2Z0SA

Crystal structure of putative exosome complex rna-binding protein
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
175
structure length
175
Chain Sequence
EIYVPQAGDVVIGLIQSVGIMNWFVDINSPYVAVLSVQDFLGRPFNPAVDDMQSLLKVGDYIKAKVVAFDKTRSPLLTVQGEGLGRIVRGKIVEISPAKVPRVIGRKMSMLKTLEEKTECKIFVARNGRIHLECPNEDLEAIAVMAIKIIDEEAYTSGLTKRIIKFIEEERRIRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of putative exosome complex RNA-binding protein
rcsb
source organism Aeropyrum pernix
molecule tags Rna binding protein
molecule keywords Probable exosome complex RNA-binding protein 1
total genus 42
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 2007-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2z0sA01
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 2z0sA02
2R6GA 1YHAA 2VQFL 4OWWB 5M5WH 1CKNB 3AYHB 3D0FA 3K0XA 3S2DH 2OPUA 1YBYA 1A0IA 4DUZQ 4DR5Q 1EWIA 3M4QA 4DV2L 4A3IH 4DV6Q 3S16H 2Z6KC 2A8VA 4HJ8A 2OCEA 4JI1L 1W2BA 3HOZG 1XMOL 2PMZE 4DV0L 1AE2A 2CTFA 4HIDA 1G51A 3STBC 4IPCA 3HOZH 4O2DA 4R4OA 1JMCA 5C4XH 2WB1E 4GLXA 1JJ2A 4B3ML 4BY7H 4ME3A 1CSPA 1NMFA 4NXML 2NVQH 2KHJA 1YJ9A 1PYBA 1EQRA 3RNUA 4A3EG 1GVPA 2Q2TA 1HNZQ 4UP7A 1VQCA 2JEBI 4BBRH 1WJJA 4A3KG 2I0QA 3W1BA 2K5NA 2E3UA 3B6YA 4JG2A 1CUKA 2H5XA 4AIMA 4MNOA 1SMXA 4P75A 4B3SL 3F2BA 4JV5L 2NVTH 4P71A 1Y1VG 1SROA 3AEVA 2MJHA 1Q7YC 3KLWA 1AH9A 4DV4Q 4DV1Q 2E8GA 3STBD 2R92G 1Q86C 4DV3Q 5JJKA 3K80C 4DR4Q 4DKAC 4RMFA 2JA8G 1YJWA 2ZTDA 4GKJQ 2K5HA 3KYHC 3PO2G 4LUVA 4HJ9A 3UDGA 1Q12A 3FP9A 1E3PA 3ZJYC 2MNAA 1PH4A 4A3DH 4LNQA 3JAMc 3PUVA 1KRTA 4JI2Q 4JOIA 4DV1L 4A3KH 4YCWA 1Q46A 4L5RC 4DV2Q 3BU2A 4BXXG 1X6OA 1VQ5A 3HOVG 5IWAL 5IYCH 5M3FG 1QUQB 4NXNL 3UDIA 5IYBH 2K4KA 1KQSA 2R7ZG 2R93G 3CW2C 4Y52H 1IBMQ 2ANRA 3PUXA 2LXJA 1VIGA 1SRUA 2JA6G 1I3QH 2GVBA 2B63G 4JBWA 1ASZA 3AQQA 2AWNA 1JJCB 1BVSA 2NZHA 2JA6H 4NXMQ 2VQEQ 3J81j 1N34L 2CTJA 4WJ3M 1YEZA 2VNUD 4WANA 2CWPA 1OXSC 1K9MC 5HY6A 2PI2A 1L1OB 1EYGA 3BJUA 2AHOB 2Q2IA 3T1YQ 3A0JA 3PF4A 3S1NH 2JVZA 4KI0A 1YJNA 4IPHA 3TREA 5BR8Q 3E9HA 1XNRQ 1X65A 1XTDA 3RR5A 5HGQA 3PIOA 3T1HL 1TXYA 5GQOA 2Q2UA 4WALA 3NBHB 5IT9c 1BBWA 1XMQL 1NMGA 5C4JH 4DV4L 3OYYA 1WI5A 1HZAA 3M9BA 3OTOL 4AQYL 4X62L 3S24A 2QEXA 1TWGH 5C0XJ 3I4OA 2OPVA 5M5YH 5C3EH 4GKKQ 3G71A 1UE7A 1VQKA 4R4IA 4BBRG 3TEHB 1E1OA 1YHBA 3ULPA 1M90C 2CTKA 4YWMA 2K5VA 3F2CA 1N33Q 1LUZA 4LF9Q 4GNXB 2HH2A 1OXXK 2KCMA 4GN3B 2VUMG 2UXCQ 1VQ6A 2RCNA 2BL5A 1PYSB 3ERSX 1IBLL 4JI5L 4LIJA 2NN6G 4TQUS 2D62A 5ELNA 2WFWA 1VQGA 2NZOA 4PZ6A 2CCZA 1O7IA 3CCJA 1NJIC 2VUMH 3HOWH 3HOYG 3M3YH 1DT4A 1VCIA 1S3OA 2RHQB 4C2MH 1L2FA 3GTJH 1SE8A 4DR7Q 1CKOA 4HJ5A 3H15A 4JI2L 1E7ZA 3HOYH 1IZ6A 1GD7A 3M4OH 4JI5Q 1YVCA 1OXTA 4YY3L 4DR2Q 2JA7G 4X65Q 1C9OA 5IWAQ 5C0XI 1VQBA 3CC4A 2F3IA 4GNXA 1VS0A 1L0WA 1JJGA 1KIXA 4EX5A 3CCSA 3UE1A 4NXNQ 4OX9L 2L15A 4DR4L 3TS0A 4A93G 2JJQA 2JQOA 2IHEA 1Q1EA 5AJ3L 1K73C 4POGA 1KAWA 4UPAA 4JVHA 3GTPH 4A93H 5FJ8H 2JE6I 1N8RC 1T9HA 3GTLH 4PZ7A 3CD6A 4R4TA 1W3SA 4LFBQ 4NPSA 1XPOA 3EBEA 1VQIA 1J5EQ 3GTOH 1XPUA 2UUCL 3TQYA 1CKNA 2YTVA 3CP0A 3T1YL 3PUWA 2CTLA 3U4ZA 4DNIA 3S1QH 1YZ6A 2ALYB 2ZM6Q 3V69A 4QL5A 4B3MQ 2IT1A 4A3GG 2JEAI 4JYAQ 2VY3A 3T1HQ 1VQEA 1N33L 4B3RL 1PH2A 4R1JA 1PH7A 2HQLA 4JBKA 4LFCQ 3ULJA 4HIOA 4P73A 3HKSA 2E5LQ 4IOAA 4GS3A 3I4MG 3OTOQ 1UWVA 2ZJPA 1HR0L 1K1GA 1X4NA 3PGZA 1PHJA 1HR0W 3F8TA 2P2RA 4YCUA 1L1OA 1PH9A 1K3RA 5IP7H 4DR1Q 3I4NH 4A4IA 4JI0L 2NN6I 4LF6L 1E1TA 4AM3A 4YWLA 4DR2L 1X9NA 1PVOA 3VKEA 3GTQH 4A3LG 4LWCA 4A3MH 1HR0Q 2PI2E 4P74A 5K36G 3U50C 1N32L 2XGTA 4DUZL 2DUDA 3W5OA 1EIYB 2BH8A 4APVA 1JB7A 4A3GH 4A3MG 1KRSA 5GAHC 2HHHL 3AFPA 2OWOA 1A8VA 4RG1A 4DV0Q 3U1KA 1Z47A 1HZBA 3JC66 1KL9A 3HOVH 2E2JH 2YQRA 3DM3A 4NB3A 5GAEC 3J81i 3G48A 5H1SE 4DV3L 1LYLA 2HH3A 4ALPA 1QVFA 2I5LX 3CAMA 5FLXc 1IL2A 1J6QA 1KHIA 4IJLA 2UUBL 2EXDA 1WCMG 5JJLA 2YU9H 1P16A 3WWVA 1KC8C 4X64L 3L2PA 1B8AA 2JA7H 3PUYA 1OTCA 4JI6Q 4DR3L 2KBNA 1SR3A 1IBKQ 3S14H 4AYBE 1WE8A 2ATWA 3KDFB 4OWXB 1MJEA 2OTLA 3CC2A 5AJ3Q 4BXXH 1PH8A 4B3SQ 2Y0SE 2UXDL 5IYCG 5M3FH 4LF4Q 1RL2A 4JC0A 4K0KQ 1KHMA 3M85A 2ID0A 4EQ5A 1CSQA 3U58A 3BZKA 3CCUA 4JI4Q 3GTKH 4X65L 1WFQA 4UP9A 1KXLA 3TRZA 4J15A 4GKJL 1HH2P 3J81c 1VQJA 2KHIA 4OWTB 3PCOB 4A3FG 2HHHQ 2WAQG 4DV6L 1K8GA 1XNRL 1J5EL 1ASYA 3CQZH 3F2DA 2QA4A 4B3TL 4JV5Q 1KD1C 4YWKA 3PIPA 4PMWA 1LTLA 1I94L 2JK8A 3D31A 1PH5A 3H0GH 2VQEL 1J5KA 1A62A 1QVCA 1Q81C 1WVNA 1VQPA 1EIFA 1MIUA 1PV4A 4LF8L 1G6PA 2ZTCA 3I7FA 2MQHA 3J80i 2HT1A 1OXVA 2YTXA 2YV5A 4QIWE 4DV5L 5GAGC 1HNZL 1IBML 1VQLA 4BBSH 3FKIH 3GDEA 4DUYL 1S40A 2XTIA 4BBSG 4LF9L 4DR1L 5C0XG 4DV7Q 3K8AA 4MZ9A 1HNWL 1X3FA 1D7QA 5J3BA 3CMEA 1I5FA 1TWAH 2ZJRA 1Q8KA 2D0PA 3ER0A 1EUJA 3HOUH 3PO2H 4OO1G 4AQYQ 2VW9A 2N49A 5M3MH 1UEBA 1Y1WH 4NBQA 2E5LL 4BY7G 3SGIA 3BZCA 1V9PA 1GM5A 4IJHA 1YIJA 1NBWA 5GADC 1VQ8A 4BA1I 2Q2HA 2PY9A 1YHQA 4DR7L 2E2HH 4BA2I 1U0LA 2F4VL 2UXBL 3G6EA 3CCQA 4JBMA 2B3GA 2CQOA 5BR8L 5C44G 3RZDH 2D0OA 4LF6Q 3I4MH 2UXCL 5JJIA 4K0KL 2N3SA 4GOPA 4LFAL 2UXDQ 4JI3Q 2AXYA 4DK3C 4HJ7A 4LUZA 4MTNA 4LF4L 1FL0A 2AMCB 3RZOH 2BA0A 5IP7G 3HKZE 4GN4B 1VQMA 2B63H 3I4NG 3Q8DA 1TWHH 4UP8A 1U5KA 4X62Q 1R9TH 2ANNA 1E24A 3NEMA 2UUAQ 4JI6L 1EFWA 1Q82C 1IBKL 2UUBQ 4L5SA 1X56A 4JCVE 5IYDG 1FJGQ 2YYZA 2R92H 1OXUA 1Y14B 4A3JG 4YHHL 3RN2A 1HNXQ 1Y1WG 4LFAQ 3A74A 3PO3G 1VQFA 5IYDH 4QMFB 2I5HA 1P8LA 3KF8B 2K50A 3KF6A 4KHZA 3CCLA 3S15H 3GO5A 4LF7L 1XNQQ 3HOXG 1ZZKA 1XJVA 1S72A 3KJOA 1VQ7A 4OX9Q 1EQQA 1N34Q 4DAYB 1XMOQ 3ICEA 4JI1Q 2BA1A 3M7NA 4O0AA 4AYBG 3AFQA 2EIFA 3EIVA 3UDXA 1E22A 2Z6KA 3UE0A 3RN5A 1I94Q 3MEFA 3HFZB 2R93H 3TS2A 3CCRA 4B3TQ 2PNHA 3HKZG 3AEVB 3K7UC 2JA8H 4X6AH 4LF7Q 1WYDA 4GNXC 4Y7NH 1K0RA 2VQFQ 3CPFA 5IP9G 4DR5L 3CXCA 4WJ4A 1TWFH 4JBJA 1G291 4JI4L 4DV5Q 2CKZB 4TVAB 4A3DG 2MO0A 2JA5G 2B29A 2LXKA 2GN5A 5IP9H 3OW2A 4LF8Q 4IFDG 4LF5Q 2VS1A 4JI8L 1QUQA 5LMUQ 4QQBX 3DLLA 2MO1A 3NENA 1UE5A 1VQ9A 2PQUA 2K75A 2EQSA 3PUZA 4JYAL 4JVYA 2MFIA 1UE6A 2LSSA 2HIVA 3JAMi 4B3RQ 2CPQA 2CTEA 1RIPA 1X3EA 4GLAC 1A63A 3KOJA 1FVIA 3PSIA 3KJPA 4HIMA 4HJAA 1ZZIA 3H0GG 5M3MG 4C3JH 1QVGA 1NE3A 4FDBA 1LM0A 1MKHA 2NVXH 2UUCQ 4YCVA 2F4VQ 1K83H 3S1MH 4DR6L 4HIKA 4A3LH 2UXBQ 2ZTEA 3G4SA 3I55A 1N32Q 4KLKA 1X3GA 1HZ9A 5ELOA 5LMNL 3PF5A 2OQ0A 3FKIG 1Y1VH 2N78A 3I56A 1L1OC 4X64Q 5FJ8G 1PA6A 1VQHA 1PH6A 3ULLA 1JT8A 3S2HH 3L7ZC 4DR3Q 3PV0A 4DK6C 1SN8A 1UE1A 4QY7A 4GOPB 4H02A 1C7YA 3I2ZA 2PQAA 2NVYH 1PH3A 4A3EH 3J7ZC 4JI0Q 1EC6A 1XPRA 4IFDJ 1PFSA 1WCMH 2Y0SG 2F52A 4LFCL 3CMAA 2IX1A 2QNDA 2JA9A 1VQ4A 1C0AA 1D8LA 2FXQA 3H3VI 4IPDA 1XNQL 3GD7A 1EOVA 5C44H 4UY8C 1JE5A 4L5QA 2I5MX 3A5UA 4OO1I 4OONA 1DTJA 1SFOH 5M5XH 3HOXH 1VQNA 3CF5A 4R4CA 4YHHQ 1HNXL 4XTCS 1VIHA 1ZTGA 1Q1BA 2IHFA 1X55A 2DGYA 1K8AC 1QZGA 3FHWA 4QJFA 3HOWG 1I50H 3S17H 1H95A 4DAMA 3CPWA 4KHPL 4OXPA 2RHSB 2KENA 2C35B 3CC7A 4GKKL 4JI7Q 2CTMA 5EAYA 3CCVA 1AE3A 1BKBA 2WAQE 3K7AH 5LMUL 2WP8J 3RLFA 1N36Q 2UU9Q 4DR6Q 1WOCA 3E9IA 2A19A 3MXNB 4KHPQ 3CCMA 4A3IG 1VQDA 1XMQQ 1YITA 4A3CH 3K81C 4A75A 3GTMH 2JZXA 2IX0A 2K52A 4X66L 5LMNW 4PZ8A 1V43A 1MJCA 1PH1A 2YTYA 3L0OA 2A1AA 2ASBA 1X54A 3KFUA 5C4XG 4B8TA 4DV7L 2OQKA 4POFA 1J4WA 4BY1G 3KDFA 3HOUG 3UDFA 2Z0SA 1B70B 2JA5H 2K14A 2RF4A 4AH6A 3CCEA 1QZHA 1VQAA 3A5ZB 3U4VA 1N9WA 5IE8A 4X66Q 4BY1H 1B7YB 4C3HH 2VL6A 4DPGA 1IBLQ 2R7FA 2DGRA 3NELA 3H3VH 4P72A 3RLOA 2CFMA 3IRBA 5FLMG 4A3BG 1YNXA 3J80c 5GROA 1IYJB 5JEAG 4A76A 2R7DA 4DUYQ 4XIGS 5E7NA 2AWOA 4A3CG 2HIXA 5IYBG 4LW1A 1CKMA 4C3IH 3F1ZA 3S1RH 2R7ZH 1TUAA 4JI3L 4YY3Q 2BH2A 1GO3E 4IFDI 5C3EG 2IY5B 4GN5A 1HJPA 1ZZJA 3E0EA 5LMNQ 1YI2A 2GVAA 1FJGL 1GKHA 3J7A5 5DLQE 1IXRA 3VDYA 4A3JH 4L5TA 3KF6B 2AKWB 4IO9A 4GLVB 2VZAA 4GOPC 2ZM6L 1V1QA 2PQAB 2KCTA 2ZJQA 5FLMH 1M1KC 4A3BH 2QGQA 3W1GA 3PO3H 1HNWQ 4LFBL 1FGUA 1X4MA 1BBUA 1HZCA 2N8NA 1VQOA 1NTGA 4A3FH 2E2IH 2CWAA 2OTJA 2WB1G 1SLJA 1DGSA 2ES2A 2UUAL 4LF5L 4QGUA 4JI8Q 3GTGH 1TWCH 2V1CC 5IY0A 3RLNA 4JI7L 4PG3A 3LGJA 3M4PA 4LUOA 4IOCA 1N36L 2UU9L 1Z9FA 4JOIC 4R4QA 5JEAJ 1NY4A 3EN2A 1I6HH 4IPGA 2FMRA
chains in the Genus database with same CATH superfamily
2R6GA 1YHAA 2VQFL 4CKCA 4X3SA 1TWAB 3OIPA 3D0FA 3K0XA 3M4QA 4DV2L 5JPMC 2Z6KC 2BE5C 4HJ8A 1X0AA 4DV0L 1AE2A 1I4XA 5EBCA 4HIDA 1RKNA 2D9IA 5TSSA 4IPCA 3UOEA 5K5PA 1JJ2A 1GUTA 2F0DA 1NMFA 2KHJA 5EBDA 2Q2TA 4UP7A 2JEBI 5C3EB 4AIMA 4QIWB 1SMXA 4R8NA 4JV5L 4H44C 2NVTH 4GKJH 5A35A 3DWPA 4OL7A 5C5MA 3KLWA 5LMUH 4DV1Q 1NAPA 1Q86C 1U9RA 3BDLA 3K80C 4B08A 2Z9HA 5JJZA 4KN7C 4RKLA 3NXWA 4LUVA 1PH4A 2B2YA 1CZGA 2WKDA 1E3PA 3ZJYC 2MNAA 4LF8H 2B2TC 4DV1L 2DN8A 1ESFA 2E2IB 5FKAC 3BU2A 1STHA 4BWGB 5IYCH 4RGNA 1QUQB 4NXNL 1BOSA 3CW2C 2LXJA 2EDGA 4G7HC 3NBHA 1Y1VB 1I3QH 2HQEA 1HA5A 1XXGA 1BVSA 3I72A 2JA6H 4IUTA 3V2TA 4A3EB 2VNUD 4WANA 3SK6A 5HY6A 4A3DB 3A0JA 4IZ8A 3BVGA 4KN4C 2UXDH 1IW7D 1JR0D 2UUBH 3D6WA 4HCSA 1SBBB 2Q2UA 4WALA 3NHHA 4B8CD 1WD0A 4Q0FA 5EGTA 3S2HB 4XQNA 5EPJA 1V9NA 2KVMA 1MSZA 3G6JB 3OTOL 2JA8B 3DWQA 3MWYW 2E76C 5C0XJ 3I4OA 2OPVA 1QG7A 3I4NB 1LO5D 4BBRG 4RWSC 2B39A 3F2CA 2B2YC 1ZYRD 2HH2A 3TZUA 1PZJD 2B2TA 2KCMA 2UXCQ 3S14B 1VQ6A 3DEPA 4IUVA 3ERSX 1SEIA 2BL5A 2PNRC 1LT5D 2WFWA 2NZOA 4F87A 3HOWH 1MBYA 2EPBA 4I7ZC 1DOLA 4FXGC 5ELCA 3WOEA 3HOYG 1VCIA 1DT4A 1B44D 3TP5A 1SNOA 1SYDA 2FINB 1MHWC 3MEHA 1YVCA 4YY3L 2JA7G 5FLXL 1C9OA 1VQBA 4GNXA 2JA5B 4OX9L 4A93G 1EOTA 2JJQA 2JQOA 2UXCH 4POGA 1D1IA 5C4HA 2C5CA 3NP8A 4PZ7A 1PXUA 3TN2A 1XPOA 2HCIA 2WKCA 3ZYYX 2ZQEA 1QOHA 1Z7TA 5EJWA 5M5XB 3HOXB 4XYQA 2EYOA 1MGSA 2ALYB 4B3MQ 4JYAQ 2VY3A 3T1HQ 3W3AA 1SFOB 3SXHA 1WTJA 4DA2A 3ULJA 4P73A 3HOVB 2ZJPA 3QWNA 1X4NA 4RGMA 1L1OA 1K3RA 4DR1Q 3I4NH 2LF0A 1YNJC 4A4IA 4JI0L 1DM0B 3OHXC 3TBIB 1F2LA 4DR2L 4O1NA 5EKIA 1PVOA 2F0FA 4A3LG 4LWCA 3SK8A 3U50C 5JAVA 5M3MB 2DUDA 3W5OA 1I94H 1JB7A 4A3MG 1KRSA 2SNMA 3AFPA 2K04A 2OWOA 2LRRA 2B2WA 4RG1A 4DV0Q 4RH6A 1KL9A 2E2JH 1T5EA 1EIGA 2HH3A 4ALPA 1QVFA 2WV6D 4IJLA 3N6RA 3BYYB 3WWVA 1KC8C 4X64L 2JA7H 3J7AV 1WE8A 2ATWA 3KLSX 4OWXB 1MJEA 1MSHA 5A2QE 2OTLA 4N9TA 1ICWA 2K03A 4B3SQ 1HUNA 2MHVA 2UXDL 1RL2A 4JC0A 5D3IB 4EQ5A 1IBKH 2K5DA 4JYAH 1WFQA 3TRZA 4GKJL 2J7ZA 1VQJA 1EY0A 2K5QA 3DUZA 2WAQG 1XNRL 4XT3B 1TKWB 3NWSA 5CORA 4BY1B 1AP0A 1GUNA 2JK8A 2VQEL 4HN7A 1GJXA 3DMUA 1WVNA 1VQPA 1MIUA 4LF8L 4A93B 2MQHA 4PMCA 2HT1A 4QIWE 4DV5L 2YV5A 3WDNA 1IBML 1VQLA 3R8BA 4BBSH 1D5MC 2PZUA 1S40A 3QG1A 4LF9L 1CI3M 3H6MA 4DV7Q 5KEEA 1BXTA 1X3FA 1HNWL 5J3BA 1EYAA 2LFNA 1I5FA 2ZJRA 1CQFA 1EU3A 3ER0A 1L0XB 4OO1G 5M3MH 2AQ3B 4MTKA 4EGVA 3URYA 1YHQA 2F4VL 4XXEA 3CCQA 4JBMA 4NZRM 5JJIA 2KCCA 4LFAL 4DUZH 4JI3Q 4E6IA 5CGKA 2IPKD 4F8MA 5IGDA 1TY0A 2B63H 3I4NG 1I4RA 3KLRA 1TS3A 3Q8DA 3E6ZX 1R9TH 1K8OA 2UXBH 1E24A 4JCVE 2R92H 2OXPA 1Y14B 1EQTA 4YHHL 3RN2A 4A3JG 1HNXQ 3BDCA 4LFAQ 3K59A 3K5MA 1JE4A 3I91A 1U4LA 2AUKA 3CCLA 1O7ZA 1XNQQ 4EC5A 4IURA 2ENBA 3KJOA 1VQ7A 4LF6H 4OX9Q 1N34Q 3ICEA 1DXMA 1VMPA 4ZUIA 3RN5A 2Z6KA 3UE0A 2XVSA 4G4KA 5KNCA 3MEFA 5FO9B 3S9WA 1X32A 3GTMB 1TIID 2XWBB 3HKZG 1HQRD 4X6AH 2NYZD 2JYOA 1WYDA 1K0RA 4WJ4A 1B2TA 4A3FB 1H9JA 4DV5Q 2CKZB 2L9HA 1HUMA 4LF5Q 1EY4A 2VS1A 3QIAA 2VQFH 5IT9E 1LT3D 2TMPA 1QNUA 3G7LA 5KGUA 4DV2H 1UE6A 3SK5A 3CRLC 1RIPA 1EL0A 2L12A 3PIP3 3GTJB 1PTOD 1A63A 3CHBD 1YNNC 3PSIA 4HIMA 1ZZIA 1NE3A 1TQOA 4FDBA 2F4VQ 4YCVA 3LNNA 1ESRA 2UXBQ 2ZTEA 3P1HA 4MN3A 4LF5H 1KNEA 1X3GA 2X69A 5LMNL 3FDTA 3FKIG 1Y1VH 1YNJD 4J8QA 5JEAH 1I6UA 2QKIC 4DV7H 1PH6A 3ULLA 5JVG3 1PFBA 2F0TA 3S2HH 4DR3Q 3PV0A 1SJHD 4LFCH 1UE1A 3R93A 1JOKA 4NXMH 3J7ZC 3J80L 3A8KE 5FLXE 2QEJC 2XIWA 4K14A 4LFCL 1VQ4A 3RD4A 3GD7A 4CKBA 4UY8C 1JE5A 4L5QA 5E1FA 2I5MX 2A1SA 3K57A 4OONA 4N9PA 4L8JA 3P20A 3FPUB 4A3IB 4H7BA 3S17H 3LWUA 1I50H 1UAPA 2CVRA 4DAMA 3MTSA 4LF9H 2RHSB 1TR5A 3D8GA 2F0SA 2C35B 5ELDA 3CC7A 4GKKL 2CTMA 2P5ZX 3TDQA 1QCBD 2WACA 3GTGB 2WAQE 5LMUL 2EYHA 2UU9Q 1WOCA 4K5VA 2YU9B 1HNZH 3E9IA 4ZKCB 2F4VH 1LABA 1VQDA 1SEBD 1T5XD 2DNEA 1KLUD 2F0UA 4FJSA 2K32A 3O13A 4RAUC 4F88A 5IGBA 2G9DA 1ML0D 3MFGA 4M1UB 4RFBA 3KDFA 3HOUG 2E2DC 3L9AX 1GHJA 3HS0C 4AH6A 2A69C 4X66Q 2EJFC 4C3HH 3Q0AA 1IBLQ 2DGRA 3VA5A 5FLMG 3RLOA 5GROA 1IYJB 5JEAG 4A76A 4DUYQ 2HIXA 2R7ZH 3S1RH 1CKMA 3F1ZA 3OOCA 1S5FD 4JI3L 3TSSA 2BH2A 4G7ZC 4IFDI 4EVOA 3T1YH 1SYBA 3E0EA 4XDXA 5LMNQ 5DLQE 2EYLA 3NSWA 3L3OC 4IO9A 1G8ZD 1STYA 4IQZA 1O7YA 4GOPC 3D4DA 3I3CA 4JVZA 1ZEQX 3PO3H 2PMZB 1BBUA 2N8NA 2RSNA 1VQOA 1HRJA 2E2IH 3NWTA 3HOZB 2BOSA 3I4MB 1U4RA 3R2TA 3TP6A 4JI8Q 3C1EA 1TWCH 4JI7L 2JEAI 2UU9L 1CK1A 2ICIA 1NY4A 2I46A 4IPGA 4RGTA 2FMRA 2PT7G 4DFAA 4OWWB 4TRDA 2BDOA 2FJ2A 1A0IA 4H0LC 1DD2A 3ONAB 1VF5C 1V8QA 4UDUC 3FEWX 4PMBA 1EY5A 2RQXA 3STBC 4NZTM 3HOZH 3ND8A 1JMCA 5ELFA 5IWAH 1F2YA 2ZXOA 5I9PA 4K8IA 4BY7H 1CSPA 2EY1A 1YJ9A 3I4LA 1HNZQ 4OGQC 1VQCA 4ODGA 2K5NA 4A3KB 3KK7A 3NE5B 4XQQA 3DM1A 2NVYB 5HURA 4R8IA 4MNOA 4B3SL 1Q3LA 1SROA 3C2PA 2MJHA 1AH9A 1N36H 2O5IC 2E8GA 3ERQA 3QO2A 2R92G 4DV3Q 5JJKA 1XTCD 4DKAC 2JA8G 2ICEC 2VKCA 1Y8PB 1YJWA 4B9XA 4DK1A 3EFXD 4BY7B 3UDGA 1Q12A 4CKEA 3JAMc 4JI2Q 1KRTA 4A3KH 3E3XA 5I6YA 3SK4A 3S17B 1E2VA 1Q46A 3LWEA 3IAYA 1CZWA 4L5RC 1X6OA 1VQ5A 4FJUA 5IWAL 5M3FG 1RODA 1FD7D 4Y52H 1PLFA 2EE1A 3PUXA 3IFTA 4J1MA 1JCKB 1SRUA 1BCPC 4NDXA 5DNFA 2B63G 3M7GA 3I73A 4JBWA 1U4PA 1ASZA 3PIO3 2F0IA 5ELEA 2CTJA 2CH4A 3BDOA 2FFKB 2PI2A 1EYGA 3BJUA 3S1NH 4KI0A 1YJNA 3HGBA 2VQEH 1PZKD 3E9HA 1SAPA 1RF2D 5HGQA 1TXYA 2RKSA 3NBHB 4I65A 1XMQL 1C4QA 3C46A 3OYYA 5FO8B 4KD3A 3FRPB 2QEXA 1D5XC 5IT9L 1LLRD 5M5YH 4GKKQ 4JI5H 1UE7A 2Q8IB 1VQKA 4R4IA 2F0GA 1I6VC 2ZXPA 3D6CA 4KV6A 4GNXB 1OXXK 3MHBA 4GN3B 1CTMA 4PDBA 4LIJA 1IBLL 4JI5L 2NN6G 5I2XA 2F0PA 5ELNA 5IGGA 1SNDA 4BS9A 1WVLA 1O7IA 2KECA 3CCJA 3M3YH 4DGZA 2RHQB 1S3OA 4XQJA 3GTJH 1SE8A 5IGEA 4JI2L 3OSSD 1BUVT 3H09A 3PO3B 3M4OH 4JI5Q 4GKKH 1OXTA 1O7LA 5IWAQ 5E3FA 1JJGA 2QILA 1R4QB 1K3BC 4NXNQ 4G7OC 2IHEA 1Q1EA 4QB4A 2K28A 1KAWA 1JOOA 3SR1A 3GTPH 5FJ8H 1BQQT 2JE6I 1N8RC 3HKZB 1EIHA 1VBIA 1O78A 1S5ED 2B2VC 2A68D 3CD6A 4NPSA 4JI6H 3EBEA 4C3IB 3NTKA 2HDMA 1J5EQ 3GTOH 2CTLA 3HOUB 2SOBA 4QL5A 4HMJA 5KYIA 1VQEA 3H94A 4B3RL 4UAIA 1WTPA 2Q8RE 1PH7A 4CGYB 2E5LQ 3HKSA 4GS3A 3I4MG 3OTOQ 1B50A 1PHJA 2P2RA 2A73B 1PH9A 2K1HA 1EY6A 2QDLA 3JAMW 1E1TA 4AM3A 4AYBB 3VKEA 2H4OA 5K36G 1IL8A 1SNQA 2GA4B 3QD7X 1N32L 1EIYB 5FLXW 4FVMA 3AU7A 2HHHL 1A8VA 1EWHA 3U1KA 1HZBA 3JC66 3HOVH 1K83B 2Z6BA 5GAEC 1LYLA 3Q22A 2I5LX 3CAMA 5FLXc 1IL2A 4DAYA 2EXDA 1EY8A 1JQYD 5JJLA 1DONA 3L2PA 4FXKC 4ID6A 1QJOA 3PUYA 4HMIA 1SYFA 1SR3A 2J0TD 1NSNS 3S2DB 3CC2A 2CQAA 5AJ3Q 4BXXH 4ZK9B 4X66H 1KHMA 4LF4Q 5KNDA 4OCHA 1LT4D 1AN7A 2RDFA 4JI4Q 2DJFC 4CJ1B 1KXLA 1GUOA 1B53A 2DY7A 2KHIA 5JOBA 1ZXTA 2HHHQ 1F9PA 1ASYA 3F2DA 4FO2A 4JV5Q 3IFDA 1KD1C 4YWKA 3PIPA 5BN4A 1J5KA 1ICFB 1SNPA 1S5CD 3S1MB 1PV4A 3J80i 1STGA 1OXVA 2YTXA 5M5YB 1HNZL 1DZ1A 4LMQD 2QF7A 3NK9A 4DUYL 3GQBA 4KKSA 2F0OA 5I9OA 2XTIA 1JORA 4DNTB 5C0XG 3K8AA 1AW7A 5BN5A 2F0HA 5E4XA 3BZCA 5CV5A 3SGIA 3W2DA 4BA1I 2Q2HA 1ET9A 2O4CA 2E2HH 1MSGA 1LV9A 2B3GA 1EU4A 5C44G 3I4MH 2O4XA 2N3SA 2F0EA 4DK3C 4LF4L 4LUZA 4MTNA 4FF2A 5CV9A 2BA0A 5IP7G 1VQMA 3T1HH 5J1ZA 3NEMA 5CC4A 1Q82C 2ZT9C 4L5SA 1FJGQ 2IL8A 2L5TA 5IYDG 2YYZA 1ENAA 2IWHA 3T51B 4CBVA 3MZ5A 4X62H 4QMFB 4CHTB 4PNYA 1HQMC 4KHZA 2K50A 2KQ3A 2E2HB 3S15H 3VR5A 3HOXG 4HTHA 1XJVA 1S72A 2E2JB 1EQQA 4K6DA 2BA1A 3CRKC 1XYIA 3T56B 4L6TB 3AFQA 1GUSA 3EIVA 3EJIA 4IUPA 4DV5H 3SE0A 3CCRA 3BS1A 2Z4HA 3TS2A 2PNHA 4GNXC 3VR4A 4LAAA 3MFYA 2EVBA 3K0YA 4DF7A 4B3TH 4A3DG 1CHPD 2JA5G 2B29A 5IP9H 4IFDG 2NTSA 1N32H 1ZYRC 2A68C 1DOMA 3X3MA 1JWMD 1UE5A 2PQUA 2K75A 4NXNH 3PQIA 3PUZA 4JYAL 4WORA 1UUPA 2HIVA 3JAMi 2CPQA 2K6AA 2WB1B 4QUFA 3NPPA 4ZCKA 3KOJA 2O2LD 3OWEB 5CBAE 2G5DA 3H0GG 1QVGA 2KJXA 4DXFA 2CHBD 5DAUA 2F0KA 4DR6L 2F0LA 3S1NB 2EJMA 3KDGA 1HZ9A 3PF5A 2FHTA 2OQ0A 1LTBD 4C3HB 1L1OC 1LTRD 1PA6A 1JT8A 2B2UA 5IGCA 1W6KA 4GOPB 1K8MA 3I2ZA 2AUJD 2PQAA 1RHPA 5D3DA 4A3EH 4IFDJ 1PFSA 2KHSA 1WCMH 2AQ2B 1U4MA 2NTTA 2Y0SG 2IX1A 3S15B 1KTKA 2JA9A 3A7AB 1C0AA 1D8LA 1XNQL 5DM63 1DTJA 3I90A 5M5XH 3HOXH 5A2QW 1M4VA 2Y3MA 5LL6b 5CMDA 3CF5A 2A5HA 1G91A 4YHHQ 1HNXL 1DJRD 1VIHA 4K6LA 2NN6H 1QZGA 4QJFA 4OXPA 3FMCA 1RTNA 4RCNA 1QNKA 4K5XA 1BKBA 5I6WA 3K7AH 3EROA 3RLFA 1F77A 4DR6Q 3EVQA 5EQ0A 3MXNB 1F0XA 3T53B 4X65H 3CCMA 2LY7A 4FNFA 4ZKBB 4LK1C 5KYLA 3GTMH 5LMNW 4E9JA 1MJCA 3KFUA 4B8TA 2B2UC 4G57A 1Z6HA 3TMEA 2XSCA 2JA5H 1VQAA 3A5ZB 4B3SH 2QCPX 3TP8A 2VL6A 1PRTB 3Q23A 3MC0B 4IUNA 4A3BB 4KJNA 2R92B 2R7DA 5E7NA 5M9OA 1B9NA 5IYBG 1IBLH 3KF8A 5G3LD 3GTQB 4A3MB 1PMRA 1TS2A 1ZZJA 3VDYA 5I2YA 1M8AA 2VUMB 2K5WA 1BCPB 4HCEA 3M3YB 3V96A 1EYCA 4FYDA 2VZAA 5K36H 1I4HA 2PZWA 2PQAB 2ZJQA 4A3BH 1TT2A 1CA5A 4LFBL 1F9QA 4A3FH 1SLJA 3K5LA 4JI0H 2UUAL 4OEMB 4LF5L 4CJ0B 1LTSD 2V1CC 2OF1A 4OO1H 3LGJA 4LUOA 5JEAJ 3A56A 1I6HH 2X6LA 3H91A 1CFMA 1CKNB 3AYHB 4IN3A 1GHKA 3S2DH 4ZYSA 1YBYA 3K5OA 4M8AA 2F0VA 4DV6Q 3S16H 1EWCA 1KDCA 2OCEA 4JI1L 3HOZG 5C0XH 2CTFA 1L0YB 1G51A 1WHRA 1FJGH 5C4ZA 4DR4H 1TWHB 1SNCA 5F2DA 4B3ML 4ME3A 2RCFA 4C1NK 1CA6A 3EZJA 2NVQH 3RNUA 4A3EG 1GVPA 4BBRH 1WJJA 4A3KG 2I0QA 3W1BA 2K05A 3C3LA 2E3UA 1FR3A 4JG2A 3VYSA 1CUKA 4FP5D 1FNVA 1DOKA 2H5XA 4DU9A 1Y1VG 3AEVA 2BE5D 4GZYC 1G6ZA 4JW0A 2HD3A 4RMFA 5IGFA 2H1EA 4GKJQ 4JV5H 2K5HA 3KYHC 3J7AF 2XWJB 3V05A 3Q24A 3FP9A 4LNQA 1WTQA 4MIUA 4JOIA 5NUCA 1FGBD 4BXXG 2KCNA 4DV2Q 5IYBH 1KQSA 2PPBC 3HP3A 2ANRA 1IBMQ 5G3LF 1JWSD 4DV1H 1STNA 2MGSA 1EY9A 2Z1CA 3AQQA 2AWNA 1JJCB 2NZHA 3PMFA 3KDKA 4TKOB 4WJ3M 3GTKB 2M8WA 1OXSC 1K9MC 1L1OB 4C56C 3T1YQ 1BF4A 1Z2IA 1HNXH 2KEEA 3MXGA 5C3WA 1BCPF 5BR8Q 1XNRQ 1X65A 1KABA 4KKUA 3RR5A 3PIOA 5GQOA 2F3VA 3SEBA 1ODHA 3J81E 4CDDC 2NVQB 2FMMA 1WI5A 1HZAA 3M9BA 1Y8OB 4AQYL 2E74C 3G71A 5I4DA 5ISRA 1F9RA 3ULPA 1YHBA 1M90C 3OTOH 1EY7A 4K5WA 2RCNA 3U9OA 3SVMA 4PZ6A 5LHY1 2VUMH 4CJ2C 2OEOA 1NJIC 1WTXA 4DR5H 4DR7Q 1EFID 1V8CA 4HJ5A 1E7ZA 2M9VA 1IZ6A 1GD7A 3BVZA 2LTMA 5C0XI 3CC4A 2F3IA 1L0WA 1D5ZC 1J8IA 2B2WC 4EX5A 3CCSA 1KIXA 1TWCB 2PO4A 3K7AB 1K73C 2EY2A 1VMCA 5D65A 4JVHA 4AQYH 3D4RA 4BBSB 1T9HA 2HDLA 2Q8TA 3QR8A 4LFBQ 3MA2B 3BG3A 4EQOA 2QW7A 1XPUA 4DV4H 3CP0A 1R4PB 3U4ZA 1PRTD 4A3GG 4KKTA 2KA7A 2F3WA 4Y7NB 4KTAA 1PFMA 4R1JA 2HQLA 4JBKA 3ITPA 4LFCQ 4H8AA 1I3QB 3C1FA 1UWVA 4RA8A 4CDEC 1HR0L 1K1GA 5LMNH 2O5JC 1WCMB 1STAA 2IW3A 5HGTA 3MAQA 5KIXA 1CHQD 3FKIB 2NN6I 1FNUA 4YWLA 2F0QA 1Y8NB 4H13C 1O80A 4ILWA 4OHJA 3GTQH 1HR0Q 4EQNA 2XGTA 1IYUA 2HCCA 5GAHC 2A6ED 1E2WA 5BN3A 1UNSA 2YQRA 1UEAB 1V1PB 3DM3A 4NB3A 3J81i 3G48A 4ZLTF 3QJYA 2RDGA 1KHIA 1WCMG 2N88A 2YU9H 1P16A 5EPLA 1OTCA 4JI6Q 2KBNA 3S14H 4AYBE 4Q5VA 3J7YW 1PH8A 2XNAC 2Y0SE 3GTLB 4CDCC 4K8JA 5M3FH 1X3QA 4K0KQ 3M85A 3VYTA 2ID0A 4G08A 1CSQA 3BZKA 1N33H 3GTKH 3OSOA 1Q8IA 1HH2P 3J81c 4OWTB 4DR2H 1H9KA 1K8GA 2NBFA 3NQTA 1SNMA 2QA4A 4B3TL 2M2LA 1I94L 3D31A 1PH5A 2F0NA 3JAML 1QVCA 2WAQB 3NQIA 4LJZC 4JI2H 1EIFA 1BDOA 3I7FA 3GTPB 2CPMA 3DWAA 2MUYA 4K0KH 1D2BA 5JVH3 2BCOA 3FKIH 3GDEA 4X64H 4MZ9A 3SB1A 2AQ1B 1D7QA 3CMEA 1TWAH 2L1BA 1Q8KA 4OD6A 3PO2H 1EUJA 1A3VA 4AQYQ 1Y1WH 2E5LL 4BY7G 2FFMA 1GM5A 1V9PA 2LKVA 4B9WA 1UG8A 3N52A 1NBWA 3OMCA 5GADC 1VQ8A 4B3RH 1U0LA 2UXBL 4KMUC 5BR8L 3RZDH 4RHRA 3VYRA 5C44B 2UXCL 5DT9A 2AXYA 1S4ZA 1FL0A 3RZOH 4X62Q 1TWHH 2ANNA 1U5KA 2UUAQ 2WIIB 3LX0A 1V1PA 1WD1A 1EFWA 2UUBQ 3DEOA 1Y1WB 3A74A 4ABNA 1VQFA 5IYDH 2LS01 3GABA 3GO5A 4LF7L 1AN8A 1ZZKA 2L55A 3RZDB 2Z8LA 2EXZA 4JI1Q 4X3TA 2RDHA 4O0AA 4AYBG 5J39A 2EIFA 1E22A 1K0SA 3HFZB 1NNXA 2R93H 1CT1D 3VR6A 3AEVB 1YNND 2A6EC 1TWGB 1WTOA 3NTHA 4Y7NH 4DR5L 3WOFA 5IP9G 4IFDH 4NP5A 1I4QA 4JBJA 1EYDA 4JI4L 4TVAB 4HSVA 4DV3H 4N8X1 3OW2A 4LF8Q 4HSPA 1A2UA 4JI8L 1QUQA 1HTPA 2A6HD 3NENA 1FNWA 4OELB 1VQ9A 3GR5A 4DR7H 2LSSA 4B3RQ 1PRTC 4GLAC 4C3IG 3K6OA 1FVIA 1QILA 4C1NI 5M3MG 2UUCQ 1LM0A 1GUWA 4FXDA 3MXUA 1K83H 3S1MH 3E5SA 3H3VC 2F03A 3G4SA 1E2ZA 4P2CB 3RZOB 2EYMA 1J5EH 2NWGA 3I56A 4X64Q 1PTOF 5FJ8G 4DK6C 1SN8A 4QY7A 1C7YA 2D5DA 1PH3A 1RD9D 1A2TA 3JAME 1EC6A 1XNRH 2EY5A 1XPRA 3RF2A 1G2TA 2JP1A 2JN4A 5EPKA 2FXQA 3VYUA 4IPDA 1EOVA 3A8JE 4DR1H 1SYGA 1VQNA 4C2MB 1OO9B 3TZDA 2KEDA 1Q1BA 1ZTGA 1X55A 3OPOA 1SDFA 3HOWG 4ME5A 1H95A 1WTHA 1HXYD 1H9SB 2XRQD 3T13A 3D3RA 1ZKOA 1WTVA 2WP8J 1JOQA 2RA4A 1N36Q 4OIKA 4CDFC 2PCFB 2A19A 4DV0H 1FKAH 1IKLA 2OT2A 4A3IG 3A8IE 3PO2B 4DN4M 2R61A 3D4WA 4NW2A 1YITA 3K81C 4A75A 3J81W 3FAUA 2JZXA 1KLGD 1H9RA 3S16B 4PZ8A 1X9ZA 2A1AA 5C4XG 1X54A 1BR9A 4EQPA 1XRHA 4Z9CB 4POFA 1J4WA 4BY1G 4A3JB 3UDFA 3Q6SA 1LTAD 1NR4A 4R9WA 2K14A 2RF4A 2JXMB 3GP7A 1N9WA 5AFWA 4DPGA 1IHZA 3NELA 3H3VH 5ELBA 4P72A 4A3BG 3IRBA 3DXJC 2VXWA 3J80c 2A74C 4XIGS 3QOLA 2NB0A 4A3CG 4LW1A 5COYA 4C3IH 4KJOA 2N55A 1GO3E 3NUCA 5C3EG 1B1ZA 4PV1C 1HJPA 2IY5B 1TVXA 2XRSD 2GVAA 1DYQA 1IXRA 1HCZA 4L5TA 3KF6B 2A69D 2AKWB 2JSOA 1VF7A 4DNRB 3IL8A 4GLVB 4WFN3 4A3GB 1V1QA 2KCTA 3TP7A 4RHSA 2QGQA 1HNWQ 1X4MA 2QDBA 1HZCA 1NTGA 1VDZA 5A2QL 1ENFA 1A3UA 5IY0A 4PG3A 3M4PA 1EEID 4IOCA 1SE3A 1N36L 4WJWA 2EOTA 4R4QA 2I07B 1SMYC 2IX3A 3A7LA 1LACA 2M00A 4K2KA 5M5WH 2C9OA 2J4XA 4FF1A 2OPUA 3MXPA 4DR5Q 4DUZQ 1EWIA 4YHHH 2NVTB 4A3IH 2A8VA 1W2BA 3KBGA 1XMOL 2PMZE 1IYVA 4ZUJA 1ENCA 2L11A 4O2DA 1EZ8A 4R4OA 1FYCA 5C4XH 2WB1E 4GLXA 2CWHA 4JI4H 5IODA 4NXML 1F2MA 1TY2A 5C4JB 1PYBA 2A6HC 1EQRA 1XMOH 2DJGC 4ZAIA 3B6YA 5CBEE 4C3HG 2CWFA 2F0JA 1IKMA 4L63B 4P75A 3F2BA 4P71A 1SXTA 4DAPA 3J81L 1JB3A 3A55A 3OW7A 1Q7YC 2UU9H 4DV4Q 4O42A 3STBD 4DR4Q 1RDPD 2ZTDA 1GXDC 1GOZA 3OIQA 1KAAA 2NUCA 3EQLC 1S03G 1AEXA 3PO2G 1F9SA 4HJ9A 3RMHA 4A3DH 1MD2D 3PUVA 3HOYB 1QWYA 4RGOS 4S3SA 4YCWA 2FPHX 1S5DD 1PTOH 3HOVG 3UDIA 2R7ZG 2K4KA 2R93G 2X06A 4UHVA 1VIGA 2JA6G 2GVBA 1A6XA 4DUYH 5KNBA 3P7JA 4NXMQ 2VQEQ 1NR2A 1H9MA 1W6JA 3J81j 1N34L 2NVXB 1YEZA 2CWPA 4DR3H 1RTOA 3U9SA 1GUGA 2K7VA 3V69A 3PF4A 2AHOB 2Q2IA 4WRDA 2JVZA 2K01A 4IPHA 3TREA 3S1QB 3I0PA 1XTDA 3T1HL 4KY5A 4HEDA 5IT9c 1BBWA 1XWEA 1NMGA 5C4JH 4DV4L 2R3ZA 3KLSA 5T1IA 2G8YA 2B8FA 1I4GA 4X62L 1I6HB 2ZM6H 2IJ0A 3S24A 1TWGH 4OIJA 5C3EH 1TWFB 1ET6A 3TEHB 1E1OA 4HAEA 2CTKA 3M4YA 2EY6A 1WTRA 4YWMA 2K5VA 1N33Q 1LUZA 4LF9Q 2X6GA 1BNZA 2VUMG 1SMYD 4JI1H 1PYSB 5EKLA 4TQUS 2D62A 5LL6S 1II3A 1VQGA 1X3PA 2CCZA 3PO3G 4QF4A 2G9HD 1HFGA 4C2MH 1L2FA 1PTOC 2D2CC 1CKOA 1B3AA 3H15A 5IIFA 4BBRB 3HOYH 3OMGA 2EJGC 4DR2Q 1MI2A 4X65Q 1VS0A 5CV7A 4B3MH 2PZTA 2RSOA 4DR4L 3ND9A 3UE1A 2L15A 3TS0A 3J80E 2K1BA 5AJ3L 5IT9W 4UPAA 3VA7A 4U68A 4DXGA 4YIJA 1PRTF 4A93H 1NXUA 4KY6A 5FK9C 5M5WB 3GTLH 1PFNA 4R4TA 1W3SA 5CV8A 3S1RB 1VQIA 2PYKA 3CKIB 2UUCL 3TQYA 1CKNA 2YTVA 1SSOA 4IALA 3PUWA 3T1YL 4DNIA 3S1QH 1YZ6A 3CQZB 2ZM6Q 2IT1A 1SE2A 1LTTD 5C4XB 1N33L 3CU7A 1PH2A 3K58A 1WTWA 5EKKA 4HIOA 4IOAA 2D9UA 1A3TA 4JK1C 1B3QA 3PGZA 1AZPA 1RJTA 1HR0W 3F8TA 4YCUA 2LMCB 3OETA 5IP7H 2B63B 4LF6L 3OWFA 1XNQH 2RVLA 1X9NA 2KOLA 1AZQA 5LL6X 4XYOA 1J9OA 4A3MH 2PI2E 4P74A 2PW7A 4DUZL 4LFAH 5CYUA 2BH8A 4APVA 3HOWB 4A3GH 5DM73 1KDBA 4KHPH 1Z47A 2SEBD 1KDAA 2EYFA 1BO0A 3FPPA 5H1SE 4DV3L 2EZVA 4C3JG 4JI7H 1J6QA 2UUBL 4RKBA 4DR6H 1B8AA 4LF7H 4DR3L 1IBKQ 1F2ZA 3KDFB 1BBXC 3NTIA 5IYCG 5DEHA 5FO7B 2VB2X 3U58A 3CCUA 1HPCA 2XN9C 4X65L 4UP9A 3IKJA 4J15A 2L0CA 2SNSA 4KK7A 4A3FG 3PCOB 3KUPA 4J6HA 4DV6L 4LF4H 1J5EL 3CQZH 4I7AA 2CW0D 1LTLA 4PMWA 3J7AK 2Z4IA 3H0GH 3EA6A 1A62A 2HHHH 1Q81C 1I50B 1LTGD 2TSSA 1G6PA 2ZTCA 3A54A 5GAGC 5C3XA 1CQVA 3MVVA 2Y0SB 4YY3H 3HEJA 1TS4A 3R2IA 4BBSG 1R9TB 1SE4A 4DR1L 1Q90A 1D6EC 4IUQA 2K33A 1NCVA 2D0PA 3HOUH 2VW9A 2N49A 1UEBA 4NBQA 4JI8H 1KNAA 2V4DA 1XX8A 4IJHA 1YIJA 1PZID 4LFBH 2KUMA 5IOCA 2PY9A 4C3JB 4DR7L 1SYCA 4BA2I 5KRUA 1PYWD 3G6EA 2CQOA 4LF6Q 2UUAH 2D0OA 4K0KL 4GOPA 5J22A 1I4PA 1LTID 2UXDQ 4HJ7A 3J80W 2AMCB 4DV6H 3HKZE 4GN4B 1TS5A 1CM9A 4UP8A 1HHVA 4JI6L 3I8ZA 1B9MA 1IBKL 4NMZA 1X56A 4JI3H 1OXUA 1HTLD 1Y1WG 4OX9H 3GV3A 3HZXA 3P75A 1PDQA 2DNCA 2I5HA 1P8LA 3KF8B 2PQEA 3KF6A 5E4WC 1STBA 1C48A 4MHEA 5CR3A 3RUZA 1JICA 4DAYB 1XMOQ 1DCZA 4QMGA 4FF4A 4QUCA 3I70A 3M7NA 3UDXA 4PQXA 4XT1B 1I94Q 4U673 1HA6A 3SDZA 4B3TQ 2CH4W 3K7UC 2JA8H 3SHLA 4LF7Q 2VQFQ 3AB9A 3CPFA 3CXCA 2SDFA 1TWFH 1A15A 1G291 1JC7A 1S20A 3HG9A 3MXNA 2MO0A 2LXKA 2GN5A 3M4OB 5M3FB 1STEA 1HFNA 1RCVD 4QQBX 5LMUQ 3DLLA 1PTOB 2MO1A 2E75C 1S5BD 4DAVA 2EQSA 4JVYA 2MFIA 2LTLA 2BDNA 1BCPD 2CTEA 1QB5D 1X3EA 5C5LA 4N8FA 3E0JA 2MJ8A 4IUUA 4HJAA 3KJPA 1B4OA 4C3JH 1MKHA 2NVXH 1HNWH 4FF3A 4A3LH 4HIKA 3I55A 1N32Q 4KLKA 3VR2A 1G2SA 5ELOA 1EQVA 1IBMH 2N78A 1H9SA 3UI2A 1VQHA 1SYEA 2F0WA 5BR8H 3L7ZC 2JA7B 4H02A 4ZRZA 2NVYH 3HRZC 3VR3A 5C6AA 2NZ1D 4JI0Q 2E5LH 4X3KA 3BVMA 2UUCH 3T16A 2F52A 3CMAA 2QNDA 4JPBW 4V0BA 1JWUD 5T1GA 3H3VI 5C44H 1E0BA 3A5UA 2EYJA 2F4IA 4OO1I 2HUGA 2MP1A 1SFOH 3KBXA 2B8GA 4F7XA 4X3UA 4R4CA 3AMUA 5FOBB 2EYPA 1D1KA 4XTCS 3T4AC 2IHFA 2DGYA 1K8AC 1ILQA 3FHWA 4KHVA 3CPWA 4KHPL 5CV6A 1EZ6A 1ONLA 2KENA 2WINB 4JI7Q 5EAYA 3CCVA 1AE3A 2MPMA 1EEFD 3QB3A 2DY8A 3F2UA 1N34H 1V1OA 4KHPQ 2JA6B 1C8CA 1XMQQ 4A3CH 2R93B 4QCLA 4HR7B 2IX0A 2CW0C 2K52A 4X66L 2R7ZB 3GTOB 1TU2B 1V43A 1PH1A 3NBIA 4V190 2YTYA 1LT6D 3L0OA 2ASBA 4DV7L 1XMQH 2OQKA 5JPNC 3BYTB 3BZDB 2Z0SA 1B70B 2ZXRA 3FVQA 3CCEA 1PQXA 3K5NA 1QZHA 3DHQA 3U4VA 5IE8A 4BY1H 1B7YB 4NKLA 2R7FA 1QE6A 2CFMA 4KD4A 1YNXA 2PW5A 1SJED 4RCOA 2M6QA 4TSSA 2AWOA 4ZQ3A 1TUAA 2L4NA 4DK0A 4YY3Q 1NUCA 1K28A 4GN5A 1YI2A 3GV6A 1FJGL 3J7A5 1GKHA 1IW7C 4A3JH 2B2VA 1ILPA 1Y69U 3X3NA 2ZM6L 3R3OA 4K2LA 5CV4A 5D14A 1HR0H 3H0GB 5FLMH 2F1MA 1M1KC 3W1GA 4ULLA 1FGUA 3GKUA 2F0MA 2RBMA 2CWAA 2OTJA 3NCVA 2WB1G 1DGSA 5L37A 2ES2A 2FMCA 4QGUA 3GTGH 3RLNA 1AFPA 2VB3X 1Z9FA 4JOIC 4KY7A 3EN2A 3QOJA
chains in the Genus database with same CATH topology
2R6GA 1YHAA 2VQFL 4OWWB 5M5WH 1CKNB 3AYHB 3D0FA 3K0XA 3S2DH 2OPUA 1YBYA 1A0IA 4DUZQ 4DR5Q 1EWIA 3M4QA 4DV2L 4A3IH 4DV6Q 3S16H 2Z6KC 2A8VA 4HJ8A 2OCEA 4JI1L 1W2BA 3HOZG 1XMOL 2PMZE 4DV0L 1AE2A 2CTFA 4HIDA 1G51A 3STBC 4IPCA 3HOZH 4O2DA 4R4OA 1JMCA 5C4XH 2WB1E 4GLXA 1JJ2A 4B3ML 4BY7H 4ME3A 1CSPA 1NMFA 4NXML 2NVQH 2KHJA 1YJ9A 1PYBA 1EQRA 3RNUA 4A3EG 1GVPA 2Q2TA 1HNZQ 4UP7A 1VQCA 2JEBI 4BBRH 1WJJA 4A3KG 2I0QA 3W1BA 2K5NA 2E3UA 3B6YA 4JG2A 1CUKA 2H5XA 4AIMA 4MNOA 1SMXA 4P75A 4B3SL 3F2BA 4JV5L 2NVTH 4P71A 1Y1VG 1SROA 3AEVA 2MJHA 1Q7YC 3KLWA 1AH9A 4DV4Q 4DV1Q 2E8GA 3STBD 2R92G 1Q86C 4DV3Q 5JJKA 3K80C 4DR4Q 4DKAC 4RMFA 2JA8G 1YJWA 2ZTDA 4GKJQ 2K5HA 3KYHC 3PO2G 4LUVA 4HJ9A 3UDGA 1Q12A 3FP9A 1E3PA 3ZJYC 2MNAA 1PH4A 4A3DH 4LNQA 3JAMc 3PUVA 1KRTA 4JI2Q 4JOIA 4DV1L 4A3KH 4YCWA 1Q46A 4L5RC 4DV2Q 3BU2A 4BXXG 1X6OA 1VQ5A 3HOVG 5IWAL 5IYCH 5M3FG 1QUQB 4NXNL 3UDIA 5IYBH 2K4KA 1KQSA 2R7ZG 2R93G 3CW2C 4Y52H 1IBMQ 2ANRA 3PUXA 2LXJA 1VIGA 1SRUA 2JA6G 1I3QH 2GVBA 2B63G 4JBWA 1ASZA 3AQQA 2AWNA 1JJCB 1BVSA 2NZHA 2JA6H 4NXMQ 2VQEQ 3J81j 1N34L 2CTJA 4WJ3M 1YEZA 2VNUD 4WANA 2CWPA 1OXSC 1K9MC 5HY6A 2PI2A 1L1OB 1EYGA 3BJUA 2AHOB 2Q2IA 3T1YQ 3A0JA 3PF4A 3S1NH 2JVZA 4KI0A 1YJNA 4IPHA 3TREA 5BR8Q 3E9HA 1XNRQ 1X65A 1XTDA 3RR5A 5HGQA 3PIOA 3T1HL 1TXYA 5GQOA 2Q2UA 4WALA 3NBHB 5IT9c 1BBWA 1XMQL 1NMGA 5C4JH 4DV4L 3OYYA 1WI5A 1HZAA 3M9BA 3OTOL 4AQYL 4X62L 3S24A 2QEXA 1TWGH 5C0XJ 3I4OA 2OPVA 5M5YH 5C3EH 4GKKQ 3G71A 1UE7A 1VQKA 4R4IA 4BBRG 3TEHB 1E1OA 1YHBA 3ULPA 1M90C 2CTKA 4YWMA 2K5VA 3F2CA 1N33Q 1LUZA 4LF9Q 4GNXB 2HH2A 1OXXK 2KCMA 4GN3B 2VUMG 2UXCQ 1VQ6A 2RCNA 2BL5A 1PYSB 3ERSX 1IBLL 4JI5L 4LIJA 2NN6G 4TQUS 2D62A 5ELNA 2WFWA 1VQGA 2NZOA 4PZ6A 2CCZA 1O7IA 3CCJA 1NJIC 2VUMH 3HOWH 3HOYG 3M3YH 1DT4A 1VCIA 1S3OA 2RHQB 4C2MH 1L2FA 3GTJH 1SE8A 4DR7Q 1CKOA 4HJ5A 3H15A 4JI2L 1E7ZA 3HOYH 1IZ6A 1GD7A 3M4OH 4JI5Q 1YVCA 1OXTA 4YY3L 4DR2Q 2JA7G 4X65Q 1C9OA 5IWAQ 5C0XI 1VQBA 3CC4A 2F3IA 4GNXA 1VS0A 1L0WA 1JJGA 1KIXA 4EX5A 3CCSA 3UE1A 4NXNQ 4OX9L 2L15A 4DR4L 3TS0A 4A93G 2JJQA 2JQOA 2IHEA 1Q1EA 5AJ3L 1K73C 4POGA 1KAWA 4UPAA 4JVHA 3GTPH 4A93H 5FJ8H 2JE6I 1N8RC 1T9HA 3GTLH 4PZ7A 3CD6A 4R4TA 1W3SA 4LFBQ 4NPSA 1XPOA 3EBEA 1VQIA 1J5EQ 3GTOH 1XPUA 2UUCL 3TQYA 1CKNA 2YTVA 3CP0A 3T1YL 3PUWA 2CTLA 3U4ZA 4DNIA 3S1QH 1YZ6A 2ALYB 2ZM6Q 3V69A 4QL5A 4B3MQ 2IT1A 4A3GG 2JEAI 4JYAQ 2VY3A 3T1HQ 1VQEA 1N33L 4B3RL 1PH2A 4R1JA 1PH7A 2HQLA 4JBKA 4LFCQ 3ULJA 4HIOA 4P73A 3HKSA 2E5LQ 4IOAA 4GS3A 3I4MG 3OTOQ 1UWVA 2ZJPA 1HR0L 1K1GA 1X4NA 3PGZA 1PHJA 1HR0W 3F8TA 2P2RA 4YCUA 1L1OA 1PH9A 1K3RA 5IP7H 4DR1Q 3I4NH 4A4IA 4JI0L 2NN6I 4LF6L 1E1TA 4AM3A 4YWLA 4DR2L 1X9NA 1PVOA 3VKEA 3GTQH 4A3LG 4LWCA 4A3MH 1HR0Q 2PI2E 4P74A 5K36G 3U50C 1N32L 2XGTA 4DUZL 2DUDA 3W5OA 1EIYB 2BH8A 4APVA 1JB7A 4A3GH 4A3MG 1KRSA 5GAHC 2HHHL 3AFPA 2OWOA 1A8VA 4RG1A 4DV0Q 3U1KA 1Z47A 1HZBA 3JC66 1KL9A 3HOVH 2E2JH 2YQRA 3DM3A 4NB3A 5GAEC 3J81i 3G48A 5H1SE 4DV3L 1LYLA 2HH3A 4ALPA 1QVFA 2I5LX 3CAMA 5FLXc 1IL2A 1J6QA 1KHIA 4IJLA 2UUBL 2EXDA 1WCMG 5JJLA 2YU9H 1P16A 3WWVA 1KC8C 4X64L 3L2PA 1B8AA 2JA7H 3PUYA 1OTCA 4JI6Q 4DR3L 2KBNA 1SR3A 1IBKQ 3S14H 4AYBE 1WE8A 2ATWA 3KDFB 4OWXB 1MJEA 2OTLA 3CC2A 5AJ3Q 4BXXH 1PH8A 4B3SQ 2Y0SE 2UXDL 5IYCG 5M3FH 4LF4Q 1RL2A 4JC0A 4K0KQ 1KHMA 3M85A 2ID0A 4EQ5A 1CSQA 3U58A 3BZKA 3CCUA 4JI4Q 3GTKH 4X65L 1WFQA 4UP9A 1KXLA 3TRZA 4J15A 4GKJL 1HH2P 3J81c 1VQJA 2KHIA 4OWTB 3PCOB 4A3FG 2HHHQ 2WAQG 4DV6L 1K8GA 1XNRL 1J5EL 1ASYA 3CQZH 3F2DA 2QA4A 4B3TL 4JV5Q 1KD1C 4YWKA 3PIPA 4PMWA 1LTLA 1I94L 2JK8A 3D31A 1PH5A 3H0GH 2VQEL 1J5KA 1A62A 1QVCA 1Q81C 1WVNA 1VQPA 1EIFA 1MIUA 1PV4A 4LF8L 1G6PA 2ZTCA 3I7FA 2MQHA 3J80i 2HT1A 1OXVA 2YTXA 2YV5A 4QIWE 4DV5L 5GAGC 1HNZL 1IBML 1VQLA 4BBSH 3FKIH 3GDEA 4DUYL 1S40A 2XTIA 4BBSG 4LF9L 4DR1L 5C0XG 4DV7Q 3K8AA 4MZ9A 1HNWL 1X3FA 1D7QA 5J3BA 3CMEA 1I5FA 1TWAH 2ZJRA 1Q8KA 2D0PA 3ER0A 1EUJA 3HOUH 3PO2H 4OO1G 4AQYQ 2VW9A 2N49A 5M3MH 1UEBA 1Y1WH 4NBQA 2E5LL 4BY7G 3SGIA 3BZCA 1V9PA 1GM5A 4IJHA 1YIJA 1NBWA 5GADC 1VQ8A 4BA1I 2Q2HA 2PY9A 1YHQA 4DR7L 2E2HH 4BA2I 1U0LA 2F4VL 2UXBL 3G6EA 3CCQA 4JBMA 2B3GA 2CQOA 5BR8L 5C44G 3RZDH 2D0OA 4LF6Q 3I4MH 2UXCL 5JJIA 4K0KL 2N3SA 4GOPA 4LFAL 2UXDQ 4JI3Q 2AXYA 4DK3C 4HJ7A 4LUZA 4MTNA 4LF4L 1FL0A 2AMCB 3RZOH 2BA0A 5IP7G 3HKZE 4GN4B 1VQMA 2B63H 3I4NG 3Q8DA 1TWHH 4UP8A 1U5KA 4X62Q 1R9TH 2ANNA 1E24A 3NEMA 2UUAQ 4JI6L 1EFWA 1Q82C 1IBKL 2UUBQ 4L5SA 1X56A 4JCVE 5IYDG 1FJGQ 2YYZA 2R92H 1OXUA 1Y14B 4A3JG 4YHHL 3RN2A 1HNXQ 1Y1WG 4LFAQ 3A74A 3PO3G 1VQFA 5IYDH 4QMFB 2I5HA 1P8LA 3KF8B 2K50A 3KF6A 4KHZA 3CCLA 3S15H 3GO5A 4LF7L 1XNQQ 3HOXG 1ZZKA 1XJVA 1S72A 3KJOA 1VQ7A 4OX9Q 1EQQA 1N34Q 4DAYB 1XMOQ 3ICEA 4JI1Q 2BA1A 3M7NA 4O0AA 4AYBG 3AFQA 2EIFA 3EIVA 3UDXA 1E22A 2Z6KA 3UE0A 3RN5A 1I94Q 3MEFA 3HFZB 2R93H 3TS2A 3CCRA 4B3TQ 2PNHA 3HKZG 3AEVB 3K7UC 2JA8H 4X6AH 4LF7Q 1WYDA 4GNXC 4Y7NH 1K0RA 2VQFQ 3CPFA 5IP9G 4DR5L 3CXCA 4WJ4A 1TWFH 4JBJA 1G291 4JI4L 4DV5Q 2CKZB 4TVAB 4A3DG 2MO0A 2JA5G 2B29A 2LXKA 2GN5A 5IP9H 3OW2A 4LF8Q 4IFDG 4LF5Q 2VS1A 4JI8L 1QUQA 5LMUQ 4QQBX 3DLLA 2MO1A 3NENA 1UE5A 1VQ9A 2PQUA 2K75A 2EQSA 3PUZA 4JYAL 4JVYA 2MFIA 1UE6A 2LSSA 2HIVA 3JAMi 4B3RQ 2CPQA 2CTEA 1RIPA 1X3EA 4GLAC 1A63A 3KOJA 1FVIA 3PSIA 3KJPA 4HIMA 4HJAA 1ZZIA 3H0GG 5M3MG 4C3JH 1QVGA 1NE3A 4FDBA 1LM0A 1MKHA 2NVXH 2UUCQ 4YCVA 2F4VQ 1K83H 3S1MH 4DR6L 4HIKA 4A3LH 2UXBQ 2ZTEA 3G4SA 3I55A 1N32Q 4KLKA 1X3GA 1HZ9A 5ELOA 5LMNL 3PF5A 2OQ0A 3FKIG 1Y1VH 2N78A 3I56A 1L1OC 4X64Q 5FJ8G 1PA6A 1VQHA 1PH6A 3ULLA 1JT8A 3S2HH 3L7ZC 4DR3Q 3PV0A 4DK6C 1SN8A 1UE1A 4QY7A 4GOPB 4H02A 1C7YA 3I2ZA 2PQAA 2NVYH 1PH3A 4A3EH 3J7ZC 4JI0Q 1EC6A 1XPRA 4IFDJ 1PFSA 1WCMH 2Y0SG 2F52A 4LFCL 3CMAA 2IX1A 2QNDA 2JA9A 1VQ4A 1C0AA 1D8LA 2FXQA 3H3VI 4IPDA 1XNQL 3GD7A 1EOVA 5C44H 4UY8C 1JE5A 4L5QA 2I5MX 3A5UA 4OO1I 4OONA 1DTJA 1SFOH 5M5XH 3HOXH 1VQNA 3CF5A 4R4CA 4YHHQ 1HNXL 4XTCS 1VIHA 1ZTGA 1Q1BA 2IHFA 1X55A 2DGYA 1K8AC 1QZGA 3FHWA 4QJFA 3HOWG 1I50H 3S17H 1H95A 4DAMA 3CPWA 4KHPL 4OXPA 2RHSB 2KENA 2C35B 3CC7A 4GKKL 4JI7Q 2CTMA 5EAYA 3CCVA 1AE3A 1BKBA 2WAQE 3K7AH 5LMUL 2WP8J 3RLFA 1N36Q 2UU9Q 4DR6Q 1WOCA 3E9IA 2A19A 3MXNB 4KHPQ 3CCMA 4A3IG 1VQDA 1XMQQ 1YITA 4A3CH 3K81C 4A75A 3GTMH 2JZXA 2IX0A 2K52A 4X66L 5LMNW 4PZ8A 1V43A 1MJCA 1PH1A 2YTYA 3L0OA 2A1AA 2ASBA 1X54A 3KFUA 5C4XG 4B8TA 4DV7L 2OQKA 4POFA 1J4WA 4BY1G 3KDFA 3HOUG 3UDFA 2Z0SA 1B70B 2JA5H 2K14A 2RF4A 4AH6A 3CCEA 1QZHA 1VQAA 3A5ZB 3U4VA 1N9WA 5IE8A 4X66Q 4BY1H 1B7YB 4C3HH 2VL6A 4DPGA 1IBLQ 2R7FA 2DGRA 3NELA 3H3VH 4P72A 3RLOA 2CFMA 3IRBA 5FLMG 4A3BG 1YNXA 3J80c 5GROA 1IYJB 5JEAG 4A76A 2R7DA 4DUYQ 4XIGS 5E7NA 2AWOA 4A3CG 2HIXA 5IYBG 4LW1A 1CKMA 4C3IH 3F1ZA 3S1RH 2R7ZH 1TUAA 4JI3L 4YY3Q 2BH2A 1GO3E 4IFDI 5C3EG 2IY5B 4GN5A 1HJPA 1ZZJA 3E0EA 5LMNQ 1YI2A 2GVAA 1FJGL 1GKHA 3J7A5 5DLQE 1IXRA 3VDYA 4A3JH 4L5TA 3KF6B 2AKWB 4IO9A 4GLVB 2VZAA 4GOPC 2ZM6L 1V1QA 2PQAB 2KCTA 2ZJQA 5FLMH 1M1KC 4A3BH 2QGQA 3W1GA 3PO3H 1HNWQ 4LFBL 1FGUA 1X4MA 1BBUA 1HZCA 2N8NA 1VQOA 1NTGA 4A3FH 2E2IH 2CWAA 2OTJA 2WB1G 1SLJA 1DGSA 2ES2A 2UUAL 4LF5L 4QGUA 4JI8Q 3GTGH 1TWCH 2V1CC 5IY0A 3RLNA 4JI7L 4PG3A 3LGJA 3M4PA 4LUOA 4IOCA 1N36L 2UU9L 1Z9FA 4JOIC 4R4QA 5JEAJ 1NY4A 3EN2A 1I6HH 4IPGA 2FMRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R6G A;  1YHA A;  2VQF L;  4OWW B;  5M5W H;  1CKN B;  3AYH B;  3D0F A;  3K0X A;  3S2D H;  2OPU A;  1YBY A;  1A0I A;  4DUZ Q;  4DR5 Q;  1EWI A;  3M4Q A;  4DV2 L;  4A3I H;  4DV6 Q;  3S16 H;  2Z6K C;  2A8V A;  4HJ8 A;  2OCE A;  4JI1 L;  1W2B A;  3HOZ G;  1XMO L;  2PMZ E;  4DV0 L;  1AE2 A;  2CTF A;  4HID A;  1G51 A;  3STB C;  4IPC A;  3HOZ H;  4O2D A;  4R4O A;  1JMC A;  5C4X H;  2WB1 E;  4GLX A;  1JJ2 A;  4B3M L;  4BY7 H;  4ME3 A;  1CSP A;  1NMF A;  4NXM L;  2NVQ H;  2KHJ A;  1YJ9 A;  1PYB A;  1EQR A;  3RNU A;  4A3E G;  1GVP A;  2Q2T A;  1HNZ Q;  4UP7 A;  1VQC A;  2JEB I;  4BBR H;  1WJJ A;  4A3K G;  2I0Q A;  3W1B A;  2K5N A;  2E3U A;  3B6Y A;  4JG2 A;  1CUK A;  2H5X A;  4AIM A;  4MNO A;  1SMX A;  4P75 A;  4B3S L;  3F2B A;  4JV5 L;  2NVT H;  4P71 A;  1Y1V G;  1SRO A;  3AEV A;  2MJH A;  1Q7Y C;  3KLW A;  1AH9 A;  4DV4 Q;  4DV1 Q;  2E8G A;  3STB D;  2R92 G;  1Q86 C;  4DV3 Q;  5JJK A;  3K80 C;  4DR4 Q;  4DKA C;  4RMF A;  2JA8 G;  1YJW A;  2ZTD A;  4GKJ Q;  2K5H A;  3KYH C;  3PO2 G;  4LUV A;  4HJ9 A;  3UDG A;  1Q12 A;  3FP9 A;  1E3P A;  3ZJY C;  2MNA A;  1PH4 A;  4A3D H;  4LNQ A;  3JAM c;  3PUV A;  1KRT A;  4JI2 Q;  4JOI A;  4DV1 L;  4A3K H;  4YCW A;  1Q46 A;  4L5R C;  4DV2 Q;  3BU2 A;  4BXX G;  1X6O A;  1VQ5 A;  3HOV G;  5IWA L;  5IYC H;  5M3F G;  1QUQ B;  4NXN L;  3UDI A;  5IYB H;  2K4K A;  1KQS A;  2R7Z G;  2R93 G;  3CW2 C;  4Y52 H;  1IBM Q;  2ANR A;  3PUX A;  2LXJ A;  1VIG A;  1SRU A;  2JA6 G;  1I3Q H;  2GVB A;  2B63 G;  4JBW A;  1ASZ A;  3AQQ A;  2AWN A;  1JJC B;  1BVS A;  2NZH A;  2JA6 H;  4NXM Q;  2VQE Q;  3J81 j;  1N34 L;  2CTJ A;  4WJ3 M;  1YEZ A;  2VNU D;  4WAN A;  2CWP A;  1OXS C;  1K9M C;  5HY6 A;  2PI2 A;  1L1O B;  1EYG A;  3BJU A;  2AHO B;  2Q2I A;  3T1Y Q;  3A0J A;  3PF4 A;  3S1N H;  2JVZ A;  4KI0 A;  1YJN A;  4IPH A;  3TRE A;  5BR8 Q;  3E9H A;  1XNR Q;  1X65 A;  1XTD A;  3RR5 A;  5HGQ A;  3PIO A;  3T1H L;  1TXY A;  5GQO A;  2Q2U A;  4WAL A;  3NBH B;  5IT9 c;  1BBW A;  1XMQ L;  1NMG A;  5C4J H;  4DV4 L;  3OYY A;  1WI5 A;  1HZA A;  3M9B A;  3OTO L;  4AQY L;  4X62 L;  3S24 A;  2QEX A;  1TWG H;  5C0X J;  3I4O A;  2OPV A;  5M5Y H;  5C3E H;  4GKK Q;  3G71 A;  1UE7 A;  1VQK A;  4R4I A;  4BBR G;  3TEH B;  1E1O A;  1YHB A;  3ULP A;  1M90 C;  2CTK A;  4YWM A;  2K5V A;  3F2C A;  1N33 Q;  1LUZ A;  4LF9 Q;  4GNX B;  2HH2 A;  1OXX K;  2KCM A;  4GN3 B;  2VUM G;  2UXC Q;  1VQ6 A;  2RCN A;  2BL5 A;  1PYS B;  3ERS X;  1IBL L;  4JI5 L;  4LIJ A;  2NN6 G;  4TQU S;  2D62 A;  5ELN A;  2WFW A;  1VQG A;  2NZO A;  4PZ6 A;  2CCZ A;  1O7I A;  3CCJ A;  1NJI C;  2VUM H;  3HOW H;  3HOY G;  3M3Y H;  1DT4 A;  1VCI A;  1S3O A;  2RHQ B;  4C2M H;  1L2F A;  3GTJ H;  1SE8 A;  4DR7 Q;  1CKO A;  4HJ5 A;  3H15 A;  4JI2 L;  1E7Z A;  3HOY H;  1IZ6 A;  1GD7 A;  3M4O H;  4JI5 Q;  1YVC A;  1OXT A;  4YY3 L;  4DR2 Q;  2JA7 G;  4X65 Q;  1C9O A;  5IWA Q;  5C0X I;  1VQB A;  3CC4 A;  2F3I A;  4GNX A;  1VS0 A;  1L0W A;  1JJG A;  1KIX A;  4EX5 A;  3CCS A;  3UE1 A;  4NXN Q;  4OX9 L;  2L15 A;  4DR4 L;  3TS0 A;  4A93 G;  2JJQ A;  2JQO A;  2IHE A;  1Q1E A;  5AJ3 L;  1K73 C;  4POG A;  1KAW A;  4UPA A;  4JVH A;  3GTP H;  4A93 H;  5FJ8 H;  2JE6 I;  1N8R C;  1T9H A;  3GTL H;  4PZ7 A;  3CD6 A;  4R4T A;  1W3S A;  4LFB Q;  4NPS A;  1XPO A;  3EBE A;  1VQI A;  1J5E Q;  3GTO H;  1XPU A;  2UUC L;  3TQY A;  1CKN A;  2YTV A;  3CP0 A;  3T1Y L;  3PUW A;  2CTL A;  3U4Z A;  4DNI A;  3S1Q H;  1YZ6 A;  2ALY B;  2ZM6 Q;  3V69 A;  4QL5 A;  4B3M Q;  2IT1 A;  4A3G G;  2JEA I;  4JYA Q;  2VY3 A;  3T1H Q;  1VQE A;  1N33 L;  4B3R L;  1PH2 A;  4R1J A;  1PH7 A;  2HQL A;  4JBK A;  4LFC Q;  3ULJ A;  4HIO A;  4P73 A;  3HKS A;  2E5L Q;  4IOA A;  4GS3 A;  3I4M G;  3OTO Q;  1UWV A;  2ZJP A;  1HR0 L;  1K1G A;  1X4N A;  3PGZ A;  1PHJ A;  1HR0 W;  3F8T A;  2P2R A;  4YCU A;  1L1O A;  1PH9 A;  1K3R A;  5IP7 H;  4DR1 Q;  3I4N H;  4A4I A;  4JI0 L;  2NN6 I;  4LF6 L;  1E1T A;  4AM3 A;  4YWL A;  4DR2 L;  1X9N A;  1PVO A;  3VKE A;  3GTQ H;  4A3L G;  4LWC A;  4A3M H;  1HR0 Q;  2PI2 E;  4P74 A;  5K36 G;  3U50 C;  1N32 L;  2XGT A;  4DUZ L;  2DUD A;  3W5O A;  1EIY B;  2BH8 A;  4APV A;  1JB7 A;  4A3G H;  4A3M G;  1KRS A;  5GAH C;  2HHH L;  3AFP A;  2OWO A;  1A8V A;  4RG1 A;  4DV0 Q;  3U1K A;  1Z47 A;  1HZB A;  3JC6 6;  1KL9 A;  3HOV H;  2E2J H;  2YQR A;  3DM3 A;  4NB3 A;  5GAE C;  3J81 i;  3G48 A;  5H1S E;  4DV3 L;  1LYL A;  2HH3 A;  4ALP A;  1QVF A;  2I5L X;  3CAM A;  5FLX c;  1IL2 A;  1J6Q A;  1KHI A;  4IJL A;  2UUB L;  2EXD A;  1WCM G;  5JJL A;  2YU9 H;  1P16 A;  3WWV A;  1KC8 C;  4X64 L;  3L2P A;  1B8A A;  2JA7 H;  3PUY A;  1OTC A;  4JI6 Q;  4DR3 L;  2KBN A;  1SR3 A;  1IBK Q;  3S14 H;  4AYB E;  1WE8 A;  2ATW A;  3KDF B;  4OWX B;  1MJE A;  2OTL A;  3CC2 A;  5AJ3 Q;  4BXX H;  1PH8 A;  4B3S Q;  2Y0S E;  2UXD L;  5IYC G;  5M3F H;  4LF4 Q;  1RL2 A;  4JC0 A;  4K0K Q;  1KHM A;  3M85 A;  2ID0 A;  4EQ5 A;  1CSQ A;  3U58 A;  3BZK A;  3CCU A;  4JI4 Q;  3GTK H;  4X65 L;  1WFQ A;  4UP9 A;  1KXL A;  3TRZ A;  4J15 A;  4GKJ L;  1HH2 P;  3J81 c;  1VQJ A;  2KHI A;  4OWT B;  3PCO B;  4A3F G;  2HHH Q;  2WAQ G;  4DV6 L;  1K8G A;  1XNR L;  1J5E L;  1ASY A;  3CQZ H;  3F2D A;  2QA4 A;  4B3T L;  4JV5 Q;  1KD1 C;  4YWK A;  3PIP A;  4PMW A;  1LTL A;  1I94 L;  2JK8 A;  3D31 A;  1PH5 A;  3H0G H;  2VQE L;  1J5K A;  1A62 A;  1QVC A;  1Q81 C;  1WVN A;  1VQP A;  1EIF A;  1MIU A;  1PV4 A;  4LF8 L;  1G6P A;  2ZTC A;  3I7F A;  2MQH A;  3J80 i;  2HT1 A;  1OXV A;  2YTX A;  2YV5 A;  4QIW E;  4DV5 L;  5GAG C;  1HNZ L;  1IBM L;  1VQL A;  4BBS H;  3FKI H;  3GDE A;  4DUY L;  1S40 A;  2XTI A;  4BBS G;  4LF9 L;  4DR1 L;  5C0X G;  4DV7 Q;  3K8A A;  4MZ9 A;  1HNW L;  1X3F A;  1D7Q A;  5J3B A;  3CME A;  1I5F A;  1TWA H;  2ZJR A;  1Q8K A;  2D0P A;  3ER0 A;  1EUJ A;  3HOU H;  3PO2 H;  4OO1 G;  4AQY Q;  2VW9 A;  2N49 A;  5M3M H;  1UEB A;  1Y1W H;  4NBQ A;  2E5L L;  4BY7 G;  3SGI A;  3BZC A;  1V9P A;  1GM5 A;  4IJH A;  1YIJ A;  1NBW A;  5GAD C;  1VQ8 A;  4BA1 I;  2Q2H A;  2PY9 A;  1YHQ A;  4DR7 L;  2E2H H;  4BA2 I;  1U0L A;  2F4V L;  2UXB L;  3G6E A;  3CCQ A;  4JBM A;  2B3G A;  2CQO A;  5BR8 L;  5C44 G;  3RZD H;  2D0O A;  4LF6 Q;  3I4M H;  2UXC L;  5JJI A;  4K0K L;  2N3S A;  4GOP A;  4LFA L;  2UXD Q;  4JI3 Q;  2AXY A;  4DK3 C;  4HJ7 A;  4LUZ A;  4MTN A;  4LF4 L;  1FL0 A;  2AMC B;  3RZO H;  2BA0 A;  5IP7 G;  3HKZ E;  4GN4 B;  1VQM A;  2B63 H;  3I4N G;  3Q8D A;  1TWH H;  4UP8 A;  1U5K A;  4X62 Q;  1R9T H;  2ANN A;  1E24 A;  3NEM A;  2UUA Q;  4JI6 L;  1EFW A;  1Q82 C;  1IBK L;  2UUB Q;  4L5S A;  1X56 A;  4JCV E;  5IYD G;  1FJG Q;  2YYZ A;  2R92 H;  1OXU A;  1Y14 B;  4A3J G;  4YHH L;  3RN2 A;  1HNX Q;  1Y1W G;  4LFA Q;  3A74 A;  3PO3 G;  1VQF A;  5IYD H;  4QMF B;  2I5H A;  1P8L A;  3KF8 B;  2K50 A;  3KF6 A;  4KHZ A;  3CCL A;  3S15 H;  3GO5 A;  4LF7 L;  1XNQ Q;  3HOX G;  1ZZK A;  1XJV A;  1S72 A;  3KJO A;  1VQ7 A;  4OX9 Q;  1EQQ A;  1N34 Q;  4DAY B;  1XMO Q;  3ICE A;  4JI1 Q;  2BA1 A;  3M7N A;  4O0A A;  4AYB G;  3AFQ A;  2EIF A;  3EIV A;  3UDX A;  1E22 A;  2Z6K A;  3UE0 A;  3RN5 A;  1I94 Q;  3MEF A;  3HFZ B;  2R93 H;  3TS2 A;  3CCR A;  4B3T Q;  2PNH A;  3HKZ G;  3AEV B;  3K7U C;  2JA8 H;  4X6A H;  4LF7 Q;  1WYD A;  4GNX C;  4Y7N H;  1K0R A;  2VQF Q;  3CPF A;  5IP9 G;  4DR5 L;  3CXC A;  4WJ4 A;  1TWF H;  4JBJ A;  1G29 1;  4JI4 L;  4DV5 Q;  2CKZ B;  4TVA B;  4A3D G;  2MO0 A;  2JA5 G;  2B29 A;  2LXK A;  2GN5 A;  5IP9 H;  3OW2 A;  4LF8 Q;  4IFD G;  4LF5 Q;  2VS1 A;  4JI8 L;  1QUQ A;  5LMU Q;  4QQB X;  3DLL A;  2MO1 A;  3NEN A;  1UE5 A;  1VQ9 A;  2PQU A;  2K75 A;  2EQS A;  3PUZ A;  4JYA L;  4JVY A;  2MFI A;  1UE6 A;  2LSS A;  2HIV A;  3JAM i;  4B3R Q;  2CPQ A;  2CTE A;  1RIP A;  1X3E A;  4GLA C;  1A63 A;  3KOJ A;  1FVI A;  3PSI A;  3KJP A;  4HIM A;  4HJA A;  1ZZI A;  3H0G G;  5M3M G;  4C3J H;  1QVG A;  1NE3 A;  4FDB A;  1LM0 A;  1MKH A;  2NVX H;  2UUC Q;  4YCV A;  2F4V Q;  1K83 H;  3S1M H;  4DR6 L;  4HIK A;  4A3L H;  2UXB Q;  2ZTE A;  3G4S A;  3I55 A;  1N32 Q;  4KLK A;  1X3G A;  1HZ9 A;  5ELO A;  5LMN L;  3PF5 A;  2OQ0 A;  3FKI G;  1Y1V H;  2N78 A;  3I56 A;  1L1O C;  4X64 Q;  5FJ8 G;  1PA6 A;  1VQH A;  1PH6 A;  3ULL A;  1JT8 A;  3S2H H;  3L7Z C;  4DR3 Q;  3PV0 A;  4DK6 C;  1SN8 A;  1UE1 A;  4QY7 A;  4GOP B;  4H02 A;  1C7Y A;  3I2Z A;  2PQA A;  2NVY H;  1PH3 A;  4A3E H;  3J7Z C;  4JI0 Q;  1EC6 A;  1XPR A;  4IFD J;  1PFS A;  1WCM H;  2Y0S G;  2F52 A;  4LFC L;  3CMA A;  2IX1 A;  2QND A;  2JA9 A;  1VQ4 A;  1C0A A;  1D8L A;  2FXQ A;  3H3V I;  4IPD A;  1XNQ L;  3GD7 A;  1EOV A;  5C44 H;  4UY8 C;  1JE5 A;  4L5Q A;  2I5M X;  3A5U A;  4OO1 I;  4OON A;  1DTJ A;  1SFO H;  5M5X H;  3HOX H;  1VQN A;  3CF5 A;  4R4C A;  4YHH Q;  1HNX L;  4XTC S;  1VIH A;  1ZTG A;  1Q1B A;  2IHF A;  1X55 A;  2DGY A;  1K8A C;  1QZG A;  3FHW A;  4QJF A;  3HOW G;  1I50 H;  3S17 H;  1H95 A;  4DAM A;  3CPW A;  4KHP L;  4OXP A;  2RHS B;  2KEN A;  2C35 B;  3CC7 A;  4GKK L;  4JI7 Q;  2CTM A;  5EAY A;  3CCV A;  1AE3 A;  1BKB A;  2WAQ E;  3K7A H;  5LMU L;  2WP8 J;  3RLF A;  1N36 Q;  2UU9 Q;  4DR6 Q;  1WOC A;  3E9I A;  2A19 A;  3MXN B;  4KHP Q;  3CCM A;  4A3I G;  1VQD A;  1XMQ Q;  1YIT A;  4A3C H;  3K81 C;  4A75 A;  3GTM H;  2JZX A;  2IX0 A;  2K52 A;  4X66 L;  5LMN W;  4PZ8 A;  1V43 A;  1MJC A;  1PH1 A;  2YTY A;  3L0O A;  2A1A A;  2ASB A;  1X54 A;  3KFU A;  5C4X G;  4B8T A;  4DV7 L;  2OQK A;  4POF A;  1J4W A;  4BY1 G;  3KDF A;  3HOU G;  3UDF A;  2Z0S A;  1B70 B;  2JA5 H;  2K14 A;  2RF4 A;  4AH6 A;  3CCE A;  1QZH A;  1VQA A;  3A5Z B;  3U4V A;  1N9W A;  5IE8 A;  4X66 Q;  4BY1 H;  1B7Y B;  4C3H H;  2VL6 A;  4DPG A;  1IBL Q;  2R7F A;  2DGR A;  3NEL A;  3H3V H;  4P72 A;  3RLO A;  2CFM A;  3IRB A;  5FLM G;  4A3B G;  1YNX A;  3J80 c;  5GRO A;  1IYJ B;  5JEA G;  4A76 A;  2R7D A;  4DUY Q;  4XIG S;  5E7N A;  2AWO A;  4A3C G;  2HIX A;  5IYB G;  4LW1 A;  1CKM A;  4C3I H;  3F1Z A;  3S1R H;  2R7Z H;  1TUA A;  4JI3 L;  4YY3 Q;  2BH2 A;  1GO3 E;  4IFD I;  5C3E G;  2IY5 B;  4GN5 A;  1HJP A;  1ZZJ A;  3E0E A;  5LMN Q;  1YI2 A;  2GVA A;  1FJG L;  1GKH A;  3J7A 5;  5DLQ E;  1IXR A;  3VDY A;  4A3J H;  4L5T A;  3KF6 B;  2AKW B;  4IO9 A;  4GLV B;  2VZA A;  4GOP C;  2ZM6 L;  1V1Q A;  2PQA B;  2KCT A;  2ZJQ A;  5FLM H;  1M1K C;  4A3B H;  2QGQ A;  3W1G A;  3PO3 H;  1HNW Q;  4LFB L;  1FGU A;  1X4M A;  1BBU A;  1HZC A;  2N8N A;  1VQO A;  1NTG A;  4A3F H;  2E2I H;  2CWA A;  2OTJ A;  2WB1 G;  1SLJ A;  1DGS A;  2ES2 A;  2UUA L;  4LF5 L;  4QGU A;  4JI8 Q;  3GTG H;  1TWC H;  2V1C C;  5IY0 A;  3RLN A;  4JI7 L;  4PG3 A;  3LGJ A;  3M4P A;  4LUO A;  4IOC A;  1N36 L;  2UU9 L;  1Z9F A;  4JOI C;  4R4Q A;  5JEA J;  1NY4 A;  3EN2 A;  1I6H H;  4IPG A;  2FMR A; 
#chains in the Genus database with same CATH topology
 2R6G A;  1YHA A;  2VQF L;  4CKC A;  4X3S A;  1TWA B;  3OIP A;  3D0F A;  3K0X A;  3M4Q A;  4DV2 L;  5JPM C;  2Z6K C;  2BE5 C;  4HJ8 A;  1X0A A;  4DV0 L;  1AE2 A;  1I4X A;  5EBC A;  4HID A;  1RKN A;  2D9I A;  5TSS A;  4IPC A;  3UOE A;  5K5P A;  1JJ2 A;  1GUT A;  2F0D A;  1NMF A;  2KHJ A;  5EBD A;  2Q2T A;  4UP7 A;  2JEB I;  5C3E B;  4AIM A;  4QIW B;  1SMX A;  4R8N A;  4JV5 L;  4H44 C;  2NVT H;  4GKJ H;  5A35 A;  3DWP A;  4OL7 A;  5C5M A;  3KLW A;  5LMU H;  4DV1 Q;  1NAP A;  1Q86 C;  1U9R A;  3BDL A;  3K80 C;  4B08 A;  2Z9H A;  5JJZ A;  4KN7 C;  4RKL A;  3NXW A;  4LUV A;  1PH4 A;  2B2Y A;  1CZG A;  2WKD A;  1E3P A;  3ZJY C;  2MNA A;  4LF8 H;  2B2T C;  4DV1 L;  2DN8 A;  1ESF A;  2E2I B;  5FKA C;  3BU2 A;  1STH A;  4BWG B;  5IYC H;  4RGN A;  1QUQ B;  4NXN L;  1BOS A;  3CW2 C;  2LXJ A;  2EDG A;  4G7H C;  3NBH A;  1Y1V B;  1I3Q H;  2HQE A;  1HA5 A;  1XXG A;  1BVS A;  3I72 A;  2JA6 H;  4IUT A;  3V2T A;  4A3E B;  2VNU D;  4WAN A;  3SK6 A;  5HY6 A;  4A3D B;  3A0J A;  4IZ8 A;  3BVG A;  4KN4 C;  2UXD H;  1IW7 D;  1JR0 D;  2UUB H;  3D6W A;  4HCS A;  1SBB B;  2Q2U A;  4WAL A;  3NHH A;  4B8C D;  1WD0 A;  4Q0F A;  5EGT A;  3S2H B;  4XQN A;  5EPJ A;  1V9N A;  2KVM A;  1MSZ A;  3G6J B;  3OTO L;  2JA8 B;  3DWQ A;  3MWY W;  2E76 C;  5C0X J;  3I4O A;  2OPV A;  1QG7 A;  3I4N B;  1LO5 D;  4BBR G;  4RWS C;  2B39 A;  3F2C A;  2B2Y C;  1ZYR D;  2HH2 A;  3TZU A;  1PZJ D;  2B2T A;  2KCM A;  2UXC Q;  3S14 B;  1VQ6 A;  3DEP A;  4IUV A;  3ERS X;  1SEI A;  2BL5 A;  2PNR C;  1LT5 D;  2WFW A;  2NZO A;  4F87 A;  3HOW H;  1MBY A;  2EPB A;  4I7Z C;  1DOL A;  4FXG C;  5ELC A;  3WOE A;  3HOY G;  1VCI A;  1DT4 A;  1B44 D;  3TP5 A;  1SNO A;  1SYD A;  2FIN B;  1MHW C;  3MEH A;  1YVC A;  4YY3 L;  2JA7 G;  5FLX L;  1C9O A;  1VQB A;  4GNX A;  2JA5 B;  4OX9 L;  4A93 G;  1EOT A;  2JJQ A;  2JQO A;  2UXC H;  4POG A;  1D1I A;  5C4H A;  2C5C A;  3NP8 A;  4PZ7 A;  1PXU A;  3TN2 A;  1XPO A;  2HCI A;  2WKC A;  3ZYY X;  2ZQE A;  1QOH A;  1Z7T A;  5EJW A;  5M5X B;  3HOX B;  4XYQ A;  2EYO A;  1MGS A;  2ALY B;  4B3M Q;  4JYA Q;  2VY3 A;  3T1H Q;  3W3A A;  1SFO B;  3SXH A;  1WTJ A;  4DA2 A;  3ULJ A;  4P73 A;  3HOV B;  2ZJP A;  3QWN A;  1X4N A;  4RGM A;  1L1O A;  1K3R A;  4DR1 Q;  3I4N H;  2LF0 A;  1YNJ C;  4A4I A;  4JI0 L;  1DM0 B;  3OHX C;  3TBI B;  1F2L A;  4DR2 L;  4O1N A;  5EKI A;  1PVO A;  2F0F A;  4A3L G;  4LWC A;  3SK8 A;  3U50 C;  5JAV A;  5M3M B;  2DUD A;  3W5O A;  1I94 H;  1JB7 A;  4A3M G;  1KRS A;  2SNM A;  3AFP A;  2K04 A;  2OWO A;  2LRR A;  2B2W A;  4RG1 A;  4DV0 Q;  4RH6 A;  1KL9 A;  2E2J H;  1T5E A;  1EIG A;  2HH3 A;  4ALP A;  1QVF A;  2WV6 D;  4IJL A;  3N6R A;  3BYY B;  3WWV A;  1KC8 C;  4X64 L;  2JA7 H;  3J7A V;  1WE8 A;  2ATW A;  3KLS X;  4OWX B;  1MJE A;  1MSH A;  5A2Q E;  2OTL A;  4N9T A;  1ICW A;  2K03 A;  4B3S Q;  1HUN A;  2MHV A;  2UXD L;  1RL2 A;  4JC0 A;  5D3I B;  4EQ5 A;  1IBK H;  2K5D A;  4JYA H;  1WFQ A;  3TRZ A;  4GKJ L;  2J7Z A;  1VQJ A;  1EY0 A;  2K5Q A;  3DUZ A;  2WAQ G;  1XNR L;  4XT3 B;  1TKW B;  3NWS A;  5COR A;  4BY1 B;  1AP0 A;  1GUN A;  2JK8 A;  2VQE L;  4HN7 A;  1GJX A;  3DMU A;  1WVN A;  1VQP A;  1MIU A;  4LF8 L;  4A93 B;  2MQH A;  4PMC A;  2HT1 A;  4QIW E;  4DV5 L;  2YV5 A;  3WDN A;  1IBM L;  1VQL A;  3R8B A;  4BBS H;  1D5M C;  2PZU A;  1S40 A;  3QG1 A;  4LF9 L;  1CI3 M;  3H6M A;  4DV7 Q;  5KEE A;  1BXT A;  1X3F A;  1HNW L;  5J3B A;  1EYA A;  2LFN A;  1I5F A;  2ZJR A;  1CQF A;  1EU3 A;  3ER0 A;  1L0X B;  4OO1 G;  5M3M H;  2AQ3 B;  4MTK A;  4EGV A;  3URY A;  1YHQ A;  2F4V L;  4XXE A;  3CCQ A;  4JBM A;  4NZR M;  5JJI A;  2KCC A;  4LFA L;  4DUZ H;  4JI3 Q;  4E6I A;  5CGK A;  2IPK D;  4F8M A;  5IGD A;  1TY0 A;  2B63 H;  3I4N G;  1I4R A;  3KLR A;  1TS3 A;  3Q8D A;  3E6Z X;  1R9T H;  1K8O A;  2UXB H;  1E24 A;  4JCV E;  2R92 H;  2OXP A;  1Y14 B;  1EQT A;  4YHH L;  3RN2 A;  4A3J G;  1HNX Q;  3BDC A;  4LFA Q;  3K59 A;  3K5M A;  1JE4 A;  3I91 A;  1U4L A;  2AUK A;  3CCL A;  1O7Z A;  1XNQ Q;  4EC5 A;  4IUR A;  2ENB A;  3KJO A;  1VQ7 A;  4LF6 H;  4OX9 Q;  1N34 Q;  3ICE A;  1DXM A;  1VMP A;  4ZUI A;  3RN5 A;  2Z6K A;  3UE0 A;  2XVS A;  4G4K A;  5KNC A;  3MEF A;  5FO9 B;  3S9W A;  1X32 A;  3GTM B;  1TII D;  2XWB B;  3HKZ G;  1HQR D;  4X6A H;  2NYZ D;  2JYO A;  1WYD A;  1K0R A;  4WJ4 A;  1B2T A;  4A3F B;  1H9J A;  4DV5 Q;  2CKZ B;  2L9H A;  1HUM A;  4LF5 Q;  1EY4 A;  2VS1 A;  3QIA A;  2VQF H;  5IT9 E;  1LT3 D;  2TMP A;  1QNU A;  3G7L A;  5KGU A;  4DV2 H;  1UE6 A;  3SK5 A;  3CRL C;  1RIP A;  1EL0 A;  2L12 A;  3PIP 3;  3GTJ B;  1PTO D;  1A63 A;  3CHB D;  1YNN C;  3PSI A;  4HIM A;  1ZZI A;  1NE3 A;  1TQO A;  4FDB A;  2F4V Q;  4YCV A;  3LNN A;  1ESR A;  2UXB Q;  2ZTE A;  3P1H A;  4MN3 A;  4LF5 H;  1KNE A;  1X3G A;  2X69 A;  5LMN L;  3FDT A;  3FKI G;  1Y1V H;  1YNJ D;  4J8Q A;  5JEA H;  1I6U A;  2QKI C;  4DV7 H;  1PH6 A;  3ULL A;  5JVG 3;  1PFB A;  2F0T A;  3S2H H;  4DR3 Q;  3PV0 A;  1SJH D;  4LFC H;  1UE1 A;  3R93 A;  1JOK A;  4NXM H;  3J7Z C;  3J80 L;  3A8K E;  5FLX E;  2QEJ C;  2XIW A;  4K14 A;  4LFC L;  1VQ4 A;  3RD4 A;  3GD7 A;  4CKB A;  4UY8 C;  1JE5 A;  4L5Q A;  5E1F A;  2I5M X;  2A1S A;  3K57 A;  4OON A;  4N9P A;  4L8J A;  3P20 A;  3FPU B;  4A3I B;  4H7B A;  3S17 H;  3LWU A;  1I50 H;  1UAP A;  2CVR A;  4DAM A;  3MTS A;  4LF9 H;  2RHS B;  1TR5 A;  3D8G A;  2F0S A;  2C35 B;  5ELD A;  3CC7 A;  4GKK L;  2CTM A;  2P5Z X;  3TDQ A;  1QCB D;  2WAC A;  3GTG B;  2WAQ E;  5LMU L;  2EYH A;  2UU9 Q;  1WOC A;  4K5V A;  2YU9 B;  1HNZ H;  3E9I A;  4ZKC B;  2F4V H;  1LAB A;  1VQD A;  1SEB D;  1T5X D;  2DNE A;  1KLU D;  2F0U A;  4FJS A;  2K32 A;  3O13 A;  4RAU C;  4F88 A;  5IGB A;  2G9D A;  1ML0 D;  3MFG A;  4M1U B;  4RFB A;  3KDF A;  3HOU G;  2E2D C;  3L9A X;  1GHJ A;  3HS0 C;  4AH6 A;  2A69 C;  4X66 Q;  2EJF C;  4C3H H;  3Q0A A;  1IBL Q;  2DGR A;  3VA5 A;  5FLM G;  3RLO A;  5GRO A;  1IYJ B;  5JEA G;  4A76 A;  4DUY Q;  2HIX A;  2R7Z H;  3S1R H;  1CKM A;  3F1Z A;  3OOC A;  1S5F D;  4JI3 L;  3TSS A;  2BH2 A;  4G7Z C;  4IFD I;  4EVO A;  3T1Y H;  1SYB A;  3E0E A;  4XDX A;  5LMN Q;  5DLQ E;  2EYL A;  3NSW A;  3L3O C;  4IO9 A;  1G8Z D;  1STY A;  4IQZ A;  1O7Y A;  4GOP C;  3D4D A;  3I3C A;  4JVZ A;  1ZEQ X;  3PO3 H;  2PMZ B;  1BBU A;  2N8N A;  2RSN A;  1VQO A;  1HRJ A;  2E2I H;  3NWT A;  3HOZ B;  2BOS A;  3I4M B;  1U4R A;  3R2T A;  3TP6 A;  4JI8 Q;  3C1E A;  1TWC H;  4JI7 L;  2JEA I;  2UU9 L;  1CK1 A;  2ICI A;  1NY4 A;  2I46 A;  4IPG A;  4RGT A;  2FMR A;  2PT7 G;  4DFA A;  4OWW B;  4TRD A;  2BDO A;  2FJ2 A;  1A0I A;  4H0L C;  1DD2 A;  3ONA B;  1VF5 C;  1V8Q A;  4UDU C;  3FEW X;  4PMB A;  1EY5 A;  2RQX A;  3STB C;  4NZT M;  3HOZ H;  3ND8 A;  1JMC A;  5ELF A;  5IWA H;  1F2Y A;  2ZXO A;  5I9P A;  4K8I A;  4BY7 H;  1CSP A;  2EY1 A;  1YJ9 A;  3I4L A;  1HNZ Q;  4OGQ C;  1VQC A;  4ODG A;  2K5N A;  4A3K B;  3KK7 A;  3NE5 B;  4XQQ A;  3DM1 A;  2NVY B;  5HUR A;  4R8I A;  4MNO A;  4B3S L;  1Q3L A;  1SRO A;  3C2P A;  2MJH A;  1AH9 A;  1N36 H;  2O5I C;  2E8G A;  3ERQ A;  3QO2 A;  2R92 G;  4DV3 Q;  5JJK A;  1XTC D;  4DKA C;  2JA8 G;  2ICE C;  2VKC A;  1Y8P B;  1YJW A;  4B9X A;  4DK1 A;  3EFX D;  4BY7 B;  3UDG A;  1Q12 A;  4CKE A;  3JAM c;  4JI2 Q;  1KRT A;  4A3K H;  3E3X A;  5I6Y A;  3SK4 A;  3S17 B;  1E2V A;  1Q46 A;  3LWE A;  3IAY A;  1CZW A;  4L5R C;  1X6O A;  1VQ5 A;  4FJU A;  5IWA L;  5M3F G;  1ROD A;  1FD7 D;  4Y52 H;  1PLF A;  2EE1 A;  3PUX A;  3IFT A;  4J1M A;  1JCK B;  1SRU A;  1BCP C;  4NDX A;  5DNF A;  2B63 G;  3M7G A;  3I73 A;  4JBW A;  1U4P A;  1ASZ A;  3PIO 3;  2F0I A;  5ELE A;  2CTJ A;  2CH4 A;  3BDO A;  2FFK B;  2PI2 A;  1EYG A;  3BJU A;  3S1N H;  4KI0 A;  1YJN A;  3HGB A;  2VQE H;  1PZK D;  3E9H A;  1SAP A;  1RF2 D;  5HGQ A;  1TXY A;  2RKS A;  3NBH B;  4I65 A;  1XMQ L;  1C4Q A;  3C46 A;  3OYY A;  5FO8 B;  4KD3 A;  3FRP B;  2QEX A;  1D5X C;  5IT9 L;  1LLR D;  5M5Y H;  4GKK Q;  4JI5 H;  1UE7 A;  2Q8I B;  1VQK A;  4R4I A;  2F0G A;  1I6V C;  2ZXP A;  3D6C A;  4KV6 A;  4GNX B;  1OXX K;  3MHB A;  4GN3 B;  1CTM A;  4PDB A;  4LIJ A;  1IBL L;  4JI5 L;  2NN6 G;  5I2X A;  2F0P A;  5ELN A;  5IGG A;  1SND A;  4BS9 A;  1WVL A;  1O7I A;  2KEC A;  3CCJ A;  3M3Y H;  4DGZ A;  2RHQ B;  1S3O A;  4XQJ A;  3GTJ H;  1SE8 A;  5IGE A;  4JI2 L;  3OSS D;  1BUV T;  3H09 A;  3PO3 B;  3M4O H;  4JI5 Q;  4GKK H;  1OXT A;  1O7L A;  5IWA Q;  5E3F A;  1JJG A;  2QIL A;  1R4Q B;  1K3B C;  4NXN Q;  4G7O C;  2IHE A;  1Q1E A;  4QB4 A;  2K28 A;  1KAW A;  1JOO A;  3SR1 A;  3GTP H;  5FJ8 H;  1BQQ T;  2JE6 I;  1N8R C;  3HKZ B;  1EIH A;  1VBI A;  1O78 A;  1S5E D;  2B2V C;  2A68 D;  3CD6 A;  4NPS A;  4JI6 H;  3EBE A;  4C3I B;  3NTK A;  2HDM A;  1J5E Q;  3GTO H;  2CTL A;  3HOU B;  2SOB A;  4QL5 A;  4HMJ A;  5KYI A;  1VQE A;  3H94 A;  4B3R L;  4UAI A;  1WTP A;  2Q8R E;  1PH7 A;  4CGY B;  2E5L Q;  3HKS A;  4GS3 A;  3I4M G;  3OTO Q;  1B50 A;  1PHJ A;  2P2R A;  2A73 B;  1PH9 A;  2K1H A;  1EY6 A;  2QDL A;  3JAM W;  1E1T A;  4AM3 A;  4AYB B;  3VKE A;  2H4O A;  5K36 G;  1IL8 A;  1SNQ A;  2GA4 B;  3QD7 X;  1N32 L;  1EIY B;  5FLX W;  4FVM A;  3AU7 A;  2HHH L;  1A8V A;  1EWH A;  3U1K A;  1HZB A;  3JC6 6;  3HOV H;  1K83 B;  2Z6B A;  5GAE C;  1LYL A;  3Q22 A;  2I5L X;  3CAM A;  5FLX c;  1IL2 A;  4DAY A;  2EXD A;  1EY8 A;  1JQY D;  5JJL A;  1DON A;  3L2P A;  4FXK C;  4ID6 A;  1QJO A;  3PUY A;  4HMI A;  1SYF A;  1SR3 A;  2J0T D;  1NSN S;  3S2D B;  3CC2 A;  2CQA A;  5AJ3 Q;  4BXX H;  4ZK9 B;  4X66 H;  1KHM A;  4LF4 Q;  5KND A;  4OCH A;  1LT4 D;  1AN7 A;  2RDF A;  4JI4 Q;  2DJF C;  4CJ1 B;  1KXL A;  1GUO A;  1B53 A;  2DY7 A;  2KHI A;  5JOB A;  1ZXT A;  2HHH Q;  1F9P A;  1ASY A;  3F2D A;  4FO2 A;  4JV5 Q;  3IFD A;  1KD1 C;  4YWK A;  3PIP A;  5BN4 A;  1J5K A;  1ICF B;  1SNP A;  1S5C D;  3S1M B;  1PV4 A;  3J80 i;  1STG A;  1OXV A;  2YTX A;  5M5Y B;  1HNZ L;  1DZ1 A;  4LMQ D;  2QF7 A;  3NK9 A;  4DUY L;  3GQB A;  4KKS A;  2F0O A;  5I9O A;  2XTI A;  1JOR A;  4DNT B;  5C0X G;  3K8A A;  1AW7 A;  5BN5 A;  2F0H A;  5E4X A;  3BZC A;  5CV5 A;  3SGI A;  3W2D A;  4BA1 I;  2Q2H A;  1ET9 A;  2O4C A;  2E2H H;  1MSG A;  1LV9 A;  2B3G A;  1EU4 A;  5C44 G;  3I4M H;  2O4X A;  2N3S A;  2F0E A;  4DK3 C;  4LF4 L;  4LUZ A;  4MTN A;  4FF2 A;  5CV9 A;  2BA0 A;  5IP7 G;  1VQM A;  3T1H H;  5J1Z A;  3NEM A;  5CC4 A;  1Q82 C;  2ZT9 C;  4L5S A;  1FJG Q;  2IL8 A;  2L5T A;  5IYD G;  2YYZ A;  1ENA A;  2IWH A;  3T51 B;  4CBV A;  3MZ5 A;  4X62 H;  4QMF B;  4CHT B;  4PNY A;  1HQM C;  4KHZ A;  2K50 A;  2KQ3 A;  2E2H B;  3S15 H;  3VR5 A;  3HOX G;  4HTH A;  1XJV A;  1S72 A;  2E2J B;  1EQQ A;  4K6D A;  2BA1 A;  3CRK C;  1XYI A;  3T56 B;  4L6T B;  3AFQ A;  1GUS A;  3EIV A;  3EJI A;  4IUP A;  4DV5 H;  3SE0 A;  3CCR A;  3BS1 A;  2Z4H A;  3TS2 A;  2PNH A;  4GNX C;  3VR4 A;  4LAA A;  3MFY A;  2EVB A;  3K0Y A;  4DF7 A;  4B3T H;  4A3D G;  1CHP D;  2JA5 G;  2B29 A;  5IP9 H;  4IFD G;  2NTS A;  1N32 H;  1ZYR C;  2A68 C;  1DOM A;  3X3M A;  1JWM D;  1UE5 A;  2PQU A;  2K75 A;  4NXN H;  3PQI A;  3PUZ A;  4JYA L;  4WOR A;  1UUP A;  2HIV A;  3JAM i;  2CPQ A;  2K6A A;  2WB1 B;  4QUF A;  3NPP A;  4ZCK A;  3KOJ A;  2O2L D;  3OWE B;  5CBA E;  2G5D A;  3H0G G;  1QVG A;  2KJX A;  4DXF A;  2CHB D;  5DAU A;  2F0K A;  4DR6 L;  2F0L A;  3S1N B;  2EJM A;  3KDG A;  1HZ9 A;  3PF5 A;  2FHT A;  2OQ0 A;  1LTB D;  4C3H B;  1L1O C;  1LTR D;  1PA6 A;  1JT8 A;  2B2U A;  5IGC A;  1W6K A;  4GOP B;  1K8M A;  3I2Z A;  2AUJ D;  2PQA A;  1RHP A;  5D3D A;  4A3E H;  4IFD J;  1PFS A;  2KHS A;  1WCM H;  2AQ2 B;  1U4M A;  2NTT A;  2Y0S G;  2IX1 A;  3S15 B;  1KTK A;  2JA9 A;  3A7A B;  1C0A A;  1D8L A;  1XNQ L;  5DM6 3;  1DTJ A;  3I90 A;  5M5X H;  3HOX H;  5A2Q W;  1M4V A;  2Y3M A;  5LL6 b;  5CMD A;  3CF5 A;  2A5H A;  1G91 A;  4YHH Q;  1HNX L;  1DJR D;  1VIH A;  4K6L A;  2NN6 H;  1QZG A;  4QJF A;  4OXP A;  3FMC A;  1RTN A;  4RCN A;  1QNK A;  4K5X A;  1BKB A;  5I6W A;  3K7A H;  3ERO A;  3RLF A;  1F77 A;  4DR6 Q;  3EVQ A;  5EQ0 A;  3MXN B;  1F0X A;  3T53 B;  4X65 H;  3CCM A;  2LY7 A;  4FNF A;  4ZKB B;  4LK1 C;  5KYL A;  3GTM H;  5LMN W;  4E9J A;  1MJC A;  3KFU A;  4B8T A;  2B2U C;  4G57 A;  1Z6H A;  3TME A;  2XSC A;  2JA5 H;  1VQA A;  3A5Z B;  4B3S H;  2QCP X;  3TP8 A;  2VL6 A;  1PRT B;  3Q23 A;  3MC0 B;  4IUN A;  4A3B B;  4KJN A;  2R92 B;  2R7D A;  5E7N A;  5M9O A;  1B9N A;  5IYB G;  1IBL H;  3KF8 A;  5G3L D;  3GTQ B;  4A3M B;  1PMR A;  1TS2 A;  1ZZJ A;  3VDY A;  5I2Y A;  1M8A A;  2VUM B;  2K5W A;  1BCP B;  4HCE A;  3M3Y B;  3V96 A;  1EYC A;  4FYD A;  2VZA A;  5K36 H;  1I4H A;  2PZW A;  2PQA B;  2ZJQ A;  4A3B H;  1TT2 A;  1CA5 A;  4LFB L;  1F9Q A;  4A3F H;  1SLJ A;  3K5L A;  4JI0 H;  2UUA L;  4OEM B;  4LF5 L;  4CJ0 B;  1LTS D;  2V1C C;  2OF1 A;  4OO1 H;  3LGJ A;  4LUO A;  5JEA J;  3A56 A;  1I6H H;  2X6L A;  3H91 A;  1CFM A;  1CKN B;  3AYH B;  4IN3 A;  1GHK A;  3S2D H;  4ZYS A;  1YBY A;  3K5O A;  4M8A A;  2F0V A;  4DV6 Q;  3S16 H;  1EWC A;  1KDC A;  2OCE A;  4JI1 L;  3HOZ G;  5C0X H;  2CTF A;  1L0Y B;  1G51 A;  1WHR A;  1FJG H;  5C4Z A;  4DR4 H;  1TWH B;  1SNC A;  5F2D A;  4B3M L;  4ME3 A;  2RCF A;  4C1N K;  1CA6 A;  3EZJ A;  2NVQ H;  3RNU A;  4A3E G;  1GVP A;  4BBR H;  1WJJ A;  4A3K G;  2I0Q A;  3W1B A;  2K05 A;  3C3L A;  2E3U A;  1FR3 A;  4JG2 A;  3VYS A;  1CUK A;  4FP5 D;  1FNV A;  1DOK A;  2H5X A;  4DU9 A;  1Y1V G;  3AEV A;  2BE5 D;  4GZY C;  1G6Z A;  4JW0 A;  2HD3 A;  4RMF A;  5IGF A;  2H1E A;  4GKJ Q;  4JV5 H;  2K5H A;  3KYH C;  3J7A F;  2XWJ B;  3V05 A;  3Q24 A;  3FP9 A;  4LNQ A;  1WTQ A;  4MIU A;  4JOI A;  5NUC A;  1FGB D;  4BXX G;  2KCN A;  4DV2 Q;  5IYB H;  1KQS A;  2PPB C;  3HP3 A;  2ANR A;  1IBM Q;  5G3L F;  1JWS D;  4DV1 H;  1STN A;  2MGS A;  1EY9 A;  2Z1C A;  3AQQ A;  2AWN A;  1JJC B;  2NZH A;  3PMF A;  3KDK A;  4TKO B;  4WJ3 M;  3GTK B;  2M8W A;  1OXS C;  1K9M C;  1L1O B;  4C56 C;  3T1Y Q;  1BF4 A;  1Z2I A;  1HNX H;  2KEE A;  3MXG A;  5C3W A;  1BCP F;  5BR8 Q;  1XNR Q;  1X65 A;  1KAB A;  4KKU A;  3RR5 A;  3PIO A;  5GQO A;  2F3V A;  3SEB A;  1ODH A;  3J81 E;  4CDD C;  2NVQ B;  2FMM A;  1WI5 A;  1HZA A;  3M9B A;  1Y8O B;  4AQY L;  2E74 C;  3G71 A;  5I4D A;  5ISR A;  1F9R A;  3ULP A;  1YHB A;  1M90 C;  3OTO H;  1EY7 A;  4K5W A;  2RCN A;  3U9O A;  3SVM A;  4PZ6 A;  5LHY 1;  2VUM H;  4CJ2 C;  2OEO A;  1NJI C;  1WTX A;  4DR5 H;  4DR7 Q;  1EFI D;  1V8C A;  4HJ5 A;  1E7Z A;  2M9V A;  1IZ6 A;  1GD7 A;  3BVZ A;  2LTM A;  5C0X I;  3CC4 A;  2F3I A;  1L0W A;  1D5Z C;  1J8I A;  2B2W C;  4EX5 A;  3CCS A;  1KIX A;  1TWC B;  2PO4 A;  3K7A B;  1K73 C;  2EY2 A;  1VMC A;  5D65 A;  4JVH A;  4AQY H;  3D4R A;  4BBS B;  1T9H A;  2HDL A;  2Q8T A;  3QR8 A;  4LFB Q;  3MA2 B;  3BG3 A;  4EQO A;  2QW7 A;  1XPU A;  4DV4 H;  3CP0 A;  1R4P B;  3U4Z A;  1PRT D;  4A3G G;  4KKT A;  2KA7 A;  2F3W A;  4Y7N B;  4KTA A;  1PFM A;  4R1J A;  2HQL A;  4JBK A;  3ITP A;  4LFC Q;  4H8A A;  1I3Q B;  3C1F A;  1UWV A;  4RA8 A;  4CDE C;  1HR0 L;  1K1G A;  5LMN H;  2O5J C;  1WCM B;  1STA A;  2IW3 A;  5HGT A;  3MAQ A;  5KIX A;  1CHQ D;  3FKI B;  2NN6 I;  1FNU A;  4YWL A;  2F0Q A;  1Y8N B;  4H13 C;  1O80 A;  4ILW A;  4OHJ A;  3GTQ H;  1HR0 Q;  4EQN A;  2XGT A;  1IYU A;  2HCC A;  5GAH C;  2A6E D;  1E2W A;  5BN3 A;  1UNS A;  2YQR A;  1UEA B;  1V1P B;  3DM3 A;  4NB3 A;  3J81 i;  3G48 A;  4ZLT F;  3QJY A;  2RDG A;  1KHI A;  1WCM G;  2N88 A;  2YU9 H;  1P16 A;  5EPL A;  1OTC A;  4JI6 Q;  2KBN A;  3S14 H;  4AYB E;  4Q5V A;  3J7Y W;  1PH8 A;  2XNA C;  2Y0S E;  3GTL B;  4CDC C;  4K8J A;  5M3F H;  1X3Q A;  4K0K Q;  3M85 A;  3VYT A;  2ID0 A;  4G08 A;  1CSQ A;  3BZK A;  1N33 H;  3GTK H;  3OSO A;  1Q8I A;  1HH2 P;  3J81 c;  4OWT B;  4DR2 H;  1H9K A;  1K8G A;  2NBF A;  3NQT A;  1SNM A;  2QA4 A;  4B3T L;  2M2L A;  1I94 L;  3D31 A;  1PH5 A;  2F0N A;  3JAM L;  1QVC A;  2WAQ B;  3NQI A;  4LJZ C;  4JI2 H;  1EIF A;  1BDO A;  3I7F A;  3GTP B;  2CPM A;  3DWA A;  2MUY A;  4K0K H;  1D2B A;  5JVH 3;  2BCO A;  3FKI H;  3GDE A;  4X64 H;  4MZ9 A;  3SB1 A;  2AQ1 B;  1D7Q A;  3CME A;  1TWA H;  2L1B A;  1Q8K A;  4OD6 A;  3PO2 H;  1EUJ A;  1A3V A;  4AQY Q;  1Y1W H;  2E5L L;  4BY7 G;  2FFM A;  1GM5 A;  1V9P A;  2LKV A;  4B9W A;  1UG8 A;  3N52 A;  1NBW A;  3OMC A;  5GAD C;  1VQ8 A;  4B3R H;  1U0L A;  2UXB L;  4KMU C;  5BR8 L;  3RZD H;  4RHR A;  3VYR A;  5C44 B;  2UXC L;  5DT9 A;  2AXY A;  1S4Z A;  1FL0 A;  3RZO H;  4X62 Q;  1TWH H;  2ANN A;  1U5K A;  2UUA Q;  2WII B;  3LX0 A;  1V1P A;  1WD1 A;  1EFW A;  2UUB Q;  3DEO A;  1Y1W B;  3A74 A;  4ABN A;  1VQF A;  5IYD H;  2LS0 1;  3GAB A;  3GO5 A;  4LF7 L;  1AN8 A;  1ZZK A;  2L55 A;  3RZD B;  2Z8L A;  2EXZ A;  4JI1 Q;  4X3T A;  2RDH A;  4O0A A;  4AYB G;  5J39 A;  2EIF A;  1E22 A;  1K0S A;  3HFZ B;  1NNX A;  2R93 H;  1CT1 D;  3VR6 A;  3AEV B;  1YNN D;  2A6E C;  1TWG B;  1WTO A;  3NTH A;  4Y7N H;  4DR5 L;  3WOF A;  5IP9 G;  4IFD H;  4NP5 A;  1I4Q A;  4JBJ A;  1EYD A;  4JI4 L;  4TVA B;  4HSV A;  4DV3 H;  4N8X 1;  3OW2 A;  4LF8 Q;  4HSP A;  1A2U A;  4JI8 L;  1QUQ A;  1HTP A;  2A6H D;  3NEN A;  1FNW A;  4OEL B;  1VQ9 A;  3GR5 A;  4DR7 H;  2LSS A;  4B3R Q;  1PRT C;  4GLA C;  4C3I G;  3K6O A;  1FVI A;  1QIL A;  4C1N I;  5M3M G;  2UUC Q;  1LM0 A;  1GUW A;  4FXD A;  3MXU A;  1K83 H;  3S1M H;  3E5S A;  3H3V C;  2F03 A;  3G4S A;  1E2Z A;  4P2C B;  3RZO B;  2EYM A;  1J5E H;  2NWG A;  3I56 A;  4X64 Q;  1PTO F;  5FJ8 G;  4DK6 C;  1SN8 A;  4QY7 A;  1C7Y A;  2D5D A;  1PH3 A;  1RD9 D;  1A2T A;  3JAM E;  1EC6 A;  1XNR H;  2EY5 A;  1XPR A;  3RF2 A;  1G2T A;  2JP1 A;  2JN4 A;  5EPK A;  2FXQ A;  3VYU A;  4IPD A;  1EOV A;  3A8J E;  4DR1 H;  1SYG A;  1VQN A;  4C2M B;  1OO9 B;  3TZD A;  2KED A;  1Q1B A;  1ZTG A;  1X55 A;  3OPO A;  1SDF A;  3HOW G;  4ME5 A;  1H95 A;  1WTH A;  1HXY D;  1H9S B;  2XRQ D;  3T13 A;  3D3R A;  1ZKO A;  1WTV A;  2WP8 J;  1JOQ A;  2RA4 A;  1N36 Q;  4OIK A;  4CDF C;  2PCF B;  2A19 A;  4DV0 H;  1FKA H;  1IKL A;  2OT2 A;  4A3I G;  3A8I E;  3PO2 B;  4DN4 M;  2R61 A;  3D4W A;  4NW2 A;  1YIT A;  3K81 C;  4A75 A;  3J81 W;  3FAU A;  2JZX A;  1KLG D;  1H9R A;  3S16 B;  4PZ8 A;  1X9Z A;  2A1A A;  5C4X G;  1X54 A;  1BR9 A;  4EQP A;  1XRH A;  4Z9C B;  4POF A;  1J4W A;  4BY1 G;  4A3J B;  3UDF A;  3Q6S A;  1LTA D;  1NR4 A;  4R9W A;  2K14 A;  2RF4 A;  2JXM B;  3GP7 A;  1N9W A;  5AFW A;  4DPG A;  1IHZ A;  3NEL A;  3H3V H;  5ELB A;  4P72 A;  4A3B G;  3IRB A;  3DXJ C;  2VXW A;  3J80 c;  2A74 C;  4XIG S;  3QOL A;  2NB0 A;  4A3C G;  4LW1 A;  5COY A;  4C3I H;  4KJO A;  2N55 A;  1GO3 E;  3NUC A;  5C3E G;  1B1Z A;  4PV1 C;  1HJP A;  2IY5 B;  1TVX A;  2XRS D;  2GVA A;  1DYQ A;  1IXR A;  1HCZ A;  4L5T A;  3KF6 B;  2A69 D;  2AKW B;  2JSO A;  1VF7 A;  4DNR B;  3IL8 A;  4GLV B;  4WFN 3;  4A3G B;  1V1Q A;  2KCT A;  3TP7 A;  4RHS A;  2QGQ A;  1HNW Q;  1X4M A;  2QDB A;  1HZC A;  1NTG A;  1VDZ A;  5A2Q L;  1ENF A;  1A3U A;  5IY0 A;  4PG3 A;  3M4P A;  1EEI D;  4IOC A;  1SE3 A;  1N36 L;  4WJW A;  2EOT A;  4R4Q A;  2I07 B;  1SMY C;  2IX3 A;  3A7L A;  1LAC A;  2M00 A;  4K2K A;  5M5W H;  2C9O A;  2J4X A;  4FF1 A;  2OPU A;  3MXP A;  4DR5 Q;  4DUZ Q;  1EWI A;  4YHH H;  2NVT B;  4A3I H;  2A8V A;  1W2B A;  3KBG A;  1XMO L;  2PMZ E;  1IYV A;  4ZUJ A;  1ENC A;  2L11 A;  4O2D A;  1EZ8 A;  4R4O A;  1FYC A;  5C4X H;  2WB1 E;  4GLX A;  2CWH A;  4JI4 H;  5IOD A;  4NXM L;  1F2M A;  1TY2 A;  5C4J B;  1PYB A;  2A6H C;  1EQR A;  1XMO H;  2DJG C;  4ZAI A;  3B6Y A;  5CBE E;  4C3H G;  2CWF A;  2F0J A;  1IKM A;  4L63 B;  4P75 A;  3F2B A;  4P71 A;  1SXT A;  4DAP A;  3J81 L;  1JB3 A;  3A55 A;  3OW7 A;  1Q7Y C;  2UU9 H;  4DV4 Q;  4O42 A;  3STB D;  4DR4 Q;  1RDP D;  2ZTD A;  1GXD C;  1GOZ A;  3OIQ A;  1KAA A;  2NUC A;  3EQL C;  1S03 G;  1AEX A;  3PO2 G;  1F9S A;  4HJ9 A;  3RMH A;  4A3D H;  1MD2 D;  3PUV A;  3HOY B;  1QWY A;  4RGO S;  4S3S A;  4YCW A;  2FPH X;  1S5D D;  1PTO H;  3HOV G;  3UDI A;  2R7Z G;  2K4K A;  2R93 G;  2X06 A;  4UHV A;  1VIG A;  2JA6 G;  2GVB A;  1A6X A;  4DUY H;  5KNB A;  3P7J A;  4NXM Q;  2VQE Q;  1NR2 A;  1H9M A;  1W6J A;  3J81 j;  1N34 L;  2NVX B;  1YEZ A;  2CWP A;  4DR3 H;  1RTO A;  3U9S A;  1GUG A;  2K7V A;  3V69 A;  3PF4 A;  2AHO B;  2Q2I A;  4WRD A;  2JVZ A;  2K01 A;  4IPH A;  3TRE A;  3S1Q B;  3I0P A;  1XTD A;  3T1H L;  4KY5 A;  4HED A;  5IT9 c;  1BBW A;  1XWE A;  1NMG A;  5C4J H;  4DV4 L;  2R3Z A;  3KLS A;  5T1I A;  2G8Y A;  2B8F A;  1I4G A;  4X62 L;  1I6H B;  2ZM6 H;  2IJ0 A;  3S24 A;  1TWG H;  4OIJ A;  5C3E H;  1TWF B;  1ET6 A;  3TEH B;  1E1O A;  4HAE A;  2CTK A;  3M4Y A;  2EY6 A;  1WTR A;  4YWM A;  2K5V A;  1N33 Q;  1LUZ A;  4LF9 Q;  2X6G A;  1BNZ A;  2VUM G;  1SMY D;  4JI1 H;  1PYS B;  5EKL A;  4TQU S;  2D62 A;  5LL6 S;  1II3 A;  1VQG A;  1X3P A;  2CCZ A;  3PO3 G;  4QF4 A;  2G9H D;  1HFG A;  4C2M H;  1L2F A;  1PTO C;  2D2C C;  1CKO A;  1B3A A;  3H15 A;  5IIF A;  4BBR B;  3HOY H;  3OMG A;  2EJG C;  4DR2 Q;  1MI2 A;  4X65 Q;  1VS0 A;  5CV7 A;  4B3M H;  2PZT A;  2RSO A;  4DR4 L;  3ND9 A;  3UE1 A;  2L15 A;  3TS0 A;  3J80 E;  2K1B A;  5AJ3 L;  5IT9 W;  4UPA A;  3VA7 A;  4U68 A;  4DXG A;  4YIJ A;  1PRT F;  4A93 H;  1NXU A;  4KY6 A;  5FK9 C;  5M5W B;  3GTL H;  1PFN A;  4R4T A;  1W3S A;  5CV8 A;  3S1R B;  1VQI A;  2PYK A;  3CKI B;  2UUC L;  3TQY A;  1CKN A;  2YTV A;  1SSO A;  4IAL A;  3PUW A;  3T1Y L;  4DNI A;  3S1Q H;  1YZ6 A;  3CQZ B;  2ZM6 Q;  2IT1 A;  1SE2 A;  1LTT D;  5C4X B;  1N33 L;  3CU7 A;  1PH2 A;  3K58 A;  1WTW A;  5EKK A;  4HIO A;  4IOA A;  2D9U A;  1A3T A;  4JK1 C;  1B3Q A;  3PGZ A;  1AZP A;  1RJT A;  1HR0 W;  3F8T A;  4YCU A;  2LMC B;  3OET A;  5IP7 H;  2B63 B;  4LF6 L;  3OWF A;  1XNQ H;  2RVL A;  1X9N A;  2KOL A;  1AZQ A;  5LL6 X;  4XYO A;  1J9O A;  4A3M H;  2PI2 E;  4P74 A;  2PW7 A;  4DUZ L;  4LFA H;  5CYU A;  2BH8 A;  4APV A;  3HOW B;  4A3G H;  5DM7 3;  1KDB A;  4KHP H;  1Z47 A;  2SEB D;  1KDA A;  2EYF A;  1BO0 A;  3FPP A;  5H1S E;  4DV3 L;  2EZV A;  4C3J G;  4JI7 H;  1J6Q A;  2UUB L;  4RKB A;  4DR6 H;  1B8A A;  4LF7 H;  4DR3 L;  1IBK Q;  1F2Z A;  3KDF B;  1BBX C;  3NTI A;  5IYC G;  5DEH A;  5FO7 B;  2VB2 X;  3U58 A;  3CCU A;  1HPC A;  2XN9 C;  4X65 L;  4UP9 A;  3IKJ A;  4J15 A;  2L0C A;  2SNS A;  4KK7 A;  4A3F G;  3PCO B;  3KUP A;  4J6H A;  4DV6 L;  4LF4 H;  1J5E L;  3CQZ H;  4I7A A;  2CW0 D;  1LTL A;  4PMW A;  3J7A K;  2Z4I A;  3H0G H;  3EA6 A;  1A62 A;  2HHH H;  1Q81 C;  1I50 B;  1LTG D;  2TSS A;  1G6P A;  2ZTC A;  3A54 A;  5GAG C;  5C3X A;  1CQV A;  3MVV A;  2Y0S B;  4YY3 H;  3HEJ A;  1TS4 A;  3R2I A;  4BBS G;  1R9T B;  1SE4 A;  4DR1 L;  1Q90 A;  1D6E C;  4IUQ A;  2K33 A;  1NCV A;  2D0P A;  3HOU H;  2VW9 A;  2N49 A;  1UEB A;  4NBQ A;  4JI8 H;  1KNA A;  2V4D A;  1XX8 A;  4IJH A;  1YIJ A;  1PZI D;  4LFB H;  2KUM A;  5IOC A;  2PY9 A;  4C3J B;  4DR7 L;  1SYC A;  4BA2 I;  5KRU A;  1PYW D;  3G6E A;  2CQO A;  4LF6 Q;  2UUA H;  2D0O A;  4K0K L;  4GOP A;  5J22 A;  1I4P A;  1LTI D;  2UXD Q;  4HJ7 A;  3J80 W;  2AMC B;  4DV6 H;  3HKZ E;  4GN4 B;  1TS5 A;  1CM9 A;  4UP8 A;  1HHV A;  4JI6 L;  3I8Z A;  1B9M A;  1IBK L;  4NMZ A;  1X56 A;  4JI3 H;  1OXU A;  1HTL D;  1Y1W G;  4OX9 H;  3GV3 A;  3HZX A;  3P75 A;  1PDQ A;  2DNC A;  2I5H A;  1P8L A;  3KF8 B;  2PQE A;  3KF6 A;  5E4W C;  1STB A;  1C48 A;  4MHE A;  5CR3 A;  3RUZ A;  1JIC A;  4DAY B;  1XMO Q;  1DCZ A;  4QMG A;  4FF4 A;  4QUC A;  3I70 A;  3M7N A;  3UDX A;  4PQX A;  4XT1 B;  1I94 Q;  4U67 3;  1HA6 A;  3SDZ A;  4B3T Q;  2CH4 W;  3K7U C;  2JA8 H;  3SHL A;  4LF7 Q;  2VQF Q;  3AB9 A;  3CPF A;  3CXC A;  2SDF A;  1TWF H;  1A15 A;  1G29 1;  1JC7 A;  1S20 A;  3HG9 A;  3MXN A;  2MO0 A;  2LXK A;  2GN5 A;  3M4O B;  5M3F B;  1STE A;  1HFN A;  1RCV D;  4QQB X;  5LMU Q;  3DLL A;  1PTO B;  2MO1 A;  2E75 C;  1S5B D;  4DAV A;  2EQS A;  4JVY A;  2MFI A;  2LTL A;  2BDN A;  1BCP D;  2CTE A;  1QB5 D;  1X3E A;  5C5L A;  4N8F A;  3E0J A;  2MJ8 A;  4IUU A;  4HJA A;  3KJP A;  1B4O A;  4C3J H;  1MKH A;  2NVX H;  1HNW H;  4FF3 A;  4A3L H;  4HIK A;  3I55 A;  1N32 Q;  4KLK A;  3VR2 A;  1G2S A;  5ELO A;  1EQV A;  1IBM H;  2N78 A;  1H9S A;  3UI2 A;  1VQH A;  1SYE A;  2F0W A;  5BR8 H;  3L7Z C;  2JA7 B;  4H02 A;  4ZRZ A;  2NVY H;  3HRZ C;  3VR3 A;  5C6A A;  2NZ1 D;  4JI0 Q;  2E5L H;  4X3K A;  3BVM A;  2UUC H;  3T16 A;  2F52 A;  3CMA A;  2QND A;  4JPB W;  4V0B A;  1JWU D;  5T1G A;  3H3V I;  5C44 H;  1E0B A;  3A5U A;  2EYJ A;  2F4I A;  4OO1 I;  2HUG A;  2MP1 A;  1SFO H;  3KBX A;  2B8G A;  4F7X A;  4X3U A;  4R4C A;  3AMU A;  5FOB B;  2EYP A;  1D1K A;  4XTC S;  3T4A C;  2IHF A;  2DGY A;  1K8A C;  1ILQ A;  3FHW A;  4KHV A;  3CPW A;  4KHP L;  5CV6 A;  1EZ6 A;  1ONL A;  2KEN A;  2WIN B;  4JI7 Q;  5EAY A;  3CCV A;  1AE3 A;  2MPM A;  1EEF D;  3QB3 A;  2DY8 A;  3F2U A;  1N34 H;  1V1O A;  4KHP Q;  2JA6 B;  1C8C A;  1XMQ Q;  4A3C H;  2R93 B;  4QCL A;  4HR7 B;  2IX0 A;  2CW0 C;  2K52 A;  4X66 L;  2R7Z B;  3GTO B;  1TU2 B;  1V43 A;  1PH1 A;  3NBI A;  4V19 0;  2YTY A;  1LT6 D;  3L0O A;  2ASB A;  4DV7 L;  1XMQ H;  2OQK A;  5JPN C;  3BYT B;  3BZD B;  2Z0S A;  1B70 B;  2ZXR A;  3FVQ A;  3CCE A;  1PQX A;  3K5N A;  1QZH A;  3DHQ A;  3U4V A;  5IE8 A;  4BY1 H;  1B7Y B;  4NKL A;  2R7F A;  1QE6 A;  2CFM A;  4KD4 A;  1YNX A;  2PW5 A;  1SJE D;  4RCO A;  2M6Q A;  4TSS A;  2AWO A;  4ZQ3 A;  1TUA A;  2L4N A;  4DK0 A;  4YY3 Q;  1NUC A;  1K28 A;  4GN5 A;  1YI2 A;  3GV6 A;  1FJG L;  3J7A 5;  1GKH A;  1IW7 C;  4A3J H;  2B2V A;  1ILP A;  1Y69 U;  3X3N A;  2ZM6 L;  3R3O A;  4K2L A;  5CV4 A;  5D14 A;  1HR0 H;  3H0G B;  5FLM H;  2F1M A;  1M1K C;  3W1G A;  4ULL A;  1FGU A;  3GKU A;  2F0M A;  2RBM A;  2CWA A;  2OTJ A;  3NCV A;  2WB1 G;  1DGS A;  5L37 A;  2ES2 A;  2FMC A;  4QGU A;  3GTG H;  3RLN A;  1AFP A;  2VB3 X;  1Z9F A;  4JOI C;  4KY7 A;  3EN2 A;  3QOJ A; 
#chains in the Genus database with same CATH homology
 2R6G A;  1YHA A;  2VQF L;  4OWW B;  5M5W H;  1CKN B;  3AYH B;  3D0F A;  3K0X A;  3S2D H;  2OPU A;  1YBY A;  1A0I A;  4DUZ Q;  4DR5 Q;  1EWI A;  3M4Q A;  4DV2 L;  4A3I H;  4DV6 Q;  3S16 H;  2Z6K C;  2A8V A;  4HJ8 A;  2OCE A;  4JI1 L;  1W2B A;  3HOZ G;  1XMO L;  2PMZ E;  4DV0 L;  1AE2 A;  2CTF A;  4HID A;  1G51 A;  3STB C;  4IPC A;  3HOZ H;  4O2D A;  4R4O A;  1JMC A;  5C4X H;  2WB1 E;  4GLX A;  1JJ2 A;  4B3M L;  4BY7 H;  4ME3 A;  1CSP A;  1NMF A;  4NXM L;  2NVQ H;  2KHJ A;  1YJ9 A;  1PYB A;  1EQR A;  3RNU A;  4A3E G;  1GVP A;  2Q2T A;  1HNZ Q;  4UP7 A;  1VQC A;  2JEB I;  4BBR H;  1WJJ A;  4A3K G;  2I0Q A;  3W1B A;  2K5N A;  2E3U A;  3B6Y A;  4JG2 A;  1CUK A;  2H5X A;  4AIM A;  4MNO A;  1SMX A;  4P75 A;  4B3S L;  3F2B A;  4JV5 L;  2NVT H;  4P71 A;  1Y1V G;  1SRO A;  3AEV A;  2MJH A;  1Q7Y C;  3KLW A;  1AH9 A;  4DV4 Q;  4DV1 Q;  2E8G A;  3STB D;  2R92 G;  1Q86 C;  4DV3 Q;  5JJK A;  3K80 C;  4DR4 Q;  4DKA C;  4RMF A;  2JA8 G;  1YJW A;  2ZTD A;  4GKJ Q;  2K5H A;  3KYH C;  3PO2 G;  4LUV A;  4HJ9 A;  3UDG A;  1Q12 A;  3FP9 A;  1E3P A;  3ZJY C;  2MNA A;  1PH4 A;  4A3D H;  4LNQ A;  3JAM c;  3PUV A;  1KRT A;  4JI2 Q;  4JOI A;  4DV1 L;  4A3K H;  4YCW A;  1Q46 A;  4L5R C;  4DV2 Q;  3BU2 A;  4BXX G;  1X6O A;  1VQ5 A;  3HOV G;  5IWA L;  5IYC H;  5M3F G;  1QUQ B;  4NXN L;  3UDI A;  5IYB H;  2K4K A;  1KQS A;  2R7Z G;  2R93 G;  3CW2 C;  4Y52 H;  1IBM Q;  2ANR A;  3PUX A;  2LXJ A;  1VIG A;  1SRU A;  2JA6 G;  1I3Q H;  2GVB A;  2B63 G;  4JBW A;  1ASZ A;  3AQQ A;  2AWN A;  1JJC B;  1BVS A;  2NZH A;  2JA6 H;  4NXM Q;  2VQE Q;  3J81 j;  1N34 L;  2CTJ A;  4WJ3 M;  1YEZ A;  2VNU D;  4WAN A;  2CWP A;  1OXS C;  1K9M C;  5HY6 A;  2PI2 A;  1L1O B;  1EYG A;  3BJU A;  2AHO B;  2Q2I A;  3T1Y Q;  3A0J A;  3PF4 A;  3S1N H;  2JVZ A;  4KI0 A;  1YJN A;  4IPH A;  3TRE A;  5BR8 Q;  3E9H A;  1XNR Q;  1X65 A;  1XTD A;  3RR5 A;  5HGQ A;  3PIO A;  3T1H L;  1TXY A;  5GQO A;  2Q2U A;  4WAL A;  3NBH B;  5IT9 c;  1BBW A;  1XMQ L;  1NMG A;  5C4J H;  4DV4 L;  3OYY A;  1WI5 A;  1HZA A;  3M9B A;  3OTO L;  4AQY L;  4X62 L;  3S24 A;  2QEX A;  1TWG H;  5C0X J;  3I4O A;  2OPV A;  5M5Y H;  5C3E H;  4GKK Q;  3G71 A;  1UE7 A;  1VQK A;  4R4I A;  4BBR G;  3TEH B;  1E1O A;  1YHB A;  3ULP A;  1M90 C;  2CTK A;  4YWM A;  2K5V A;  3F2C A;  1N33 Q;  1LUZ A;  4LF9 Q;  4GNX B;  2HH2 A;  1OXX K;  2KCM A;  4GN3 B;  2VUM G;  2UXC Q;  1VQ6 A;  2RCN A;  2BL5 A;  1PYS B;  3ERS X;  1IBL L;  4JI5 L;  4LIJ A;  2NN6 G;  4TQU S;  2D62 A;  5ELN A;  2WFW A;  1VQG A;  2NZO A;  4PZ6 A;  2CCZ A;  1O7I A;  3CCJ A;  1NJI C;  2VUM H;  3HOW H;  3HOY G;  3M3Y H;  1DT4 A;  1VCI A;  1S3O A;  2RHQ B;  4C2M H;  1L2F A;  3GTJ H;  1SE8 A;  4DR7 Q;  1CKO A;  4HJ5 A;  3H15 A;  4JI2 L;  1E7Z A;  3HOY H;  1IZ6 A;  1GD7 A;  3M4O H;  4JI5 Q;  1YVC A;  1OXT A;  4YY3 L;  4DR2 Q;  2JA7 G;  4X65 Q;  1C9O A;  5IWA Q;  5C0X I;  1VQB A;  3CC4 A;  2F3I A;  4GNX A;  1VS0 A;  1L0W A;  1JJG A;  1KIX A;  4EX5 A;  3CCS A;  3UE1 A;  4NXN Q;  4OX9 L;  2L15 A;  4DR4 L;  3TS0 A;  4A93 G;  2JJQ A;  2JQO A;  2IHE A;  1Q1E A;  5AJ3 L;  1K73 C;  4POG A;  1KAW A;  4UPA A;  4JVH A;  3GTP H;  4A93 H;  5FJ8 H;  2JE6 I;  1N8R C;  1T9H A;  3GTL H;  4PZ7 A;  3CD6 A;  4R4T A;  1W3S A;  4LFB Q;  4NPS A;  1XPO A;  3EBE A;  1VQI A;  1J5E Q;  3GTO H;  1XPU A;  2UUC L;  3TQY A;  1CKN A;  2YTV A;  3CP0 A;  3T1Y L;  3PUW A;  2CTL A;  3U4Z A;  4DNI A;  3S1Q H;  1YZ6 A;  2ALY B;  2ZM6 Q;  3V69 A;  4QL5 A;  4B3M Q;  2IT1 A;  4A3G G;  2JEA I;  4JYA Q;  2VY3 A;  3T1H Q;  1VQE A;  1N33 L;  4B3R L;  1PH2 A;  4R1J A;  1PH7 A;  2HQL A;  4JBK A;  4LFC Q;  3ULJ A;  4HIO A;  4P73 A;  3HKS A;  2E5L Q;  4IOA A;  4GS3 A;  3I4M G;  3OTO Q;  1UWV A;  2ZJP A;  1HR0 L;  1K1G A;  1X4N A;  3PGZ A;  1PHJ A;  1HR0 W;  3F8T A;  2P2R A;  4YCU A;  1L1O A;  1PH9 A;  1K3R A;  5IP7 H;  4DR1 Q;  3I4N H;  4A4I A;  4JI0 L;  2NN6 I;  4LF6 L;  1E1T A;  4AM3 A;  4YWL A;  4DR2 L;  1X9N A;  1PVO A;  3VKE A;  3GTQ H;  4A3L G;  4LWC A;  4A3M H;  1HR0 Q;  2PI2 E;  4P74 A;  5K36 G;  3U50 C;  1N32 L;  2XGT A;  4DUZ L;  2DUD A;  3W5O A;  1EIY B;  2BH8 A;  4APV A;  1JB7 A;  4A3G H;  4A3M G;  1KRS A;  5GAH C;  2HHH L;  3AFP A;  2OWO A;  1A8V A;  4RG1 A;  4DV0 Q;  3U1K A;  1Z47 A;  1HZB A;  3JC6 6;  1KL9 A;  3HOV H;  2E2J H;  2YQR A;  3DM3 A;  4NB3 A;  5GAE C;  3J81 i;  3G48 A;  5H1S E;  4DV3 L;  1LYL A;  2HH3 A;  4ALP A;  1QVF A;  2I5L X;  3CAM A;  5FLX c;  1IL2 A;  1J6Q A;  1KHI A;  4IJL A;  2UUB L;  2EXD A;  1WCM G;  5JJL A;  2YU9 H;  1P16 A;  3WWV A;  1KC8 C;  4X64 L;  3L2P A;  1B8A A;  2JA7 H;  3PUY A;  1OTC A;  4JI6 Q;  4DR3 L;  2KBN A;  1SR3 A;  1IBK Q;  3S14 H;  4AYB E;  1WE8 A;  2ATW A;  3KDF B;  4OWX B;  1MJE A;  2OTL A;  3CC2 A;  5AJ3 Q;  4BXX H;  1PH8 A;  4B3S Q;  2Y0S E;  2UXD L;  5IYC G;  5M3F H;  4LF4 Q;  1RL2 A;  4JC0 A;  4K0K Q;  1KHM A;  3M85 A;  2ID0 A;  4EQ5 A;  1CSQ A;  3U58 A;  3BZK A;  3CCU A;  4JI4 Q;  3GTK H;  4X65 L;  1WFQ A;  4UP9 A;  1KXL A;  3TRZ A;  4J15 A;  4GKJ L;  1HH2 P;  3J81 c;  1VQJ A;  2KHI A;  4OWT B;  3PCO B;  4A3F G;  2HHH Q;  2WAQ G;  4DV6 L;  1K8G A;  1XNR L;  1J5E L;  1ASY A;  3CQZ H;  3F2D A;  2QA4 A;  4B3T L;  4JV5 Q;  1KD1 C;  4YWK A;  3PIP A;  4PMW A;  1LTL A;  1I94 L;  2JK8 A;  3D31 A;  1PH5 A;  3H0G H;  2VQE L;  1J5K A;  1A62 A;  1QVC A;  1Q81 C;  1WVN A;  1VQP A;  1EIF A;  1MIU A;  1PV4 A;  4LF8 L;  1G6P A;  2ZTC A;  3I7F A;  2MQH A;  3J80 i;  2HT1 A;  1OXV A;  2YTX A;  2YV5 A;  4QIW E;  4DV5 L;  5GAG C;  1HNZ L;  1IBM L;  1VQL A;  4BBS H;  3FKI H;  3GDE A;  4DUY L;  1S40 A;  2XTI A;  4BBS G;  4LF9 L;  4DR1 L;  5C0X G;  4DV7 Q;  3K8A A;  4MZ9 A;  1HNW L;  1X3F A;  1D7Q A;  5J3B A;  3CME A;  1I5F A;  1TWA H;  2ZJR A;  1Q8K A;  2D0P A;  3ER0 A;  1EUJ A;  3HOU H;  3PO2 H;  4OO1 G;  4AQY Q;  2VW9 A;  2N49 A;  5M3M H;  1UEB A;  1Y1W H;  4NBQ A;  2E5L L;  4BY7 G;  3SGI A;  3BZC A;  1V9P A;  1GM5 A;  4IJH A;  1YIJ A;  1NBW A;  5GAD C;  1VQ8 A;  4BA1 I;  2Q2H A;  2PY9 A;  1YHQ A;  4DR7 L;  2E2H H;  4BA2 I;  1U0L A;  2F4V L;  2UXB L;  3G6E A;  3CCQ A;  4JBM A;  2B3G A;  2CQO A;  5BR8 L;  5C44 G;  3RZD H;  2D0O A;  4LF6 Q;  3I4M H;  2UXC L;  5JJI A;  4K0K L;  2N3S A;  4GOP A;  4LFA L;  2UXD Q;  4JI3 Q;  2AXY A;  4DK3 C;  4HJ7 A;  4LUZ A;  4MTN A;  4LF4 L;  1FL0 A;  2AMC B;  3RZO H;  2BA0 A;  5IP7 G;  3HKZ E;  4GN4 B;  1VQM A;  2B63 H;  3I4N G;  3Q8D A;  1TWH H;  4UP8 A;  1U5K A;  4X62 Q;  1R9T H;  2ANN A;  1E24 A;  3NEM A;  2UUA Q;  4JI6 L;  1EFW A;  1Q82 C;  1IBK L;  2UUB Q;  4L5S A;  1X56 A;  4JCV E;  5IYD G;  1FJG Q;  2YYZ A;  2R92 H;  1OXU A;  1Y14 B;  4A3J G;  4YHH L;  3RN2 A;  1HNX Q;  1Y1W G;  4LFA Q;  3A74 A;  3PO3 G;  1VQF A;  5IYD H;  4QMF B;  2I5H A;  1P8L A;  3KF8 B;  2K50 A;  3KF6 A;  4KHZ A;  3CCL A;  3S15 H;  3GO5 A;  4LF7 L;  1XNQ Q;  3HOX G;  1ZZK A;  1XJV A;  1S72 A;  3KJO A;  1VQ7 A;  4OX9 Q;  1EQQ A;  1N34 Q;  4DAY B;  1XMO Q;  3ICE A;  4JI1 Q;  2BA1 A;  3M7N A;  4O0A A;  4AYB G;  3AFQ A;  2EIF A;  3EIV A;  3UDX A;  1E22 A;  2Z6K A;  3UE0 A;  3RN5 A;  1I94 Q;  3MEF A;  3HFZ B;  2R93 H;  3TS2 A;  3CCR A;  4B3T Q;  2PNH A;  3HKZ G;  3AEV B;  3K7U C;  2JA8 H;  4X6A H;  4LF7 Q;  1WYD A;  4GNX C;  4Y7N H;  1K0R A;  2VQF Q;  3CPF A;  5IP9 G;  4DR5 L;  3CXC A;  4WJ4 A;  1TWF H;  4JBJ A;  1G29 1;  4JI4 L;  4DV5 Q;  2CKZ B;  4TVA B;  4A3D G;  2MO0 A;  2JA5 G;  2B29 A;  2LXK A;  2GN5 A;  5IP9 H;  3OW2 A;  4LF8 Q;  4IFD G;  4LF5 Q;  2VS1 A;  4JI8 L;  1QUQ A;  5LMU Q;  4QQB X;  3DLL A;  2MO1 A;  3NEN A;  1UE5 A;  1VQ9 A;  2PQU A;  2K75 A;  2EQS A;  3PUZ A;  4JYA L;  4JVY A;  2MFI A;  1UE6 A;  2LSS A;  2HIV A;  3JAM i;  4B3R Q;  2CPQ A;  2CTE A;  1RIP A;  1X3E A;  4GLA C;  1A63 A;  3KOJ A;  1FVI A;  3PSI A;  3KJP A;  4HIM A;  4HJA A;  1ZZI A;  3H0G G;  5M3M G;  4C3J H;  1QVG A;  1NE3 A;  4FDB A;  1LM0 A;  1MKH A;  2NVX H;  2UUC Q;  4YCV A;  2F4V Q;  1K83 H;  3S1M H;  4DR6 L;  4HIK A;  4A3L H;  2UXB Q;  2ZTE A;  3G4S A;  3I55 A;  1N32 Q;  4KLK A;  1X3G A;  1HZ9 A;  5ELO A;  5LMN L;  3PF5 A;  2OQ0 A;  3FKI G;  1Y1V H;  2N78 A;  3I56 A;  1L1O C;  4X64 Q;  5FJ8 G;  1PA6 A;  1VQH A;  1PH6 A;  3ULL A;  1JT8 A;  3S2H H;  3L7Z C;  4DR3 Q;  3PV0 A;  4DK6 C;  1SN8 A;  1UE1 A;  4QY7 A;  4GOP B;  4H02 A;  1C7Y A;  3I2Z A;  2PQA A;  2NVY H;  1PH3 A;  4A3E H;  3J7Z C;  4JI0 Q;  1EC6 A;  1XPR A;  4IFD J;  1PFS A;  1WCM H;  2Y0S G;  2F52 A;  4LFC L;  3CMA A;  2IX1 A;  2QND A;  2JA9 A;  1VQ4 A;  1C0A A;  1D8L A;  2FXQ A;  3H3V I;  4IPD A;  1XNQ L;  3GD7 A;  1EOV A;  5C44 H;  4UY8 C;  1JE5 A;  4L5Q A;  2I5M X;  3A5U A;  4OO1 I;  4OON A;  1DTJ A;  1SFO H;  5M5X H;  3HOX H;  1VQN A;  3CF5 A;  4R4C A;  4YHH Q;  1HNX L;  4XTC S;  1VIH A;  1ZTG A;  1Q1B A;  2IHF A;  1X55 A;  2DGY A;  1K8A C;  1QZG A;  3FHW A;  4QJF A;  3HOW G;  1I50 H;  3S17 H;  1H95 A;  4DAM A;  3CPW A;  4KHP L;  4OXP A;  2RHS B;  2KEN A;  2C35 B;  3CC7 A;  4GKK L;  4JI7 Q;  2CTM A;  5EAY A;  3CCV A;  1AE3 A;  1BKB A;  2WAQ E;  3K7A H;  5LMU L;  2WP8 J;  3RLF A;  1N36 Q;  2UU9 Q;  4DR6 Q;  1WOC A;  3E9I A;  2A19 A;  3MXN B;  4KHP Q;  3CCM A;  4A3I G;  1VQD A;  1XMQ Q;  1YIT A;  4A3C H;  3K81 C;  4A75 A;  3GTM H;  2JZX A;  2IX0 A;  2K52 A;  4X66 L;  5LMN W;  4PZ8 A;  1V43 A;  1MJC A;  1PH1 A;  2YTY A;  3L0O A;  2A1A A;  2ASB A;  1X54 A;  3KFU A;  5C4X G;  4B8T A;  4DV7 L;  2OQK A;  4POF A;  1J4W A;  4BY1 G;  3KDF A;  3HOU G;  3UDF A;  2Z0S A;  1B70 B;  2JA5 H;  2K14 A;  2RF4 A;  4AH6 A;  3CCE A;  1QZH A;  1VQA A;  3A5Z B;  3U4V A;  1N9W A;  5IE8 A;  4X66 Q;  4BY1 H;  1B7Y B;  4C3H H;  2VL6 A;  4DPG A;  1IBL Q;  2R7F A;  2DGR A;  3NEL A;  3H3V H;  4P72 A;  3RLO A;  2CFM A;  3IRB A;  5FLM G;  4A3B G;  1YNX A;  3J80 c;  5GRO A;  1IYJ B;  5JEA G;  4A76 A;  2R7D A;  4DUY Q;  4XIG S;  5E7N A;  2AWO A;  4A3C G;  2HIX A;  5IYB G;  4LW1 A;  1CKM A;  4C3I H;  3F1Z A;  3S1R H;  2R7Z H;  1TUA A;  4JI3 L;  4YY3 Q;  2BH2 A;  1GO3 E;  4IFD I;  5C3E G;  2IY5 B;  4GN5 A;  1HJP A;  1ZZJ A;  3E0E A;  5LMN Q;  1YI2 A;  2GVA A;  1FJG L;  1GKH A;  3J7A 5;  5DLQ E;  1IXR A;  3VDY A;  4A3J H;  4L5T A;  3KF6 B;  2AKW B;  4IO9 A;  4GLV B;  2VZA A;  4GOP C;  2ZM6 L;  1V1Q A;  2PQA B;  2KCT A;  2ZJQ A;  5FLM H;  1M1K C;  4A3B H;  2QGQ A;  3W1G A;  3PO3 H;  1HNW Q;  4LFB L;  1FGU A;  1X4M A;  1BBU A;  1HZC A;  2N8N A;  1VQO A;  1NTG A;  4A3F H;  2E2I H;  2CWA A;  2OTJ A;  2WB1 G;  1SLJ A;  1DGS A;  2ES2 A;  2UUA L;  4LF5 L;  4QGU A;  4JI8 Q;  3GTG H;  1TWC H;  2V1C C;  5IY0 A;  3RLN A;  4JI7 L;  4PG3 A;  3LGJ A;  3M4P A;  4LUO A;  4IOC A;  1N36 L;  2UU9 L;  1Z9F A;  4JOI C;  4R4Q A;  5JEA J;  1NY4 A;  3EN2 A;  1I6H H;  4IPG A;  2FMR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...