO1G 1RF2D 1T9HA 3A54A 3FMCA 2D0OA 5I4DA 1PH9A 4Q5VA 2F0KA 4JI7L 4Z9CB 3RLFA 1HUMA 3URYA 5EJWA 3I73A 1D1KA 1KNEA 5DNFA 1LTTD 5BN3A 1KIXA 1HUNA 3I4NB 2A68C 4DV4L 2DJFC 2B2VA 2HIXA 1HR0W 2CCZA 4B3TQ 2IY5B 4RKBA 3UDXA 3RZDB 1PH2A 2K05A 3BU2A 4EGVA 1L1OB 1N34Q 4JI0Q 4KY5A 5C5MA 4FF2A 2MNAA 1AZPA 2B2UC 3CPFA 2ZM6H 4A3MB 1NR4A 4IZ8A 3OHXC 5EKLA 2CWPA 2N78A 1F9SA 2B2WA 1VF7A 4PG3A 5BR8H 4DV7Q 2Z4IA 1KDBA 4RH6A 1VMPA 5IGGA 4NXMQ 2G5DA 3D4DA 2A6EC 3IRBA 2E2HB 1HZ9A 4F88A 2K1BA 1OXUA 3M4YA 1IBLL 2A68D 3NWSA 3R2TA 4JBMA 4H0LC 5I9OA 1PLFA 3CD6A 1HXYD 2L9HA 5A2QL 1UEAB 4QGUA 5CYUA 2B2YC 1YHQA 4HTHA 1YZ6A 2NZ1D 1D5ZC 1JORA 2I46A 4QB4A 2B63G 3NENA 2AWOA 1XNRH 4LW1A 4DR5H 1ASYA 5LMNW 5BR8Q 3I70A 1S5ED 3PQIA 4OWWB 3HOYG 2YTXA 3K81C 4X66Q 2CTMA 4MTKA 1I5FA 2A6ED 3AEVB 2PQEA 1FD7D 2IX3A 4X65Q 4K0KH 1U9RA 1F9RA 1QCBD 2Z6KC 2K52A 1Q86C 1XMOH 4N8FA 1NBWA 1OXTA 1WTXA 3T56B 2G8YA 1RL2A 4DAVA 4F8MA 3ZYYX 3S2DB 1EWHA 4HSVA 2QA4A 1TY0A 1L0XB 1YNNC 4XTCS 3W2DA 2P5ZX 4IALA 5K5PA 1WHRA 4A3BH 3IFDA 4HCSA 2LMCB 2NVXH 4IO9A 4IPCA 2E8GA 1TQOA 4B3SQ 3IAYA 2VQEL 2I5MX 2EPBA 4HEDA 1S40A 1BBWA 2RSOA 1H9MA 5IYDH 1WD0A 1PH7A 2CTJA 1E7ZA 2Q2HA 1N9WA 5IGFA 2NZHA 3I91A 3TZDA 1HNWQ 3T16A 1FNVA 3EN2A 1O7ZA 1NY4A 3DWAA 4LUVA 4NW2A 4HSPA 5COYA 3GTGB 4TQUS 1HNXQ 3EA6A 2PI2A 5CR3A 1ESFA 4GZYC 1VQEA 2WB1E 1WD1A 2XWBB 2IWHA 1PV4A 5ELFA 2QF7A 1LTID 1NMFA 2UUCQ 3GR5A 2R93H 2F0TA 1VBIA 2PW7A 2F4VH 5LL6X 3A74A 4A3DB 1I6VC 3HG9A 4K5VA 1N33H 4A3EH 2JQOA 3GTKH 4EC5A 4KJOA 2E3UA 3P20A 1K8AC 4OONA 4OX9L 4J15A 1HNZL 5IP7G 3HEJA 1G91A 1EY8A 4UP8A 4R1JA 2PPBC 3BYYB 4FYDA 4DUZH 3L9AX 1LYLA 2FMRA 5KNBA 1VQ4A 1RKNA 2RQXA 2KHJA 3BYTB 3QIAA 1B2TA 3K5MA 1XMQL 2F4VQ 2AQ2B 3RNUA 3S1RB 3CCUA 3NSWA 2C35B 3KF8B 4U68A 4IUTA 3PV0A 3J7YW 1J5KA 3PUVA 3QWNA 1VQGA 4NB3A 4DF7A 2A6HC 4H7BA 1X6OA 2R92G 4YHHH 4DV4Q 1MSGA 4B3RH 4K6LA 3VYUA 1PH3A 1D1IA 2F0DA 1XTCD 1N32L 2FINB 1VQAA 2B3GA 4OGQC 4K8IA 1SYCA 3X3MA 4BBRG 1Y1WH 4ZQ3A 3OMGA 4JI1L 1I94L 4JCVE 4APVA 1C9OA 4B3ML 2Y3MA 3SB1A 4RGMA 2A19A 3RN2A 3HOUG 5M5YB 3MHBA 1BBXC 4OO1H 1FYCA 2K4KA 4OHJA 4R4QA 1S4ZA 3M9BA 4DV2L 3DHQA 4YHHQ 4DR1L 3CRKC 1K0SA 5CV4A 4BS9A 1Z7TA 3ONAB 3FKIG 2K33A 2A69C 3U9OA 4FO2A 4GKKH 2E5LH 4K8JA 1A2UA 1B9NA 1I4HA 4A3KG 2WB1B 2C9OA 5T1GA 4A93B 2EJMA 4M8AA 3A8KE 1PTOH 3RLOA 1SMYC 4WRDA 4LF8L 3K7AH 3RUZA 1LV9A 2EDGA 1Y8OB 2QCPX 1WTPA 2NBFA 2KQ3A 2QEXA 2EXDA 1VQHA 2UUAH 4PDBA 4RKLA 3K0YA 1YHAA 3RMHA 2RA4A 4GNXB 3PIO3 3OW7A 1BBUA 1EQQA 1CKMA 4KJNA 1RCVD 3OTOL 1GHKA 1PFBA 1RJTA 5E4WC 2A69D 2OPUA 1EFID 2OF1A 2KECA 3CC4A 4QIWE 3GABA 1EY4A 1YHBA 2LKVA 4RCNA 4RHRA 2H4OA 3BZCA 4MZ9A 4CHTB 4HR7B 1F2YA 2MPMA 1SMYD 5EPJA 1SJHD 4LFAL 3SR1A 4LF6L 3KFUA 1L0YB 1HPCA 1A63A 1XTDA 2D9IA 3NUCA 1HH2P 1YEZA 4A3GG 4FXGC 4OXPA 1EY7A 3ZJYC 4JPBW 4DUYH 2KA7A 1TXYA 2ZTCA 2ASBA 2DUDA 3GTPB 3I7FA 1FJGL 5T1IA 3S2HB 3KLSX 4QMFB 3E0JA 3VKEA 1WTOA 3HOYH 1XPRA 4JC0A 3SVMA 1EY0A 4JYAH 3T13A 1IW7C 1H9SA 4Q0FA 1DCZA 2AQ1B 1Q46A 1LT3D 4DV1L 2O5IC 2UUBH 4KD4A 4BXXG 1KRTA 1HR0H 1K1GA 4HJ7A 4DR2H 3RZOB 3GD7A 2L4NA 2F0PA 4FXDA 4DV0H 1HA5A 4BY1B 3A8IE 1EOTA 4GLVB 1VQFA 2V4DA 2CPQA 1XNQH 1WVLA 1S5BD 3QG1A 3E0EA 2O5JC 4DR7H 4BA2I 4G7ZC 2B2YA 2NVTH 3TP8A 1ZZJA 1M4VA 3GTMH 2OCEA 1NXUA 2NN6I 2FFKB 1HNZQ 3CU7A 2M9VA 3DWPA 5CV6A 2WV6D 3S17B 2NTTA 4R4IA 2V1CC 2JVZA 1RD9D 4BY7G 2OQKA 1VQIA 3K5LA 2JA7B 3BZKA 3MXNA 4K2KA 3SE0A 2DGYA 3KOJA 1UUPA 4GKJL 5IT9c 4BBSB 1UE5A 2DY7A 4LJZC 5LMNH 1ZYRC 2JA6B 4G08A 3OWEB 1STAA 2Z6KA 1IBML 4DR7Q 3GTLH 1XXGA 4QIWB 2F0FA 2F0JA 3JAMi 2N3SA 2VKCA 3D31A 5KNCA 2MJ8A 2DN8A 3I0PA 2EYJA 5C4XB 3FP9A 1N32Q 5ELNA 2JA8G 3NCVA 2PYKA 2RHQB 1TKWB 1DM0B 5FO8B 4A3MG 1JMCA 3HOZG 2NVQB 3BDCA 4JI1Q 2Z0SA 1WYDA 2NYZD 4DNRB 3HOWH 1HQMC 1I4QA 5IP7H 4JBKA 1S20A 2E2JB 3S15H 1JC7A 4JI4L 2UU9H 1SR3A 3Q24A 1V1PB 4RWSC 1JT8A 1ZYRD 5GQOA 1B70B 5J1ZA 2F0EA 4DV2Q 1HZBA 1KAWA 1TS3A 2GN5A 2OXPA 1B50A 2Q2IA 2HT1A 3C3LA 3PO3G 4KD3A 2QEJC 2I5LX 1VQOA 1L1OC 2E76C 2EYFA 3R2IA 1BVSA 2N8NA 1TR5A 5M5WB 3J81W 1K83B 1XPUA 5F2DA 1K9MC 2R92H 1QE6A 2AQ3B 2A73B 1VQ7A 2JA5G 1UE6A 1I4RA 5IWAL 1R9TB 4IOCA 4C56C 4LF8Q 4JV5L 2KBNA 4C3JG 4IPHA 2FMCA 4UDUC 2K32A 3OIPA 4BBRH 3UDFA 4ULLA 2F0HA 3S14H 1QUQB 2WAQE 3NELA 4HJ9A 1VQBA 4KHVA 1NR2A 3HOUH 3VR5A 5FJ8G 3OTOQ 5IYBG 5M3MG 1HZCA 5JAVA 1LTSD 1N36H 3I4OA 1A15A 1JR0D 3T51B 4GN3B 3U4VA 1GJXA 4DV5H 3T1YH 5IE8A 2BCOA 3FKIH 4LFAQ 3EZJA 2FXQA 1B1ZA 1VQ6A 1MI2A 4A3KH 2XVSA 4LF4H 4HAEA 1EZ8A 4NMZA 4WFN3 2XRSD 1GUTA 4QUCA 2F0NA 5EGTA 1FJGQ 1EZ6A 2XRQD 1S72A 4GN5A 5FOBB 4PV1C 2E75C 1FL0A 1RDPD 4JOIC 1KHIA 1JOOA 1KL9A 1IL8A 2VW9A 1HCZA 4UY8C 2BA1A 3SDZA 3VYTA 3PIP3 4DV1Q 1YNXA 1SFOB 4FP5D 1I50B 1LACA 1I6HB 5IT9E 3FAUA 1EIGA 4QCLA 3J80i 2ANNA 3HKZG 2CQOA 2Z8LA 3AYHB 1VMCA 1E1OA 3OWFA 2P2RA 3R3OA 3M85A 1HTPA 3DEPA 4RG1A 4A3GH 1Z6HA 2R61A 1P16A 1KHMA 3ICEA 5A2QW 1UE7A 5GAGC 1C8CA 1Q81C 4JI2L 2WIIB 4V190 1IKMA 1TWCH 5IGCA 1VQ9A 2YTVA 5C44G 3SGIA 3BVMA 3J81c 2VQFH 4P73A 2IHEA 1Y8NB 1GO3E 4GKJQ 4BXXH 2JEBI 2WAQB 3K5NA 5EKKA 1DOLA 5M5XB 4ZAIA 4NXNH 3D6WA 1EUJA 4CBVA 4QF4A 1S3OA 1VS0A 3TZUA 2F0SA 4KKSA 4JI3H 1STGA 3Q23A 1YITA 1W3SA 5BN5A 1SNDA 2ENBA 1SEIA 1GKHA 4KV6A 3IFTA 2EY2A 1EIFA 1FGUA 1PVOA 1ENAA 2CWHA 2LRRA 4I65A 2H1EA 3HOXG 1STHA 1SYFA 4JI4Q 4ABNA 4NXNQ 2WINB 4BY7H 3TSSA 2R7ZB 4JVZA 3C1FA 1IYJB 1WTVA 1J9OA 2CWAA 1S5CD 4A75A 1EFWA 2X6LA 1TS4A 2EOTA 4NPSA 1YBYA 2HH3A 1HJPA 1ZZKA 3K6OA 4LF9L 4WALA 2UXBL 3I4MG 4C3IB 1Y14B 3UDIA 1HTLD 2L11A 1U0LA 2Y0SG 4GLXA 1ET9A 4A3FB 1I6UA 2IJ0A 1LABA 1RIPA 2XWJB 3TDQA 2ZXPA 5IWAQ 1N34H 1GUSA 5ELCA 3O13A 4JI0H 1AW7A 1STBA 1JE5A 2MHVA 2PZTA 1Y1VG 1HQRD 5KNDA 4H8AA 3JAML 3ERQA 2JA8H 1WCMG 3OIQA 3H0GG 3HOZH 4A3MH 1PMRA 2Z9HA 3MC0B 1DD2A 3CKIB 4OL7A 1J6QA 4WJWA 4DV7H 4NXMH 4I7AA 3LNNA 4G57A 1TWGB 4QJFA 3M4PA 4EX5A 4MIUA 1CSQA 2EYMA 1W2BA 2F0IA 1EEFD 2R7FA 3GTOB 2VY3A 1K28A 4JVYA 1ZXTA 3ERSX 3PO3H 4DGZA 4YY3L 1JICA 3S1NB 3A55A 4K6DA 2SDFA 3VR3A 2ID0A 4DR6L 2NUCA 3PF5A 2HQLA 1SDFA 3TN2A 3CPWA 3OPOA 4GNXC 4LFBL 4L5SA 2EXZA 2JA5H 1YNJC 3K58A 1VQJA 1G6ZA 3QR8A 5D3IB 4C3JH 3M3YH 4X66H 1BUVT 4OIJA 2CQAA 1MJCA 4AQYL 2QDBA 3NEMA 1Q8KA 1GUOA 3FPUB 1VCIA 4X65H 1QZHA 2ZJRA 4JG2A 1Q3LA 1NNXA 4AYBE 4X62L 2LTMA 1NSNS 3QOJA 1SN8A 2EQSA 1H95A 3PUYA 5ELBA 5FJ8H 1K3BC 5IYBH 3D3RA 5M3MH 3PO2G 1V9NA 3AQQA 1LT6D 3I56A 5EQ0A 2B39A 1S5FD 3NE5B 3NHHA 3J80c 1YNJD 2KEDA 1EY6A 2JSOA 1IBKL 2D5DA 5I2YA 1P8LA 3HRZC 4YWLA 2MO1A 2HQEA 3JAME 1AFPA 1L1OA 4ILWA 4B3SH 4IJHA 1G2SA 1F77A 2WFWA 4L5QA 3PIPA 4RGTA 4TKOB 5M3FG 4RGNA 1HNWH 4B8TA 4JI2Q 3J7A5 1PH4A 4LF7L 2PZWA 2UXDL 3GTGH 3RLNA 3P75A 2F3IA 1EYDA 2K5QA 2RVLA 1U4LA 3GO5A 1HNXH 5FLMG 5C3XA 4UHVA 5E4XA 4FF1A 1Q7YC 2MO0A 3CCEA 5CV5A 4DAPA 2AUKA 2UUCH 3VYSA 1SYEA 1V9PA 3DEOA 2EYHA 5BN4A 1EWCA 3KLSA 4EVOA 1D6EC 2IX1A 4C2MH 4A3JG 2J4XA 1CT1D 1EYAA 3HFZB 3S16H 5CBAE 1JJ2A 5JVH3 3AEVA 2VB2X 1YNND 4R4TA 3MFYA 4DKAC 3CMEA 1JWSD 5LMUL 3J7ZC 2JK8A 2KCMA 3WOEA 1PH6A 1VIGA 3D6CA 1ILPA 1UWVA 5J22A 4X3TA 1I3QB 5C44H 4JOIA 4JI7H 1JOKA 4PMCA 2UXCL 4PNYA 4DK6C 1CA6A 3KYHC 1MSHA 4AYBB 4M1UB 1AZQA 1II3A 4DAMA 5L37A 1AN8A 3H3VH 4LF9Q 3TP7A 2N49A 4YCVA 4DV6L 3HOWG 3DLLA 4DV4H 3CCRA 4XDXA 4A3BB 4L5RC 3S1QB 2NVXB 3MEFA 3F2CA 1TUAA 2PCFB 2NWGA 2O4XA 1PZJD 4YWMA 4E9JA 2FJ2A 3TP6A 1BCPB 3S1MH 2RCNA 1C0AA 2JEAI 3CXCA 1DGSA 4JI7Q 5M5YH 3T53B 4CKBA 5K36G 1EEID 2Z1CA 2D9UA 3HOXH 4ZUIA 5H1SE 1IYVA 3DXJC 1U4MA 2IL8A 5LL6S 3E5SA 5EKIA 1SXTA 3A8JE 1IBLH 4XT1B 3C2PA 1LUZA 1KTKA 3BDOA 5HGQA 4YY3Q 4KN4C 3MTSA 4BWGB 5JEAJ 1ICWA 2F0LA 2HH2A 2GVAA 2R93B 3A7LA 4DR6Q 3J80E 1QG7A 3KDFB 3V05A 3I4MH 1JWMD 1T5XD 2XGTA 3DM3A 4PZ6A 4XT3B 2J7ZA 4Y7NH 2AXYA 4A3EB 3L7ZC 3D4RA 3GTKB 1O80A 1QNUA 3TQYA 2I0QA 4FVMA 4IFDG 1QVCA 1FNWA 1I4XA 1Y1VH 2KOLA 2A6HD 5M9OA 2IPKD 1WCMH 4AQYQ 1J5EL 3H0GH 2F0OA 1IBLQ 2EYLA 1QVFA
chains in the Genus database with same CATH topology
3GTJH 4DR3Q 1M1KC 4X62Q 4HIDA 1L0WA 1PHJA 2BL5A 1N32Q 5ELNA 2JA8G 1PH5A 2R93G 2RHQB 4GOPA 4QQBX 2MJHA 3HOZG 4A3MG 1JMCA 2ZM6Q 2ALYB 2JA7G 4JI1Q 3CF5A 1TWHH 2Z0SA 4MTNA 1WYDA 3HOWH 4C3IH 2OTLA 3FHWA 5IP7H 4JBKA 4BBSG 1YJWA 4A3FH 3S15H 3W1BA 4A3EG 4JI4L 1SR3A 1CKOA 2JA6G 4B3SL 1VQDA 1DT4A 1IBKQ 1MJEA 2H5XA 1JT8A 4UP9A 3S24A 2YYZA 3CQZH 1B70B 5GQOA 4DV2Q 1I3QH 1HZBA 1N8RC 3L0OA 3GTPH 2I5HA 4GKKL 1KAWA 2GN5A 2E5LL 2Q2IA 2HT1A 2K50A 3PO3G 1Q1BA 1V1QA 1HNWL 5C4XG 3JAMc 2I5LX 1VQOA 1L1OC 2HIVA 4A3DH 5JEAG 3U1KA 1PH1A 1SROA 4IPDA 1KXLA 1BVSA 4A3LH 2MQHA 1Q82C 2N8NA 2QGQA 3CCSA 1VQPA 1XNRQ 1XPUA 1K9MC 1HNXL 4LF7Q 4DR5Q 1TWGH 2R92H 3PCOB 2UXDQ 3M4QA 2BH2A 3PGZA 2VQFQ 1VQKA 1VQ7A 2JA5G 1UE6A 2R7DA 3S1QH 5IWAL 4IOCA 2KCTA 4LF8Q 4JV5L 2KBNA 2UUAL 4IPHA 3F2BA 1KRSA 3S1NH 2PQAB 5AJ3L 2UUCL 1EOVA 4DR4L 3ULJA 3A5UA 3T1HQ 3CCVA 4LF5L 4K0KQ 4BBRH 2PNHA 4A76A 3Q8DA 3UDFA 3M4OH 3PO2H 1VQMA 3K7UC 4LFCL 2VQEQ 5JJKA 3S14H 1XMOQ 1QUQB 2WAQE 3NELA 3L2PA 3S1RH 4HJ9A 1VQBA 4JI3Q 1E24A 1QVGA 3HOUH 2IT1A 4JI5Q 1Y1WG 3CCJA 5FJ8G 3OTOQ 2PQUA 5IYBG 1IXRA 5M3MG 4WANA 1HZCA 4P74A 2CTFA 1C7YA 3ER0A 4LNQA 3I4OA 4A3IG 2MFIA 1IL2A 4MNOA 3TS0A 1MKHA 3PSIA 2UXBQ 4GN3B 2AKWB 5DLQE 5J3BA 3U4VA 2AHOB 4OO1G 1X55A 1X65A 5IE8A 3FKIH 1T9HA 4LFAQ 2FXQA 4DUYL 1PA6A 3S17H 3CCQA 2D0OA 1VQ6A 5ELOA 2BH8A 5M3FH 4GNXA 4A3KH 2JZXA 3TRZA 5LMUQ 1PH9A 4JI7L 3RLFA 2VUMG 2Y0SE 2YQRA 1GVPA 2F52A 1E22A 4R4OA 4BBSH 2KENA 5C0XI 1FJGQ 2ES2A 5FLMH 1S72A 4GN5A 2D0PA 4ALPA 4JYAL 1FL0A 4JOIC 2AMCB 1KIXA 3B6YA 1KHIA 2RF4A 4DV4L 1KL9A 2HIXA 3G71A 2VW9A 2UUBL 2PQAA 5C3EG 1HR0W 2HHHL 1HR0L 2CCZA 4B3TQ 2IY5B 3UDXA 2LXJA 4DV6Q 1PH2A 4JI8L 2BA1A 3BU2A 4UY8C 1D7QA 1L1OB 3CW2C 4DV1Q 1N34Q 1YNXA 4OX9Q 4JI0Q 4Y52H 3J81j 4DR2L 1NTGA 4IFDI 4A3JH 2DGRA 4A93H 1DTJA 2MNAA 3J81i 4DV0L 3CPFA 1E3PA 3J80i 1J4WA 2PMZE 1PH8A 2ANNA 3HKZG 2VZAA 2CQOA 2K5HA 3AYHB 2CWPA 1E1OA 2N78A 4PG3A 4YCUA 4DV3Q 3U58A 4IOAA 1XNQL 4DV7Q 1XMQQ 2P2RA 4NXMQ 1N33Q 1WJJA 3I55A 4DR7L 1EQRA 1X3GA 3IRBA 4LFBQ 3M85A 1HZ9A 1VQCA 3I4NG 3UE0A 4RG1A 4A4IA 4A3GH 1OXUA 1IZ6A 1IBLL 1P16A 2JA9A 1KHMA 4JBMA 3ICEA 3G6EA 4DR3L 5GAEC 2CTMA 4KHPL 3CD6A 4QY7A 3HOVG 1UE7A 3WWVA 5GAGC 1YHQA 4QGUA 4WJ4A 1Q81C 4DUZQ 1YZ6A 1PFSA 3G4SA 1NMGA 4JI2L 1TWAH 2VS1A 1BKBA 1TWCH 1YI2A 4A3CG 1K83H 5IYCG 1VIHA 2B63G 3NENA 3GTQH 5JJLA 1VQ9A 2YTVA 3A0JA 5C44G 2AWOA 3SGIA 4LW1A 2EIFA 2NN6G 1OXVA 1I94Q 5LMNW 1ASYA 3J81c 5LMNL 1EC6A 1R9TH 2K14A 2IHEA 4P73A 1OXXK 3A5ZB 5BR8Q 1GO3E 1VQNA 4B3MQ 3RR5A 4GKJQ 4OWWB 3HOYG 2JEBI 2YTXA 3K81C 4X66Q 4BXXH 1VQ5A 1WE8A 4HIOA 1G6PA 1I5FA 3AEVB 4B3RQ 3U4ZA 2YV5A 1YJ9A 1EUJA 4X65Q 4O0AA 1S3OA 4UPAA 1CSPA 5IP9G 1VS0A 4DR1Q 1J5EQ 4JI6L 2OQ0A 2Z6KC 1LTLA 2K52A 4GLAC 1Q86C 3S2HH 1NBWA 3KF6B 1YITA 1W3SA 2NZOA 1OXTA 3KDFA 1B7YB 1RL2A 1SE8A 1SRUA 1AH9A 1GKHA 1YVCA 3TREA 3U50C 2QA4A 3CC2A 3K0XA 4LWCA 1X9NA 1EIFA 4FDBA 4DNIA 4XTCS 1FGUA 2UU9L 1PVOA 1JJCB 4GOPC 4A3BH 3T1HL 4DV3L 2WAQG 2NVXH 3HOXG 1SMXA 3PUXA 4IO9A 3STBC 5EAYA 4JI4Q 4IPCA 3CMAA 2E8GA 2ZTDA 4X64L 4B3SQ 4NXNQ 2VQEL 2I5MX 2YU9H 1S40A 4BY7H 1JJGA 1BBWA 1G291 5IYDH 3K80C 3M7NA 3BJUA 3RZOH 2CTLA 1PH7A 2CTJA 1IYJB 1E7ZA 2Q2HA 1N9WA 3EBEA 3GDEA 2CWAA 4IPGA 4JI5L 4O2DA 4A75A 2E5LQ 2NZHA 4GKKQ 2LXKA 1EFWA 1HNWQ 4BY1H 1OTCA 4DAYB 3EN2A 4NPSA 1WVNA 1YBYA 2HH3A 4HJAA 1HJPA 3CP0A 1NY4A 4LUVA 1ZZKA 1M90C 4LF9L 4A3GG 4WALA 3OYYA 2UXBL 2PY9A 5IY0A 3I4MG 4TQUS 1Y14B 1HNXQ 2ZJQA 3UDIA 2JJQA 1U0LA 2Y0SG 2WP8J 2PI2A 4GLXA 5C0XJ 2WB1E 1VQEA 1RIPA 2QNDA 1SFOH 3AFPA 5IWAQ 3F1ZA 1PV4A 1A8VA 2UUAQ 4LF6Q 1JE5A 4PZ7A 4HIKA 1NMFA 1Y1VG 3OW2A 1QZGA 3STBD 1CKNB 5AJ3Q 3KJOA 2UUCQ 2B63H 2JA8H 4DR4Q 3KLWA 1WCMG 4LF5Q 2R93H 2ZJPA 3H0GG 2R7ZG 1L2FA 4A3MH 1KC8C 4DPGA 1A62A 2JA7H 3HOZH 2KHIA 4LIJA 2OTJA 4LFCQ 3A74A 1MIUA 3MXNB 1X4MA 1OXSC 1J6QA 2B29A 3UDGA 5GROA 5GAHC 4A3EH 1N36L 4IFDJ 2UXCQ 2JQOA 3GTKH 1X4NA 2JA6H 2E3UA 4B3TL 1X54A 4X6AH 4QJFA 3M4PA 1K8AC 4OONA 4EX5A 4DV5L 4J15A 1CSQA 3T1YL 1W2BA 5IP7G 1HNZL 4OX9L 2RHSB 4A3FG 2R7FA 2VY3A 4JVYA 1EWIA 1K0RA 3ERSX 4UP8A 1O7IA 1PYBA 4R1JA 5C4XH 4YY3L 3PO3H 1ZZIA 4LF4L 4DUYQ 2NVYH 1LYLA 2ID0A 2FMRA 4DR6L 3PF5A 1VQ4A 2HQLA 1QUQA 1UE1A 2KHJA 4POGA 2NVQH 1Q12A 4YWKA 1XMQL 3CPWA 3RNUA 2F4VQ 3CCUA 3F2DA 4GNXC 2C35B 4LFBL 3KF8B 4L5SA 1PYSB 4A3DG 3PV0A 4AYBG 2JA5H 1J5KA 1VQJA 2XTIA 4KHZA 3W1GA 2E2JH 3PUVA 4A3LG 1VQGA 5M5XH 4NB3A 4C3JH 3M3YH 4JYAQ 1JB7A 1X6OA 4XIGS 1MJCA 4AQYL 2R92G 4HJ5A 3E9HA 3NEMA 1Q8KA 5C4JH 4DV4Q 3RN5A 1VCIA 3AFQA 4UP7A 2A1AA 3EIVA 1PH3A 2UUBQ 1QZHA 3G48A 5C0XG 2HHHQ 2ZJRA 4JG2A 1HR0Q 1FVIA 1QVFA 2R6GA 4AYBE 4X62L 1N32L 1SN8A 1VQAA 2B3GA 2EQSA 1H95A 4BBRG 3PUYA 4DR2Q 1Y1WH 1TWFH 5FJ8H 2ZM6L 5IYBH 4JI1L 5M3MH 3PO2G 3NBHB 5M5WH 1I94L 2ATWA 4JCVE 3AQQA 2BA0A 4APVA 5BR8L 1C9OA 1WI5A 4DV0Q 4B3ML 4A3IH 2A19A 3I56A 3RN2A 3F8TA 3HOUG 2LSSA 1XNQQ 1KQSA 1B8AA 2K4KA 4R4QA 4JBWA 3J80c 1IBKL 3M9BA 1P8LA 1SLJA 4YWLA 2MO1A 4DV2L 3TEHB 3I2ZA 4YHHQ 4DR1L 1GM5A 1L1OA 4BA1I 2VUMH 2CKZB 4IJHA 1IBMQ 4JBJA 2ZTEA 3FKIG 2K75A 2WFWA 4L5QA 4KHPQ 3V69A 3PIPA 5GADC 5M3FG 1KD1C 4A3KG 1EYGA 2CFMA 4B8TA 4JI2Q 1XNRL 3J7A5 1PH4A 4LF7L 4OWXB 4DR5L 2UXDL 4ME3A 3GTGH 2VQFL 3RLNA 4EQ5A 1K3RA 3RLOA 1AE3A 2F3IA 4GN4B 5C3EH 3GO5A 3H15A 4LF8L 5FLMG 3K7AH 1X3EA 2K5NA 5LMNQ 4NXNL 1Q7YC 4K0KL 1NE3A 2MO0A 3CCEA 4HJ8A 1LM0A 2EXDA 2QEXA 1VQHA 1UEBA 2CTEA 1V43A 1YHAA 4DK3C 1XMOL 1V9PA 4JI3L 4GNXB 4RMFA 1BBUA 1GD7A 1Z9FA 3W5OA 1EQQA 1CKMA 1AE2A 4JI6Q 3OTOL 2OPUA 4OO1I 4P75A 2WB1G 4C2MH 4A3JG 2IX1A 4WJ3M 4A93G 4JVHA 3CC4A 3HFZB 4P72A 4QIWE 3S16H 3I4NH 1VQLA 4HIMA 1YHBA 3K8AA 1WOCA 4PMWA 3BZCA 4MZ9A 3GTOH 1G51A 3RZDH 1JJ2A 2Q2UA 4IJLA 1Z47A 2YTYA 2UU9Q 4LF6L 4LFAL 3ULPA 3AEVA 3KFUA 1A63A 4R4TA 1Q1EA 3HOVH 1XTDA 1E1TA 1D8LA 1HH2P 1YEZA 4DKAC 3CMEA 3D0FA 5LMUL 4OXPA 3J7ZC 2IHFA 2JK8A 3ZJYC 1I50H 2KCMA 1PH6A 3TS2A 4JV5Q 4OWTB 4TVAB 4A3CH 1I6HH 2D62A 1VIGA 5IYCH 4X64Q 4PZ8A 1UWVA 1TXYA 2ZTCA 1A0IA 2ASBA 2DUDA 3KF6A 5C44H 4R4CA 4JOIA 3I7FA 1FJGL 1NJIC 1HZAA 2UXCL 2PI2E 3UE1A 4DK6C 3KYHC 4QMFB 2GVBA 1XPOA 2E2IH 3VKEA 3HOYH 1XPRA 2OWOA 2E2HH 4DAMA 4JC0A 3H3VH 4POFA 4QL5A 4LF9Q 3ULLA 2N49A 4YCVA 4AIMA 4DV6L 3JC66 3DLLA 3HOWG 4AM3A 3PF4A 1Q46A 2IX0A 4C3HH 3CCRA 4DV1L 1CUKA 1N34L 4JI0L 5IP9H 4BXXG 1XJVA 1KRTA 4L5RC 3MEFA 4L5TA 5FLXc 3F2CA 1TUAA 1ZTGA 1K1GA 3PUZA 2F4VL 4HJ7A 4YWMA 3GD7A 3S1MH 2RCNA 3PIOA 1C0AA 1VQ8A 3CXCA 2JEAI 1DGSA 4JI7Q 4AH6A 4DV7L 4NXML 2ANRA 2A8VA 5M5YH 1N33L 2AWNA 4GOPB 4LUOA 5K36G 4GLVB 4P71A 3CC7A 1VQFA 2CPQA 3HOXH 5H1SE 1N36Q 3E0EA 1YJNA 1X56A 1X3FA 4BA2I 5JJIA 2NVTH 1K73C 1ZZJA 3GTMH 1YIJA 3CAMA 2OCEA 4A3BG 4NBQA 4DV5Q 2NN6I 3T1YQ 1HNZQ 1LUZA 4H02A 4KLKA 4DUZL 1CKNA 4LUZA 5HGQA 3E9IA 4YY3Q 3VDYA 4JI8Q 5JEAJ 4LF4Q 2HH2A 4R4IA 2V1CC 2JVZA 2GVAA 4BY7G 3H3VI 2OQKA 5IYDG 1VQIA 3S2DH 4DR6Q 3BZKA 3KDFB 3KJPA 3I4MH 3CCLA 2DGYA 3KOJA 4PZ6A 2XGTA 3DM3A 4GKJL 4BY1G 5IT9c 1UE5A 2K5VA 4X66L 4Y7NH 3CCMA 1EIYB 2AXYA 4KI0A 3L7ZC 4YHHL 2L15A 2VNUD 2CTKA 2I0QA 3TQYA 4IFDG 4B3RL 4X65L 2OPVA 2Z6KA 3HKSA 1IBML 1QVCA 1Y1VH 4GS3A 1U5KA 3GTLH 3HKZE 4DR7Q 2JE6I 1K8GA 3JAMi 4AQYQ 2N3SA 1WCMH 2VL6A 3PUWA 1J5EL 3D31A 3H0GH 3LGJA 1IBLQ 5E7NA 1ASZA 2R7ZH 1WFQA 4YCWA 3FP9A 2Q2TA 5HY6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GTJ H;  4DR3 Q;  1M1K C;  4X62 Q;  4HID A;  1L0W A;  1PHJ A;  2BL5 A;  1N32 Q;  5ELN A;  2JA8 G;  1PH5 A;  2R93 G;  2RHQ B;  4GOP A;  4QQB X;  2MJH A;  3HOZ G;  4A3M G;  1JMC A;  2ZM6 Q;  2ALY B;  2JA7 G;  4JI1 Q;  3CF5 A;  1TWH H;  2Z0S A;  4MTN A;  1WYD A;  3HOW H;  4C3I H;  2OTL A;  3FHW A;  5IP7 H;  4JBK A;  4BBS G;  1YJW A;  4A3F H;  3S15 H;  3W1B A;  4A3E G;  4JI4 L;  1SR3 A;  1CKO A;  2JA6 G;  4B3S L;  1VQD A;  1DT4 A;  1IBK Q;  1MJE A;  2H5X A;  1JT8 A;  4UP9 A;  3S24 A;  2YYZ A;  3CQZ H;  1B70 B;  5GQO A;  4DV2 Q;  1I3Q H;  1HZB A;  1N8R C;  3L0O A;  3GTP H;  2I5H A;  4GKK L;  1KAW A;  2GN5 A;  2E5L L;  2Q2I A;  2HT1 A;  2K50 A;  3PO3 G;  1Q1B A;  1V1Q A;  1HNW L;  5C4X G;  3JAM c;  2I5L X;  1VQO A;  1L1O C;  2HIV A;  4A3D H;  5JEA G;  3U1K A;  1PH1 A;  1SRO A;  4IPD A;  1KXL A;  1BVS A;  4A3L H;  2MQH A;  1Q82 C;  2N8N A;  2QGQ A;  3CCS A;  1VQP A;  1XNR Q;  1XPU A;  1K9M C;  1HNX L;  4LF7 Q;  4DR5 Q;  1TWG H;  2R92 H;  3PCO B;  2UXD Q;  3M4Q A;  2BH2 A;  3PGZ A;  2VQF Q;  1VQK A;  1VQ7 A;  2JA5 G;  1UE6 A;  2R7D A;  3S1Q H;  5IWA L;  4IOC A;  2KCT A;  4LF8 Q;  4JV5 L;  2KBN A;  2UUA L;  4IPH A;  3F2B A;  1KRS A;  3S1N H;  2PQA B;  5AJ3 L;  2UUC L;  1EOV A;  4DR4 L;  3ULJ A;  3A5U A;  3T1H Q;  3CCV A;  4LF5 L;  4K0K Q;  4BBR H;  2PNH A;  4A76 A;  3Q8D A;  3UDF A;  3M4O H;  3PO2 H;  1VQM A;  3K7U C;  4LFC L;  2VQE Q;  5JJK A;  3S14 H;  1XMO Q;  1QUQ B;  2WAQ E;  3NEL A;  3L2P A;  3S1R H;  4HJ9 A;  1VQB A;  4JI3 Q;  1E24 A;  1QVG A;  3HOU H;  2IT1 A;  4JI5 Q;  1Y1W G;  3CCJ A;  5FJ8 G;  3OTO Q;  2PQU A;  5IYB G;  1IXR A;  5M3M G;  4WAN A;  1HZC A;  4P74 A;  2CTF A;  1C7Y A;  3ER0 A;  4LNQ A;  3I4O A;  4A3I G;  2MFI A;  1IL2 A;  4MNO A;  3TS0 A;  1MKH A;  3PSI A;  2UXB Q;  4GN3 B;  2AKW B;  5DLQ E;  5J3B A;  3U4V A;  2AHO B;  4OO1 G;  1X55 A;  1X65 A;  5IE8 A;  3FKI H;  1T9H A;  4LFA Q;  2FXQ A;  4DUY L;  1PA6 A;  3S17 H;  3CCQ A;  2D0O A;  1VQ6 A;  5ELO A;  2BH8 A;  5M3F H;  4GNX A;  4A3K H;  2JZX A;  3TRZ A;  5LMU Q;  1PH9 A;  4JI7 L;  3RLF A;  2VUM G;  2Y0S E;  2YQR A;  1GVP A;  2F52 A;  1E22 A;  4R4O A;  4BBS H;  2KEN A;  5C0X I;  1FJG Q;  2ES2 A;  5FLM H;  1S72 A;  4GN5 A;  2D0P A;  4ALP A;  4JYA L;  1FL0 A;  4JOI C;  2AMC B;  1KIX A;  3B6Y A;  1KHI A;  2RF4 A;  4DV4 L;  1KL9 A;  2HIX A;  3G71 A;  2VW9 A;  2UUB L;  2PQA A;  5C3E G;  1HR0 W;  2HHH L;  1HR0 L;  2CCZ A;  4B3T Q;  2IY5 B;  3UDX A;  2LXJ A;  4DV6 Q;  1PH2 A;  4JI8 L;  2BA1 A;  3BU2 A;  4UY8 C;  1D7Q A;  1L1O B;  3CW2 C;  4DV1 Q;  1N34 Q;  1YNX A;  4OX9 Q;  4JI0 Q;  4Y52 H;  3J81 j;  4DR2 L;  1NTG A;  4IFD I;  4A3J H;  2DGR A;  4A93 H;  1DTJ A;  2MNA A;  3J81 i;  4DV0 L;  3CPF A;  1E3P A;  3J80 i;  1J4W A;  2PMZ E;  1PH8 A;  2ANN A;  3HKZ G;  2VZA A;  2CQO A;  2K5H A;  3AYH B;  2CWP A;  1E1O A;  2N78 A;  4PG3 A;  4YCU A;  4DV3 Q;  3U58 A;  4IOA A;  1XNQ L;  4DV7 Q;  1XMQ Q;  2P2R A;  4NXM Q;  1N33 Q;  1WJJ A;  3I55 A;  4DR7 L;  1EQR A;  1X3G A;  3IRB A;  4LFB Q;  3M85 A;  1HZ9 A;  1VQC A;  3I4N G;  3UE0 A;  4RG1 A;  4A4I A;  4A3G H;  1OXU A;  1IZ6 A;  1IBL L;  1P16 A;  2JA9 A;  1KHM A;  4JBM A;  3ICE A;  3G6E A;  4DR3 L;  5GAE C;  2CTM A;  4KHP L;  3CD6 A;  4QY7 A;  3HOV G;  1UE7 A;  3WWV A;  5GAG C;  1YHQ A;  4QGU A;  4WJ4 A;  1Q81 C;  4DUZ Q;  1YZ6 A;  1PFS A;  3G4S A;  1NMG A;  4JI2 L;  1TWA H;  2VS1 A;  1BKB A;  1TWC H;  1YI2 A;  4A3C G;  1K83 H;  5IYC G;  1VIH A;  2B63 G;  3NEN A;  3GTQ H;  5JJL A;  1VQ9 A;  2YTV A;  3A0J A;  5C44 G;  2AWO A;  3SGI A;  4LW1 A;  2EIF A;  2NN6 G;  1OXV A;  1I94 Q;  5LMN W;  1ASY A;  3J81 c;  5LMN L;  1EC6 A;  1R9T H;  2K14 A;  2IHE A;  4P73 A;  1OXX K;  3A5Z B;  5BR8 Q;  1GO3 E;  1VQN A;  4B3M Q;  3RR5 A;  4GKJ Q;  4OWW B;  3HOY G;  2JEB I;  2YTX A;  3K81 C;  4X66 Q;  4BXX H;  1VQ5 A;  1WE8 A;  4HIO A;  1G6P A;  1I5F A;  3AEV B;  4B3R Q;  3U4Z A;  2YV5 A;  1YJ9 A;  1EUJ A;  4X65 Q;  4O0A A;  1S3O A;  4UPA A;  1CSP A;  5IP9 G;  1VS0 A;  4DR1 Q;  1J5E Q;  4JI6 L;  2OQ0 A;  2Z6K C;  1LTL A;  2K52 A;  4GLA C;  1Q86 C;  3S2H H;  1NBW A;  3KF6 B;  1YIT A;  1W3S A;  2NZO A;  1OXT A;  3KDF A;  1B7Y B;  1RL2 A;  1SE8 A;  1SRU A;  1AH9 A;  1GKH A;  1YVC A;  3TRE A;  3U50 C;  2QA4 A;  3CC2 A;  3K0X A;  4LWC A;  1X9N A;  1EIF A;  4FDB A;  4DNI A;  4XTC S;  1FGU A;  2UU9 L;  1PVO A;  1JJC B;  4GOP C;  4A3B H;  3T1H L;  4DV3 L;  2WAQ G;  2NVX H;  3HOX G;  1SMX A;  3PUX A;  4IO9 A;  3STB C;  5EAY A;  4JI4 Q;  4IPC A;  3CMA A;  2E8G A;  2ZTD A;  4X64 L;  4B3S Q;  4NXN Q;  2VQE L;  2I5M X;  2YU9 H;  1S40 A;  4BY7 H;  1JJG A;  1BBW A;  1G29 1;  5IYD H;  3K80 C;  3M7N A;  3BJU A;  3RZO H;  2CTL A;  1PH7 A;  2CTJ A;  1IYJ B;  1E7Z A;  2Q2H A;  1N9W A;  3EBE A;  3GDE A;  2CWA A;  4IPG A;  4JI5 L;  4O2D A;  4A75 A;  2E5L Q;  2NZH A;  4GKK Q;  2LXK A;  1EFW A;  1HNW Q;  4BY1 H;  1OTC A;  4DAY B;  3EN2 A;  4NPS A;  1WVN A;  1YBY A;  2HH3 A;  4HJA A;  1HJP A;  3CP0 A;  1NY4 A;  4LUV A;  1ZZK A;  1M90 C;  4LF9 L;  4A3G G;  4WAL A;  3OYY A;  2UXB L;  2PY9 A;  5IY0 A;  3I4M G;  4TQU S;  1Y14 B;  1HNX Q;  2ZJQ A;  3UDI A;  2JJQ A;  1U0L A;  2Y0S G;  2WP8 J;  2PI2 A;  4GLX A;  5C0X J;  2WB1 E;  1VQE A;  1RIP A;  2QND A;  1SFO H;  3AFP A;  5IWA Q;  3F1Z A;  1PV4 A;  1A8V A;  2UUA Q;  4LF6 Q;  1JE5 A;  4PZ7 A;  4HIK A;  1NMF A;  1Y1V G;  3OW2 A;  1QZG A;  3STB D;  1CKN B;  5AJ3 Q;  3KJO A;  2UUC Q;  2B63 H;  2JA8 H;  4DR4 Q;  3KLW A;  1WCM G;  4LF5 Q;  2R93 H;  2ZJP A;  3H0G G;  2R7Z G;  1L2F A;  4A3M H;  1KC8 C;  4DPG A;  1A62 A;  2JA7 H;  3HOZ H;  2KHI A;  4LIJ A;  2OTJ A;  4LFC Q;  3A74 A;  1MIU A;  3MXN B;  1X4M A;  1OXS C;  1J6Q A;  2B29 A;  3UDG A;  5GRO A;  5GAH C;  4A3E H;  1N36 L;  4IFD J;  2UXC Q;  2JQO A;  3GTK H;  1X4N A;  2JA6 H;  2E3U A;  4B3T L;  1X54 A;  4X6A H;  4QJF A;  3M4P A;  1K8A C;  4OON A;  4EX5 A;  4DV5 L;  4J15 A;  1CSQ A;  3T1Y L;  1W2B A;  5IP7 G;  1HNZ L;  4OX9 L;  2RHS B;  4A3F G;  2R7F A;  2VY3 A;  4JVY A;  1EWI A;  1K0R A;  3ERS X;  4UP8 A;  1O7I A;  1PYB A;  4R1J A;  5C4X H;  4YY3 L;  3PO3 H;  1ZZI A;  4LF4 L;  4DUY Q;  2NVY H;  1LYL A;  2ID0 A;  2FMR A;  4DR6 L;  3PF5 A;  1VQ4 A;  2HQL A;  1QUQ A;  1UE1 A;  2KHJ A;  4POG A;  2NVQ H;  1Q12 A;  4YWK A;  1XMQ L;  3CPW A;  3RNU A;  2F4V Q;  3CCU A;  3F2D A;  4GNX C;  2C35 B;  4LFB L;  3KF8 B;  4L5S A;  1PYS B;  4A3D G;  3PV0 A;  4AYB G;  2JA5 H;  1J5K A;  1VQJ A;  2XTI A;  4KHZ A;  3W1G A;  2E2J H;  3PUV A;  4A3L G;  1VQG A;  5M5X H;  4NB3 A;  4C3J H;  3M3Y H;  4JYA Q;  1JB7 A;  1X6O A;  4XIG S;  1MJC A;  4AQY L;  2R92 G;  4HJ5 A;  3E9H A;  3NEM A;  1Q8K A;  5C4J H;  4DV4 Q;  3RN5 A;  1VCI A;  3AFQ A;  4UP7 A;  2A1A A;  3EIV A;  1PH3 A;  2UUB Q;  1QZH A;  3G48 A;  5C0X G;  2HHH Q;  2ZJR A;  4JG2 A;  1HR0 Q;  1FVI A;  1QVF A;  2R6G A;  4AYB E;  4X62 L;  1N32 L;  1SN8 A;  1VQA A;  2B3G A;  2EQS A;  1H95 A;  4BBR G;  3PUY A;  4DR2 Q;  1Y1W H;  1TWF H;  5FJ8 H;  2ZM6 L;  5IYB H;  4JI1 L;  5M3M H;  3PO2 G;  3NBH B;  5M5W H;  1I94 L;  2ATW A;  4JCV E;  3AQQ A;  2BA0 A;  4APV A;  5BR8 L;  1C9O A;  1WI5 A;  4DV0 Q;  4B3M L;  4A3I H;  2A19 A;  3I56 A;  3RN2 A;  3F8T A;  3HOU G;  2LSS A;  1XNQ Q;  1KQS A;  1B8A A;  2K4K A;  4R4Q A;  4JBW A;  3J80 c;  1IBK L;  3M9B A;  1P8L A;  1SLJ A;  4YWL A;  2MO1 A;  4DV2 L;  3TEH B;  3I2Z A;  4YHH Q;  4DR1 L;  1GM5 A;  1L1O A;  4BA1 I;  2VUM H;  2CKZ B;  4IJH A;  1IBM Q;  4JBJ A;  2ZTE A;  3FKI G;  2K75 A;  2WFW A;  4L5Q A;  4KHP Q;  3V69 A;  3PIP A;  5GAD C;  5M3F G;  1KD1 C;  4A3K G;  1EYG A;  2CFM A;  4B8T A;  4JI2 Q;  1XNR L;  3J7A 5;  1PH4 A;  4LF7 L;  4OWX B;  4DR5 L;  2UXD L;  4ME3 A;  3GTG H;  2VQF L;  3RLN A;  4EQ5 A;  1K3R A;  3RLO A;  1AE3 A;  2F3I A;  4GN4 B;  5C3E H;  3GO5 A;  3H15 A;  4LF8 L;  5FLM G;  3K7A H;  1X3E A;  2K5N A;  5LMN Q;  4NXN L;  1Q7Y C;  4K0K L;  1NE3 A;  2MO0 A;  3CCE A;  4HJ8 A;  1LM0 A;  2EXD A;  2QEX A;  1VQH A;  1UEB A;  2CTE A;  1V43 A;  1YHA A;  4DK3 C;  1XMO L;  1V9P A;  4JI3 L;  4GNX B;  4RMF A;  1BBU A;  1GD7 A;  1Z9F A;  3W5O A;  1EQQ A;  1CKM A;  1AE2 A;  4JI6 Q;  3OTO L;  2OPU A;  4OO1 I;  4P75 A;  2WB1 G;  4C2M H;  4A3J G;  2IX1 A;  4WJ3 M;  4A93 G;  4JVH A;  3CC4 A;  3HFZ B;  4P72 A;  4QIW E;  3S16 H;  3I4N H;  1VQL A;  4HIM A;  1YHB A;  3K8A A;  1WOC A;  4PMW A;  3BZC A;  4MZ9 A;  3GTO H;  1G51 A;  3RZD H;  1JJ2 A;  2Q2U A;  4IJL A;  1Z47 A;  2YTY A;  2UU9 Q;  4LF6 L;  4LFA L;  3ULP A;  3AEV A;  3KFU A;  1A63 A;  4R4T A;  1Q1E A;  3HOV H;  1XTD A;  1E1T A;  1D8L A;  1HH2 P;  1YEZ A;  4DKA C;  3CME A;  3D0F A;  5LMU L;  4OXP A;  3J7Z C;  2IHF A;  2JK8 A;  3ZJY C;  1I50 H;  2KCM A;  1PH6 A;  3TS2 A;  4JV5 Q;  4OWT B;  4TVA B;  4A3C H;  1I6H H;  2D62 A;  1VIG A;  5IYC H;  4X64 Q;  4PZ8 A;  1UWV A;  1TXY A;  2ZTC A;  1A0I A;  2ASB A;  2DUD A;  3KF6 A;  5C44 H;  4R4C A;  4JOI A;  3I7F A;  1FJG L;  1NJI C;  1HZA A;  2UXC L;  2PI2 E;  3UE1 A;  4DK6 C;  3KYH C;  4QMF B;  2GVB A;  1XPO A;  2E2I H;  3VKE A;  3HOY H;  1XPR A;  2OWO A;  2E2H H;  4DAM A;  4JC0 A;  3H3V H;  4POF A;  4QL5 A;  4LF9 Q;  3ULL A;  2N49 A;  4YCV A;  4AIM A;  4DV6 L;  3JC6 6;  3DLL A;  3HOW G;  4AM3 A;  3PF4 A;  1Q46 A;  2IX0 A;  4C3H H;  3CCR A;  4DV1 L;  1CUK A;  1N34 L;  4JI0 L;  5IP9 H;  4BXX G;  1XJV A;  1KRT A;  4L5R C;  3MEF A;  4L5T A;  5FLX c;  3F2C A;  1TUA A;  1ZTG A;  1K1G A;  3PUZ A;  2F4V L;  4HJ7 A;  4YWM A;  3GD7 A;  3S1M H;  2RCN A;  3PIO A;  1C0A A;  1VQ8 A;  3CXC A;  2JEA I;  1DGS A;  4JI7 Q;  4AH6 A;  4DV7 L;  4NXM L;  2ANR A;  2A8V A;  5M5Y H;  1N33 L;  2AWN A;  4GOP B;  4LUO A;  5K36 G;  4GLV B;  4P71 A;  3CC7 A;  1VQF A;  2CPQ A;  3HOX H;  5H1S E;  1N36 Q;  3E0E A;  1YJN A;  1X56 A;  1X3F A;  4BA2 I;  5JJI A;  2NVT H;  1K73 C;  1ZZJ A;  3GTM H;  1YIJ A;  3CAM A;  2OCE A;  4A3B G;  4NBQ A;  4DV5 Q;  2NN6 I;  3T1Y Q;  1HNZ Q;  1LUZ A;  4H02 A;  4KLK A;  4DUZ L;  1CKN A;  4LUZ A;  5HGQ A;  3E9I A;  4YY3 Q;  3VDY A;  4JI8 Q;  5JEA J;  4LF4 Q;  2HH2 A;  4R4I A;  2V1C C;  2JVZ A;  2GVA A;  4BY7 G;  3H3V I;  2OQK A;  5IYD G;  1VQI A;  3S2D H;  4DR6 Q;  3BZK A;  3KDF B;  3KJP A;  3I4M H;  3CCL A;  2DGY A;  3KOJ A;  4PZ6 A;  2XGT A;  3DM3 A;  4GKJ L;  4BY1 G;  5IT9 c;  1UE5 A;  2K5V A;  4X66 L;  4Y7N H;  3CCM A;  1EIY B;  2AXY A;  4KI0 A;  3L7Z C;  4YHH L;  2L15 A;  2VNU D;  2CTK A;  2I0Q A;  3TQY A;  4IFD G;  4B3R L;  4X65 L;  2OPV A;  2Z6K A;  3HKS A;  1IBM L;  1QVC A;  1Y1V H;  4GS3 A;  1U5K A;  3GTL H;  3HKZ E;  4DR7 Q;  2JE6 I;  1K8G A;  3JAM i;  4AQY Q;  2N3S A;  1WCM H;  2VL6 A;  3PUW A;  1J5E L;  3D31 A;  3H0G H;  3LGJ A;  1IBL Q;  5E7N A;  1ASZ A;  2R7Z H;  1WFQ A;  4YCW A;  3FP9 A;  2Q2T A;  5HY6 A; 
#chains in the Genus database with same CATH topology
 3GTJ H;  4X62 Q;  1PHJ A;  2XN9 C;  1L0W A;  3SK6 A;  1WTH A;  4EQP A;  5IGD A;  1PH5 A;  4HMJ A;  3IL8 A;  3KF8 A;  1QWY A;  4C1N I;  1TWH H;  2OTL A;  2XIW A;  2CW0 C;  3FHW A;  1YJW A;  3LWE A;  2RBM A;  3TBI B;  1CKO A;  3CHB D;  1A6X A;  1DT4 A;  1IBK Q;  4RAU C;  2Q8R E;  4N9T A;  3S24 A;  1LT4 D;  3CQZ H;  3GTP H;  4IUN A;  3R93 A;  2VQE H;  1FKA H;  2F0U A;  1TII D;  2F0V A;  2K50 A;  3VR2 A;  1V1Q A;  1PH1 A;  4IPD A;  1KXL A;  1UNS A;  1Q82 C;  5FO9 B;  3CCS A;  1JE4 A;  1VQP A;  4LF7 Q;  3VA5 A;  1SYB A;  2UXD Q;  2HDM A;  3PCO B;  2BH2 A;  3BVZ A;  3PGZ A;  2EZV A;  1WTJ A;  2R7D A;  3MWY W;  1KRS A;  2PQA B;  5AJ3 L;  4DR4 L;  4LF5 L;  1D2B A;  2M8W A;  1EYC A;  4RGO S;  4KKT A;  3BG3 A;  1PRT B;  3PO2 H;  4NKL A;  4LFC L;  2VQE Q;  1EL0 A;  3L2P A;  1F2Z A;  1E24 A;  2M00 A;  5AFW A;  1ZEQ X;  3MXG A;  5KIX A;  4F7X A;  3RF2 A;  2CTF A;  1G8Z D;  1SE3 A;  1PXU A;  1PTO B;  3ER0 A;  4LNQ A;  4PQX A;  4A3I G;  1IL2 A;  3TS0 A;  3K7A B;  2K5D A;  4OX9 H;  4TRD A;  1XYI A;  1X65 A;  1HNZ H;  3S17 H;  3K57 A;  2B2U A;  2BE5 C;  5ELO A;  2BH8 A;  5M3F H;  5DT9 A;  4GNX A;  3TRZ A;  5LMU Q;  2PNR C;  5DM6 3;  3Q22 A;  1F2M A;  5CC4 A;  3FEW X;  4K5X A;  2F52 A;  3ND9 A;  1E22 A;  4R4O A;  5CMD A;  2KEN A;  5C0X I;  4DK0 A;  4BBS H;  1XMQ H;  5FLM H;  2D0P A;  4J6H A;  3G71 A;  2PQA A;  2FPH X;  5C3E G;  2HHH L;  2DY8 A;  5C5L A;  3AB9 A;  4O1N A;  4JI8 L;  3N6R A;  4DV6 Q;  1IW7 D;  4OX9 Q;  3CW2 C;  1D7Q A;  4Y52 H;  1O7Y A;  2O4C A;  1NTG A;  1U4P A;  2EY5 A;  5ELD A;  4A3J H;  3SK4 A;  5I6Y A;  5IOD A;  2DGR A;  1N32 H;  1TS5 A;  2B63 B;  1DTJ A;  3J81 i;  3VA7 A;  4L63 B;  1PH8 A;  4JI1 H;  2VZA A;  2F0G A;  5C4Z A;  1I94 H;  1GHJ A;  4YCU A;  4ZLT F;  4IUP A;  5G3L D;  3U58 A;  1XMQ Q;  5CV7 A;  4B3M H;  3I55 A;  3HOY B;  1MGS A;  3NQI A;  3I4N G;  3UE0 A;  1MD2 D;  4A4I A;  1X3P A;  1IZ6 A;  5FLX W;  1GXD C;  3I72 A;  1O78 A;  2JA9 A;  2HUG A;  2GA4 B;  4DV2 H;  3G6E A;  4DR3 L;  5CV9 A;  5GAE C;  4DR1 H;  4X3K A;  4KHP L;  1PZI D;  3KBX A;  3WWV A;  4MN3 A;  4KN7 C;  3G4S A;  4B8C D;  1TWA H;  1BKB A;  1K83 H;  2NVY B;  5IYC G;  3GTQ H;  3OSO A;  1I4P A;  2NN6 G;  1OXV A;  1I94 Q;  1EC6 A;  1R9T H;  5DEH A;  1OXX K;  3A5Z B;  4B3M Q;  3RR5 A;  1VQ5 A;  4LF8 H;  4HIO A;  2E74 C;  1NAP A;  3TP5 A;  1QJO A;  2JYO A;  1XRH A;  2NVT B;  1MHW C;  1TY2 A;  2YV5 A;  1YJ9 A;  3GTM B;  1CI3 M;  3W3A A;  5TSS A;  2X6G A;  4O0A A;  4UPA A;  1RHP A;  3GP7 A;  4J1M A;  4DR1 Q;  1J5E Q;  4JI6 L;  2OQ0 A;  2HDL A;  2X06 A;  4DXG A;  4L6T B;  4GLA C;  3KF6 B;  2NZO A;  3NTK A;  5K36 H;  3NWT A;  5KEE A;  1B7Y B;  1HFG A;  5IT9 L;  1DXM A;  1SE8 A;  3OTO H;  3TRE A;  1YVC A;  3CC2 A;  3U50 C;  3K0X A;  3GV6 A;  3Q6S A;  1X9N A;  4HCE A;  2F03 A;  1F2L A;  1TT2 A;  4CJ1 B;  1RTN A;  4RHS A;  4GOP C;  3T1H L;  3MFG A;  4DV3 L;  4P2C B;  1SMX A;  3PUX A;  2ZXR A;  4LFA H;  2F4I A;  4LF6 H;  3CMA A;  4X64 L;  2YU9 H;  3GTL B;  3K59 A;  1QIL A;  1DJR D;  3M7N A;  3BJU A;  2VUM B;  2CTL A;  4JI5 L;  3GDE A;  5KYI A;  1PYW D;  4O2D A;  2LXK A;  4FJU A;  1OTC A;  2EE1 A;  4DAY B;  1WVN A;  4XYO A;  1FJG H;  3ERO A;  2WKC A;  4HJA A;  3CP0 A;  4B9W A;  2F3W A;  1M90 C;  4IFD H;  4IQZ A;  3OYY A;  2TSS A;  1NUC A;  3BVG A;  3MXU A;  2JJQ A;  1V1P A;  4JW0 A;  4ZRZ A;  3S15 B;  5C0X J;  2QND A;  1O7L A;  3OET A;  1SFO H;  3AFP A;  4DV1 H;  3HP3 A;  1SNP A;  2K6A A;  3M7G A;  4LF6 Q;  4PZ7 A;  2VNU D;  5JJZ A;  2RCF A;  1QZG A;  5AJ3 Q;  1CKN B;  3S9W A;  4DR4 Q;  2RDH A;  3JAM W;  3KLW A;  1C48 A;  4LF5 Q;  2ZJP A;  1L2F A;  5I2X A;  2Z4H A;  1A62 A;  2KHI A;  5E1F A;  3NXW A;  4LFC Q;  2OTJ A;  1MIU A;  4EQN A;  3UDG A;  5GAH C;  1X4N A;  2M2L A;  4N9P A;  4B3T L;  1TS2 A;  3I4L A;  2R92 B;  3KDK A;  1E0B A;  2RHS B;  1B44 D;  4R9W A;  3EQL C;  3HOV B;  1GUG A;  3G6J B;  5DAU A;  1QUQ A;  1A3T A;  4E6I A;  4POG A;  2K04 A;  1Q12 A;  3S14 B;  5ELE A;  2L0C A;  3F2D A;  4FNF A;  1EY5 A;  3J7A V;  4A3D G;  1B9M A;  4AYB G;  2F0W A;  3W1G A;  4HN7 A;  5M5X H;  4GKJ H;  4DK1 A;  5J39 A;  2E2I B;  1Y8P B;  1JB7 A;  5C3W A;  4XQQ A;  3E6Z X;  3E9H A;  5C4J H;  3RN5 A;  4R8N A;  2HD3 A;  3AFQ A;  2A1A A;  2EY6 A;  5IGB A;  1IBM H;  3G48 A;  2LY7 A;  2HHH Q;  1XX8 A;  2B2T C;  1FVI A;  2N88 A;  3EFX D;  2R6G A;  4C3H B;  2OT2 A;  4LK1 C;  1LTG D;  4ODG A;  4O42 A;  4FF3 A;  4A3K B;  1TWF H;  4EQO A;  3NPP A;  2ZM6 L;  2BA0 A;  5BR8 L;  3FPP A;  4A3I H;  3F8T A;  1FGB D;  2LSS A;  1SBB B;  2HCC A;  1BNZ A;  5EPL A;  3NTI A;  4TSS A;  3Q0A A;  4JI4 H;  3HS0 C;  3I2Z A;  4B08 A;  1SNM A;  1IBM Q;  2ZTE A;  5KRU A;  1IHZ A;  2K75 A;  4KHP Q;  3V69 A;  2JN4 A;  1KD1 C;  3EVQ A;  3V2T A;  1SNC A;  3PMF A;  4B9X A;  1EYG A;  3KDG A;  4DU9 A;  1XNR L;  2Z6B A;  4OWX B;  1DON A;  3AU7 A;  4DR5 L;  3EJI A;  1E2W A;  4EQ5 A;  1BCP C;  1V1O A;  3NQT A;  4GN4 B;  5C3E H;  1KDA A;  1STE A;  3KBG A;  3H15 A;  3SEB A;  3LWU A;  1EQT A;  5D65 A;  1NE3 A;  4K0K L;  5IWA H;  4HJ8 A;  1LM0 A;  4JV5 H;  4N8X 1;  5HGT A;  1UEB A;  2CTE A;  1SEB D;  1V43 A;  4QUF A;  5HUR A;  4DK3 C;  2DNE A;  1XMO L;  1MSZ A;  3H6M A;  3TME A;  3N52 A;  5COR A;  1GD7 A;  1AE2 A;  4JI6 Q;  4OO1 I;  2CWF A;  2WB1 G;  2N55 A;  1CK1 A;  1CQV A;  3J81 L;  4A93 G;  5FKA C;  4P72 A;  4JVH A;  1HFN A;  2RDG A;  3I4N H;  1VQL A;  5JVG 3;  1WOC A;  4PMW A;  5JPM C;  3GTO H;  2KCC A;  1BCP D;  3RZD H;  4ZUJ A;  1W6J A;  2Q2U A;  4IJL A;  1Z47 A;  4CDC C;  2K1H A;  1BDO A;  1Q1E A;  2J0T D;  1E1T A;  1C4Q A;  1D8L A;  3WDN A;  4DV3 Q;  4QQB X;  4X6A H;  3TS2 A;  4JV5 Q;  4ZKC B;  5IYC H;  4X64 Q;  3MEH A;  1A0I A;  4IUV A;  4R4C A;  2NN6 H;  1NJI C;  1HZA A;  2PI2 E;  1PDQ A;  1AEX A;  2PZU A;  1SE4 A;  2GVB A;  3I3C A;  3UOE A;  2OWO A;  2E2H H;  2M6Q A;  2EY1 A;  1SJE D;  3QD7 X;  4QL5 A;  2F1M A;  1VDZ A;  4AM3 A;  2E2D C;  3DUZ A;  5IGE A;  2C5C A;  2PW5 A;  5C4H A;  2XNA C;  4ZCK A;  1S03 G;  1XWE A;  3FVQ A;  5FO7 B;  5JOB A;  3PUZ A;  2F4V L;  2WAC A;  1CA5 A;  4BY7 B;  3M4O B;  1LTA D;  1VQ8 A;  3KK7 A;  5KGU A;  1N33 L;  2AUJ D;  4GOP B;  4P71 A;  1KLG D;  4I7Z C;  3BDL A;  3GKU A;  5DM7 3;  2WKD A;  1YJN A;  1X56 A;  1X3F A;  1SE2 A;  1K73 C;  3T4A C;  1YIJ A;  1S5D D;  3CAM A;  4KLK A;  1EY9 A;  1ODH A;  4DUZ L;  1KAB A;  1Z2I A;  2CHB D;  3VDY A;  3SK5 A;  2JA8 B;  3J81 E;  4JI2 H;  3HOZ B;  3S2D H;  1PRT C;  3I90 A;  1UAP A;  1SNO A;  3KJP A;  4BY1 G;  1DZ1 A;  1EIY B;  1BXT A;  2XSC A;  4KI0 A;  4YHH L;  2L15 A;  4B3R L;  4LMQ D;  2OPV A;  3MAQ A;  4GS3 A;  3HKZ E;  2JE6 I;  1PTO C;  5E3F A;  1K8G A;  1ASZ A;  3C1E A;  1U4R A;  4C1N K;  3VYR A;  5ISR A;  3PO3 B;  2K7V A;  4YCW A;  3X3N A;  2Q2T A;  5HY6 A;  1ROD A;  1M1K C;  4HID A;  2BL5 A;  2Q8T A;  2I07 B;  4GOP A;  1ZKO A;  2ZM6 Q;  2JA7 G;  3CF5 A;  3H91 A;  4JK1 C;  1PRT D;  4BBS G;  2JA5 B;  4CKE A;  2DNC A;  1A3U A;  4C3J B;  3M3Y B;  1E2Z A;  2JA6 G;  2RKS A;  1VQD A;  1MJE A;  2H5X A;  2ZT9 C;  4UP9 A;  2YYZ A;  1I3Q H;  2I5H A;  3GQB A;  4GKK L;  1PTO D;  2E5L L;  3C46 A;  4MHE A;  1Q1B A;  5C4X G;  1X9Z A;  3MZ5 A;  1D5X C;  2QIL A;  2HIV A;  4A3D H;  1CM9 A;  5JEA G;  3F2U A;  1J8I A;  2NTS A;  2B8G A;  5M3M B;  2L1B A;  1XNR Q;  4DR5 Q;  3J80 L;  3M4Q A;  1VQK A;  4LF9 H;  2UXB H;  3HGB A;  4ZK9 B;  1HRJ A;  3S1Q H;  2KCT A;  2UUA L;  3F2B A;  5CBE E;  1SYG A;  1EOV A;  3A5U A;  4K0K Q;  4DFA A;  2PNH A;  4A76 A;  3GV3 A;  1X0A A;  1VQM A;  3ITP A;  2KJX A;  1XMO Q;  3S1R H;  1QVG A;  1JB3 A;  2IT1 A;  3QB3 A;  3CCJ A;  4NZR M;  2PQU A;  1IXR A;  5NUC A;  1TU2 B;  4P74 A;  5G3L F;  1HA6 A;  2ZQE A;  2KCN A;  2MFI A;  2L12 A;  4MNO A;  3QOL A;  1MKH A;  3D8G A;  3PSI A;  5CV8 A;  2UXB Q;  5D3D A;  5A2Q E;  1X55 A;  1PA6 A;  1DYQ A;  4DUY L;  1LTR D;  3CCQ A;  2JXM B;  4YY3 H;  2JZX A;  3K5O A;  2VUM G;  4IUU A;  2Y0S E;  4DXF A;  3NP8 A;  2YQR A;  4DR6 H;  1GVP A;  1VF5 C;  3HKZ B;  4KK7 A;  2ES2 A;  1CHP D;  4C2M B;  3I8Z A;  4ALP A;  4JYA L;  4LFB H;  2AMC B;  3QO2 A;  3B6Y A;  2RF4 A;  3S16 B;  2B2T A;  1B4O A;  2UUB L;  1JCK B;  3IKJ A;  4OIK A;  1T5E A;  1HR0 L;  3SXH A;  4AQY H;  2LXJ A;  2F0Q A;  3L3O C;  4KY7 A;  3J81 j;  4DR2 L;  1GOZ A;  1RTO A;  4IFD I;  4X62 H;  2VB3 X;  4A93 H;  2BOS A;  1A2T A;  4DV0 L;  5C44 B;  1E3P A;  1J4W A;  2PMZ E;  3FDT A;  4WOR A;  2K5H A;  4IOA A;  1XNQ L;  1BF4 A;  1N33 Q;  1WTW A;  1K8O A;  2X69 A;  1WJJ A;  4DR7 L;  1EQR A;  1X3G A;  3LX0 A;  4LFB Q;  2CPM A;  4OCH A;  1BR9 A;  1VQC A;  4V0B A;  3V96 A;  2FFM A;  1X3Q A;  3G7L A;  4F87 A;  2LFN A;  2K01 A;  2TMP A;  1IBK H;  4NP5 A;  4XYQ A;  4CKC A;  2A5H A;  4K2L A;  1Y69 U;  3MXP A;  4QY7 A;  3HOV G;  4WJ4 A;  4DUZ Q;  1PFS A;  1NMG A;  3D4W A;  4ZKB B;  2EYP A;  2VS1 A;  1YI2 A;  4A3C G;  1VIH A;  5JJL A;  4RFB A;  5A35 A;  2L55 A;  3A0J A;  5C6A A;  3S1M B;  2KUM A;  1X32 A;  4LF7 H;  2EIF A;  2UXD H;  2BDN A;  5LMN L;  2K14 A;  2K5W A;  1VQN A;  4H44 C;  1WE8 A;  3HOX B;  1G6P A;  4FF4 A;  1LLR D;  3P7J A;  1ML0 D;  4B3R Q;  3U4Z A;  2LTL A;  4C3H G;  1H9J A;  1CSP A;  5IP9 G;  5IOC A;  1ET6 A;  1LTL A;  2MUY A;  3S2H H;  4R8I A;  2SOB A;  4OD6 A;  2ICE C;  2CH4 A;  3DMU A;  3KDF A;  3SK8 A;  2LF0 A;  5IT9 W;  1JWU D;  1Y1W B;  1SRU A;  1AH9 A;  1STY A;  4LWC A;  3I4M B;  4FDB A;  4XQN A;  4DNI A;  2UU9 L;  2Y0S B;  1JJC B;  2A74 C;  4OEL B;  4Y7N B;  2KEE A;  1H9S B;  2LS0 1;  2WAQ G;  4DNT B;  2CW0 D;  1NCV A;  3STB C;  5EAY A;  1QNK A;  2ZTD A;  3SHL A;  1Y1V B;  5EPK A;  1WTQ A;  3QJY A;  1JJG A;  5LMU H;  1WCM B;  1G29 1;  3OMC A;  4XQJ A;  3H0G B;  3K80 C;  3RZO H;  2EJF C;  4IUR A;  3EBE A;  4IPG A;  3UI2 A;  3FRP B;  4GKK Q;  2A1S A;  2E5L Q;  3GTJ B;  4BY1 H;  2UXC H;  2MP1 A;  2PY9 A;  1TWH B;  5IY0 A;  1F0X A;  2ZJQ A;  1HHV A;  1LO5 D;  2WP8 J;  1BO0 A;  2PMZ B;  2MGS A;  4DV6 H;  3F1Z A;  4HMI A;  4ME5 A;  1A8V A;  2UUA Q;  4HIK A;  3OW2 A;  3STB D;  2B63 H;  3CQZ B;  3KJO A;  2R7Z G;  4X3U A;  1KC8 C;  5I6W A;  4DPG A;  2JA7 H;  4LIJ A;  3MXN B;  1X4M A;  1OXS C;  2B29 A;  5GRO A;  1N36 L;  2UXC Q;  4IFD J;  2JA6 H;  1X54 A;  3U9S A;  3MVV A;  4QMG A;  4C3I G;  4DV5 L;  1DOM A;  2FHT A;  3T1Y L;  4A3F G;  1EWI A;  1K0R A;  1O7I A;  1PYB A;  5C4X H;  2QDL A;  4RCO A;  1ZZI A;  4LF4 L;  4DUY Q;  5JEA H;  2NVY H;  2DJG C;  1UE1 A;  3PO2 B;  1ONL A;  2NVQ H;  2BE5 D;  4YWK A;  1ESR A;  5EBD A;  4CDD C;  1M8A A;  3NK9 A;  1PYS B;  3NTH A;  2XTI A;  4FXK C;  4KHZ A;  2E2J H;  4A3L G;  1PQX A;  1CZG A;  2R3Z A;  4JYA Q;  4H13 C;  1R4Q B;  4XIG S;  2IW3 A;  4HJ5 A;  4UP7 A;  1MBY A;  3BS1 A;  3EIV A;  2EJG C;  2UUB Q;  1CZW A;  5C0X G;  1HR0 Q;  3DWQ A;  2RDF A;  1J5E H;  4K5W A;  2B2V C;  1KAA A;  4K14 A;  1R4P B;  5M3F B;  4DR2 Q;  1GUW A;  4X3S A;  1CHQ D;  3NBH B;  5M5W H;  2ATW A;  1WI5 A;  4DV0 Q;  1ENC A;  4ID6 A;  1Q8I A;  4OEM B;  4LAA A;  1XNQ Q;  4CJ0 B;  1KQS A;  5LL6 b;  1B8A A;  4JBW A;  2K28 A;  1SLJ A;  2B2W C;  1BCP F;  3TEH B;  1GM5 A;  4BA1 I;  3ND8 A;  1B53 A;  1JQY D;  2VUM H;  2CKZ B;  1FNU A;  5D14 A;  1EIH A;  3DM1 A;  4JBJ A;  1AN7 A;  2QKI C;  1QB5 D;  5GAD C;  2CFM A;  4A3J B;  1D5M C;  1SAP A;  4G4K A;  4L8J A;  4ME3 A;  2VQF L;  1SYD A;  1K3R A;  1AE3 A;  1QOH A;  1X3E A;  2K5N A;  5LMN Q;  4NXN L;  1DOK A;  1BOS A;  4U67 3;  1EU4 A;  1STN A;  4KTA A;  5KYL A;  1KNA A;  4S3S A;  3A7A B;  4DR4 H;  4LF5 H;  4JI3 L;  4RMF A;  5LHY 1;  1Z9F A;  5EBC A;  3W5O A;  3NBH A;  2B8F A;  2RSN A;  4LFC H;  3VR4 A;  4DA2 A;  1TWA B;  4P75 A;  1B3Q A;  3VR6 A;  4WJ3 M;  4DN4 M;  5CGK A;  3GTQ B;  3E3X A;  4RA8 A;  4HIM A;  1KDC A;  3K8A A;  3P1H A;  3BZD B;  3HOW B;  1G51 A;  1ICF B;  2G9H D;  2YTY A;  2UU9 Q;  3ULP A;  2VXW A;  3HOV H;  3D0F A;  2IHF A;  2SNS A;  1I50 H;  1I6H H;  4OWT B;  4TVA B;  4A3C H;  2PT7 G;  1CQF A;  2D62 A;  4PZ8 A;  1PFN A;  4ZYS A;  3A56 A;  3KF6 A;  1SNQ A;  5IIF A;  3UE1 A;  4NZT M;  4CJ2 C;  1XPO A;  2E2I H;  4POF A;  3ULL A;  2EYO A;  4AIM A;  3JC6 6;  3PF4 A;  2IX0 A;  4C3H H;  1N34 L;  1CUK A;  4JI0 L;  5IP9 H;  1XJV A;  2HHH H;  5FLX c;  4L5T A;  1ZTG A;  1H9R A;  4JI8 H;  2CH4 W;  2YU9 B;  2FMM A;  4BBR B;  3KLR A;  4KKU A;  4DAY A;  3PIO A;  4AH6 A;  4DV7 L;  3J7A K;  4NXM L;  2ANR A;  2A8V A;  3MA2 B;  2AWN A;  4LUO A;  3CC7 A;  3HOU B;  1PFM A;  4CDF C;  4FJS A;  1PRT F;  1K8M A;  1LT5 D;  1N36 Q;  5JJI A;  4A3B G;  4NBQ A;  4DV5 Q;  3T1Y Q;  4XXE A;  4H02 A;  1CKN A;  4LUZ A;  1W6K A;  3E9I A;  4DR3 H;  3FKI B;  4KHP H;  2F3V A;  3H09 A;  2PO4 A;  4JI8 Q;  4LF4 Q;  1PTO F;  2K03 A;  5IYD G;  3H3V I;  2SNM A;  2Q8I B;  3CCL A;  5I9P A;  3AMU A;  2K5V A;  4X66 L;  1F9Q A;  2CVR A;  3CCM A;  1ENF A;  2ICI A;  4J8Q A;  2CTK A;  1E2V A;  3KUP A;  4X65 L;  5FLX L;  3HKS A;  1U5K A;  4KY6 A;  1V8C A;  2VL6 A;  3PUW A;  2R7Z H;  2JP1 A;  3LGJ A;  1PZK D;  1TVX A;  5E7N A;  4CGY B;  2KHS A;  1WFQ A;  3CRL C;  4UAI A;  1G2T A;  2ZXO A;  4DR3 Q;  4CDE C;  2F0M A;  4JI6 H;  4KMU C;  2R93 G;  1V8Q A;  2MJH A;  4PMB A;  2ALY B;  4MTN A;  4C3I H;  3RD4 A;  4A3F H;  3W1B A;  1OO9 B;  2L5T A;  2SEB D;  4A3E G;  1I4G A;  2NB0 A;  4B3S L;  3J7A F;  1FR3 A;  3T1H H;  4DV3 H;  1EU3 A;  5C4J B;  4A3G B;  1N8R C;  3L0O A;  4NDX A;  4X64 H;  1CFM A;  4YIJ A;  2HCI A;  5JPN C;  1HNW L;  2OEO A;  3JAM c;  1GUN A;  3U1K A;  1EQV A;  1JOQ A;  4JI5 H;  1SRO A;  4IUQ A;  1H9K A;  2D2C C;  2O2L D;  4IN3 A;  1TWF B;  2MQH A;  2QGQ A;  4A3L H;  1IYU A;  1TWC B;  1B3A A;  3OOC A;  1HNX L;  3J80 W;  1TWG H;  1Q90 A;  4A3I B;  2VQF Q;  1KLU D;  5C0X H;  5FK9 C;  3S1N H;  1BQQ T;  2UUC L;  3ULJ A;  2BDO A;  3T1H Q;  3CCV A;  4G7O C;  3H3V C;  3Q8D A;  1CTM A;  3M4O H;  2EVB A;  3K7U C;  1ILQ A;  5JJK A;  3NBI A;  2QW7 A;  4JI3 Q;  1A3V A;  2G9D A;  1SSO A;  4JI5 Q;  1Y1W G;  4WAN A;  1F9P A;  3HZX A;  1C7Y A;  5FLX E;  1AP0 A;  3R8B A;  3H94 A;  5C3E B;  3OSS D;  1LTB D;  4B3T H;  3WOF A;  2KVM A;  4G7H C;  2AKW B;  5DLQ E;  5J3B A;  1WTR A;  1UG8 A;  1IKL A;  2AHO B;  4OO1 G;  1RF2 D;  1T9H A;  3A54 A;  3FMC A;  2D0O A;  5I4D A;  1PH9 A;  4Q5V A;  2F0K A;  4JI7 L;  4Z9C B;  3RLF A;  1HUM A;  3URY A;  5EJW A;  3I73 A;  1D1K A;  1KNE A;  5DNF A;  1LTT D;  5BN3 A;  1KIX A;  1HUN A;  3I4N B;  2A68 C;  4DV4 L;  2DJF C;  2B2V A;  2HIX A;  1HR0 W;  2CCZ A;  4B3T Q;  2IY5 B;  4RKB A;  3UDX A;  3RZD B;  1PH2 A;  2K05 A;  3BU2 A;  4EGV A;  1L1O B;  1N34 Q;  4JI0 Q;  4KY5 A;  5C5M A;  4FF2 A;  2MNA A;  1AZP A;  2B2U C;  3CPF A;  2ZM6 H;  4A3M B;  1NR4 A;  4IZ8 A;  3OHX C;  5EKL A;  2CWP A;  2N78 A;  1F9S A;  2B2W A;  1VF7 A;  4PG3 A;  5BR8 H;  4DV7 Q;  2Z4I A;  1KDB A;  4RH6 A;  1VMP A;  5IGG A;  4NXM Q;  2G5D A;  3D4D A;  2A6E C;  3IRB A;  2E2H B;  1HZ9 A;  4F88 A;  2K1B A;  1OXU A;  3M4Y A;  1IBL L;  2A68 D;  3NWS A;  3R2T A;  4JBM A;  4H0L C;  5I9O A;  1PLF A;  3CD6 A;  1HXY D;  2L9H A;  5A2Q L;  1UEA B;  4QGU A;  5CYU A;  2B2Y C;  1YHQ A;  4HTH A;  1YZ6 A;  2NZ1 D;  1D5Z C;  1JOR A;  2I46 A;  4QB4 A;  2B63 G;  3NEN A;  2AWO A;  1XNR H;  4LW1 A;  4DR5 H;  1ASY A;  5LMN W;  5BR8 Q;  3I70 A;  1S5E D;  3PQI A;  4OWW B;  3HOY G;  2YTX A;  3K81 C;  4X66 Q;  2CTM A;  4MTK A;  1I5F A;  2A6E D;  3AEV B;  2PQE A;  1FD7 D;  2IX3 A;  4X65 Q;  4K0K H;  1U9R A;  1F9R A;  1QCB D;  2Z6K C;  2K52 A;  1Q86 C;  1XMO H;  4N8F A;  1NBW A;  1OXT A;  1WTX A;  3T56 B;  2G8Y A;  1RL2 A;  4DAV A;  4F8M A;  3ZYY X;  3S2D B;  1EWH A;  4HSV A;  2QA4 A;  1TY0 A;  1L0X B;  1YNN C;  4XTC S;  3W2D A;  2P5Z X;  4IAL A;  5K5P A;  1WHR A;  4A3B H;  3IFD A;  4HCS A;  2LMC B;  2NVX H;  4IO9 A;  4IPC A;  2E8G A;  1TQO A;  4B3S Q;  3IAY A;  2VQE L;  2I5M X;  2EPB A;  4HED A;  1S40 A;  1BBW A;  2RSO A;  1H9M A;  5IYD H;  1WD0 A;  1PH7 A;  2CTJ A;  1E7Z A;  2Q2H A;  1N9W A;  5IGF A;  2NZH A;  3I91 A;  3TZD A;  1HNW Q;  3T16 A;  1FNV A;  3EN2 A;  1O7Z A;  1NY4 A;  3DWA A;  4LUV A;  4NW2 A;  4HSP A;  5COY A;  3GTG B;  4TQU S;  1HNX Q;  3EA6 A;  2PI2 A;  5CR3 A;  1ESF A;  4GZY C;  1VQE A;  2WB1 E;  1WD1 A;  2XWB B;  2IWH A;  1PV4 A;  5ELF A;  2QF7 A;  1LTI D;  1NMF A;  2UUC Q;  3GR5 A;  2R93 H;  2F0T A;  1VBI A;  2PW7 A;  2F4V H;  5LL6 X;  3A74 A;  4A3D B;  1I6V C;  3HG9 A;  4K5V A;  1N33 H;  4A3E H;  2JQO A;  3GTK H;  4EC5 A;  4KJO A;  2E3U A;  3P20 A;  1K8A C;  4OON A;  4OX9 L;  4J15 A;  1HNZ L;  5IP7 G;  3HEJ A;  1G91 A;  1EY8 A;  4UP8 A;  4R1J A;  2PPB C;  3BYY B;  4FYD A;  4DUZ H;  3L9A X;  1LYL A;  2FMR A;  5KNB A;  1VQ4 A;  1RKN A;  2RQX A;  2KHJ A;  3BYT B;  3QIA A;  1B2T A;  3K5M A;  1XMQ L;  2F4V Q;  2AQ2 B;  3RNU A;  3S1R B;  3CCU A;  3NSW A;  2C35 B;  3KF8 B;  4U68 A;  4IUT A;  3PV0 A;  3J7Y W;  1J5K A;  3PUV A;  3QWN A;  1VQG A;  4NB3 A;  4DF7 A;  2A6H C;  4H7B A;  1X6O A;  2R92 G;  4YHH H;  4DV4 Q;  1MSG A;  4B3R H;  4K6L A;  3VYU A;  1PH3 A;  1D1I A;  2F0D A;  1XTC D;  1N32 L;  2FIN B;  1VQA A;  2B3G A;  4OGQ C;  4K8I A;  1SYC A;  3X3M A;  4BBR G;  1Y1W H;  4ZQ3 A;  3OMG A;  4JI1 L;  1I94 L;  4JCV E;  4APV A;  1C9O A;  4B3M L;  2Y3M A;  3SB1 A;  4RGM A;  2A19 A;  3RN2 A;  3HOU G;  5M5Y B;  3MHB A;  1BBX C;  4OO1 H;  1FYC A;  2K4K A;  4OHJ A;  4R4Q A;  1S4Z A;  3M9B A;  4DV2 L;  3DHQ A;  4YHH Q;  4DR1 L;  3CRK C;  1K0S A;  5CV4 A;  4BS9 A;  1Z7T A;  3ONA B;  3FKI G;  2K33 A;  2A69 C;  3U9O A;  4FO2 A;  4GKK H;  2E5L H;  4K8J A;  1A2U A;  1B9N A;  1I4H A;  4A3K G;  2WB1 B;  2C9O A;  5T1G A;  4A93 B;  2EJM A;  4M8A A;  3A8K E;  1PTO H;  3RLO A;  1SMY C;  4WRD A;  4LF8 L;  3K7A H;  3RUZ A;  1LV9 A;  2EDG A;  1Y8O B;  2QCP X;  1WTP A;  2NBF A;  2KQ3 A;  2QEX A;  2EXD A;  1VQH A;  2UUA H;  4PDB A;  4RKL A;  3K0Y A;  1YHA A;  3RMH A;  2RA4 A;  4GNX B;  3PIO 3;  3OW7 A;  1BBU A;  1EQQ A;  1CKM A;  4KJN A;  1RCV D;  3OTO L;  1GHK A;  1PFB A;  1RJT A;  5E4W C;  2A69 D;  2OPU A;  1EFI D;  2OF1 A;  2KEC A;  3CC4 A;  4QIW E;  3GAB A;  1EY4 A;  1YHB A;  2LKV A;  4RCN A;  4RHR A;  2H4O A;  3BZC A;  4MZ9 A;  4CHT B;  4HR7 B;  1F2Y A;  2MPM A;  1SMY D;  5EPJ A;  1SJH D;  4LFA L;  3SR1 A;  4LF6 L;  3KFU A;  1L0Y B;  1HPC A;  1A63 A;  1XTD A;  2D9I A;  3NUC A;  1HH2 P;  1YEZ A;  4A3G G;  4FXG C;  4OXP A;  1EY7 A;  3ZJY C;  4JPB W;  4DUY H;  2KA7 A;  1TXY A;  2ZTC A;  2ASB A;  2DUD A;  3GTP B;  3I7F A;  1FJG L;  5T1I A;  3S2H B;  3KLS X;  4QMF B;  3E0J A;  3VKE A;  1WTO A;  3HOY H;  1XPR A;  4JC0 A;  3SVM A;  1EY0 A;  4JYA H;  3T13 A;  1IW7 C;  1H9S A;  4Q0F A;  1DCZ A;  2AQ1 B;  1Q46 A;  1LT3 D;  4DV1 L;  2O5I C;  2UUB H;  4KD4 A;  4BXX G;  1KRT A;  1HR0 H;  1K1G A;  4HJ7 A;  4DR2 H;  3RZO B;  3GD7 A;  2L4N A;  2F0P A;  4FXD A;  4DV0 H;  1HA5 A;  4BY1 B;  3A8I E;  1EOT A;  4GLV B;  1VQF A;  2V4D A;  2CPQ A;  1XNQ H;  1WVL A;  1S5B D;  3QG1 A;  3E0E A;  2O5J C;  4DR7 H;  4BA2 I;  4G7Z C;  2B2Y A;  2NVT H;  3TP8 A;  1ZZJ A;  1M4V A;  3GTM H;  2OCE A;  1NXU A;  2NN6 I;  2FFK B;  1HNZ Q;  3CU7 A;  2M9V A;  3DWP A;  5CV6 A;  2WV6 D;  3S17 B;  2NTT A;  4R4I A;  2V1C C;  2JVZ A;  1RD9 D;  4BY7 G;  2OQK A;  1VQI A;  3K5L A;  2JA7 B;  3BZK A;  3MXN A;  4K2K A;  3SE0 A;  2DGY A;  3KOJ A;  1UUP A;  4GKJ L;  5IT9 c;  4BBS B;  1UE5 A;  2DY7 A;  4LJZ C;  5LMN H;  1ZYR C;  2JA6 B;  4G08 A;  3OWE B;  1STA A;  2Z6K A;  1IBM L;  4DR7 Q;  3GTL H;  1XXG A;  4QIW B;  2F0F A;  2F0J A;  3JAM i;  2N3S A;  2VKC A;  3D31 A;  5KNC A;  2MJ8 A;  2DN8 A;  3I0P A;  2EYJ A;  5C4X B;  3FP9 A;  1N32 Q;  5ELN A;  2JA8 G;  3NCV A;  2PYK A;  2RHQ B;  1TKW B;  1DM0 B;  5FO8 B;  4A3M G;  1JMC A;  3HOZ G;  2NVQ B;  3BDC A;  4JI1 Q;  2Z0S A;  1WYD A;  2NYZ D;  4DNR B;  3HOW H;  1HQM C;  1I4Q A;  5IP7 H;  4JBK A;  1S20 A;  2E2J B;  3S15 H;  1JC7 A;  4JI4 L;  2UU9 H;  1SR3 A;  3Q24 A;  1V1P B;  4RWS C;  1JT8 A;  1ZYR D;  5GQO A;  1B70 B;  5J1Z A;  2F0E A;  4DV2 Q;  1HZB A;  1KAW A;  1TS3 A;  2GN5 A;  2OXP A;  1B50 A;  2Q2I A;  2HT1 A;  3C3L A;  3PO3 G;  4KD3 A;  2QEJ C;  2I5L X;  1VQO A;  1L1O C;  2E76 C;  2EYF A;  3R2I A;  1BVS A;  2N8N A;  1TR5 A;  5M5W B;  3J81 W;  1K83 B;  1XPU A;  5F2D A;  1K9M C;  2R92 H;  1QE6 A;  2AQ3 B;  2A73 B;  1VQ7 A;  2JA5 G;  1UE6 A;  1I4R A;  5IWA L;  1R9T B;  4IOC A;  4C56 C;  4LF8 Q;  4JV5 L;  2KBN A;  4C3J G;  4IPH A;  2FMC A;  4UDU C;  2K32 A;  3OIP A;  4BBR H;  3UDF A;  4ULL A;  2F0H A;  3S14 H;  1QUQ B;  2WAQ E;  3NEL A;  4HJ9 A;  1VQB A;  4KHV A;  1NR2 A;  3HOU H;  3VR5 A;  5FJ8 G;  3OTO Q;  5IYB G;  5M3M G;  1HZC A;  5JAV A;  1LTS D;  1N36 H;  3I4O A;  1A15 A;  1JR0 D;  3T51 B;  4GN3 B;  3U4V A;  1GJX A;  4DV5 H;  3T1Y H;  5IE8 A;  2BCO A;  3FKI H;  4LFA Q;  3EZJ A;  2FXQ A;  1B1Z A;  1VQ6 A;  1MI2 A;  4A3K H;  2XVS A;  4LF4 H;  4HAE A;  1EZ8 A;  4NMZ A;  4WFN 3;  2XRS D;  1GUT A;  4QUC A;  2F0N A;  5EGT A;  1FJG Q;  1EZ6 A;  2XRQ D;  1S72 A;  4GN5 A;  5FOB B;  4PV1 C;  2E75 C;  1FL0 A;  1RDP D;  4JOI C;  1KHI A;  1JOO A;  1KL9 A;  1IL8 A;  2VW9 A;  1HCZ A;  4UY8 C;  2BA1 A;  3SDZ A;  3VYT A;  3PIP 3;  4DV1 Q;  1YNX A;  1SFO B;  4FP5 D;  1I50 B;  1LAC A;  1I6H B;  5IT9 E;  3FAU A;  1EIG A;  4QCL A;  3J80 i;  2ANN A;  3HKZ G;  2CQO A;  2Z8L A;  3AYH B;  1VMC A;  1E1O A;  3OWF A;  2P2R A;  3R3O A;  3M85 A;  1HTP A;  3DEP A;  4RG1 A;  4A3G H;  1Z6H A;  2R61 A;  1P16 A;  1KHM A;  3ICE A;  5A2Q W;  1UE7 A;  5GAG C;  1C8C A;  1Q81 C;  4JI2 L;  2WII B;  4V19 0;  1IKM A;  1TWC H;  5IGC A;  1VQ9 A;  2YTV A;  5C44 G;  3SGI A;  3BVM A;  3J81 c;  2VQF H;  4P73 A;  2IHE A;  1Y8N B;  1GO3 E;  4GKJ Q;  4BXX H;  2JEB I;  2WAQ B;  3K5N A;  5EKK A;  1DOL A;  5M5X B;  4ZAI A;  4NXN H;  3D6W A;  1EUJ A;  4CBV A;  4QF4 A;  1S3O A;  1VS0 A;  3TZU A;  2F0S A;  4KKS A;  4JI3 H;  1STG A;  3Q23 A;  1YIT A;  1W3S A;  5BN5 A;  1SND A;  2ENB A;  1SEI A;  1GKH A;  4KV6 A;  3IFT A;  2EY2 A;  1EIF A;  1FGU A;  1PVO A;  1ENA A;  2CWH A;  2LRR A;  4I65 A;  2H1E A;  3HOX G;  1STH A;  1SYF A;  4JI4 Q;  4ABN A;  4NXN Q;  2WIN B;  4BY7 H;  3TSS A;  2R7Z B;  4JVZ A;  3C1F A;  1IYJ B;  1WTV A;  1J9O A;  2CWA A;  1S5C D;  4A75 A;  1EFW A;  2X6L A;  1TS4 A;  2EOT A;  4NPS A;  1YBY A;  2HH3 A;  1HJP A;  1ZZK A;  3K6O A;  4LF9 L;  4WAL A;  2UXB L;  3I4M G;  4C3I B;  1Y14 B;  3UDI A;  1HTL D;  2L11 A;  1U0L A;  2Y0S G;  4GLX A;  1ET9 A;  4A3F B;  1I6U A;  2IJ0 A;  1LAB A;  1RIP A;  2XWJ B;  3TDQ A;  2ZXP A;  5IWA Q;  1N34 H;  1GUS A;  5ELC A;  3O13 A;  4JI0 H;  1AW7 A;  1STB A;  1JE5 A;  2MHV A;  2PZT A;  1Y1V G;  1HQR D;  5KND A;  4H8A A;  3JAM L;  3ERQ A;  2JA8 H;  1WCM G;  3OIQ A;  3H0G G;  3HOZ H;  4A3M H;  1PMR A;  2Z9H A;  3MC0 B;  1DD2 A;  3CKI B;  4OL7 A;  1J6Q A;  4WJW A;  4DV7 H;  4NXM H;  4I7A A;  3LNN A;  4G57 A;  1TWG B;  4QJF A;  3M4P A;  4EX5 A;  4MIU A;  1CSQ A;  2EYM A;  1W2B A;  2F0I A;  1EEF D;  2R7F A;  3GTO B;  2VY3 A;  1K28 A;  4JVY A;  1ZXT A;  3ERS X;  3PO3 H;  4DGZ A;  4YY3 L;  1JIC A;  3S1N B;  3A55 A;  4K6D A;  2SDF A;  3VR3 A;  2ID0 A;  4DR6 L;  2NUC A;  3PF5 A;  2HQL A;  1SDF A;  3TN2 A;  3CPW A;  3OPO A;  4GNX C;  4LFB L;  4L5S A;  2EXZ A;  2JA5 H;  1YNJ C;  3K58 A;  1VQJ A;  1G6Z A;  3QR8 A;  5D3I B;  4C3J H;  3M3Y H;  4X66 H;  1BUV T;  4OIJ A;  2CQA A;  1MJC A;  4AQY L;  2QDB A;  3NEM A;  1Q8K A;  1GUO A;  3FPU B;  1VCI A;  4X65 H;  1QZH A;  2ZJR A;  4JG2 A;  1Q3L A;  1NNX A;  4AYB E;  4X62 L;  2LTM A;  1NSN S;  3QOJ A;  1SN8 A;  2EQS A;  1H95 A;  3PUY A;  5ELB A;  5FJ8 H;  1K3B C;  5IYB H;  3D3R A;  5M3M H;  3PO2 G;  1V9N A;  3AQQ A;  1LT6 D;  3I56 A;  5EQ0 A;  2B39 A;  1S5F D;  3NE5 B;  3NHH A;  3J80 c;  1YNJ D;  2KED A;  1EY6 A;  2JSO A;  1IBK L;  2D5D A;  5I2Y A;  1P8L A;  3HRZ C;  4YWL A;  2MO1 A;  2HQE A;  3JAM E;  1AFP A;  1L1O A;  4ILW A;  4B3S H;  4IJH A;  1G2S A;  1F77 A;  2WFW A;  4L5Q A;  3PIP A;  4RGT A;  4TKO B;  5M3F G;  4RGN A;  1HNW H;  4B8T A;  4JI2 Q;  3J7A 5;  1PH4 A;  4LF7 L;  2PZW A;  2UXD L;  3GTG H;  3RLN A;  3P75 A;  2F3I A;  1EYD A;  2K5Q A;  2RVL A;  1U4L A;  3GO5 A;  1HNX H;  5FLM G;  5C3X A;  4UHV A;  5E4X A;  4FF1 A;  1Q7Y C;  2MO0 A;  3CCE A;  5CV5 A;  4DAP A;  2AUK A;  2UUC H;  3VYS A;  1SYE A;  1V9P A;  3DEO A;  2EYH A;  5BN4 A;  1EWC A;  3KLS A;  4EVO A;  1D6E C;  2IX1 A;  4C2M H;  4A3J G;  2J4X A;  1CT1 D;  1EYA A;  3HFZ B;  3S16 H;  5CBA E;  1JJ2 A;  5JVH 3;  3AEV A;  2VB2 X;  1YNN D;  4R4T A;  3MFY A;  4DKA C;  3CME A;  1JWS D;  5LMU L;  3J7Z C;  2JK8 A;  2KCM A;  3WOE A;  1PH6 A;  1VIG A;  3D6C A;  1ILP A;  1UWV A;  5J22 A;  4X3T A;  1I3Q B;  5C44 H;  4JOI A;  4JI7 H;  1JOK A;  4PMC A;  2UXC L;  4PNY A;  4DK6 C;  1CA6 A;  3KYH C;  1MSH A;  4AYB B;  4M1U B;  1AZQ A;  1II3 A;  4DAM A;  5L37 A;  1AN8 A;  3H3V H;  4LF9 Q;  3TP7 A;  2N49 A;  4YCV A;  4DV6 L;  3HOW G;  3DLL A;  4DV4 H;  3CCR A;  4XDX A;  4A3B B;  4L5R C;  3S1Q B;  2NVX B;  3MEF A;  3F2C A;  1TUA A;  2PCF B;  2NWG A;  2O4X A;  1PZJ D;  4YWM A;  4E9J A;  2FJ2 A;  3TP6 A;  1BCP B;  3S1M H;  2RCN A;  1C0A A;  2JEA I;  3CXC A;  1DGS A;  4JI7 Q;  5M5Y H;  3T53 B;  4CKB A;  5K36 G;  1EEI D;  2Z1C A;  2D9U A;  3HOX H;  4ZUI A;  5H1S E;  1IYV A;  3DXJ C;  1U4M A;  2IL8 A;  5LL6 S;  3E5S A;  5EKI A;  1SXT A;  3A8J E;  1IBL H;  4XT1 B;  3C2P A;  1LUZ A;  1KTK A;  3BDO A;  5HGQ A;  4YY3 Q;  4KN4 C;  3MTS A;  4BWG B;  5JEA J;  1ICW A;  2F0L A;  2HH2 A;  2GVA A;  2R93 B;  3A7L A;  4DR6 Q;  3J80 E;  1QG7 A;  3KDF B;  3V05 A;  3I4M H;  1JWM D;  1T5X D;  2XGT A;  3DM3 A;  4PZ6 A;  4XT3 B;  2J7Z A;  4Y7N H;  2AXY A;  4A3E B;  3L7Z C;  3D4R A;  3GTK B;  1O80 A;  1QNU A;  3TQY A;  2I0Q A;  4FVM A;  4IFD G;  1QVC A;  1FNW A;  1I4X A;  1Y1V H;  2KOL A;  2A6H D;  5M9O A;  2IPK D;  1WCM H;  4AQY Q;  1J5E L;  3H0G H;  2F0O A;  1IBL Q;  2EYL A;  1QVF A; 
#chains in the Genus database with same CATH homology
 3GTJ H;  4DR3 Q;  1M1K C;  4X62 Q;  4HID A;  1L0W A;  1PHJ A;  2BL5 A;  1N32 Q;  5ELN A;  2JA8 G;  1PH5 A;  2R93 G;  2RHQ B;  4GOP A;  4QQB X;  2MJH A;  3HOZ G;  4A3M G;  1JMC A;  2ZM6 Q;  2ALY B;  2JA7 G;  4JI1 Q;  3CF5 A;  1TWH H;  2Z0S A;  4MTN A;  1WYD A;  3HOW H;  4C3I H;  2OTL A;  3FHW A;  5IP7 H;  4JBK A;  4BBS G;  1YJW A;  4A3F H;  3S15 H;  3W1B A;  4A3E G;  4JI4 L;  1SR3 A;  1CKO A;  2JA6 G;  4B3S L;  1VQD A;  1DT4 A;  1IBK Q;  1MJE A;  2H5X A;  1JT8 A;  4UP9 A;  3S24 A;  2YYZ A;  3CQZ H;  1B70 B;  5GQO A;  4DV2 Q;  1I3Q H;  1HZB A;  1N8R C;  3L0O A;  3GTP H;  2I5H A;  4GKK L;  1KAW A;  2GN5 A;  2E5L L;  2Q2I A;  2HT1 A;  2K50 A;  3PO3 G;  1Q1B A;  1V1Q A;  1HNW L;  5C4X G;  3JAM c;  2I5L X;  1VQO A;  1L1O C;  2HIV A;  4A3D H;  5JEA G;  3U1K A;  1PH1 A;  1SRO A;  4IPD A;  1KXL A;  1BVS A;  4A3L H;  2MQH A;  1Q82 C;  2N8N A;  2QGQ A;  3CCS A;  1VQP A;  1XNR Q;  1XPU A;  1K9M C;  1HNX L;  4LF7 Q;  4DR5 Q;  1TWG H;  2R92 H;  3PCO B;  2UXD Q;  3M4Q A;  2BH2 A;  3PGZ A;  2VQF Q;  1VQK A;  1VQ7 A;  2JA5 G;  1UE6 A;  2R7D A;  3S1Q H;  5IWA L;  4IOC A;  2KCT A;  4LF8 Q;  4JV5 L;  2KBN A;  2UUA L;  4IPH A;  3F2B A;  1KRS A;  3S1N H;  2PQA B;  5AJ3 L;  2UUC L;  1EOV A;  4DR4 L;  3ULJ A;  3A5U A;  3T1H Q;  3CCV A;  4LF5 L;  4K0K Q;  4BBR H;  2PNH A;  4A76 A;  3Q8D A;  3UDF A;  3M4O H;  3PO2 H;  1VQM A;  3K7U C;  4LFC L;  2VQE Q;  5JJK A;  3S14 H;  1XMO Q;  1QUQ B;  2WAQ E;  3NEL A;  3L2P A;  3S1R H;  4HJ9 A;  1VQB A;  4JI3 Q;  1E24 A;  1QVG A;  3HOU H;  2IT1 A;  4JI5 Q;  1Y1W G;  3CCJ A;  5FJ8 G;  3OTO Q;  2PQU A;  5IYB G;  1IXR A;  5M3M G;  4WAN A;  1HZC A;  4P74 A;  2CTF A;  1C7Y A;  3ER0 A;  4LNQ A;  3I4O A;  4A3I G;  2MFI A;  1IL2 A;  4MNO A;  3TS0 A;  1MKH A;  3PSI A;  2UXB Q;  4GN3 B;  2AKW B;  5DLQ E;  5J3B A;  3U4V A;  2AHO B;  4OO1 G;  1X55 A;  1X65 A;  5IE8 A;  3FKI H;  1T9H A;  4LFA Q;  2FXQ A;  4DUY L;  1PA6 A;  3S17 H;  3CCQ A;  2D0O A;  1VQ6 A;  5ELO A;  2BH8 A;  5M3F H;  4GNX A;  4A3K H;  2JZX A;  3TRZ A;  5LMU Q;  1PH9 A;  4JI7 L;  3RLF A;  2VUM G;  2Y0S E;  2YQR A;  1GVP A;  2F52 A;  1E22 A;  4R4O A;  4BBS H;  2KEN A;  5C0X I;  1FJG Q;  2ES2 A;  5FLM H;  1S72 A;  4GN5 A;  2D0P A;  4ALP A;  4JYA L;  1FL0 A;  4JOI C;  2AMC B;  1KIX A;  3B6Y A;  1KHI A;  2RF4 A;  4DV4 L;  1KL9 A;  2HIX A;  3G71 A;  2VW9 A;  2UUB L;  2PQA A;  5C3E G;  1HR0 W;  2HHH L;  1HR0 L;  2CCZ A;  4B3T Q;  2IY5 B;  3UDX A;  2LXJ A;  4DV6 Q;  1PH2 A;  4JI8 L;  2BA1 A;  3BU2 A;  4UY8 C;  1D7Q A;  1L1O B;  3CW2 C;  4DV1 Q;  1N34 Q;  1YNX A;  4OX9 Q;  4JI0 Q;  4Y52 H;  3J81 j;  4DR2 L;  1NTG A;  4IFD I;  4A3J H;  2DGR A;  4A93 H;  1DTJ A;  2MNA A;  3J81 i;  4DV0 L;  3CPF A;  1E3P A;  3J80 i;  1J4W A;  2PMZ E;  1PH8 A;  2ANN A;  3HKZ G;  2VZA A;  2CQO A;  2K5H A;  3AYH B;  2CWP A;  1E1O A;  2N78 A;  4PG3 A;  4YCU A;  4DV3 Q;  3U58 A;  4IOA A;  1XNQ L;  4DV7 Q;  1XMQ Q;  2P2R A;  4NXM Q;  1N33 Q;  1WJJ A;  3I55 A;  4DR7 L;  1EQR A;  1X3G A;  3IRB A;  4LFB Q;  3M85 A;  1HZ9 A;  1VQC A;  3I4N G;  3UE0 A;  4RG1 A;  4A4I A;  4A3G H;  1OXU A;  1IZ6 A;  1IBL L;  1P16 A;  2JA9 A;  1KHM A;  4JBM A;  3ICE A;  3G6E A;  4DR3 L;  5GAE C;  2CTM A;  4KHP L;  3CD6 A;  4QY7 A;  3HOV G;  1UE7 A;  3WWV A;  5GAG C;  1YHQ A;  4QGU A;  4WJ4 A;  1Q81 C;  4DUZ Q;  1YZ6 A;  1PFS A;  3G4S A;  1NMG A;  4JI2 L;  1TWA H;  2VS1 A;  1BKB A;  1TWC H;  1YI2 A;  4A3C G;  1K83 H;  5IYC G;  1VIH A;  2B63 G;  3NEN A;  3GTQ H;  5JJL A;  1VQ9 A;  2YTV A;  3A0J A;  5C44 G;  2AWO A;  3SGI A;  4LW1 A;  2EIF A;  2NN6 G;  1OXV A;  1I94 Q;  5LMN W;  1ASY A;  3J81 c;  5LMN L;  1EC6 A;  1R9T H;  2K14 A;  2IHE A;  4P73 A;  1OXX K;  3A5Z B;  5BR8 Q;  1GO3 E;  1VQN A;  4B3M Q;  3RR5 A;  4GKJ Q;  4OWW B;  3HOY G;  2JEB I;  2YTX A;  3K81 C;  4X66 Q;  4BXX H;  1VQ5 A;  1WE8 A;  4HIO A;  1G6P A;  1I5F A;  3AEV B;  4B3R Q;  3U4Z A;  2YV5 A;  1YJ9 A;  1EUJ A;  4X65 Q;  4O0A A;  1S3O A;  4UPA A;  1CSP A;  5IP9 G;  1VS0 A;  4DR1 Q;  1J5E Q;  4JI6 L;  2OQ0 A;  2Z6K C;  1LTL A;  2K52 A;  4GLA C;  1Q86 C;  3S2H H;  1NBW A;  3KF6 B;  1YIT A;  1W3S A;  2NZO A;  1OXT A;  3KDF A;  1B7Y B;  1RL2 A;  1SE8 A;  1SRU A;  1AH9 A;  1GKH A;  1YVC A;  3TRE A;  3U50 C;  2QA4 A;  3CC2 A;  3K0X A;  4LWC A;  1X9N A;  1EIF A;  4FDB A;  4DNI A;  4XTC S;  1FGU A;  2UU9 L;  1PVO A;  1JJC B;  4GOP C;  4A3B H;  3T1H L;  4DV3 L;  2WAQ G;  2NVX H;  3HOX G;  1SMX A;  3PUX A;  4IO9 A;  3STB C;  5EAY A;  4JI4 Q;  4IPC A;  3CMA A;  2E8G A;  2ZTD A;  4X64 L;  4B3S Q;  4NXN Q;  2VQE L;  2I5M X;  2YU9 H;  1S40 A;  4BY7 H;  1JJG A;  1BBW A;  1G29 1;  5IYD H;  3K80 C;  3M7N A;  3BJU A;  3RZO H;  2CTL A;  1PH7 A;  2CTJ A;  1IYJ B;  1E7Z A;  2Q2H A;  1N9W A;  3EBE A;  3GDE A;  2CWA A;  4IPG A;  4JI5 L;  4O2D A;  4A75 A;  2E5L Q;  2NZH A;  4GKK Q;  2LXK A;  1EFW A;  1HNW Q;  4BY1 H;  1OTC A;  4DAY B;  3EN2 A;  4NPS A;  1WVN A;  1YBY A;  2HH3 A;  4HJA A;  1HJP A;  3CP0 A;  1NY4 A;  4LUV A;  1ZZK A;  1M90 C;  4LF9 L;  4A3G G;  4WAL A;  3OYY A;  2UXB L;  2PY9 A;  5IY0 A;  3I4M G;  4TQU S;  1Y14 B;  1HNX Q;  2ZJQ A;  3UDI A;  2JJQ A;  1U0L A;  2Y0S G;  2WP8 J;  2PI2 A;  4GLX A;  5C0X J;  2WB1 E;  1VQE A;  1RIP A;  2QND A;  1SFO H;  3AFP A;  5IWA Q;  3F1Z A;  1PV4 A;  1A8V A;  2UUA Q;  4LF6 Q;  1JE5 A;  4PZ7 A;  4HIK A;  1NMF A;  1Y1V G;  3OW2 A;  1QZG A;  3STB D;  1CKN B;  5AJ3 Q;  3KJO A;  2UUC Q;  2B63 H;  2JA8 H;  4DR4 Q;  3KLW A;  1WCM G;  4LF5 Q;  2R93 H;  2ZJP A;  3H0G G;  2R7Z G;  1L2F A;  4A3M H;  1KC8 C;  4DPG A;  1A62 A;  2JA7 H;  3HOZ H;  2KHI A;  4LIJ A;  2OTJ A;  4LFC Q;  3A74 A;  1MIU A;  3MXN B;  1X4M A;  1OXS C;  1J6Q A;  2B29 A;  3UDG A;  5GRO A;  5GAH C;  4A3E H;  1N36 L;  4IFD J;  2UXC Q;  2JQO A;  3GTK H;  1X4N A;  2JA6 H;  2E3U A;  4B3T L;  1X54 A;  4X6A H;  4QJF A;  3M4P A;  1K8A C;  4OON A;  4EX5 A;  4DV5 L;  4J15 A;  1CSQ A;  3T1Y L;  1W2B A;  5IP7 G;  1HNZ L;  4OX9 L;  2RHS B;  4A3F G;  2R7F A;  2VY3 A;  4JVY A;  1EWI A;  1K0R A;  3ERS X;  4UP8 A;  1O7I A;  1PYB A;  4R1J A;  5C4X H;  4YY3 L;  3PO3 H;  1ZZI A;  4LF4 L;  4DUY Q;  2NVY H;  1LYL A;  2ID0 A;  2FMR A;  4DR6 L;  3PF5 A;  1VQ4 A;  2HQL A;  1QUQ A;  1UE1 A;  2KHJ A;  4POG A;  2NVQ H;  1Q12 A;  4YWK A;  1XMQ L;  3CPW A;  3RNU A;  2F4V Q;  3CCU A;  3F2D A;  4GNX C;  2C35 B;  4LFB L;  3KF8 B;  4L5S A;  1PYS B;  4A3D G;  3PV0 A;  4AYB G;  2JA5 H;  1J5K A;  1VQJ A;  2XTI A;  4KHZ A;  3W1G A;  2E2J H;  3PUV A;  4A3L G;  1VQG A;  5M5X H;  4NB3 A;  4C3J H;  3M3Y H;  4JYA Q;  1JB7 A;  1X6O A;  4XIG S;  1MJC A;  4AQY L;  2R92 G;  4HJ5 A;  3E9H A;  3NEM A;  1Q8K A;  5C4J H;  4DV4 Q;  3RN5 A;  1VCI A;  3AFQ A;  4UP7 A;  2A1A A;  3EIV A;  1PH3 A;  2UUB Q;  1QZH A;  3G48 A;  5C0X G;  2HHH Q;  2ZJR A;  4JG2 A;  1HR0 Q;  1FVI A;  1QVF A;  2R6G A;  4AYB E;  4X62 L;  1N32 L;  1SN8 A;  1VQA A;  2B3G A;  2EQS A;  1H95 A;  4BBR G;  3PUY A;  4DR2 Q;  1Y1W H;  1TWF H;  5FJ8 H;  2ZM6 L;  5IYB H;  4JI1 L;  5M3M H;  3PO2 G;  3NBH B;  5M5W H;  1I94 L;  2ATW A;  4JCV E;  3AQQ A;  2BA0 A;  4APV A;  5BR8 L;  1C9O A;  1WI5 A;  4DV0 Q;  4B3M L;  4A3I H;  2A19 A;  3I56 A;  3RN2 A;  3F8T A;  3HOU G;  2LSS A;  1XNQ Q;  1KQS A;  1B8A A;  2K4K A;  4R4Q A;  4JBW A;  3J80 c;  1IBK L;  3M9B A;  1P8L A;  1SLJ A;  4YWL A;  2MO1 A;  4DV2 L;  3TEH B;  3I2Z A;  4YHH Q;  4DR1 L;  1GM5 A;  1L1O A;  4BA1 I;  2VUM H;  2CKZ B;  4IJH A;  1IBM Q;  4JBJ A;  2ZTE A;  3FKI G;  2K75 A;  2WFW A;  4L5Q A;  4KHP Q;  3V69 A;  3PIP A;  5GAD C;  5M3F G;  1KD1 C;  4A3K G;  1EYG A;  2CFM A;  4B8T A;  4JI2 Q;  1XNR L;  3J7A 5;  1PH4 A;  4LF7 L;  4OWX B;  4DR5 L;  2UXD L;  4ME3 A;  3GTG H;  2VQF L;  3RLN A;  4EQ5 A;  1K3R A;  3RLO A;  1AE3 A;  2F3I A;  4GN4 B;  5C3E H;  3GO5 A;  3H15 A;  4LF8 L;  5FLM G;  3K7A H;  1X3E A;  2K5N A;  5LMN Q;  4NXN L;  1Q7Y C;  4K0K L;  1NE3 A;  2MO0 A;  3CCE A;  4HJ8 A;  1LM0 A;  2EXD A;  2QEX A;  1VQH A;  1UEB A;  2CTE A;  1V43 A;  1YHA A;  4DK3 C;  1XMO L;  1V9P A;  4JI3 L;  4GNX B;  4RMF A;  1BBU A;  1GD7 A;  1Z9F A;  3W5O A;  1EQQ A;  1CKM A;  1AE2 A;  4JI6 Q;  3OTO L;  2OPU A;  4OO1 I;  4P75 A;  2WB1 G;  4C2M H;  4A3J G;  2IX1 A;  4WJ3 M;  4A93 G;  4JVH A;  3CC4 A;  3HFZ B;  4P72 A;  4QIW E;  3S16 H;  3I4N H;  1VQL A;  4HIM A;  1YHB A;  3K8A A;  1WOC A;  4PMW A;  3BZC A;  4MZ9 A;  3GTO H;  1G51 A;  3RZD H;  1JJ2 A;  2Q2U A;  4IJL A;  1Z47 A;  2YTY A;  2UU9 Q;  4LF6 L;  4LFA L;  3ULP A;  3AEV A;  3KFU A;  1A63 A;  4R4T A;  1Q1E A;  3HOV H;  1XTD A;  1E1T A;  1D8L A;  1HH2 P;  1YEZ A;  4DKA C;  3CME A;  3D0F A;  5LMU L;  4OXP A;  3J7Z C;  2IHF A;  2JK8 A;  3ZJY C;  1I50 H;  2KCM A;  1PH6 A;  3TS2 A;  4JV5 Q;  4OWT B;  4TVA B;  4A3C H;  1I6H H;  2D62 A;  1VIG A;  5IYC H;  4X64 Q;  4PZ8 A;  1UWV A;  1TXY A;  2ZTC A;  1A0I A;  2ASB A;  2DUD A;  3KF6 A;  5C44 H;  4R4C A;  4JOI A;  3I7F A;  1FJG L;  1NJI C;  1HZA A;  2UXC L;  2PI2 E;  3UE1 A;  4DK6 C;  3KYH C;  4QMF B;  2GVB A;  1XPO A;  2E2I H;  3VKE A;  3HOY H;  1XPR A;  2OWO A;  2E2H H;  4DAM A;  4JC0 A;  3H3V H;  4POF A;  4QL5 A;  4LF9 Q;  3ULL A;  2N49 A;  4YCV A;  4AIM A;  4DV6 L;  3JC6 6;  3DLL A;  3HOW G;  4AM3 A;  3PF4 A;  1Q46 A;  2IX0 A;  4C3H H;  3CCR A;  4DV1 L;  1CUK A;  1N34 L;  4JI0 L;  5IP9 H;  4BXX G;  1XJV A;  1KRT A;  4L5R C;  3MEF A;  4L5T A;  5FLX c;  3F2C A;  1TUA A;  1ZTG A;  1K1G A;  3PUZ A;  2F4V L;  4HJ7 A;  4YWM A;  3GD7 A;  3S1M H;  2RCN A;  3PIO A;  1C0A A;  1VQ8 A;  3CXC A;  2JEA I;  1DGS A;  4JI7 Q;  4AH6 A;  4DV7 L;  4NXM L;  2ANR A;  2A8V A;  5M5Y H;  1N33 L;  2AWN A;  4GOP B;  4LUO A;  5K36 G;  4GLV B;  4P71 A;  3CC7 A;  1VQF A;  2CPQ A;  3HOX H;  5H1S E;  1N36 Q;  3E0E A;  1YJN A;  1X56 A;  1X3F A;  4BA2 I;  5JJI A;  2NVT H;  1K73 C;  1ZZJ A;  3GTM H;  1YIJ A;  3CAM A;  2OCE A;  4A3B G;  4NBQ A;  4DV5 Q;  2NN6 I;  3T1Y Q;  1HNZ Q;  1LUZ A;  4H02 A;  4KLK A;  4DUZ L;  1CKN A;  4LUZ A;  5HGQ A;  3E9I A;  4YY3 Q;  3VDY A;  4JI8 Q;  5JEA J;  4LF4 Q;  2HH2 A;  4R4I A;  2V1C C;  2JVZ A;  2GVA A;  4BY7 G;  3H3V I;  2OQK A;  5IYD G;  1VQI A;  3S2D H;  4DR6 Q;  3BZK A;  3KDF B;  3KJP A;  3I4M H;  3CCL A;  2DGY A;  3KOJ A;  4PZ6 A;  2XGT A;  3DM3 A;  4GKJ L;  4BY1 G;  5IT9 c;  1UE5 A;  2K5V A;  4X66 L;  4Y7N H;  3CCM A;  1EIY B;  2AXY A;  4KI0 A;  3L7Z C;  4YHH L;  2L15 A;  2VNU D;  2CTK A;  2I0Q A;  3TQY A;  4IFD G;  4B3R L;  4X65 L;  2OPV A;  2Z6K A;  3HKS A;  1IBM L;  1QVC A;  1Y1V H;  4GS3 A;  1U5K A;  3GTL H;  3HKZ E;  4DR7 Q;  2JE6 I;  1K8G A;  3JAM i;  4AQY Q;  2N3S A;  1WCM H;  2VL6 A;  3PUW A;  1J5E L;  3D31 A;  3H0G H;  3LGJ A;  1IBL Q;  5E7N A;  1ASZ A;  2R7Z H;  1WFQ A;  4YCW A;  3FP9 A;  2Q2T A;  5HY6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...