2Z0SA

Crystal structure of putative exosome complex rna-binding protein
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
175
structure length
175
Chain Sequence
b'EIYVPQAGDVVIGLIQSVGIMNWFVDINSPYVAVLSVQDFLGRPFNPAVDDMQSLLKVGDYIKAKVVAFDKTRSPLLTVQGEGLGRIVRGKIVEISPAKVPRVIGRKMSMLKTLEEKTECKIFVARNGRIHLECPNEDLEAIAVMAIKIIDEEAYTSGLTKRIIKFIEEERRIRE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable exosome complex RNA-binding protein 1
publication title Crystal structure of putative exosome complex RNA-binding protein
rcsb
source organism Aeropyrum pernix
molecule tags Rna binding protein
total genus 42
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 2007-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2z0sA01
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 2z0sA02
1XPOA 1XPUA 3K7AH 1IBKL 1EYGA 1OXXK 2UXCQ 2R92G 1YHBA 2OQ0A 2CTKA 4B3RQ 2HQLA 3HOVG 4LF7L 1HH2P 5LMUL 4JI6Q 3CP0A 1K73C 3OYYA 1YZ6A 3I2ZA 3HOXG 4DV5L 2UUBQ 4X65Q 4DR7Q 4X64L 3AFQA 5GQOA 5M5YH 1IZ6A 3CCVA 4DK6C 3M85A 2VUMG 4DAYB 1BBWA 1HNZL 1LYLA 2D0PA 3ER0A 3PF5A 1UE7A 3K7UC 2F4VQ 1U0LA 2Y0SE 5C0XG 2KCTA 2YTVA 2HIVA 3CMAA 2RCNA 4JI0Q 1VQ6A 4B3SL 2LSSA 4AYBG 4BA2I 2KHJA 3F8TA 1XNRL 5C4XH 3PUWA 1IBLL 2PQAA 2CWPA 1PH8A 1GM5A 1QUQA 4A3BG 3WWVA 2UUCQ 4TQUS 4GNXA 3S2HH 1P8LA 2D62A 3CW2C 1K8GA 1B8AA 3J81c 1VQEA 2JQOA 4GS3A 3TEHB 5FJ8H 2Z6KC 4NPSA 2NVQH 1Q81C 1J4WA 2P2RA 4XTCS 1IXRA 1OXUA 1B7YB 2K52A 2WB1G 3DM3A 1Z9FA 1NJIC 4BBRH 3BZCA 1N34Q 4X62L 1Q82C 1PH9A 4DUZL 3GO5A 4DR2L 1VQ8A 4LF9Q 2LXKA 3D31A 2IT1A 1VQNA 5IT9c 3PGZA 5GAGC 3HKZG 1NMFA 3Q8DA 1FGUA 2JA7H 1VQGA 4JI6L 1YHQA 2E5LL 2UXBQ 1XMOQ 2ZM6L 3VKEA 1KQSA 3BJUA 4X65L 5FLXc 2UUAQ 4IFDJ 2OPVA 3GD7A 1PH7A 1H95A 2WP8J 3NELA 3VDYA 1RIPA 3U58A 4NXNQ 1VQ5A 2JE6I 1JE5A 4TVAB 4NXML 1Y14B 4ALPA 4DR5L 3UDGA 1K83H 2H5XA 4GLVB 4JG2A 3RN2A 1JT8A 2Q2IA 2JA8G 3M9BA 4YY3L 4POGA 1QVGA 1EC6A 4JI3L 1CUKA 3FKIH 2RHQB 2HHHQ 1KRSA 1D8LA 4H02A 1HZCA 1PH4A 3E9IA 1AE3A 2I5HA 1UE6A 4YHHQ 5LMNW 1WI5A 4DV7Q 4JI4Q 3PUVA 2BH8A 1LTLA 4DV0Q 1I94Q 3S16H 4JBJA 2I5LX 4LW1A 1FJGL 4LFCQ 1VIGA 1KC8C 1J5KA 2R7FA 4XIGS 5FJ8G 4HJAA 1YJ9A 4DV2L 1CKNA 1GD7A 1BBUA 1DGSA 1J6QA 3CCEA 4DV4Q 1X65A 4HIOA 4A3MH 2NVYH 3I4OA 1WOCA 4BBRG 4A93H 1D7QA 1JJCB 4LF9L 4PMWA 1KIXA 3G6EA 4BBSH 4IPDA 2Z0SA 1K8AC 3MEFA 3T1YQ 1M90C 2VZAA 1EQRA 3HOYH 3ICEA 3ZJYC 4P72A 4DV3Q 3RN5A 3HOZH 1YNXA 3PUZA 4DV1Q 1ZZKA 4JOIC 5HGQA 2JA7G 3PIOA 4LF6L 1X56A 1C7YA 2JK8A 3OTOQ 4R4TA 4UY8C 3S24A 1K1GA 4BXXG 3CMEA 4LIJA 1K3RA 1Y1VH 2FXQA 3S1RH 3T1HL 4OWWB 2VQFL 4L5RC 3KYHC 2ATWA 4LUVA 1N33Q 3CC7A 3I4NH 3GDEA 2Y0SG 2JA6G 2GN5A 2MFIA 2PI2E 1FVIA 4JI2L 2YTXA 4KLKA 4O2DA 4EQ5A 4KHPL 5C44H 1M1KC 2E2JH 4QL5A 4UP7A 3CCQA 3FKIG 3RLNA 4A76A 4JVHA 1HNXL 4QMFB 2CTEA 2YQRA 4A3LH 1IBML 4JI4L 4DV0L 1JB7A 4A3EH 3GTGH 4DR4L 5IE8A 2F52A 1HJPA 4AH6A 1VCIA 3PF4A 2CTMA 2NN6I 2JA5G 1K9MC 5LMNQ 3S14H 4JV5Q 1L1OC 3OW2A 2BA0A 4JBWA 4BY1H 2A1AA 3MXNB 4X66Q 4LF5L 3GTJH 3S2DH 4JOIA 3ERSX 4FDBA 4OWTB 1WJJA 4P73A 5JEAJ 1I50H 2WFWA 3L0OA 4PZ7A 1JJ2A 1VQBA 1VQ9A 1BVSA 1OXSC 4DR6L 4A93G 4QIWE 4OXPA 3PO2H 4LF4Q 1TWHH 1E3PA 1NY4A 2MQHA 4DV3L 4BBSG 3PO3H 4JYAQ 1XNQQ 2D0OA 4JC0A 4R4QA 3TQYA 2E2HH 1EIYB 3PIPA 3S17H 1YJWA 5IP7H 4JI1Q 3SGIA 4WJ4A 3HOZG 2CQOA 1EFWA 5IYDH 3E0EA 4KI0A 5IY0A 1XJVA 4GKKQ 2JA9A 1XTDA 1VQ7A 1XMQL 2AMCB 4PZ6A 2EIFA 1UE1A 1PHJA 4GOPC 4YWLA 2N8NA 4A3FH 3KDFA 3EIVA 3M4PA 4JI7Q 2NZHA 1QZGA 2ASBA 4B3ML 3RR5A 4AIMA 4X6AH 1AH9A 3KF6B 1VQ4A 3HFZB 2QGQA 1SRUA 3CC2A 2IX0A 2UXDL 4DNIA 5C4JH 1MIUA 2AHOB 3H0GG 3RZDH 3RLOA 2R93G 2I5MX 4DPGA 4IPHA 2IHEA 1L1OA 1SR3A 4APVA 2NVXH 1L2FA 1YBYA 1HR0Q 4IOAA 1NMGA 3E9HA 4QGUA 2R7ZH 4A3LG 3PV0A 4A3EG 2ZJQA 2QEXA 1DT4A 1PYSB 5BR8Q 3GTPH 5LMNL 1Q46A 4JI8L 4DV6L 4NB3A 3CD6A 2DGRA 4UPAA 3GTLH 2PNHA 5FLMH 2ZTDA 5IYCH 4B3TQ 2EXDA 1SMXA 2OPUA 2ID0A 4DR3L 1VQHA 1PH1A 1KXLA 2UXBL 5JJLA 2MO1A 1G51A 2IY5B 2PMZE 1EOVA 4AQYQ 3HOWH 4DR1Q 4LFAQ 2UXCL 1YI2A 4GOPA 2Q2HA 1N36Q 3ULLA 3PO2G 1Q86C 1MKHA 2E3UA 3PO3G 4B3RL 1TUAA 4LUOA 1JMCA 1HZBA 4DK3C 3I7FA 2FMRA 5C3EH 2UUBL 3L7ZC 4DR7L 3KFUA 4IPGA 4UP9A 3I56A 3CCLA 3F2DA 3PUXA 3U4ZA 2ALYB 3A0JA 5ELNA 3S15H 4MZ9A 4A3FG 1EQQA 2N78A 4LWCA 4R4IA 2F4VL 3TREA 4C3JH 4JI5Q 1Q1EA 4LF8Q 3PSIA 1T9HA 2VNUD 4O0AA 4IOCA 4JI0L 3F1ZA 3LGJA 2IHFA 1I6HH 1SFOH 1HNWQ 2PQUA 2CFMA 1N9WA 3KOJA 2IX1A 2Z6KA 1JJGA 1HZAA 5IYBH 2UUCL 5C4XG 5JJIA 4OX9Q 5DLQE 1OTCA 3V69A 1BKBA 1TWCH 1WVNA 1PA6A 2BA1A 3CQZH 2B63H 2R7ZG 2XGTA 4DAMA 3W5OA 2JEBI 4R4CA 1GVPA 5C0XJ 1VQLA 2CCZA 3UDIA 2WAQE 2XTIA 4MTNA 1N34L 2Q2TA 4K0KQ 3A5ZB 5FLMG 1N32Q 3B6YA 4BA1I 5IYCG 2ZTCA 2VQEQ 1MJEA 2GVAA 1QVCA 2UU9Q 1VQIA 4QQBX 3G71A 3GTOH 1UE5A 1XMOL 4JVYA 1VQOA 2RHSB 2CWAA 3GTQH 4DUYQ 2UUAL 2QA4A 4LFBQ 1VQFA 2VW9A 1S3OA 4OO1I 1Y1WH 1I3QH 1KHIA 1TWAH 4NXNL 1ZZJA 1QZHA 1IL2A 3RZOH 1J5EQ 4YCWA 4P75A 2JJQA 2KHIA 1A8VA 5GAEC 1CSPA 3W1BA 1HR0W 3UDFA 2HHHL 1WE8A 2NZOA 2PI2A 2R92H 5AJ3Q 3L2PA 1YIJA 1X4MA 3GTMH 1X6OA 4YCVA 4YHHL 1N8RC 3HOVH 1AE2A 2HH2A 4DV7L 1CKMA 3KJPA 4R1JA 2MNAA 1I94L 3H3VI 2RF4A 4ME3A 4LF7Q 4HIDA 4A3KH 1WCMH 4R4OA 1EUJA 2GVBA 4LFCL 1R9TH 2B63G 4NBQA 1Z47A 4DV5Q 4HJ9A 2CTFA 1KL9A 3UE1A 4DV4L 2OQKA 4X64Q 2HIXA 2K5VA 4K0KL 4QJFA 4A3MG 1KRTA 4POFA 1GKHA 3K81C 5M5WH 1HNZQ 2PY9A 4KHZA 1QVFA 3S1QH 3T1YL 4A3IH 4GKJQ 1X4NA 1UWVA 2ES2A 2A19A 3W1GA 1NE3A 2PQAB 4DV1L 4B3SQ 3KF8B 3HOYG 3NEMA 1QUQB 4RG1A 1XNRQ 5M3MH 3CCJA 1MJCA 4RMFA 4GNXB 1IBLQ 1V9PA 3OTOL 2OTLA 3H3VH 5JJKA 2DUDA 4LNQA 1OXTA 3RLFA 1Q8KA 1DTJA 3DLLA 3K8AA 3JAMi 1N33L 4A3DH 3AYHB 1Y1VG 3J80i 5M5XH 4HJ8A 1Y1WG 4YCUA 1X54A 3I4NG 2AWOA 2B29A 4GNXC 3AEVA 4JBKA 3S1MH 1X3GA 3U1KA 3NENA 4X62Q 4DUZQ 4DR2Q 1FL0A 2AXYA 5C44G 1WFQA 2K14A 5E7NA 3CCMA 4L5SA 3I4MH 3F2CA 5IWAQ 3I55A 3PUYA 3KJOA 4MNOA 2ZTEA 3CC4A 3PCOB 3S1NH 2E5LQ 2ZM6Q 4WJ3M 4GLXA 4A3KG 2WAQG 1WCMG 2K50A 4OO1G 4JV5L 3U50C 1GO3E 4X66L 4HJ7A 1V1QA 1RL2A 1SN8A 1UEBA 4B3TL 4BY1G 3EBEA 3U4VA 1YEZA 4NXMQ 1E1OA 1PFSA 2I0QA 2VS1A 2JA8H 4GKJL 4LF4L 4DR5Q 1A62A 4JYAL 4GN5A 1A63A 4AM3A 2CTLA 2ZJRA 3KLWA 3ULPA 4A3IG 1XNQL 3STBD 4YY3Q 2NVTH 3HOUH 4JI3Q 1P16A 4JI1L 2BL5A 1EWIA 2HH3A 2CTJA 2EQSA 1X9NA 1VQPA 2JVZA 4GKKL 4L5QA 5IYDG 5M3MG 5IP7G 1KAWA 4BY7H 2KBNA 4PG3A 1PYBA 1Q12A 1VIHA 3G4SA 2NN6G 2ZJPA 4JI7L 1C9OA 3AFPA 1CKNB 2R6GA 3CCRA 1FJGQ 4A3DG 4HJ5A 2MJHA 2B3GA 4OONA 3CXCA 2K4KA 4DV2Q 4LUZA 3KF6A 3F2BA 2A8VA 3UE0A 3A5UA 3A74A 2K5NA 3GTKH 1SROA 5K36G 4GN3B 2C35B 1YITA 1PVOA 5IWAL 3K80C 4J15A 3J81j 1HR0L 4WALA 1YHAA 2N49A 3I4MG 1KHMA 1TWFH 2OCEA 1EIFA 2MO0A 1I5FA 5BR8L 4BXXH 1PH3A 4A3GH 2KENA 5GADC 1PH5A 2QNDA 4LF6Q 1NBWA 5GROA 3CPFA 1ASYA 4A3JH 1B70B 1E1TA 3T1HQ 3D0FA 2VQFQ 1VQCA 4IPCA 2JA6H 3J81i 2OWOA 1TWGH 3TS0A 1O7IA 1XPRA 4AQYL 2AKWB 1PH6A 3TRZA 4DR1L 4DKAC 4LFAL 3CF5A 2N3SA 1VQMA 5ELOA 1W2BA 5IP9H 1N36L 2CPQA 4JI2Q 3H15A 3HOWG 3ULJA 3UDXA 1E24A 3HOUG 4IFDI 1HZ9A 4KHPQ 4AYBE 2YU9H 1VS0A 2VL6A 5JEAG 5M3FH 2BH2A 2E8GA 2VY3A 1HNXQ 1X3FA 1IBMQ 2F3IA 4JCVE 1K0RA 1CKOA 4HIMA 4BY7G 1E22A 2JA5H 4DR4Q 5C3EG 4A4IA 4B8TA 3TS2A 4WANA 1A0IA 1E7ZA 2DGYA 1SLJA 4JI5L 1YVCA 2JEAI 1Q7YC 4IJHA 4IO9A 4LF8L 1LUZA 2JZXA 1ASZA 1U5KA 2WB1E 1PH2A 2V1CC 4LF5Q 1C0AA 3M4QA 1W3SA 5C0XI 3EN2A 4A3CH 2AWNA 1HNWL 1Q1BA 1CSQA 3FHWA 1L0WA 4DR6Q 1VQAA 1IYJB 4OX9L 3JAMc 1G291 3CCUA 4JBMA 1OXVA 1IBKQ 3J80c 2HT1A 5IYBG 3JC66 4Y7NH 3HKZE 4IJLA 4PZ8A 3M3YH 3HOXH 1VQKA 5J3BA 3J7ZC 1S40A 3CAMA 5H1SE 5EAYA 5LMUQ 1S72A 4A3GG 4P71A 3KDFB 5HY6A 1TXYA 1XMQQ 2KCMA 4OWXB 3M4OH 2ANRA 2VUMH 2YYZA 4P74A 4A3JG 4QY7A 5GAHC 1SE8A 4A75A 1N32L 1ZTGA 3AEVB 3CCSA 1G6PA 4B3MQ 1ZZIA 2VQEL 4GLAC 2UU9L 3RNUA 2L15A 4YWKA 3FP9A 3STBC 3J7A5 3K0XA 1YJNA 3H0GH 2R93H 2E2IH 2UXDQ 4YWMA 4C3IH 5IP9G 1L1OB 1KD1C 3NBHB 3IRBA 4A3BH 3CPWA 2CKZB 1PV4A 3BZKA 4DUYL 3BU2A 4LFBL 5M3FG 2K5HA 2YTYA 1X55A 4C2MH 2R7DA 1X3EA 4C3HH 4HIKA 1V43A 1VQJA 4JI8Q 4DV6Q 1J5EL 2LXJA 1VQDA 2YV5A 4Y52H 3M7NA 2OTJA 4L5TA 1NTGA 3AQQA 3HKSA 4UP8A 4EX5A 2Q2UA 4IFDG 2K75A 3G48A 1LM0A 4DR3Q 4GN4B 1WYDA 2ANNA 4A3CG 4GOPB 5AJ3L
chains in the Genus database with same CATH superfamily
1CQFA 2M6QA 2UXCQ 1B2TA 2R92G 2JXMB 1MSZA 1SNQA 2K1BA 3W2DA 3HOVG 2XNAC 4LF7L 5LMUL 3CP0A 3OYYA 1YZ6A 2VB2X 4DV5L 4X65Q 4X64L 3V05A 3NCVA 3QIAA 2QKIC 4XT1B 4B3SL 2HUGA 2J0TD 1CQVA 1JCKB 3PUWA 4HAEA 2C5CA 1IBLL 1D6EC 1PH8A 1JORA 1H9RA 3WWVA 4K6DA 2UUCQ 4GNXA 1EY8A 1K8GA 1HQRD 1XXGA 2E2JB 2L9HA 3TEHB 5FJ8H 4PDBA 1IXRA 4A3EB 1LTRD 2F0FA 4ZKBB 2NBFA 4C3HB 1TIID 3S9WA 2F0VA 4X62L 3A56A 2E74C 1PH9A 4FO2A 1HXYD 3D31A 3TP7A 1JWSD 1JE4A 2XRSD 5GAGC 3HKZG 1H9MA 4CJ2C 1WVLA 2RA4A 1YHQA 2RSNA 1XMOQ 4IZ8A 4OIKA 5CMDA 1VMCA 3PO3B 3K7AB 2PYKA 4ZAIA 2AQ1B 1EY4A 1PRTD 3X3MA 3NELA 3VDYA 1RIPA 4L63B 3U58A 1VQ5A 2JE6I 4NXML 2A68D 1Y14B 1CA5A 1CHQD 2F3WA 2M9VA 5M5YB 4G57A 2HHHQ 2KQ3A 1KRSA 4H02A 2I5HA 5EGTA 3JAMW 3D4DA 5LMNW 3PUVA 3FRPB 3S16H 4JBJA 4CKEA 3I72A 5C4XB 4LFCQ 1IKLA 2R7FA 1CKNA 1GD7A 3CCEA 3S2HB 1ICFB 2XIWA 4J1MA 3T53B 1WD1A 4LF9L 4PMWA 3G6EA 4IPDA 5CV5A 2RVLA 2VZAA 3BDOA 3DHQA 4QIWB 3ZJYC 3ICEA 1CZWA 4JI6H 1U4LA 4HEDA 4LF6L 1X56A 4GZYC 1K1GA 2G9HD 2FFMA 1Y1VH 1LTGD 3S1RH 3CHBD 1BDOA 2B2WA 3T1HL 1MSGA 2ATWA 3TSSA 2Y0SG 2JA6G 1FVIA 2K32A 2EDGA 4JI2L 5EBCA 4O2DA 2A5HA 1MI2A 4KHPL 2E2JH 4X3UA 3J7AF 3TZUA 4JVHA 2F0MA 2F0LA 3BS1A 4QMFB 4B08A 4A3EH 3GTGH 4DR4L 4N9PA 2D9UA 2F0TA 5E4XA 4HN7A 1OO9B 2EY6A 3PF4A 5G3LD 2B8FA 5I9OA 3OW2A 5KNCA 2EZVA 1STAA 4X66Q 3FVQA 3UOEA 3BG3A 5CORA 3GTJH 3ERSX 4B3TQ 2CTMA 5JEAJ 5IOCA 3EJIA 4PZ7A 1OXSC 4A93G 4QIWE 4RAUC 4ABNA 3A7AB 4LF4Q 4A3MB 2MQHA 3SHLA 3PO3H 1ZKOA 2NVYB 2D0OA 3PIPA 1YJWA 2CQOA 4KI0A 5IY0A 2A69D 1O7ZA 3HOYB 1XMQL 2UUAH 2NN6H 3GTOB 4XXEA 1PHJA 3HOZB 4YWLA 2N8NA 4B3ML 3NQIA 1VQ4A 2HDMA 3BVGA 1CK1A 3CC2A 2O4CA 1MIUA 3H0GG 1EYAA 4TSSA 2IHEA 4C3IG 1L2FA 2DNCA 2LF0A 4DV7H 5LL6X 4JI4H 4DV0H 1I94H 5ELCA 2ZJQA 1ILQA 3E5SA 1PYSB 2B2YC 4F87A 4DV6L 3J80L 3VR5A 3CD6A 5IGDA 3JAME 5NUCA 2SOBA 5IYCH 2WAQB 1SMXA 1VQHA 3OWEB 1PH1A 3H6MA 2MO1A 2GA4B 4AQYQ 1EOVA 4LFAQ 1GUSA 1BNZA 4DV3H 3BVMA 4LUOA 1I50B 1S5ED 1JMCA 1HZBA 5I2XA 4A3IB 1A3UA 2WKDA 5C3EH 3L7ZC 4DNRB 3CCLA 3I56A 2E2HB 2ALYB 2PNRC 1EQQA 2DNEA 4LWCA 4R4IA 2F4VL 4C3JH 4DAYA 5LL6S 4O0AA 2E75C 4IOCA 1GUGA 3LGJA 4CDFC 1SFOH 3AMUA 3KOJA 3PIP3 2R61A 1LTAD 1O80A 2NYZD 5IYBH 1SEBD 1OTCA 1LLRD 1MGSA 4FXGC 2R7ZG 1G91A 2NB0A 2CCZA 2NVXB 3I4MB 1GVPA 5LMNH 3OW7A 2A1SA 3NTIA 3UDIA 2WAQE 1RTNA 2XTIA 1X9ZA 4K0KQ 3A5ZB 2ZTCA 2VQEQ 3H91A 3GTLB 1VQIA 4JYAH 1K28A 3GTOH 4IUNA 1UE5A 2AQ2B 4JVYA 1HCZA 3GTQH 3U9SA 4OO1I 1KHIA 4NXNL 1ZZJA 1RKNA 4RGTA 1D1KA 4YCWA 4RA8A 1CM9A 3W1BA 5DNFA 5TSSA 4HSVA 2PI2A 4DK0A 1RODA 1HR0H 5EPJA 3ZYYX 1C4QA 1K3BC 1DD2A 4NBQA 1GUOA 2X6LA 2HIXA 1SE3A 1JOOA 2B63B 2EJFC 1GKHA 5M5WH 1QVFA 1TVXA 4A3IH 5JPMC 1UWVA 4Q0FA 3W1GA 2PQAB 3GR5A 3KF8B 5DEHA 4S3SA 1TWGB 4RFBA 3H3VH 5JJKA 2XN9C 1Y1VG 5E4WC 3L9AX 3J80i 4HJ8A 1Y1WG 3FAUA 1X54A 1L0XB 3C2PA 3AEVA 3MXPA 4E9JA 1I3QB 3BYYB 4C1NI 4DUZQ 2HHHH 4XQQA 2F0HA 1IW7C 5E7NA 3I4MH 4OX9H 3BZDB 1H9JA 3KJOA 4MNOA 5JJZA 1YNJC 3PCOB 2E5LQ 1SYGA 2R92B 1A2UA 4A3KG 3GTMB 3HOVB 1EY0A 3U50C 1GO3E 4ID6A 2F0UA 2LY7A 1UEBA 3D6WA 3U4VA 1E1OA 2I0QA 2VS1A 4GKJL 4DR5Q 1A62A 5D3DA 3QD7X 4GN5A 1JC7A 3KLWA 2BL5A 2O4XA 3I3CA 1P16A 4JI3Q 3OIQA 3NSWA 1EWIA 3SK8A 2HH3A 2CTJA 3RD4A 2JVZA 1VQPA 1S5BD 3S1QB 2FHTA 1KAWA 2BDOA 4XT3B 4PG3A 1VIHA 5EPLA 2NN6G 1V8QA 1GXDC 2R6GA 4HJ5A 3EFXD 4OONA 5G3LF 3NTHA 4A3DB 2BE5C 1KDBA 1CT1D 3A74A 3GTKH 3R2IA 1I6VC 1PVOA 3K80C 1B50A 4WALA 1JB3A 1PTOC 1YHAA 2MO0A 4LF7H 5KYIA 5BR8L 5GADC 1VMPA 3HKZB 1WTXA 1ASYA 4X64H 3H94A 4KK7A 4IN3A 4X66H 1MHWC 2QDLA 1TWGH 2JP1A 1PH6A 2CWHA 1DM0B 4LF4H 3CF5A 2N3SA 1VQMA 5ELOA 1HA6A 4B3SH 1SJED 5HURA 2YU9H 5JEAG 1A15A 1HUMA 4JK1C 2F0OA 2F3IA 4JCVE 1K0RA 3A55A 1YNND 5C3EG 3T4AC 1Z2IA 3TS2A 1R4QB 4DAVA 1KDCA 1H9SA 1E7ZA 1EWHA 2JSOA 2EYLA 1YVCA 3R2TA 1Q7YC 4LF8L 5KRUA 3K5LA 4C3JG 1HNWL 5C0XI 3VYTA 4A3CH 4X62H 2K01A 1CSQA 2PZWA 3FHWA 1KTKA 1IYJB 3KK7A 3JAMc 2Q8RE 5IYBG 3IKJA 3HKZE 3M3YH 5EAYA 2ANRA 1TXYA 1V1OA 4ZYSA 1PZJD 4A3JG 4A3GB 1ZZIA 3G7LA 2A6ED 2L15A 3STBC 3J7A5 1HTPA 1I4XA 2R93H 2Y0SB 5IP9G 2JA6B 3NBHB 3Q22A 1PV4A 3NXWA 4LFBL 5M3FG 3I4LA 1X55A 1X3EA 4HIKA 1SNOA 1V43A 5I2YA 4PQXA 1Y8PB 2LXJA 1J5EL 1V9NA 3M7NA 4L5TA 2Q2UA 5ELFA 2H4OA 4GN4B 2F3VA 3NEMA 1WYDA 2ANNA 3K0YA 2EXZA 1GUTA 4GOPB 1XPUA 1LT6D 1IBKL 2CW0D 4A93B 1EY7A 3I91A 1HH2P 4JI6Q 1PRTC 4LF6H 2EYMA 3I2ZA 2A68C 1SEIA 3AFQA 1IZ6A 3T1HH 4Y7NB 4DK6C 3M85A 4FP5D 1HNZL 4B9WA 5J1ZA 1UE7A 1QNKA 3K7UC 1HTLD 2TSSA 1WTOA 2Y0SE 2KCTA 1Y69U 3MHBA 4QMGA 4JI2H 3SK4A 4AYBG 2KECA 3F8TA 1XNRL 3SVMA 4KHPH 4ODGA 1QUQA 3H0GB 2E2IB 1B8AA 4DR4H 4C3IB 1VQEA 2J7ZA 2DY7A 2EVBA 3E6ZX 4NPSA 2E2DC 2M2LA 4XTCS 3DM3A 2WB1G 1B7YB 2D9IA 1S4ZA 4KD3A 3QO2A 3DXJC 1Q82C 2A74C 1DXMA 4DR2L 1K8OA 3O13A 1VQ8A 2Y3MA 5IT9c 3IAYA 2B2VC 1EY6A 1QB5D 2F0PA 4X65L 1XMQH 2UUAQ 3S17B 4IFDJ 1ILPA 1PH7A 1H95A 5T1IA 5LL6b 4B3MH 1JE5A 3MVVA 4CKBA 2VKCA 1B9NA 3MAQA 2H5XA 4GLVB 2CHBD 4JG2A 5AFWA 4POGA 4YY3L 2TMPA 1F77A 1AE3A 1T5EA 4DNTB 1FGBD 1LTID 4DV7Q 4JI4Q 1I6UA 2BH8A 5FO7B 4DV0Q 1I94Q 4FF3A 1SNDA 2I5LX 1FJGL 4DV6H 1VIGA 1KC8C 1YJ9A 2CTFA 4DFAA 4DV2L 4HIOA 2R7ZB 4NDXA 2FFKB 2CVRA 1WOCA 4BBRG 4A93H 1D7QA 1JJCB 4DUZH 1F9RA 3MEFA 4DV3Q 4P72A 2N55A 4NMZA 5JVG3 4I65A 5HGQA 1STGA 3KBGA 2JA7G 1PYWD 2JK8A 5I6WA 3MXUA 1K3RA 2FXQA 4OWWB 2VQFL 1WTPA 5FO8B 4F8MA 1BBXC 2F4VH 3DWAA 4IUVA 2GN5A 2MFIA 2YTXA 4KLKA 1JJGA 5C44H 1M1KC 4QL5A 3FKIG 1HNXL 2CTEA 3GP7A 2YQRA 1KNAA 4N8FA 1IBML 1X3PA 4EVOA 3QB3A 1JB7A 4AH6A 1VCIA 2A6HC 3EQLC 1K9MC 5CV8A 2L11A 5LMNQ 3S14H 2BA0A 3TMEA 2A1AA 4LF5L 3NWSA 4XDXA 4JOIA 3Q24A 4OWTB 1WJJA 4HMIA 1BVSA 1TWHH 4BBSG 4JYAQ 1KNEA 3TP6A 4R4QA 4JC0A 1EIYB 3S17H 5IP7H 3SGIA 2QILA 1EFWA 1II3A 3NWTA 1VQ7A 2P5ZX 3J81W 1JQYD 4FF4A 3EIVA 1TR5A 2ASBA 4NXNH 1AH9A 4RWSC 1LT4D 4ZQ3A 2QGQA 1Y1VB 1SRUA 3S1RB 1Y1WB 5C4JH 5C5MA 3HRZC 3RLOA 5I6YA 2R93G 1XWEA 2I5MX 4IPHA 4DPGA 1L1OA 3NP8A 2F03A 1YBYA 1HR0Q 4IQZA 4CJ0B 1VBIA 2R7ZH 4EQOA 5KEEA 5JVH3 1DT4A 1JWUD 4JI8L 4OELB 3TBIB 4HCEA 3GTGB 1XTCD 3MFGA 4A3KB 1S5CD 2EXDA 2K5WA 2ID0A 1K0SA 2Z4IA 1KXLA 1GOZA 3M7GA 1F0XA 3PO2G 3ULLA 4IUTA 1Q86C 3GTJB 1TUAA 4B3RL 2QF7A 3SXHA 1GJXA 5C5LA 4DK3C 2B8GA 4KKSA 1NUCA 2UUBL 4DR7L 4LK1C 3QWNA 4UP9A 4U68A 3PUXA 3F2DA 5ELNA 1EU3A 2O5IC 4MZ9A 4A3FG 2N78A 3TREA 4JI5Q 4G7ZC 2B2UC 1W6JA 3I70A 1T9HA 2VNUD 4JI0L 3F1ZA 2IHFA 1I6HH 4NZTM 2CFMA 4DF7A 3GQBA 4KY6A 3S1MB 1ONLA 1TQOA 4OX9Q 3V69A 1BKBA 1STEA 3CQZH 2XGTA 4DAMA 1U4MA 5C0XJ 4F7XA 3VYUA 5FOBB 4MTNA 1H9KA 1N34L 4CBVA 1NNXA 2B2VA 1BR9A 1V1PB 3B6YA 4BA1I 1WTVA 1QVCA 2KOLA 3P7JA 1EQVA 4QQBX 2H1EA 3G71A 3RUZA 1LTTD 2KJXA 3J7AK 4HMJA 1IL8A 1VQOA 2B2TA 2M00A 1RDPD 2QA4A 1VQFA 2VW9A 2PZTA 1S3OA 1Y1WH 1AP0A 2EY2A 2B39A 3CU7A 1IL2A 4IALA 5C3EB 3P1HA 3LNNA 3FPPA 2PQEA 4P75A 2JJQA 1CSPA 3J81E 4ZRZA 1HR0W 5ELEA 1RCVD 3UDFA 2XWBB 1SYCA 2NZOA 1TS2A 4C3JB 1BO0A 5AJ3Q 4WFN3 3L2PA 1YIJA 2HDLA 1BCPC 1X4MA 4MN3A 4YHHL 1FR3A 1N8RC 1DYQA 1UUPA 2LMCB 1CKMA 3KJPA 1SFOB 4ME3A 4LF7Q 4A3KH 5BR8H 4XQJA 2D2CC 4DV5Q 4HJ9A 4DV4L 4X64Q 3TP5A 1B1ZA 4K0KL 1EIGA 1KRTA 5ELDA 1BUVT 4A3JB 3T1YL 5A2QW 2ES2A 4B3SQ 1FKAH 4DV1L 4RG1A 1MJCA 4RMFA 1IBLQ 1Q90A 3OTOL 2OTLA 4G4KA 1OXTA 1FNVA 3I8ZA 2MHVA 1Q8KA 4XQNA 3DLLA 1DTJA 3K8AA 1N33L 2O2LD 3AYHB 3GTQB 2NWGA 2AWOA 2B29A 4MTKA 4DN4M 3S1MH 3U1KA 1HNWH 4DXGA 1ZYRD 1S03G 4X62Q 4KY5A 4H13C 5C44G 3CCMA 4X3TA 5IT9W 2ZTEA 3CC4A 3KBXA 3S1NH 4ME5A 4Q5VA 4JV5L 3RF2A 4OO1G 1TT2A 3MXGA 1YEZA 4NXMQ 3IL8A 2JA8H 3M4OB 1RHPA 2ZJRA 1XNQL 4XYQA 2BDNA 4JI1L 3D6CA 5JEAH 1AEXA 1J9OA 5M5WB 1Z7TA 1X9NA 5JPNC 2O5JC 4GKKL 5M3MG 5IP7G 4AYBB 4LFBH 4NKLA 2KBNA 1I4QA 2ICEC 3IFDA 1PYBA 3G4SA 4JI7L 1PTOF 3AFPA 1MD2D 3QG1A 4DGZA 3CXCA 1Q8IA 4LUZA 1SBBB 2A8VA 1BQQT 3U9OA 1D1IA 3A5UA 2WB1B 2KA7A 5K36G 3VYRA 3KLSX 4KTAA 4J15A 2DJFC 3TZDA 2N49A 1KHMA 3NPPA 5J39A 3UI2A 4G7HC 1LTSD 2CPMA 2Z8LA 4BXXH 2QNDA 4R8NA 4LF6Q 1IHZA 4A3JH 2A6EC 3T1HQ 1VQCA 4IPCA 1HNZH 2OWOA 4RH6A 1LACA 4IFDI 1XPRA 3TRZA 2AKWB 4DR1L 4DKAC 1N36L 5IP9H 4JI2Q 1LTBD 4KHPQ 1XNRH 4AYBE 2F0SA 5M3FH 2E8GA 1X3FA 1FNUA 2B2UA 4CHTB 4BY7G 5A2QE 1TS3A 2ICIA 4DR4Q 4CGYB 3A8IE 2EYOA 4IO9A 2JZXA 1ASZA 2WB1E 3I73A 2V1CC 1W3SA 3EN2A 2NVQB 2CW0C 1GHJA 4DR2H 3VR2A 2MGSA 2K04A 2RDFA 5IWAH 4JBMA 1CA6A 3GTKB 4PNYA 1VQKA 4HTHA 1S72A 3KDFB 1XMQQ 3M4OH 2JA7B 2F0GA 1DCZA 4P74A 5IT9E 5GAHC 1N32L 1ZTGA 3AEVB 5FLXL 5F2DA 3CCSA 4B3MQ 2UU9L 3RNUA 3FP9A 1SYDA 3DWQA 4YY3H 2XWJB 1PMRA 1KD1C 1K83B 2CKZB 3KUPA 3BZKA 4DUYL 3N6RA 1QOHA 4NP5A 2YTYA 4C2MH 2R7DA 2XSCA 5CV7A 2YU9B 1JWMD 1BXTA 1FJGH 1VQJA 4DV6Q 4RCOA 4Y52H 4DV2H 4JI5H 1KDAA 1NTGA 4EX5A 2IL8A 1DONA 2QCPX 5CV4A 3MFYA 1LM0A 5HY6A 5CR3A 1IKMA 4ZUIA 1EYGA 1OXXK 3I90A 2EYPA 2OQ0A 2CTKA 2HQLA 3A7LA 5EQ0A 3C1FA 2WIIB 4OIJA 1K73C 3HOXG 5D3IB 4Z9CB 2MJ8A 3DUZA 5GQOA 4K5WA 4X3SA 2VQFH 2VUMG 3M3YB 3ER0A 1I4RA 2F4VQ 5C0XG 2HIVA 2A73B 2RCNA 1MBYA 2LSSA 1XYIA 4HCSA 4BA2I 2KHJA 3EROA 3P20A 2PQAA 3KF8A 1DOKA 4A3BG 2LRRA 1HNXH 4TQUS 1IBMH 2AUKA 2D62A 3CW2C 2R93B 3J81c 4B9XA 5BN3A 2JQOA 2NVQH 3R8BA 1RF2D 4G7OC 1OXUA 1G2TA 4RGNA 1Z9FA 4DK1A 4LF5H 4BBRH 4QUFA 1QG7A 2SNMA 3OWFA 3D4RA 3NHHA 5EKKA 3GO5A 3F2UA 1PZID 5T1GA 1VQNA 3PGZA 1L0YB 2JA7H 1FGUA 2ENBA 4JI6L 3VKEA 2ZM6L 3BJUA 5LMUH 1NR2A 4DV5H 3GD7A 1A2TA 2PW5A 2Z9HA 3LX0A 2WP8J 4NXNQ 2LS01 4ALPA 1K83H 2EYJA 4A3FB 1JT8A 4J6HA 1SSOA 2Q2IA 2JA8G 3GABA 1F2MA 3GV3A 2F0WA 2XRQD 1CUKA 3FKIH 1GUNA 1D8LA 2IWHA 1SMYC 2K1HA 1IBLH 1R4PB 3E9IA 1SNMA 1UE6A 1QWYA 4PV1C 1WI5A 3J80W 1LTLA 5EJWA 4JI8H 1J5KA 1I4PA 4HJAA 1Y8NB 3EZJA 1TY0A 1DGSA 1J6QA 2MP1A 2SDFA 1ET6A 1HA5A 4BBSH 2VB3X 1K8AC 1EQRA 2M8WA 3N52A 1JR0D 4B3RH 3PUZA 1ZZKA 4JOIC 3WOFA 1C7YA 4R4TA 4UY8C 2UUBH 4DR7H 4OEMB 2ZXPA 4BXXG 4LIJA 1MSHA 1EEID 3KYHC 4LUVA 3I4NH 3CC7A 3VR3A 3A8KE 4RCNA 3GDEA 1Y8OB 4NXMH 3D4WA 5BN5A 4JI0H 2R3ZA 3S15B 4EQ5A 1ICWA 2CH4W 2QDBA 4O1NA 3E0JA 3ND8A 5K5PA 4JI4L 3T51B 4DV0L 3LWUA 5IE8A 2F52A 4DAPA 2ZQEA 1EQTA 1HJPA 4DU9A 5C3XA 2NN6I 4EQNA 1L1OC 1BOSA 4FJSA 4BY1H 4FNFA 3MXNB 3KLRA 1WTRA 1N34H 3S2DH 3K5OA 1SYEA 3SE0A 4P73A 4LMQD 3KLSA 1JJ2A 3L0OA 1X0AA 1VQBA 4DR6L 4LF9H 3PO2H 1E3PA 1NY4A 4DV3L 3DM1A 3CRLC 3PQIA 2C9OA 4WJ4A 3HOZG 1NSNS 2Q8IB 1G2SA 2JA9A 1XTDA 4PZ6A 4V190 2EIFA 2RQXA 4A3FH 2NZHA 1QZGA 4X6AH 1RTOA 2WV6D 3KF6B 5BN4A 1KLGD 1CZGA 2UXDL 3E3XA 4DNIA 3RZDH 3RZOB 2F0JA 4APVA 3C1EA 3NBHA 4YHHH 4QF4A 4IOAA 1NMGA 4QGUA 4A3LG 5C44B 1PQXA 2K28A 3VYSA 1T5XD 2PW7A 2ZXOA 5BR8Q 3JAML 5LMNL 3GTPH 1Q46A 2KCNA 2DGRA 1B9MA 5FLXW 4IUPA 5CGKA 2PCFB 1WTJA 4DV4H 2PNHA 2EY1A 2ZTDA 3J80E 4DR3L 2UXBL 5JJLA 3S14B 1G51A 2IY5B 3HOWH 3T1YH 2BCOA 2UXCL 1HPCA 4GOPA 2Q2HA 1MKHA 2FJ2A 1WTWA 1UG8A 3OTOH 3I7FA 1TY2A 1TWHB 4KN4C 2FMRA 4IPGA 3BDCA 3U4ZA 3A0JA 1N33H 1F9PA 2D5DA 3S15H 4R9WA 1PTOB 3QJYA 2MUYA 3K6OA 1WTHA 2B2TC 4KY7A 1Q1EA 4LF8Q 2L12A 1EIHA 2RDHA 1HNWQ 4FJUA 1A3VA 4IURA 5IGBA 2PQUA 2RSOA 1AFPA 5DM73 5IODA 2UUCL 5JJIA 3MA2B 1IW7D 5C4JB 1X32A 5KGUA 1ENCA 5M9OA 3VR4A 3ONAB 3W5OA 3CRKC 1YNJD 3URYA 2XVSA 4WORA 1HQMC 1M8AA 2Q2TA 5FLMG 4JPBW 4LJZC 1MJEA 4KJNA 2V4DA 5A35A 4ZK9B 2A69C 1XMOL 5CV9A 2G5DA 1F2ZA 2RHSB 2CWAA 3Q6SA 4M1UB 4LFBQ 1KLUD 5C4HA 2QEJC 1FYCA 1BCPF 2JYOA 4JI7H 3G6JB 1TWAH 3RZOH 1J5EQ 1ET9A 4IFDH 2CQAA 4OD6A 1A8VA 2LTMA 1SYBA 4RHRA 4EQPA 1F9QA 2HHHL 4R8IA 2K33A 2HQEA 3C3LA 4H7BA 2BE5D 4YCVA 1AE2A 1QE6A 1VF7A 3K5MA 1I6HB 2MNAA 3H3VI 2RF4A 1PTOD 4HIDA 4OO1H 4LFCL 1EUJA 2GVBA 2B63G 1Z47A 3UE1A 2OQKA 1BF4A 2F0NA 3CQZB 4POFA 3K81C 1HNZQ 3NUCA 4KD4A 4KHZA 3ERQA 5L37A 4RHSA 4DR1H 3A8JE 5FLXE 1X4NA 3NBIA 5ELBA 1N36H 2Q8TA 3D8GA 1I4GA 1XNRQ 5M3MH 3CCJA 4GNXB 4KKTA 2G9DA 5C3WA 1KAAA 1PTOH 2DUDA 1SXTA 3K57A 3JAMi 5M5XH 2KVMA 1V8CA 1G6ZA 3I4NG 2PO4A 4KMUC 2LKVA 1X3GA 2N88A 3NENA 2KUMA 5K36H 4DR2Q 2AXYA 3HP3A 1WFQA 4V0BA 1TKWB 5IWAQ 3J7YW 1VF5C 4GLXA 1WCMG 2K50A 2DY8A 4X66L 4U673 1RL2A 1SN8A 4B3TL 3HOXB 4BY1G 1N32H 3EBEA 2F0EA 3GKUA 5I4DA 3HG9A 2UU9H 2KCCA 4LF4L 1B4OA 2VUMB 4AM3A 3ULPA 1EC6A 3STBD 4YY3Q 4O42A 3CKIB 3OMGA 2EQSA 2X6GA 4L5QA 4WJWA 4DUYH 4BY7H 1IYUA 1Q12A 3T56B 4A3BB 2ZJPA 1C9OA 1CKNB 5CV6A 5FKAC 1EEFD 3CCRA 1FJGQ 4A3DG 1LO5D 2B3GA 1CFMA 2K5DA 3L3OC 4DV2Q 3F2BA 3RMHA 2NUCA 5LHY1 1STYA 2K5NA 5IGFA 1AN7A 1SROA 4GN3B 3H3VC 3FDTA 4OL7A 1EWCA 1SE2A 1EIFA 2F1MA 5IGGA 1PH3A 2L4NA 2IW3A 3ITPA 3D0FA 2VQFQ 3S1NB 1W6KA 2VXWA 3I0PA 1O7IA 2I46A 4AQYL 4LFAL 5ISRA 4GKJH 1W2BA 2CPQA 3WOEA 3HOWG 3HOUG 2DJGC 2BH2A 2JA8B 2VY3A 1HNXQ 1IBMQ 1CKOA 1E22A 3A54A 4TKOB 5JOBA 3K59A 4A4IA 2JA5H 4B8TA 1A0IA 4DXFA 2DGYA 3MEHA 3FEWX 1SLJA 4HR7B 4IJHA 1LUZA 2OT2A 1E2VA 1U5KA 4M8AA 4LF5Q 4N9TA 4K6LA 4FXKC 1L0WA 2IX3A 4NZRM 1G291 2HT1A 5C4ZA 3J80c 3K58A 2ZM6H 2F0KA 3QOJA 3HOXH 5J3BA 1Z6HA 1EYDA 1E2WA 5LMUQ 3VA7A 1S40A 4A3GG 1AW7A 2WKCA 2KCMA 4JVZA 4P2CB 4OWXB 2VUMH 2YYZA 5EKIA 4E6IA 4I7AA 4QY7A 1SE8A 1G6PA 2VQEL 1DOMA 4GLAC 5C0XH 1SE4A 1V1PA 2KEDA 3K0XA 4K8IA 1DOLA 4YWMA 5EPKA 3HGBA 1DJRD 4A3BH 1PDQA 2MPMA 2K5HA 2NZ1D 4C3HH 1D5XC 5M3FB 4JI8Q 1F9SA 2YV5A 3OPOA 2OTJA 4LF8H 1B44D 3HKSA 1LT5D 2F0DA 4OGQC 4IFDG 1JOQA 1B53A 3T13A 1XPOA 3MZ5A 4B8CD 3QOLA 4EC5A 1O7YA 3K7AH 1O7LA 1YHBA 2AUJD 4B3RQ 3MC0B 3BDLA 1EL0A 2UUBQ 4DR7Q 3FPUB 3SK6A 3CCVA 5M5YH 1PFNA 1FNWA 4DAYB 1BBWA 1LYLA 2D0PA 3PF5A 1PLFA 2EOTA 5KNBA 1U0LA 2NTTA 2YTVA 3CMAA 1ESRA 1VQ6A 4JI0Q 2K5QA 1LABA 1EY9A 2FMCA 1QILA 5C4XH 1GHKA 2CWPA 1EZ8A 1GM5A 1YNNC 3W3AA 4RGMA 3S2HH 1P8LA 1A3TA 4FF1A 4GS3A 2Z6KC 3HS0C 1Q81C 1J4WA 2P2RA 2A6HD 1J5EH 2K52A 1NR4A 4C2MB 4CDDC 1NJIC 3BZCA 1N34Q 2F0QA 4DUZL 4DR6H 4LF9Q 2LXKA 4FXDA 4FYDA 2IT1A 4C1NK 4ZKCB 1IBKH 4WRDA 1NMFA 1K8MA 3Q8DA 1B3AA 1VQGA 3C46A 2E5LL 2EJGC 1KQSA 5EBDA 1D5ZC 5FLXc 4I7ZC 2K7VA 2OPVA 5IGCA 1TS4A 4TVAB 1M4VA 4K2LA 1I4HA 4DR5L 3UDGA 3RN2A 3M9BA 2UXDH 1QVGA 4FF2A 4JI3L 3MTSA 2RHQB 2EPBA 2Z1CA 3HZXA 2FPHX 1HZCA 1PH4A 1RJTA 4YHHQ 3SR1A 4LW1A 4XIGS 5FJ8G 1RD9D 1BBUA 3TDQA 5CYUA 4DV4Q 4A3MH 1X65A 2L5TA 5KYLA 2NVYH 3I4OA 1UEAB 4DR3H 1U9RA 1UNSA 2UXBH 1KIXA 1U4RA 2Z0SA 1M90C 4QB4A 3T1YQ 3HOYH 3KDGA 5FK9C 2UXCH 5CBAE 2OEOA 4BBRB 1XX8A 3RN5A 3HOZH 1YNXA 2E76C 2PZUA 1TS5A 1G8ZD 4DV1Q 2RDGA 1J8IA 4N8X1 1SDFA 3PIOA 3OTOQ 3S24A 4X65H 3CMEA 1A6XA 4RKLA 4KKUA 5DAUA 4L5RC 1BCPB 1N33Q 3R93A 4L8JA 3GV6A 2X69A 2PI2E 1UAPA 2WINB 3SEBA 4UP7A 3CCQA 3RLNA 4A76A 1CI3M 2UUCH 4A3LH 3FKIB 3WDNA 2JA5G 4JV5Q 1E2ZA 4JBWA 1F2LA 1TWCB 2FINB 4C56C 4K8JA 1PRTF 3FMCA 4FDBA 1I50H 2WFWA 1VQ9A 3NK9A 2KHSA 4OXPA 4ZUJA 2PMZB 1XNQQ 1CTMA 3TQYA 2E2HH 4IUQA 5IYDH 4JI1Q 1XMOH 4K14A 4BBSB 3E0EA 1XJVA 4GKKQ 2PT7G 4LAAA 1EY5A 2AMCB 1B3QA 1UE1A 1FD7D 4GOPC 3KDFA 3M4PA 4JI7Q 4F88A 3EA6A 4IUUA 3RR5A 4AIMA 1HUNA 3HFZB 2IX0A 2JN4A 2K6AA 3I4NB 2AHOB 1D2BA 1S5DD 3SB1A 1TU2B 1SR3A 2NVXH 3PIO3 3NTKA 3E9HA 1BCPD 1HFGA 4CJ1B 3PV0A 4A3EG 2QEXA 1NXUA 1F2YA 4LFCH 4C3HG 4NB3A 4UPAA 3GTLH 4ZCKA 4KV6A 5FLMH 2OPUA 1WCMB 2BOSA 1R9TB 2OXPA 1KABA 1ENFA 2PMZE 1EU4A 4DR1Q 4BY1B 1YI2A 3VR6A 1N36Q 3S2DB 2E3UA 3PO3G 1AZPA 5JAVA 3PO2B 3KFUA 4K5VA 1H9SB 2Z6BA 3TN2A 2NTSA 4ULLA 2J4XA 4H8AA 2ZXRA 4H44C 3PSIA 3OSSD 2B2YA 5D14A 1N9WA 3EVQA 5J22A 3IFTA 4UAIA 2IX1A 2Z6KA 3R3OA 1HZAA 3K5NA 5C4XG 5DLQE 1TWCH 2Z4HA 1WVNA 1PA6A 3RZDB 2BA1A 3ND9A 2B63H 2IJ0A 2JEBI 2WACA 4R4CA 1VQLA 3DMUA 2ZT9C 1LT3D 4UHVA 3AU7A 4B3TH 4EGVA 1N32Q 1EFID 1AZQA 3GTPB 5IYCG 1E0BA 2GVAA 4RGOS 2UU9Q 1C48A 1NCVA 4UDUC 3HOWB 1AN8A 1JOKA 4DUYQ 2UUAL 3HOUB 2NVTB 1I3QH 4KJOA 2LFNA 2HD3A 1QZHA 2LTLA 3J81L 1C8CA 2I07B 2KHIA 5GAEC 5DT9A 2HCIA 1GUWA 2EE1A 2X06A 1HFNA 1WE8A 1STBA 2R92H 3GTMH 1SYFA 1X6OA 3H09A 5KIXA 3HOVH 4PMCA 2HH2A 4DV7L 4HSPA 4PMBA 1I94L 4R1JA 5KNDA 2SEBD 3QR8A 1WCMH 4R4OA 1R9TH 3DWPA 5C6AA 1KL9A 2EYFA 1TWFB 2CWFA 2K5VA 3TP8A 4QJFA 4A3MG 1U4PA 2PY9A 4AQYH 3OOCA 3S1QH 4LFAH 3SDZA 4GKJQ 2A19A 2EJMA 1NE3A 5COYA 3HOYG 1QUQB 2L55A 1PFBA 1PZKD 1V9PA 1VDZA 4J8QA 4LNQA 1STHA 3RLFA 4OHJA 5I9PA 5HGTA 4A3DH 1QJOA 3BVZA 3M4YA 4YCUA 1QCBD 1SJHD 1EOTA 3DEPA 3OMCA 4GNXC 4JBKA 1NAPA 2HCCA 1TWAB 3V96A 2K05A 1SNCA 1FL0A 2K14A 3BYTB 4L5SA 3KDKA 3F2CA 3I55A 4BS9A 3PUYA 2RCFA 2PPBC 2ZM6Q 4WJ3M 2WAQG 1SAPA 3V2TA 1CHPD 1Q3LA 4HJ7A 1V1QA 3OETA 1QNUA 3SK5A 4K0KH 3MXNA 2IPKD 3DEOA 2VQEH 1PFSA 4H0LC 4L6TB 4JYAL 1A63A 2CTLA 4K2KA 4A3IG 3HOUH 2SNSA 2NVTH 4DV1H 1ENAA 1SNPA 3OSOA 5IYDG 5E3FA 1ESFA 1ML0D 2L1BA 5EKLA 4FVMA 3NE5B 1JICA 1HRJA 5M3MB 2RBMA 2MJHA 2K4KA 3KF6A 4XYOA 2F0IA 3UE0A 5M5XB 2EY5A 3X3NA 3J7AV 2C35B 1YITA 1EZ6A 5IWAL 3J81j 1HR0L 1HHVA 3I4MG 1TWFH 2OCEA 1I5FA 1ZXTA 3VA5A 4A3GH 2KENA 1ZEQX 3P75A 1PH5A 1ODHA 4DA2A 1WHRA 1WD0A 1NBWA 5FO9B 5GROA 3CPFA 4YIJA 5IGEA 4QUCA 4JV5H 1B70B 1D5MC 1E1TA 2KEEA 2CH4A 2JA6H 5CC4A 3J81i 5E1FA 5D65A 5IIFA 3TS0A 2EYHA 4X3KA 2G8YA 2B2WC 3H15A 3ULJA 1XNQH 3UDXA 1E24A 1HZ9A 4KN7C 4JI1H 5A2QL 2DN8A 1VS0A 2VL6A 1EYCA 4ILWA 4GKKH 4MIUA 4HIMA 1O78A 4WANA 3PMFA 4CDCC 4CDEC 3Q23A 4KHVA 4JI5L 2JEAI 1PXUA 4BY7B 2L0CA 3Q0AA 1ZYRC 2K03A 1PH2A 4OCHA 1C0AA 3M4QA 2AWNA 3LWEA 1Q1BA 4NW2A 1DZ1A 4DR6Q 1VQAA 2QW7A 3OHXC 4OX9L 3CCUA 2RKSA 1OXVA 1IBKQ 3JC66 4Y7NH 2E5LH 4IJLA 4PZ8A 4QCLA 3NQTA 3MWYW 5IT9L 3J7ZC 3CAMA 5H1SE 4P71A 4MHEA 4RKBA 2F4IA 3T16A 5CBEE 2FMMA 4A75A 4ZLTF 1S20A 1IYVA 4YWKA 4DR5H 1YJNA 1STNA 3H0GH 2E2IH 2UXDQ 4JI3H 4C3IH 1L1OB 1X3QA 3IRBA 3CPWA 3OIPA 2AQ3B 3BU2A 1SMYD 1PFMA 1XRHA 4CKCA 1S5FD 3D3RA 1WTQA 4TRDA 4G08A 3AB9A 2OF1A 4K5XA 1VQDA 5DM63 1LV9A 3AQQA 4JW0A 3HEJA 4UP8A 3S16B 2JA5B 1PRTB 2K75A 3G48A 4DR3Q 4BWGB 4A3CG 2UXBQ 5AJ3L
chains in the Genus database with same CATH topology
1XPOA 1XPUA 3K7AH 1IBKL 1EYGA 1OXXK 2UXCQ 2R92G 1YHBA 2OQ0A 2CTKA 4B3RQ 2HQLA 3HOVG 4LF7L 1HH2P 5LMUL 4JI6Q 3CP0A 1K73C 3OYYA 1YZ6A 3I2ZA 3HOXG 4DV5L 2UUBQ 4X65Q 4DR7Q 4X64L 3AFQA 5GQOA 5M5YH 1IZ6A 3CCVA 4DK6C 3M85A 2VUMG 4DAYB 1BBWA 1HNZL 1LYLA 2D0PA 3ER0A 3PF5A 1UE7A 3K7UC 2F4VQ 1U0LA 2Y0SE 5C0XG 2KCTA 2YTVA 2HIVA 3CMAA 2RCNA 4JI0Q 1VQ6A 4B3SL 2LSSA 4AYBG 4BA2I 2KHJA 3F8TA 1XNRL 5C4XH 3PUWA 1IBLL 2PQAA 2CWPA 1PH8A 1GM5A 1QUQA 4A3BG 3WWVA 2UUCQ 4TQUS 4GNXA 3S2HH 1P8LA 2D62A 3CW2C 1K8GA 1B8AA 3J81c 1VQEA 2JQOA 4GS3A 3TEHB 5FJ8H 2Z6KC 4NPSA 2NVQH 1Q81C 1J4WA 2P2RA 4XTCS 1IXRA 1OXUA 1B7YB 2K52A 2WB1G 3DM3A 1Z9FA 1NJIC 4BBRH 3BZCA 1N34Q 4X62L 1Q82C 1PH9A 4DUZL 3GO5A 4DR2L 1VQ8A 4LF9Q 2LXKA 3D31A 2IT1A 1VQNA 5IT9c 3PGZA 5GAGC 3HKZG 1NMFA 3Q8DA 1FGUA 2JA7H 1VQGA 4JI6L 1YHQA 2E5LL 2UXBQ 1XMOQ 2ZM6L 3VKEA 1KQSA 3BJUA 4X65L 5FLXc 2UUAQ 4IFDJ 2OPVA 3GD7A 1PH7A 1H95A 2WP8J 3NELA 3VDYA 1RIPA 3U58A 4NXNQ 1VQ5A 2JE6I 1JE5A 4TVAB 4NXML 1Y14B 4ALPA 4DR5L 3UDGA 1K83H 2H5XA 4GLVB 4JG2A 3RN2A 1JT8A 2Q2IA 2JA8G 3M9BA 4YY3L 4POGA 1QVGA 1EC6A 4JI3L 1CUKA 3FKIH 2RHQB 2HHHQ 1KRSA 1D8LA 4H02A 1HZCA 1PH4A 3E9IA 1AE3A 2I5HA 1UE6A 4YHHQ 5LMNW 1WI5A 4DV7Q 4JI4Q 3PUVA 2BH8A 1LTLA 4DV0Q 1I94Q 3S16H 4JBJA 2I5LX 4LW1A 1FJGL 4LFCQ 1VIGA 1KC8C 1J5KA 2R7FA 4XIGS 5FJ8G 4HJAA 1YJ9A 4DV2L 1CKNA 1GD7A 1BBUA 1DGSA 1J6QA 3CCEA 4DV4Q 1X65A 4HIOA 4A3MH 2NVYH 3I4OA 1WOCA 4BBRG 4A93H 1D7QA 1JJCB 4LF9L 4PMWA 1KIXA 3G6EA 4BBSH 4IPDA 2Z0SA 1K8AC 3MEFA 3T1YQ 1M90C 2VZAA 1EQRA 3HOYH 3ICEA 3ZJYC 4P72A 4DV3Q 3RN5A 3HOZH 1YNXA 3PUZA 4DV1Q 1ZZKA 4JOIC 5HGQA 2JA7G 3PIOA 4LF6L 1X56A 1C7YA 2JK8A 3OTOQ 4R4TA 4UY8C 3S24A 1K1GA 4BXXG 3CMEA 4LIJA 1K3RA 1Y1VH 2FXQA 3S1RH 3T1HL 4OWWB 2VQFL 4L5RC 3KYHC 2ATWA 4LUVA 1N33Q 3CC7A 3I4NH 3GDEA 2Y0SG 2JA6G 2GN5A 2MFIA 2PI2E 1FVIA 4JI2L 2YTXA 4KLKA 4O2DA 4EQ5A 4KHPL 5C44H 1M1KC 2E2JH 4QL5A 4UP7A 3CCQA 3FKIG 3RLNA 4A76A 4JVHA 1HNXL 4QMFB 2CTEA 2YQRA 4A3LH 1IBML 4JI4L 4DV0L 1JB7A 4A3EH 3GTGH 4DR4L 5IE8A 2F52A 1HJPA 4AH6A 1VCIA 3PF4A 2CTMA 2NN6I 2JA5G 1K9MC 5LMNQ 3S14H 4JV5Q 1L1OC 3OW2A 2BA0A 4JBWA 4BY1H 2A1AA 3MXNB 4X66Q 4LF5L 3GTJH 3S2DH 4JOIA 3ERSX 4FDBA 4OWTB 1WJJA 4P73A 5JEAJ 1I50H 2WFWA 3L0OA 4PZ7A 1JJ2A 1VQBA 1VQ9A 1BVSA 1OXSC 4DR6L 4A93G 4QIWE 4OXPA 3PO2H 4LF4Q 1TWHH 1E3PA 1NY4A 2MQHA 4DV3L 4BBSG 3PO3H 4JYAQ 1XNQQ 2D0OA 4JC0A 4R4QA 3TQYA 2E2HH 1EIYB 3PIPA 3S17H 1YJWA 5IP7H 4JI1Q 3SGIA 4WJ4A 3HOZG 2CQOA 1EFWA 5IYDH 3E0EA 4KI0A 5IY0A 1XJVA 4GKKQ 2JA9A 1XTDA 1VQ7A 1XMQL 2AMCB 4PZ6A 2EIFA 1UE1A 1PHJA 4GOPC 4YWLA 2N8NA 4A3FH 3KDFA 3EIVA 3M4PA 4JI7Q 2NZHA 1QZGA 2ASBA 4B3ML 3RR5A 4AIMA 4X6AH 1AH9A 3KF6B 1VQ4A 3HFZB 2QGQA 1SRUA 3CC2A 2IX0A 2UXDL 4DNIA 5C4JH 1MIUA 2AHOB 3H0GG 3RZDH 3RLOA 2R93G 2I5MX 4DPGA 4IPHA 2IHEA 1L1OA 1SR3A 4APVA 2NVXH 1L2FA 1YBYA 1HR0Q 4IOAA 1NMGA 3E9HA 4QGUA 2R7ZH 4A3LG 3PV0A 4A3EG 2ZJQA 2QEXA 1DT4A 1PYSB 5BR8Q 3GTPH 5LMNL 1Q46A 4JI8L 4DV6L 4NB3A 3CD6A 2DGRA 4UPAA 3GTLH 2PNHA 5FLMH 2ZTDA 5IYCH 4B3TQ 2EXDA 1SMXA 2OPUA 2ID0A 4DR3L 1VQHA 1PH1A 1KXLA 2UXBL 5JJLA 2MO1A 1G51A 2IY5B 2PMZE 1EOVA 4AQYQ 3HOWH 4DR1Q 4LFAQ 2UXCL 1YI2A 4GOPA 2Q2HA 1N36Q 3ULLA 3PO2G 1Q86C 1MKHA 2E3UA 3PO3G 4B3RL 1TUAA 4LUOA 1JMCA 1HZBA 4DK3C 3I7FA 2FMRA 5C3EH 2UUBL 3L7ZC 4DR7L 3KFUA 4IPGA 4UP9A 3I56A 3CCLA 3F2DA 3PUXA 3U4ZA 2ALYB 3A0JA 5ELNA 3S15H 4MZ9A 4A3FG 1EQQA 2N78A 4LWCA 4R4IA 2F4VL 3TREA 4C3JH 4JI5Q 1Q1EA 4LF8Q 3PSIA 1T9HA 2VNUD 4O0AA 4IOCA 4JI0L 3F1ZA 3LGJA 2IHFA 1I6HH 1SFOH 1HNWQ 2PQUA 2CFMA 1N9WA 3KOJA 2IX1A 2Z6KA 1JJGA 1HZAA 5IYBH 2UUCL 5C4XG 5JJIA 4OX9Q 5DLQE 1OTCA 3V69A 1BKBA 1TWCH 1WVNA 1PA6A 2BA1A 3CQZH 2B63H 2R7ZG 2XGTA 4DAMA 3W5OA 2JEBI 4R4CA 1GVPA 5C0XJ 1VQLA 2CCZA 3UDIA 2WAQE 2XTIA 4MTNA 1N34L 2Q2TA 4K0KQ 3A5ZB 5FLMG 1N32Q 3B6YA 4BA1I 5IYCG 2ZTCA 2VQEQ 1MJEA 2GVAA 1QVCA 2UU9Q 1VQIA 4QQBX 3G71A 3GTOH 1UE5A 1XMOL 4JVYA 1VQOA 2RHSB 2CWAA 3GTQH 4DUYQ 2UUAL 2QA4A 4LFBQ 1VQFA 2VW9A 1S3OA 4OO1I 1Y1WH 1I3QH 1KHIA 1TWAH 4NXNL 1ZZJA 1QZHA 1IL2A 3RZOH 1J5EQ 4YCWA 4P75A 2JJQA 2KHIA 1A8VA 5GAEC 1CSPA 3W1BA 1HR0W 3UDFA 2HHHL 1WE8A 2NZOA 2PI2A 2R92H 5AJ3Q 3L2PA 1YIJA 1X4MA 3GTMH 1X6OA 4YCVA 4YHHL 1N8RC 3HOVH 1AE2A 2HH2A 4DV7L 1CKMA 3KJPA 4R1JA 2MNAA 1I94L 3H3VI 2RF4A 4ME3A 4LF7Q 4HIDA 4A3KH 1WCMH 4R4OA 1EUJA 2GVBA 4LFCL 1R9TH 2B63G 4NBQA 1Z47A 4DV5Q 4HJ9A 2CTFA 1KL9A 3UE1A 4DV4L 2OQKA 4X64Q 2HIXA 2K5VA 4K0KL 4QJFA 4A3MG 1KRTA 4POFA 1GKHA 3K81C 5M5WH 1HNZQ 2PY9A 4KHZA 1QVFA 3S1QH 3T1YL 4A3IH 4GKJQ 1X4NA 1UWVA 2ES2A 2A19A 3W1GA 1NE3A 2PQAB 4DV1L 4B3SQ 3KF8B 3HOYG 3NEMA 1QUQB 4RG1A 1XNRQ 5M3MH 3CCJA 1MJCA 4RMFA 4GNXB 1IBLQ 1V9PA 3OTOL 2OTLA 3H3VH 5JJKA 2DUDA 4LNQA 1OXTA 3RLFA 1Q8KA 1DTJA 3DLLA 3K8AA 3JAMi 1N33L 4A3DH 3AYHB 1Y1VG 3J80i 5M5XH 4HJ8A 1Y1WG 4YCUA 1X54A 3I4NG 2AWOA 2B29A 4GNXC 3AEVA 4JBKA 3S1MH 1X3GA 3U1KA 3NENA 4X62Q 4DUZQ 4DR2Q 1FL0A 2AXYA 5C44G 1WFQA 2K14A 5E7NA 3CCMA 4L5SA 3I4MH 3F2CA 5IWAQ 3I55A 3PUYA 3KJOA 4MNOA 2ZTEA 3CC4A 3PCOB 3S1NH 2E5LQ 2ZM6Q 4WJ3M 4GLXA 4A3KG 2WAQG 1WCMG 2K50A 4OO1G 4JV5L 3U50C 1GO3E 4X66L 4HJ7A 1V1QA 1RL2A 1SN8A 1UEBA 4B3TL 4BY1G 3EBEA 3U4VA 1YEZA 4NXMQ 1E1OA 1PFSA 2I0QA 2VS1A 2JA8H 4GKJL 4LF4L 4DR5Q 1A62A 4JYAL 4GN5A 1A63A 4AM3A 2CTLA 2ZJRA 3KLWA 3ULPA 4A3IG 1XNQL 3STBD 4YY3Q 2NVTH 3HOUH 4JI3Q 1P16A 4JI1L 2BL5A 1EWIA 2HH3A 2CTJA 2EQSA 1X9NA 1VQPA 2JVZA 4GKKL 4L5QA 5IYDG 5M3MG 5IP7G 1KAWA 4BY7H 2KBNA 4PG3A 1PYBA 1Q12A 1VIHA 3G4SA 2NN6G 2ZJPA 4JI7L 1C9OA 3AFPA 1CKNB 2R6GA 3CCRA 1FJGQ 4A3DG 4HJ5A 2MJHA 2B3GA 4OONA 3CXCA 2K4KA 4DV2Q 4LUZA 3KF6A 3F2BA 2A8VA 3UE0A 3A5UA 3A74A 2K5NA 3GTKH 1SROA 5K36G 4GN3B 2C35B 1YITA 1PVOA 5IWAL 3K80C 4J15A 3J81j 1HR0L 4WALA 1YHAA 2N49A 3I4MG 1KHMA 1TWFH 2OCEA 1EIFA 2MO0A 1I5FA 5BR8L 4BXXH 1PH3A 4A3GH 2KENA 5GADC 1PH5A 2QNDA 4LF6Q 1NBWA 5GROA 3CPFA 1ASYA 4A3JH 1B70B 1E1TA 3T1HQ 3D0FA 2VQFQ 1VQCA 4IPCA 2JA6H 3J81i 2OWOA 1TWGH 3TS0A 1O7IA 1XPRA 4AQYL 2AKWB 1PH6A 3TRZA 4DR1L 4DKAC 4LFAL 3CF5A 2N3SA 1VQMA 5ELOA 1W2BA 5IP9H 1N36L 2CPQA 4JI2Q 3H15A 3HOWG 3ULJA 3UDXA 1E24A 3HOUG 4IFDI 1HZ9A 4KHPQ 4AYBE 2YU9H 1VS0A 2VL6A 5JEAG 5M3FH 2BH2A 2E8GA 2VY3A 1HNXQ 1X3FA 1IBMQ 2F3IA 4JCVE 1K0RA 1CKOA 4HIMA 4BY7G 1E22A 2JA5H 4DR4Q 5C3EG 4A4IA 4B8TA 3TS2A 4WANA 1A0IA 1E7ZA 2DGYA 1SLJA 4JI5L 1YVCA 2JEAI 1Q7YC 4IJHA 4IO9A 4LF8L 1LUZA 2JZXA 1ASZA 1U5KA 2WB1E 1PH2A 2V1CC 4LF5Q 1C0AA 3M4QA 1W3SA 5C0XI 3EN2A 4A3CH 2AWNA 1HNWL 1Q1BA 1CSQA 3FHWA 1L0WA 4DR6Q 1VQAA 1IYJB 4OX9L 3JAMc 1G291 3CCUA 4JBMA 1OXVA 1IBKQ 3J80c 2HT1A 5IYBG 3JC66 4Y7NH 3HKZE 4IJLA 4PZ8A 3M3YH 3HOXH 1VQKA 5J3BA 3J7ZC 1S40A 3CAMA 5H1SE 5EAYA 5LMUQ 1S72A 4A3GG 4P71A 3KDFB 5HY6A 1TXYA 1XMQQ 2KCMA 4OWXB 3M4OH 2ANRA 2VUMH 2YYZA 4P74A 4A3JG 4QY7A 5GAHC 1SE8A 4A75A 1N32L 1ZTGA 3AEVB 3CCSA 1G6PA 4B3MQ 1ZZIA 2VQEL 4GLAC 2UU9L 3RNUA 2L15A 4YWKA 3FP9A 3STBC 3J7A5 3K0XA 1YJNA 3H0GH 2R93H 2E2IH 2UXDQ 4YWMA 4C3IH 5IP9G 1L1OB 1KD1C 3NBHB 3IRBA 4A3BH 3CPWA 2CKZB 1PV4A 3BZKA 4DUYL 3BU2A 4LFBL 5M3FG 2K5HA 2YTYA 1X55A 4C2MH 2R7DA 1X3EA 4C3HH 4HIKA 1V43A 1VQJA 4JI8Q 4DV6Q 1J5EL 2LXJA 1VQDA 2YV5A 4Y52H 3M7NA 2OTJA 4L5TA 1NTGA 3AQQA 3HKSA 4UP8A 4EX5A 2Q2UA 4IFDG 2K75A 3G48A 1LM0A 4DR3Q 4GN4B 1WYDA 2ANNA 4A3CG 4GOPB 5AJ3L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XPO A;  1XPU A;  3K7A H;  1IBK L;  1EYG A;  1OXX K;  2UXC Q;  2R92 G;  1YHB A;  2OQ0 A;  2CTK A;  4B3R Q;  2HQL A;  3HOV G;  4LF7 L;  1HH2 P;  5LMU L;  4JI6 Q;  3CP0 A;  1K73 C;  3OYY A;  1YZ6 A;  3I2Z A;  3HOX G;  4DV5 L;  2UUB Q;  4X65 Q;  4DR7 Q;  4X64 L;  3AFQ A;  5GQO A;  5M5Y H;  1IZ6 A;  3CCV A;  4DK6 C;  3M85 A;  2VUM G;  4DAY B;  1BBW A;  1HNZ L;  1LYL A;  2D0P A;  3ER0 A;  3PF5 A;  1UE7 A;  3K7U C;  2F4V Q;  1U0L A;  2Y0S E;  5C0X G;  2KCT A;  2YTV A;  2HIV A;  3CMA A;  2RCN A;  4JI0 Q;  1VQ6 A;  4B3S L;  2LSS A;  4AYB G;  4BA2 I;  2KHJ A;  3F8T A;  1XNR L;  5C4X H;  3PUW A;  1IBL L;  2PQA A;  2CWP A;  1PH8 A;  1GM5 A;  1QUQ A;  4A3B G;  3WWV A;  2UUC Q;  4TQU S;  4GNX A;  3S2H H;  1P8L A;  2D62 A;  3CW2 C;  1K8G A;  1B8A A;  3J81 c;  1VQE A;  2JQO A;  4GS3 A;  3TEH B;  5FJ8 H;  2Z6K C;  4NPS A;  2NVQ H;  1Q81 C;  1J4W A;  2P2R A;  4XTC S;  1IXR A;  1OXU A;  1B7Y B;  2K52 A;  2WB1 G;  3DM3 A;  1Z9F A;  1NJI C;  4BBR H;  3BZC A;  1N34 Q;  4X62 L;  1Q82 C;  1PH9 A;  4DUZ L;  3GO5 A;  4DR2 L;  1VQ8 A;  4LF9 Q;  2LXK A;  3D31 A;  2IT1 A;  1VQN A;  5IT9 c;  3PGZ A;  5GAG C;  3HKZ G;  1NMF A;  3Q8D A;  1FGU A;  2JA7 H;  1VQG A;  4JI6 L;  1YHQ A;  2E5L L;  2UXB Q;  1XMO Q;  2ZM6 L;  3VKE A;  1KQS A;  3BJU A;  4X65 L;  5FLX c;  2UUA Q;  4IFD J;  2OPV A;  3GD7 A;  1PH7 A;  1H95 A;  2WP8 J;  3NEL A;  3VDY A;  1RIP A;  3U58 A;  4NXN Q;  1VQ5 A;  2JE6 I;  1JE5 A;  4TVA B;  4NXM L;  1Y14 B;  4ALP A;  4DR5 L;  3UDG A;  1K83 H;  2H5X A;  4GLV B;  4JG2 A;  3RN2 A;  1JT8 A;  2Q2I A;  2JA8 G;  3M9B A;  4YY3 L;  4POG A;  1QVG A;  1EC6 A;  4JI3 L;  1CUK A;  3FKI H;  2RHQ B;  2HHH Q;  1KRS A;  1D8L A;  4H02 A;  1HZC A;  1PH4 A;  3E9I A;  1AE3 A;  2I5H A;  1UE6 A;  4YHH Q;  5LMN W;  1WI5 A;  4DV7 Q;  4JI4 Q;  3PUV A;  2BH8 A;  1LTL A;  4DV0 Q;  1I94 Q;  3S16 H;  4JBJ A;  2I5L X;  4LW1 A;  1FJG L;  4LFC Q;  1VIG A;  1KC8 C;  1J5K A;  2R7F A;  4XIG S;  5FJ8 G;  4HJA A;  1YJ9 A;  4DV2 L;  1CKN A;  1GD7 A;  1BBU A;  1DGS A;  1J6Q A;  3CCE A;  4DV4 Q;  1X65 A;  4HIO A;  4A3M H;  2NVY H;  3I4O A;  1WOC A;  4BBR G;  4A93 H;  1D7Q A;  1JJC B;  4LF9 L;  4PMW A;  1KIX A;  3G6E A;  4BBS H;  4IPD A;  2Z0S A;  1K8A C;  3MEF A;  3T1Y Q;  1M90 C;  2VZA A;  1EQR A;  3HOY H;  3ICE A;  3ZJY C;  4P72 A;  4DV3 Q;  3RN5 A;  3HOZ H;  1YNX A;  3PUZ A;  4DV1 Q;  1ZZK A;  4JOI C;  5HGQ A;  2JA7 G;  3PIO A;  4LF6 L;  1X56 A;  1C7Y A;  2JK8 A;  3OTO Q;  4R4T A;  4UY8 C;  3S24 A;  1K1G A;  4BXX G;  3CME A;  4LIJ A;  1K3R A;  1Y1V H;  2FXQ A;  3S1R H;  3T1H L;  4OWW B;  2VQF L;  4L5R C;  3KYH C;  2ATW A;  4LUV A;  1N33 Q;  3CC7 A;  3I4N H;  3GDE A;  2Y0S G;  2JA6 G;  2GN5 A;  2MFI A;  2PI2 E;  1FVI A;  4JI2 L;  2YTX A;  4KLK A;  4O2D A;  4EQ5 A;  4KHP L;  5C44 H;  1M1K C;  2E2J H;  4QL5 A;  4UP7 A;  3CCQ A;  3FKI G;  3RLN A;  4A76 A;  4JVH A;  1HNX L;  4QMF B;  2CTE A;  2YQR A;  4A3L H;  1IBM L;  4JI4 L;  4DV0 L;  1JB7 A;  4A3E H;  3GTG H;  4DR4 L;  5IE8 A;  2F52 A;  1HJP A;  4AH6 A;  1VCI A;  3PF4 A;  2CTM A;  2NN6 I;  2JA5 G;  1K9M C;  5LMN Q;  3S14 H;  4JV5 Q;  1L1O C;  3OW2 A;  2BA0 A;  4JBW A;  4BY1 H;  2A1A A;  3MXN B;  4X66 Q;  4LF5 L;  3GTJ H;  3S2D H;  4JOI A;  3ERS X;  4FDB A;  4OWT B;  1WJJ A;  4P73 A;  5JEA J;  1I50 H;  2WFW A;  3L0O A;  4PZ7 A;  1JJ2 A;  1VQB A;  1VQ9 A;  1BVS A;  1OXS C;  4DR6 L;  4A93 G;  4QIW E;  4OXP A;  3PO2 H;  4LF4 Q;  1TWH H;  1E3P A;  1NY4 A;  2MQH A;  4DV3 L;  4BBS G;  3PO3 H;  4JYA Q;  1XNQ Q;  2D0O A;  4JC0 A;  4R4Q A;  3TQY A;  2E2H H;  1EIY B;  3PIP A;  3S17 H;  1YJW A;  5IP7 H;  4JI1 Q;  3SGI A;  4WJ4 A;  3HOZ G;  2CQO A;  1EFW A;  5IYD H;  3E0E A;  4KI0 A;  5IY0 A;  1XJV A;  4GKK Q;  2JA9 A;  1XTD A;  1VQ7 A;  1XMQ L;  2AMC B;  4PZ6 A;  2EIF A;  1UE1 A;  1PHJ A;  4GOP C;  4YWL A;  2N8N A;  4A3F H;  3KDF A;  3EIV A;  3M4P A;  4JI7 Q;  2NZH A;  1QZG A;  2ASB A;  4B3M L;  3RR5 A;  4AIM A;  4X6A H;  1AH9 A;  3KF6 B;  1VQ4 A;  3HFZ B;  2QGQ A;  1SRU A;  3CC2 A;  2IX0 A;  2UXD L;  4DNI A;  5C4J H;  1MIU A;  2AHO B;  3H0G G;  3RZD H;  3RLO A;  2R93 G;  2I5M X;  4DPG A;  4IPH A;  2IHE A;  1L1O A;  1SR3 A;  4APV A;  2NVX H;  1L2F A;  1YBY A;  1HR0 Q;  4IOA A;  1NMG A;  3E9H A;  4QGU A;  2R7Z H;  4A3L G;  3PV0 A;  4A3E G;  2ZJQ A;  2QEX A;  1DT4 A;  1PYS B;  5BR8 Q;  3GTP H;  5LMN L;  1Q46 A;  4JI8 L;  4DV6 L;  4NB3 A;  3CD6 A;  2DGR A;  4UPA A;  3GTL H;  2PNH A;  5FLM H;  2ZTD A;  5IYC H;  4B3T Q;  2EXD A;  1SMX A;  2OPU A;  2ID0 A;  4DR3 L;  1VQH A;  1PH1 A;  1KXL A;  2UXB L;  5JJL A;  2MO1 A;  1G51 A;  2IY5 B;  2PMZ E;  1EOV A;  4AQY Q;  3HOW H;  4DR1 Q;  4LFA Q;  2UXC L;  1YI2 A;  4GOP A;  2Q2H A;  1N36 Q;  3ULL A;  3PO2 G;  1Q86 C;  1MKH A;  2E3U A;  3PO3 G;  4B3R L;  1TUA A;  4LUO A;  1JMC A;  1HZB A;  4DK3 C;  3I7F A;  2FMR A;  5C3E H;  2UUB L;  3L7Z C;  4DR7 L;  3KFU A;  4IPG A;  4UP9 A;  3I56 A;  3CCL A;  3F2D A;  3PUX A;  3U4Z A;  2ALY B;  3A0J A;  5ELN A;  3S15 H;  4MZ9 A;  4A3F G;  1EQQ A;  2N78 A;  4LWC A;  4R4I A;  2F4V L;  3TRE A;  4C3J H;  4JI5 Q;  1Q1E A;  4LF8 Q;  3PSI A;  1T9H A;  2VNU D;  4O0A A;  4IOC A;  4JI0 L;  3F1Z A;  3LGJ A;  2IHF A;  1I6H H;  1SFO H;  1HNW Q;  2PQU A;  2CFM A;  1N9W A;  3KOJ A;  2IX1 A;  2Z6K A;  1JJG A;  1HZA A;  5IYB H;  2UUC L;  5C4X G;  5JJI A;  4OX9 Q;  5DLQ E;  1OTC A;  3V69 A;  1BKB A;  1TWC H;  1WVN A;  1PA6 A;  2BA1 A;  3CQZ H;  2B63 H;  2R7Z G;  2XGT A;  4DAM A;  3W5O A;  2JEB I;  4R4C A;  1GVP A;  5C0X J;  1VQL A;  2CCZ A;  3UDI A;  2WAQ E;  2XTI A;  4MTN A;  1N34 L;  2Q2T A;  4K0K Q;  3A5Z B;  5FLM G;  1N32 Q;  3B6Y A;  4BA1 I;  5IYC G;  2ZTC A;  2VQE Q;  1MJE A;  2GVA A;  1QVC A;  2UU9 Q;  1VQI A;  4QQB X;  3G71 A;  3GTO H;  1UE5 A;  1XMO L;  4JVY A;  1VQO A;  2RHS B;  2CWA A;  3GTQ H;  4DUY Q;  2UUA L;  2QA4 A;  4LFB Q;  1VQF A;  2VW9 A;  1S3O A;  4OO1 I;  1Y1W H;  1I3Q H;  1KHI A;  1TWA H;  4NXN L;  1ZZJ A;  1QZH A;  1IL2 A;  3RZO H;  1J5E Q;  4YCW A;  4P75 A;  2JJQ A;  2KHI A;  1A8V A;  5GAE C;  1CSP A;  3W1B A;  1HR0 W;  3UDF A;  2HHH L;  1WE8 A;  2NZO A;  2PI2 A;  2R92 H;  5AJ3 Q;  3L2P A;  1YIJ A;  1X4M A;  3GTM H;  1X6O A;  4YCV A;  4YHH L;  1N8R C;  3HOV H;  1AE2 A;  2HH2 A;  4DV7 L;  1CKM A;  3KJP A;  4R1J A;  2MNA A;  1I94 L;  3H3V I;  2RF4 A;  4ME3 A;  4LF7 Q;  4HID A;  4A3K H;  1WCM H;  4R4O A;  1EUJ A;  2GVB A;  4LFC L;  1R9T H;  2B63 G;  4NBQ A;  1Z47 A;  4DV5 Q;  4HJ9 A;  2CTF A;  1KL9 A;  3UE1 A;  4DV4 L;  2OQK A;  4X64 Q;  2HIX A;  2K5V A;  4K0K L;  4QJF A;  4A3M G;  1KRT A;  4POF A;  1GKH A;  3K81 C;  5M5W H;  1HNZ Q;  2PY9 A;  4KHZ A;  1QVF A;  3S1Q H;  3T1Y L;  4A3I H;  4GKJ Q;  1X4N A;  1UWV A;  2ES2 A;  2A19 A;  3W1G A;  1NE3 A;  2PQA B;  4DV1 L;  4B3S Q;  3KF8 B;  3HOY G;  3NEM A;  1QUQ B;  4RG1 A;  1XNR Q;  5M3M H;  3CCJ A;  1MJC A;  4RMF A;  4GNX B;  1IBL Q;  1V9P A;  3OTO L;  2OTL A;  3H3V H;  5JJK A;  2DUD A;  4LNQ A;  1OXT A;  3RLF A;  1Q8K A;  1DTJ A;  3DLL A;  3K8A A;  3JAM i;  1N33 L;  4A3D H;  3AYH B;  1Y1V G;  3J80 i;  5M5X H;  4HJ8 A;  1Y1W G;  4YCU A;  1X54 A;  3I4N G;  2AWO A;  2B29 A;  4GNX C;  3AEV A;  4JBK A;  3S1M H;  1X3G A;  3U1K A;  3NEN A;  4X62 Q;  4DUZ Q;  4DR2 Q;  1FL0 A;  2AXY A;  5C44 G;  1WFQ A;  2K14 A;  5E7N A;  3CCM A;  4L5S A;  3I4M H;  3F2C A;  5IWA Q;  3I55 A;  3PUY A;  3KJO A;  4MNO A;  2ZTE A;  3CC4 A;  3PCO B;  3S1N H;  2E5L Q;  2ZM6 Q;  4WJ3 M;  4GLX A;  4A3K G;  2WAQ G;  1WCM G;  2K50 A;  4OO1 G;  4JV5 L;  3U50 C;  1GO3 E;  4X66 L;  4HJ7 A;  1V1Q A;  1RL2 A;  1SN8 A;  1UEB A;  4B3T L;  4BY1 G;  3EBE A;  3U4V A;  1YEZ A;  4NXM Q;  1E1O A;  1PFS A;  2I0Q A;  2VS1 A;  2JA8 H;  4GKJ L;  4LF4 L;  4DR5 Q;  1A62 A;  4JYA L;  4GN5 A;  1A63 A;  4AM3 A;  2CTL A;  2ZJR A;  3KLW A;  3ULP A;  4A3I G;  1XNQ L;  3STB D;  4YY3 Q;  2NVT H;  3HOU H;  4JI3 Q;  1P16 A;  4JI1 L;  2BL5 A;  1EWI A;  2HH3 A;  2CTJ A;  2EQS A;  1X9N A;  1VQP A;  2JVZ A;  4GKK L;  4L5Q A;  5IYD G;  5M3M G;  5IP7 G;  1KAW A;  4BY7 H;  2KBN A;  4PG3 A;  1PYB A;  1Q12 A;  1VIH A;  3G4S A;  2NN6 G;  2ZJP A;  4JI7 L;  1C9O A;  3AFP A;  1CKN B;  2R6G A;  3CCR A;  1FJG Q;  4A3D G;  4HJ5 A;  2MJH A;  2B3G A;  4OON A;  3CXC A;  2K4K A;  4DV2 Q;  4LUZ A;  3KF6 A;  3F2B A;  2A8V A;  3UE0 A;  3A5U A;  3A74 A;  2K5N A;  3GTK H;  1SRO A;  5K36 G;  4GN3 B;  2C35 B;  1YIT A;  1PVO A;  5IWA L;  3K80 C;  4J15 A;  3J81 j;  1HR0 L;  4WAL A;  1YHA A;  2N49 A;  3I4M G;  1KHM A;  1TWF H;  2OCE A;  1EIF A;  2MO0 A;  1I5F A;  5BR8 L;  4BXX H;  1PH3 A;  4A3G H;  2KEN A;  5GAD C;  1PH5 A;  2QND A;  4LF6 Q;  1NBW A;  5GRO A;  3CPF A;  1ASY A;  4A3J H;  1B70 B;  1E1T A;  3T1H Q;  3D0F A;  2VQF Q;  1VQC A;  4IPC A;  2JA6 H;  3J81 i;  2OWO A;  1TWG H;  3TS0 A;  1O7I A;  1XPR A;  4AQY L;  2AKW B;  1PH6 A;  3TRZ A;  4DR1 L;  4DKA C;  4LFA L;  3CF5 A;  2N3S A;  1VQM A;  5ELO A;  1W2B A;  5IP9 H;  1N36 L;  2CPQ A;  4JI2 Q;  3H15 A;  3HOW G;  3ULJ A;  3UDX A;  1E24 A;  3HOU G;  4IFD I;  1HZ9 A;  4KHP Q;  4AYB E;  2YU9 H;  1VS0 A;  2VL6 A;  5JEA G;  5M3F H;  2BH2 A;  2E8G A;  2VY3 A;  1HNX Q;  1X3F A;  1IBM Q;  2F3I A;  4JCV E;  1K0R A;  1CKO A;  4HIM A;  4BY7 G;  1E22 A;  2JA5 H;  4DR4 Q;  5C3E G;  4A4I A;  4B8T A;  3TS2 A;  4WAN A;  1A0I A;  1E7Z A;  2DGY A;  1SLJ A;  4JI5 L;  1YVC A;  2JEA I;  1Q7Y C;  4IJH A;  4IO9 A;  4LF8 L;  1LUZ A;  2JZX A;  1ASZ A;  1U5K A;  2WB1 E;  1PH2 A;  2V1C C;  4LF5 Q;  1C0A A;  3M4Q A;  1W3S A;  5C0X I;  3EN2 A;  4A3C H;  2AWN A;  1HNW L;  1Q1B A;  1CSQ A;  3FHW A;  1L0W A;  4DR6 Q;  1VQA A;  1IYJ B;  4OX9 L;  3JAM c;  1G29 1;  3CCU A;  4JBM A;  1OXV A;  1IBK Q;  3J80 c;  2HT1 A;  5IYB G;  3JC6 6;  4Y7N H;  3HKZ E;  4IJL A;  4PZ8 A;  3M3Y H;  3HOX H;  1VQK A;  5J3B A;  3J7Z C;  1S40 A;  3CAM A;  5H1S E;  5EAY A;  5LMU Q;  1S72 A;  4A3G G;  4P71 A;  3KDF B;  5HY6 A;  1TXY A;  1XMQ Q;  2KCM A;  4OWX B;  3M4O H;  2ANR A;  2VUM H;  2YYZ A;  4P74 A;  4A3J G;  4QY7 A;  5GAH C;  1SE8 A;  4A75 A;  1N32 L;  1ZTG A;  3AEV B;  3CCS A;  1G6P A;  4B3M Q;  1ZZI A;  2VQE L;  4GLA C;  2UU9 L;  3RNU A;  2L15 A;  4YWK A;  3FP9 A;  3STB C;  3J7A 5;  3K0X A;  1YJN A;  3H0G H;  2R93 H;  2E2I H;  2UXD Q;  4YWM A;  4C3I H;  5IP9 G;  1L1O B;  1KD1 C;  3NBH B;  3IRB A;  4A3B H;  3CPW A;  2CKZ B;  1PV4 A;  3BZK A;  4DUY L;  3BU2 A;  4LFB L;  5M3F G;  2K5H A;  2YTY A;  1X55 A;  4C2M H;  2R7D A;  1X3E A;  4C3H H;  4HIK A;  1V43 A;  1VQJ A;  4JI8 Q;  4DV6 Q;  1J5E L;  2LXJ A;  1VQD A;  2YV5 A;  4Y52 H;  3M7N A;  2OTJ A;  4L5T A;  1NTG A;  3AQQ A;  3HKS A;  4UP8 A;  4EX5 A;  2Q2U A;  4IFD G;  2K75 A;  3G48 A;  1LM0 A;  4DR3 Q;  4GN4 B;  1WYD A;  2ANN A;  4A3C G;  4GOP B;  5AJ3 L; 
#chains in the Genus database with same CATH topology
 1CQF A;  2M6Q A;  2UXC Q;  1B2T A;  2R92 G;  2JXM B;  1MSZ A;  1SNQ A;  2K1B A;  3W2D A;  3HOV G;  2XNA C;  4LF7 L;  5LMU L;  3CP0 A;  3OYY A;  1YZ6 A;  2VB2 X;  4DV5 L;  4X65 Q;  4X64 L;  3V05 A;  3NCV A;  3QIA A;  2QKI C;  4XT1 B;  4B3S L;  2HUG A;  2J0T D;  1CQV A;  1JCK B;  3PUW A;  4HAE A;  2C5C A;  1IBL L;  1D6E C;  1PH8 A;  1JOR A;  1H9R A;  3WWV A;  4K6D A;  2UUC Q;  4GNX A;  1EY8 A;  1K8G A;  1HQR D;  1XXG A;  2E2J B;  2L9H A;  3TEH B;  5FJ8 H;  4PDB A;  1IXR A;  4A3E B;  1LTR D;  2F0F A;  4ZKB B;  2NBF A;  4C3H B;  1TII D;  3S9W A;  2F0V A;  4X62 L;  3A56 A;  2E74 C;  1PH9 A;  4FO2 A;  1HXY D;  3D31 A;  3TP7 A;  1JWS D;  1JE4 A;  2XRS D;  5GAG C;  3HKZ G;  1H9M A;  4CJ2 C;  1WVL A;  2RA4 A;  1YHQ A;  2RSN A;  1XMO Q;  4IZ8 A;  4OIK A;  5CMD A;  1VMC A;  3PO3 B;  3K7A B;  2PYK A;  4ZAI A;  2AQ1 B;  1EY4 A;  1PRT D;  3X3M A;  3NEL A;  3VDY A;  1RIP A;  4L63 B;  3U58 A;  1VQ5 A;  2JE6 I;  4NXM L;  2A68 D;  1Y14 B;  1CA5 A;  1CHQ D;  2F3W A;  2M9V A;  5M5Y B;  4G57 A;  2HHH Q;  2KQ3 A;  1KRS A;  4H02 A;  2I5H A;  5EGT A;  3JAM W;  3D4D A;  5LMN W;  3PUV A;  3FRP B;  3S16 H;  4JBJ A;  4CKE A;  3I72 A;  5C4X B;  4LFC Q;  1IKL A;  2R7F A;  1CKN A;  1GD7 A;  3CCE A;  3S2H B;  1ICF B;  2XIW A;  4J1M A;  3T53 B;  1WD1 A;  4LF9 L;  4PMW A;  3G6E A;  4IPD A;  5CV5 A;  2RVL A;  2VZA A;  3BDO A;  3DHQ A;  4QIW B;  3ZJY C;  3ICE A;  1CZW A;  4JI6 H;  1U4L A;  4HED A;  4LF6 L;  1X56 A;  4GZY C;  1K1G A;  2G9H D;  2FFM A;  1Y1V H;  1LTG D;  3S1R H;  3CHB D;  1BDO A;  2B2W A;  3T1H L;  1MSG A;  2ATW A;  3TSS A;  2Y0S G;  2JA6 G;  1FVI A;  2K32 A;  2EDG A;  4JI2 L;  5EBC A;  4O2D A;  2A5H A;  1MI2 A;  4KHP L;  2E2J H;  4X3U A;  3J7A F;  3TZU A;  4JVH A;  2F0M A;  2F0L A;  3BS1 A;  4QMF B;  4B08 A;  4A3E H;  3GTG H;  4DR4 L;  4N9P A;  2D9U A;  2F0T A;  5E4X A;  4HN7 A;  1OO9 B;  2EY6 A;  3PF4 A;  5G3L D;  2B8F A;  5I9O A;  3OW2 A;  5KNC A;  2EZV A;  1STA A;  4X66 Q;  3FVQ A;  3UOE A;  3BG3 A;  5COR A;  3GTJ H;  3ERS X;  4B3T Q;  2CTM A;  5JEA J;  5IOC A;  3EJI A;  4PZ7 A;  1OXS C;  4A93 G;  4QIW E;  4RAU C;  4ABN A;  3A7A B;  4LF4 Q;  4A3M B;  2MQH A;  3SHL A;  3PO3 H;  1ZKO A;  2NVY B;  2D0O A;  3PIP A;  1YJW A;  2CQO A;  4KI0 A;  5IY0 A;  2A69 D;  1O7Z A;  3HOY B;  1XMQ L;  2UUA H;  2NN6 H;  3GTO B;  4XXE A;  1PHJ A;  3HOZ B;  4YWL A;  2N8N A;  4B3M L;  3NQI A;  1VQ4 A;  2HDM A;  3BVG A;  1CK1 A;  3CC2 A;  2O4C A;  1MIU A;  3H0G G;  1EYA A;  4TSS A;  2IHE A;  4C3I G;  1L2F A;  2DNC A;  2LF0 A;  4DV7 H;  5LL6 X;  4JI4 H;  4DV0 H;  1I94 H;  5ELC A;  2ZJQ A;  1ILQ A;  3E5S A;  1PYS B;  2B2Y C;  4F87 A;  4DV6 L;  3J80 L;  3VR5 A;  3CD6 A;  5IGD A;  3JAM E;  5NUC A;  2SOB A;  5IYC H;  2WAQ B;  1SMX A;  1VQH A;  3OWE B;  1PH1 A;  3H6M A;  2MO1 A;  2GA4 B;  4AQY Q;  1EOV A;  4LFA Q;  1GUS A;  1BNZ A;  4DV3 H;  3BVM A;  4LUO A;  1I50 B;  1S5E D;  1JMC A;  1HZB A;  5I2X A;  4A3I B;  1A3U A;  2WKD A;  5C3E H;  3L7Z C;  4DNR B;  3CCL A;  3I56 A;  2E2H B;  2ALY B;  2PNR C;  1EQQ A;  2DNE A;  4LWC A;  4R4I A;  2F4V L;  4C3J H;  4DAY A;  5LL6 S;  4O0A A;  2E75 C;  4IOC A;  1GUG A;  3LGJ A;  4CDF C;  1SFO H;  3AMU A;  3KOJ A;  3PIP 3;  2R61 A;  1LTA D;  1O80 A;  2NYZ D;  5IYB H;  1SEB D;  1OTC A;  1LLR D;  1MGS A;  4FXG C;  2R7Z G;  1G91 A;  2NB0 A;  2CCZ A;  2NVX B;  3I4M B;  1GVP A;  5LMN H;  3OW7 A;  2A1S A;  3NTI A;  3UDI A;  2WAQ E;  1RTN A;  2XTI A;  1X9Z A;  4K0K Q;  3A5Z B;  2ZTC A;  2VQE Q;  3H91 A;  3GTL B;  1VQI A;  4JYA H;  1K28 A;  3GTO H;  4IUN A;  1UE5 A;  2AQ2 B;  4JVY A;  1HCZ A;  3GTQ H;  3U9S A;  4OO1 I;  1KHI A;  4NXN L;  1ZZJ A;  1RKN A;  4RGT A;  1D1K A;  4YCW A;  4RA8 A;  1CM9 A;  3W1B A;  5DNF A;  5TSS A;  4HSV A;  2PI2 A;  4DK0 A;  1ROD A;  1HR0 H;  5EPJ A;  3ZYY X;  1C4Q A;  1K3B C;  1DD2 A;  4NBQ A;  1GUO A;  2X6L A;  2HIX A;  1SE3 A;  1JOO A;  2B63 B;  2EJF C;  1GKH A;  5M5W H;  1QVF A;  1TVX A;  4A3I H;  5JPM C;  1UWV A;  4Q0F A;  3W1G A;  2PQA B;  3GR5 A;  3KF8 B;  5DEH A;  4S3S A;  1TWG B;  4RFB A;  3H3V H;  5JJK A;  2XN9 C;  1Y1V G;  5E4W C;  3L9A X;  3J80 i;  4HJ8 A;  1Y1W G;  3FAU A;  1X54 A;  1L0X B;  3C2P A;  3AEV A;  3MXP A;  4E9J A;  1I3Q B;  3BYY B;  4C1N I;  4DUZ Q;  2HHH H;  4XQQ A;  2F0H A;  1IW7 C;  5E7N A;  3I4M H;  4OX9 H;  3BZD B;  1H9J A;  3KJO A;  4MNO A;  5JJZ A;  1YNJ C;  3PCO B;  2E5L Q;  1SYG A;  2R92 B;  1A2U A;  4A3K G;  3GTM B;  3HOV B;  1EY0 A;  3U50 C;  1GO3 E;  4ID6 A;  2F0U A;  2LY7 A;  1UEB A;  3D6W A;  3U4V A;  1E1O A;  2I0Q A;  2VS1 A;  4GKJ L;  4DR5 Q;  1A62 A;  5D3D A;  3QD7 X;  4GN5 A;  1JC7 A;  3KLW A;  2BL5 A;  2O4X A;  3I3C A;  1P16 A;  4JI3 Q;  3OIQ A;  3NSW A;  1EWI A;  3SK8 A;  2HH3 A;  2CTJ A;  3RD4 A;  2JVZ A;  1VQP A;  1S5B D;  3S1Q B;  2FHT A;  1KAW A;  2BDO A;  4XT3 B;  4PG3 A;  1VIH A;  5EPL A;  2NN6 G;  1V8Q A;  1GXD C;  2R6G A;  4HJ5 A;  3EFX D;  4OON A;  5G3L F;  3NTH A;  4A3D B;  2BE5 C;  1KDB A;  1CT1 D;  3A74 A;  3GTK H;  3R2I A;  1I6V C;  1PVO A;  3K80 C;  1B50 A;  4WAL A;  1JB3 A;  1PTO C;  1YHA A;  2MO0 A;  4LF7 H;  5KYI A;  5BR8 L;  5GAD C;  1VMP A;  3HKZ B;  1WTX A;  1ASY A;  4X64 H;  3H94 A;  4KK7 A;  4IN3 A;  4X66 H;  1MHW C;  2QDL A;  1TWG H;  2JP1 A;  1PH6 A;  2CWH A;  1DM0 B;  4LF4 H;  3CF5 A;  2N3S A;  1VQM A;  5ELO A;  1HA6 A;  4B3S H;  1SJE D;  5HUR A;  2YU9 H;  5JEA G;  1A15 A;  1HUM A;  4JK1 C;  2F0O A;  2F3I A;  4JCV E;  1K0R A;  3A55 A;  1YNN D;  5C3E G;  3T4A C;  1Z2I A;  3TS2 A;  1R4Q B;  4DAV A;  1KDC A;  1H9S A;  1E7Z A;  1EWH A;  2JSO A;  2EYL A;  1YVC A;  3R2T A;  1Q7Y C;  4LF8 L;  5KRU A;  3K5L A;  4C3J G;  1HNW L;  5C0X I;  3VYT A;  4A3C H;  4X62 H;  2K01 A;  1CSQ A;  2PZW A;  3FHW A;  1KTK A;  1IYJ B;  3KK7 A;  3JAM c;  2Q8R E;  5IYB G;  3IKJ A;  3HKZ E;  3M3Y H;  5EAY A;  2ANR A;  1TXY A;  1V1O A;  4ZYS A;  1PZJ D;  4A3J G;  4A3G B;  1ZZI A;  3G7L A;  2A6E D;  2L15 A;  3STB C;  3J7A 5;  1HTP A;  1I4X A;  2R93 H;  2Y0S B;  5IP9 G;  2JA6 B;  3NBH B;  3Q22 A;  1PV4 A;  3NXW A;  4LFB L;  5M3F G;  3I4L A;  1X55 A;  1X3E A;  4HIK A;  1SNO A;  1V43 A;  5I2Y A;  4PQX A;  1Y8P B;  2LXJ A;  1J5E L;  1V9N A;  3M7N A;  4L5T A;  2Q2U A;  5ELF A;  2H4O A;  4GN4 B;  2F3V A;  3NEM A;  1WYD A;  2ANN A;  3K0Y A;  2EXZ A;  1GUT A;  4GOP B;  1XPU A;  1LT6 D;  1IBK L;  2CW0 D;  4A93 B;  1EY7 A;  3I91 A;  1HH2 P;  4JI6 Q;  1PRT C;  4LF6 H;  2EYM A;  3I2Z A;  2A68 C;  1SEI A;  3AFQ A;  1IZ6 A;  3T1H H;  4Y7N B;  4DK6 C;  3M85 A;  4FP5 D;  1HNZ L;  4B9W A;  5J1Z A;  1UE7 A;  1QNK A;  3K7U C;  1HTL D;  2TSS A;  1WTO A;  2Y0S E;  2KCT A;  1Y69 U;  3MHB A;  4QMG A;  4JI2 H;  3SK4 A;  4AYB G;  2KEC A;  3F8T A;  1XNR L;  3SVM A;  4KHP H;  4ODG A;  1QUQ A;  3H0G B;  2E2I B;  1B8A A;  4DR4 H;  4C3I B;  1VQE A;  2J7Z A;  2DY7 A;  2EVB A;  3E6Z X;  4NPS A;  2E2D C;  2M2L A;  4XTC S;  3DM3 A;  2WB1 G;  1B7Y B;  2D9I A;  1S4Z A;  4KD3 A;  3QO2 A;  3DXJ C;  1Q82 C;  2A74 C;  1DXM A;  4DR2 L;  1K8O A;  3O13 A;  1VQ8 A;  2Y3M A;  5IT9 c;  3IAY A;  2B2V C;  1EY6 A;  1QB5 D;  2F0P A;  4X65 L;  1XMQ H;  2UUA Q;  3S17 B;  4IFD J;  1ILP A;  1PH7 A;  1H95 A;  5T1I A;  5LL6 b;  4B3M H;  1JE5 A;  3MVV A;  4CKB A;  2VKC A;  1B9N A;  3MAQ A;  2H5X A;  4GLV B;  2CHB D;  4JG2 A;  5AFW A;  4POG A;  4YY3 L;  2TMP A;  1F77 A;  1AE3 A;  1T5E A;  4DNT B;  1FGB D;  1LTI D;  4DV7 Q;  4JI4 Q;  1I6U A;  2BH8 A;  5FO7 B;  4DV0 Q;  1I94 Q;  4FF3 A;  1SND A;  2I5L X;  1FJG L;  4DV6 H;  1VIG A;  1KC8 C;  1YJ9 A;  2CTF A;  4DFA A;  4DV2 L;  4HIO A;  2R7Z B;  4NDX A;  2FFK B;  2CVR A;  1WOC A;  4BBR G;  4A93 H;  1D7Q A;  1JJC B;  4DUZ H;  1F9R A;  3MEF A;  4DV3 Q;  4P72 A;  2N55 A;  4NMZ A;  5JVG 3;  4I65 A;  5HGQ A;  1STG A;  3KBG A;  2JA7 G;  1PYW D;  2JK8 A;  5I6W A;  3MXU A;  1K3R A;  2FXQ A;  4OWW B;  2VQF L;  1WTP A;  5FO8 B;  4F8M A;  1BBX C;  2F4V H;  3DWA A;  4IUV A;  2GN5 A;  2MFI A;  2YTX A;  4KLK A;  1JJG A;  5C44 H;  1M1K C;  4QL5 A;  3FKI G;  1HNX L;  2CTE A;  3GP7 A;  2YQR A;  1KNA A;  4N8F A;  1IBM L;  1X3P A;  4EVO A;  3QB3 A;  1JB7 A;  4AH6 A;  1VCI A;  2A6H C;  3EQL C;  1K9M C;  5CV8 A;  2L11 A;  5LMN Q;  3S14 H;  2BA0 A;  3TME A;  2A1A A;  4LF5 L;  3NWS A;  4XDX A;  4JOI A;  3Q24 A;  4OWT B;  1WJJ A;  4HMI A;  1BVS A;  1TWH H;  4BBS G;  4JYA Q;  1KNE A;  3TP6 A;  4R4Q A;  4JC0 A;  1EIY B;  3S17 H;  5IP7 H;  3SGI A;  2QIL A;  1EFW A;  1II3 A;  3NWT A;  1VQ7 A;  2P5Z X;  3J81 W;  1JQY D;  4FF4 A;  3EIV A;  1TR5 A;  2ASB A;  4NXN H;  1AH9 A;  4RWS C;  1LT4 D;  4ZQ3 A;  2QGQ A;  1Y1V B;  1SRU A;  3S1R B;  1Y1W B;  5C4J H;  5C5M A;  3HRZ C;  3RLO A;  5I6Y A;  2R93 G;  1XWE A;  2I5M X;  4IPH A;  4DPG A;  1L1O A;  3NP8 A;  2F03 A;  1YBY A;  1HR0 Q;  4IQZ A;  4CJ0 B;  1VBI A;  2R7Z H;  4EQO A;  5KEE A;  5JVH 3;  1DT4 A;  1JWU D;  4JI8 L;  4OEL B;  3TBI B;  4HCE A;  3GTG B;  1XTC D;  3MFG A;  4A3K B;  1S5C D;  2EXD A;  2K5W A;  2ID0 A;  1K0S A;  2Z4I A;  1KXL A;  1GOZ A;  3M7G A;  1F0X A;  3PO2 G;  3ULL A;  4IUT A;  1Q86 C;  3GTJ B;  1TUA A;  4B3R L;  2QF7 A;  3SXH A;  1GJX A;  5C5L A;  4DK3 C;  2B8G A;  4KKS A;  1NUC A;  2UUB L;  4DR7 L;  4LK1 C;  3QWN A;  4UP9 A;  4U68 A;  3PUX A;  3F2D A;  5ELN A;  1EU3 A;  2O5I C;  4MZ9 A;  4A3F G;  2N78 A;  3TRE A;  4JI5 Q;  4G7Z C;  2B2U C;  1W6J A;  3I70 A;  1T9H A;  2VNU D;  4JI0 L;  3F1Z A;  2IHF A;  1I6H H;  4NZT M;  2CFM A;  4DF7 A;  3GQB A;  4KY6 A;  3S1M B;  1ONL A;  1TQO A;  4OX9 Q;  3V69 A;  1BKB A;  1STE A;  3CQZ H;  2XGT A;  4DAM A;  1U4M A;  5C0X J;  4F7X A;  3VYU A;  5FOB B;  4MTN A;  1H9K A;  1N34 L;  4CBV A;  1NNX A;  2B2V A;  1BR9 A;  1V1P B;  3B6Y A;  4BA1 I;  1WTV A;  1QVC A;  2KOL A;  3P7J A;  1EQV A;  4QQB X;  2H1E A;  3G71 A;  3RUZ A;  1LTT D;  2KJX A;  3J7A K;  4HMJ A;  1IL8 A;  1VQO A;  2B2T A;  2M00 A;  1RDP D;  2QA4 A;  1VQF A;  2VW9 A;  2PZT A;  1S3O A;  1Y1W H;  1AP0 A;  2EY2 A;  2B39 A;  3CU7 A;  1IL2 A;  4IAL A;  5C3E B;  3P1H A;  3LNN A;  3FPP A;  2PQE A;  4P75 A;  2JJQ A;  1CSP A;  3J81 E;  4ZRZ A;  1HR0 W;  5ELE A;  1RCV D;  3UDF A;  2XWB B;  1SYC A;  2NZO A;  1TS2 A;  4C3J B;  1BO0 A;  5AJ3 Q;  4WFN 3;  3L2P A;  1YIJ A;  2HDL A;  1BCP C;  1X4M A;  4MN3 A;  4YHH L;  1FR3 A;  1N8R C;  1DYQ A;  1UUP A;  2LMC B;  1CKM A;  3KJP A;  1SFO B;  4ME3 A;  4LF7 Q;  4A3K H;  5BR8 H;  4XQJ A;  2D2C C;  4DV5 Q;  4HJ9 A;  4DV4 L;  4X64 Q;  3TP5 A;  1B1Z A;  4K0K L;  1EIG A;  1KRT A;  5ELD A;  1BUV T;  4A3J B;  3T1Y L;  5A2Q W;  2ES2 A;  4B3S Q;  1FKA H;  4DV1 L;  4RG1 A;  1MJC A;  4RMF A;  1IBL Q;  1Q90 A;  3OTO L;  2OTL A;  4G4K A;  1OXT A;  1FNV A;  3I8Z A;  2MHV A;  1Q8K A;  4XQN A;  3DLL A;  1DTJ A;  3K8A A;  1N33 L;  2O2L D;  3AYH B;  3GTQ B;  2NWG A;  2AWO A;  2B29 A;  4MTK A;  4DN4 M;  3S1M H;  3U1K A;  1HNW H;  4DXG A;  1ZYR D;  1S03 G;  4X62 Q;  4KY5 A;  4H13 C;  5C44 G;  3CCM A;  4X3T A;  5IT9 W;  2ZTE A;  3CC4 A;  3KBX A;  3S1N H;  4ME5 A;  4Q5V A;  4JV5 L;  3RF2 A;  4OO1 G;  1TT2 A;  3MXG A;  1YEZ A;  4NXM Q;  3IL8 A;  2JA8 H;  3M4O B;  1RHP A;  2ZJR A;  1XNQ L;  4XYQ A;  2BDN A;  4JI1 L;  3D6C A;  5JEA H;  1AEX A;  1J9O A;  5M5W B;  1Z7T A;  1X9N A;  5JPN C;  2O5J C;  4GKK L;  5M3M G;  5IP7 G;  4AYB B;  4LFB H;  4NKL A;  2KBN A;  1I4Q A;  2ICE C;  3IFD A;  1PYB A;  3G4S A;  4JI7 L;  1PTO F;  3AFP A;  1MD2 D;  3QG1 A;  4DGZ A;  3CXC A;  1Q8I A;  4LUZ A;  1SBB B;  2A8V A;  1BQQ T;  3U9O A;  1D1I A;  3A5U A;  2WB1 B;  2KA7 A;  5K36 G;  3VYR A;  3KLS X;  4KTA A;  4J15 A;  2DJF C;  3TZD A;  2N49 A;  1KHM A;  3NPP A;  5J39 A;  3UI2 A;  4G7H C;  1LTS D;  2CPM A;  2Z8L A;  4BXX H;  2QND A;  4R8N A;  4LF6 Q;  1IHZ A;  4A3J H;  2A6E C;  3T1H Q;  1VQC A;  4IPC A;  1HNZ H;  2OWO A;  4RH6 A;  1LAC A;  4IFD I;  1XPR A;  3TRZ A;  2AKW B;  4DR1 L;  4DKA C;  1N36 L;  5IP9 H;  4JI2 Q;  1LTB D;  4KHP Q;  1XNR H;  4AYB E;  2F0S A;  5M3F H;  2E8G A;  1X3F A;  1FNU A;  2B2U A;  4CHT B;  4BY7 G;  5A2Q E;  1TS3 A;  2ICI A;  4DR4 Q;  4CGY B;  3A8I E;  2EYO A;  4IO9 A;  2JZX A;  1ASZ A;  2WB1 E;  3I73 A;  2V1C C;  1W3S A;  3EN2 A;  2NVQ B;  2CW0 C;  1GHJ A;  4DR2 H;  3VR2 A;  2MGS A;  2K04 A;  2RDF A;  5IWA H;  4JBM A;  1CA6 A;  3GTK B;  4PNY A;  1VQK A;  4HTH A;  1S72 A;  3KDF B;  1XMQ Q;  3M4O H;  2JA7 B;  2F0G A;  1DCZ A;  4P74 A;  5IT9 E;  5GAH C;  1N32 L;  1ZTG A;  3AEV B;  5FLX L;  5F2D A;  3CCS A;  4B3M Q;  2UU9 L;  3RNU A;  3FP9 A;  1SYD A;  3DWQ A;  4YY3 H;  2XWJ B;  1PMR A;  1KD1 C;  1K83 B;  2CKZ B;  3KUP A;  3BZK A;  4DUY L;  3N6R A;  1QOH A;  4NP5 A;  2YTY A;  4C2M H;  2R7D A;  2XSC A;  5CV7 A;  2YU9 B;  1JWM D;  1BXT A;  1FJG H;  1VQJ A;  4DV6 Q;  4RCO A;  4Y52 H;  4DV2 H;  4JI5 H;  1KDA A;  1NTG A;  4EX5 A;  2IL8 A;  1DON A;  2QCP X;  5CV4 A;  3MFY A;  1LM0 A;  5HY6 A;  5CR3 A;  1IKM A;  4ZUI A;  1EYG A;  1OXX K;  3I90 A;  2EYP A;  2OQ0 A;  2CTK A;  2HQL A;  3A7L A;  5EQ0 A;  3C1F A;  2WII B;  4OIJ A;  1K73 C;  3HOX G;  5D3I B;  4Z9C B;  2MJ8 A;  3DUZ A;  5GQO A;  4K5W A;  4X3S A;  2VQF H;  2VUM G;  3M3Y B;  3ER0 A;  1I4R A;  2F4V Q;  5C0X G;  2HIV A;  2A73 B;  2RCN A;  1MBY A;  2LSS A;  1XYI A;  4HCS A;  4BA2 I;  2KHJ A;  3ERO A;  3P20 A;  2PQA A;  3KF8 A;  1DOK A;  4A3B G;  2LRR A;  1HNX H;  4TQU S;  1IBM H;  2AUK A;  2D62 A;  3CW2 C;  2R93 B;  3J81 c;  4B9X A;  5BN3 A;  2JQO A;  2NVQ H;  3R8B A;  1RF2 D;  4G7O C;  1OXU A;  1G2T A;  4RGN A;  1Z9F A;  4DK1 A;  4LF5 H;  4BBR H;  4QUF A;  1QG7 A;  2SNM A;  3OWF A;  3D4R A;  3NHH A;  5EKK A;  3GO5 A;  3F2U A;  1PZI D;  5T1G A;  1VQN A;  3PGZ A;  1L0Y B;  2JA7 H;  1FGU A;  2ENB A;  4JI6 L;  3VKE A;  2ZM6 L;  3BJU A;  5LMU H;  1NR2 A;  4DV5 H;  3GD7 A;  1A2T A;  2PW5 A;  2Z9H A;  3LX0 A;  2WP8 J;  4NXN Q;  2LS0 1;  4ALP A;  1K83 H;  2EYJ A;  4A3F B;  1JT8 A;  4J6H A;  1SSO A;  2Q2I A;  2JA8 G;  3GAB A;  1F2M A;  3GV3 A;  2F0W A;  2XRQ D;  1CUK A;  3FKI H;  1GUN A;  1D8L A;  2IWH A;  1SMY C;  2K1H A;  1IBL H;  1R4P B;  3E9I A;  1SNM A;  1UE6 A;  1QWY A;  4PV1 C;  1WI5 A;  3J80 W;  1LTL A;  5EJW A;  4JI8 H;  1J5K A;  1I4P A;  4HJA A;  1Y8N B;  3EZJ A;  1TY0 A;  1DGS A;  1J6Q A;  2MP1 A;  2SDF A;  1ET6 A;  1HA5 A;  4BBS H;  2VB3 X;  1K8A C;  1EQR A;  2M8W A;  3N52 A;  1JR0 D;  4B3R H;  3PUZ A;  1ZZK A;  4JOI C;  3WOF A;  1C7Y A;  4R4T A;  4UY8 C;  2UUB H;  4DR7 H;  4OEM B;  2ZXP A;  4BXX G;  4LIJ A;  1MSH A;  1EEI D;  3KYH C;  4LUV A;  3I4N H;  3CC7 A;  3VR3 A;  3A8K E;  4RCN A;  3GDE A;  1Y8O B;  4NXM H;  3D4W A;  5BN5 A;  4JI0 H;  2R3Z A;  3S15 B;  4EQ5 A;  1ICW A;  2CH4 W;  2QDB A;  4O1N A;  3E0J A;  3ND8 A;  5K5P A;  4JI4 L;  3T51 B;  4DV0 L;  3LWU A;  5IE8 A;  2F52 A;  4DAP A;  2ZQE A;  1EQT A;  1HJP A;  4DU9 A;  5C3X A;  2NN6 I;  4EQN A;  1L1O C;  1BOS A;  4FJS A;  4BY1 H;  4FNF A;  3MXN B;  3KLR A;  1WTR A;  1N34 H;  3S2D H;  3K5O A;  1SYE A;  3SE0 A;  4P73 A;  4LMQ D;  3KLS A;  1JJ2 A;  3L0O A;  1X0A A;  1VQB A;  4DR6 L;  4LF9 H;  3PO2 H;  1E3P A;  1NY4 A;  4DV3 L;  3DM1 A;  3CRL C;  3PQI A;  2C9O A;  4WJ4 A;  3HOZ G;  1NSN S;  2Q8I B;  1G2S A;  2JA9 A;  1XTD A;  4PZ6 A;  4V19 0;  2EIF A;  2RQX A;  4A3F H;  2NZH A;  1QZG A;  4X6A H;  1RTO A;  2WV6 D;  3KF6 B;  5BN4 A;  1KLG D;  1CZG A;  2UXD L;  3E3X A;  4DNI A;  3RZD H;  3RZO B;  2F0J A;  4APV A;  3C1E A;  3NBH A;  4YHH H;  4QF4 A;  4IOA A;  1NMG A;  4QGU A;  4A3L G;  5C44 B;  1PQX A;  2K28 A;  3VYS A;  1T5X D;  2PW7 A;  2ZXO A;  5BR8 Q;  3JAM L;  5LMN L;  3GTP H;  1Q46 A;  2KCN A;  2DGR A;  1B9M A;  5FLX W;  4IUP A;  5CGK A;  2PCF B;  1WTJ A;  4DV4 H;  2PNH A;  2EY1 A;  2ZTD A;  3J80 E;  4DR3 L;  2UXB L;  5JJL A;  3S14 B;  1G51 A;  2IY5 B;  3HOW H;  3T1Y H;  2BCO A;  2UXC L;  1HPC A;  4GOP A;  2Q2H A;  1MKH A;  2FJ2 A;  1WTW A;  1UG8 A;  3OTO H;  3I7F A;  1TY2 A;  1TWH B;  4KN4 C;  2FMR A;  4IPG A;  3BDC A;  3U4Z A;  3A0J A;  1N33 H;  1F9P A;  2D5D A;  3S15 H;  4R9W A;  1PTO B;  3QJY A;  2MUY A;  3K6O A;  1WTH A;  2B2T C;  4KY7 A;  1Q1E A;  4LF8 Q;  2L12 A;  1EIH A;  2RDH A;  1HNW Q;  4FJU A;  1A3V A;  4IUR A;  5IGB A;  2PQU A;  2RSO A;  1AFP A;  5DM7 3;  5IOD A;  2UUC L;  5JJI A;  3MA2 B;  1IW7 D;  5C4J B;  1X32 A;  5KGU A;  1ENC A;  5M9O A;  3VR4 A;  3ONA B;  3W5O A;  3CRK C;  1YNJ D;  3URY A;  2XVS A;  4WOR A;  1HQM C;  1M8A A;  2Q2T A;  5FLM G;  4JPB W;  4LJZ C;  1MJE A;  4KJN A;  2V4D A;  5A35 A;  4ZK9 B;  2A69 C;  1XMO L;  5CV9 A;  2G5D A;  1F2Z A;  2RHS B;  2CWA A;  3Q6S A;  4M1U B;  4LFB Q;  1KLU D;  5C4H A;  2QEJ C;  1FYC A;  1BCP F;  2JYO A;  4JI7 H;  3G6J B;  1TWA H;  3RZO H;  1J5E Q;  1ET9 A;  4IFD H;  2CQA A;  4OD6 A;  1A8V A;  2LTM A;  1SYB A;  4RHR A;  4EQP A;  1F9Q A;  2HHH L;  4R8I A;  2K33 A;  2HQE A;  3C3L A;  4H7B A;  2BE5 D;  4YCV A;  1AE2 A;  1QE6 A;  1VF7 A;  3K5M A;  1I6H B;  2MNA A;  3H3V I;  2RF4 A;  1PTO D;  4HID A;  4OO1 H;  4LFC L;  1EUJ A;  2GVB A;  2B63 G;  1Z47 A;  3UE1 A;  2OQK A;  1BF4 A;  2F0N A;  3CQZ B;  4POF A;  3K81 C;  1HNZ Q;  3NUC A;  4KD4 A;  4KHZ A;  3ERQ A;  5L37 A;  4RHS A;  4DR1 H;  3A8J E;  5FLX E;  1X4N A;  3NBI A;  5ELB A;  1N36 H;  2Q8T A;  3D8G A;  1I4G A;  1XNR Q;  5M3M H;  3CCJ A;  4GNX B;  4KKT A;  2G9D A;  5C3W A;  1KAA A;  1PTO H;  2DUD A;  1SXT A;  3K57 A;  3JAM i;  5M5X H;  2KVM A;  1V8C A;  1G6Z A;  3I4N G;  2PO4 A;  4KMU C;  2LKV A;  1X3G A;  2N88 A;  3NEN A;  2KUM A;  5K36 H;  4DR2 Q;  2AXY A;  3HP3 A;  1WFQ A;  4V0B A;  1TKW B;  5IWA Q;  3J7Y W;  1VF5 C;  4GLX A;  1WCM G;  2K50 A;  2DY8 A;  4X66 L;  4U67 3;  1RL2 A;  1SN8 A;  4B3T L;  3HOX B;  4BY1 G;  1N32 H;  3EBE A;  2F0E A;  3GKU A;  5I4D A;  3HG9 A;  2UU9 H;  2KCC A;  4LF4 L;  1B4O A;  2VUM B;  4AM3 A;  3ULP A;  1EC6 A;  3STB D;  4YY3 Q;  4O42 A;  3CKI B;  3OMG A;  2EQS A;  2X6G A;  4L5Q A;  4WJW A;  4DUY H;  4BY7 H;  1IYU A;  1Q12 A;  3T56 B;  4A3B B;  2ZJP A;  1C9O A;  1CKN B;  5CV6 A;  5FKA C;  1EEF D;  3CCR A;  1FJG Q;  4A3D G;  1LO5 D;  2B3G A;  1CFM A;  2K5D A;  3L3O C;  4DV2 Q;  3F2B A;  3RMH A;  2NUC A;  5LHY 1;  1STY A;  2K5N A;  5IGF A;  1AN7 A;  1SRO A;  4GN3 B;  3H3V C;  3FDT A;  4OL7 A;  1EWC A;  1SE2 A;  1EIF A;  2F1M A;  5IGG A;  1PH3 A;  2L4N A;  2IW3 A;  3ITP A;  3D0F A;  2VQF Q;  3S1N B;  1W6K A;  2VXW A;  3I0P A;  1O7I A;  2I46 A;  4AQY L;  4LFA L;  5ISR A;  4GKJ H;  1W2B A;  2CPQ A;  3WOE A;  3HOW G;  3HOU G;  2DJG C;  2BH2 A;  2JA8 B;  2VY3 A;  1HNX Q;  1IBM Q;  1CKO A;  1E22 A;  3A54 A;  4TKO B;  5JOB A;  3K59 A;  4A4I A;  2JA5 H;  4B8T A;  1A0I A;  4DXF A;  2DGY A;  3MEH A;  3FEW X;  1SLJ A;  4HR7 B;  4IJH A;  1LUZ A;  2OT2 A;  1E2V A;  1U5K A;  4M8A A;  4LF5 Q;  4N9T A;  4K6L A;  4FXK C;  1L0W A;  2IX3 A;  4NZR M;  1G29 1;  2HT1 A;  5C4Z A;  3J80 c;  3K58 A;  2ZM6 H;  2F0K A;  3QOJ A;  3HOX H;  5J3B A;  1Z6H A;  1EYD A;  1E2W A;  5LMU Q;  3VA7 A;  1S40 A;  4A3G G;  1AW7 A;  2WKC A;  2KCM A;  4JVZ A;  4P2C B;  4OWX B;  2VUM H;  2YYZ A;  5EKI A;  4E6I A;  4I7A A;  4QY7 A;  1SE8 A;  1G6P A;  2VQE L;  1DOM A;  4GLA C;  5C0X H;  1SE4 A;  1V1P A;  2KED A;  3K0X A;  4K8I A;  1DOL A;  4YWM A;  5EPK A;  3HGB A;  1DJR D;  4A3B H;  1PDQ A;  2MPM A;  2K5H A;  2NZ1 D;  4C3H H;  1D5X C;  5M3F B;  4JI8 Q;  1F9S A;  2YV5 A;  3OPO A;  2OTJ A;  4LF8 H;  1B44 D;  3HKS A;  1LT5 D;  2F0D A;  4OGQ C;  4IFD G;  1JOQ A;  1B53 A;  3T13 A;  1XPO A;  3MZ5 A;  4B8C D;  3QOL A;  4EC5 A;  1O7Y A;  3K7A H;  1O7L A;  1YHB A;  2AUJ D;  4B3R Q;  3MC0 B;  3BDL A;  1EL0 A;  2UUB Q;  4DR7 Q;  3FPU B;  3SK6 A;  3CCV A;  5M5Y H;  1PFN A;  1FNW A;  4DAY B;  1BBW A;  1LYL A;  2D0P A;  3PF5 A;  1PLF A;  2EOT A;  5KNB A;  1U0L A;  2NTT A;  2YTV A;  3CMA A;  1ESR A;  1VQ6 A;  4JI0 Q;  2K5Q A;  1LAB A;  1EY9 A;  2FMC A;  1QIL A;  5C4X H;  1GHK A;  2CWP A;  1EZ8 A;  1GM5 A;  1YNN C;  3W3A A;  4RGM A;  3S2H H;  1P8L A;  1A3T A;  4FF1 A;  4GS3 A;  2Z6K C;  3HS0 C;  1Q81 C;  1J4W A;  2P2R A;  2A6H D;  1J5E H;  2K52 A;  1NR4 A;  4C2M B;  4CDD C;  1NJI C;  3BZC A;  1N34 Q;  2F0Q A;  4DUZ L;  4DR6 H;  4LF9 Q;  2LXK A;  4FXD A;  4FYD A;  2IT1 A;  4C1N K;  4ZKC B;  1IBK H;  4WRD A;  1NMF A;  1K8M A;  3Q8D A;  1B3A A;  1VQG A;  3C46 A;  2E5L L;  2EJG C;  1KQS A;  5EBD A;  1D5Z C;  5FLX c;  4I7Z C;  2K7V A;  2OPV A;  5IGC A;  1TS4 A;  4TVA B;  1M4V A;  4K2L A;  1I4H A;  4DR5 L;  3UDG A;  3RN2 A;  3M9B A;  2UXD H;  1QVG A;  4FF2 A;  4JI3 L;  3MTS A;  2RHQ B;  2EPB A;  2Z1C A;  3HZX A;  2FPH X;  1HZC A;  1PH4 A;  1RJT A;  4YHH Q;  3SR1 A;  4LW1 A;  4XIG S;  5FJ8 G;  1RD9 D;  1BBU A;  3TDQ A;  5CYU A;  4DV4 Q;  4A3M H;  1X65 A;  2L5T A;  5KYL A;  2NVY H;  3I4O A;  1UEA B;  4DR3 H;  1U9R A;  1UNS A;  2UXB H;  1KIX A;  1U4R A;  2Z0S A;  1M90 C;  4QB4 A;  3T1Y Q;  3HOY H;  3KDG A;  5FK9 C;  2UXC H;  5CBA E;  2OEO A;  4BBR B;  1XX8 A;  3RN5 A;  3HOZ H;  1YNX A;  2E76 C;  2PZU A;  1TS5 A;  1G8Z D;  4DV1 Q;  2RDG A;  1J8I A;  4N8X 1;  1SDF A;  3PIO A;  3OTO Q;  3S24 A;  4X65 H;  3CME A;  1A6X A;  4RKL A;  4KKU A;  5DAU A;  4L5R C;  1BCP B;  1N33 Q;  3R93 A;  4L8J A;  3GV6 A;  2X69 A;  2PI2 E;  1UAP A;  2WIN B;  3SEB A;  4UP7 A;  3CCQ A;  3RLN A;  4A76 A;  1CI3 M;  2UUC H;  4A3L H;  3FKI B;  3WDN A;  2JA5 G;  4JV5 Q;  1E2Z A;  4JBW A;  1F2L A;  1TWC B;  2FIN B;  4C56 C;  4K8J A;  1PRT F;  3FMC A;  4FDB A;  1I50 H;  2WFW A;  1VQ9 A;  3NK9 A;  2KHS A;  4OXP A;  4ZUJ A;  2PMZ B;  1XNQ Q;  1CTM A;  3TQY A;  2E2H H;  4IUQ A;  5IYD H;  4JI1 Q;  1XMO H;  4K14 A;  4BBS B;  3E0E A;  1XJV A;  4GKK Q;  2PT7 G;  4LAA A;  1EY5 A;  2AMC B;  1B3Q A;  1UE1 A;  1FD7 D;  4GOP C;  3KDF A;  3M4P A;  4JI7 Q;  4F88 A;  3EA6 A;  4IUU A;  3RR5 A;  4AIM A;  1HUN A;  3HFZ B;  2IX0 A;  2JN4 A;  2K6A A;  3I4N B;  2AHO B;  1D2B A;  1S5D D;  3SB1 A;  1TU2 B;  1SR3 A;  2NVX H;  3PIO 3;  3NTK A;  3E9H A;  1BCP D;  1HFG A;  4CJ1 B;  3PV0 A;  4A3E G;  2QEX A;  1NXU A;  1F2Y A;  4LFC H;  4C3H G;  4NB3 A;  4UPA A;  3GTL H;  4ZCK A;  4KV6 A;  5FLM H;  2OPU A;  1WCM B;  2BOS A;  1R9T B;  2OXP A;  1KAB A;  1ENF A;  2PMZ E;  1EU4 A;  4DR1 Q;  4BY1 B;  1YI2 A;  3VR6 A;  1N36 Q;  3S2D B;  2E3U A;  3PO3 G;  1AZP A;  5JAV A;  3PO2 B;  3KFU A;  4K5V A;  1H9S B;  2Z6B A;  3TN2 A;  2NTS A;  4ULL A;  2J4X A;  4H8A A;  2ZXR A;  4H44 C;  3PSI A;  3OSS D;  2B2Y A;  5D14 A;  1N9W A;  3EVQ A;  5J22 A;  3IFT A;  4UAI A;  2IX1 A;  2Z6K A;  3R3O A;  1HZA A;  3K5N A;  5C4X G;  5DLQ E;  1TWC H;  2Z4H A;  1WVN A;  1PA6 A;  3RZD B;  2BA1 A;  3ND9 A;  2B63 H;  2IJ0 A;  2JEB I;  2WAC A;  4R4C A;  1VQL A;  3DMU A;  2ZT9 C;  1LT3 D;  4UHV A;  3AU7 A;  4B3T H;  4EGV A;  1N32 Q;  1EFI D;  1AZQ A;  3GTP B;  5IYC G;  1E0B A;  2GVA A;  4RGO S;  2UU9 Q;  1C48 A;  1NCV A;  4UDU C;  3HOW B;  1AN8 A;  1JOK A;  4DUY Q;  2UUA L;  3HOU B;  2NVT B;  1I3Q H;  4KJO A;  2LFN A;  2HD3 A;  1QZH A;  2LTL A;  3J81 L;  1C8C A;  2I07 B;  2KHI A;  5GAE C;  5DT9 A;  2HCI A;  1GUW A;  2EE1 A;  2X06 A;  1HFN A;  1WE8 A;  1STB A;  2R92 H;  3GTM H;  1SYF A;  1X6O A;  3H09 A;  5KIX A;  3HOV H;  4PMC A;  2HH2 A;  4DV7 L;  4HSP A;  4PMB A;  1I94 L;  4R1J A;  5KND A;  2SEB D;  3QR8 A;  1WCM H;  4R4O A;  1R9T H;  3DWP A;  5C6A A;  1KL9 A;  2EYF A;  1TWF B;  2CWF A;  2K5V A;  3TP8 A;  4QJF A;  4A3M G;  1U4P A;  2PY9 A;  4AQY H;  3OOC A;  3S1Q H;  4LFA H;  3SDZ A;  4GKJ Q;  2A19 A;  2EJM A;  1NE3 A;  5COY A;  3HOY G;  1QUQ B;  2L55 A;  1PFB A;  1PZK D;  1V9P A;  1VDZ A;  4J8Q A;  4LNQ A;  1STH A;  3RLF A;  4OHJ A;  5I9P A;  5HGT A;  4A3D H;  1QJO A;  3BVZ A;  3M4Y A;  4YCU A;  1QCB D;  1SJH D;  1EOT A;  3DEP A;  3OMC A;  4GNX C;  4JBK A;  1NAP A;  2HCC A;  1TWA B;  3V96 A;  2K05 A;  1SNC A;  1FL0 A;  2K14 A;  3BYT B;  4L5S A;  3KDK A;  3F2C A;  3I55 A;  4BS9 A;  3PUY A;  2RCF A;  2PPB C;  2ZM6 Q;  4WJ3 M;  2WAQ G;  1SAP A;  3V2T A;  1CHP D;  1Q3L A;  4HJ7 A;  1V1Q A;  3OET A;  1QNU A;  3SK5 A;  4K0K H;  3MXN A;  2IPK D;  3DEO A;  2VQE H;  1PFS A;  4H0L C;  4L6T B;  4JYA L;  1A63 A;  2CTL A;  4K2K A;  4A3I G;  3HOU H;  2SNS A;  2NVT H;  4DV1 H;  1ENA A;  1SNP A;  3OSO A;  5IYD G;  5E3F A;  1ESF A;  1ML0 D;  2L1B A;  5EKL A;  4FVM A;  3NE5 B;  1JIC A;  1HRJ A;  5M3M B;  2RBM A;  2MJH A;  2K4K A;  3KF6 A;  4XYO A;  2F0I A;  3UE0 A;  5M5X B;  2EY5 A;  3X3N A;  3J7A V;  2C35 B;  1YIT A;  1EZ6 A;  5IWA L;  3J81 j;  1HR0 L;  1HHV A;  3I4M G;  1TWF H;  2OCE A;  1I5F A;  1ZXT A;  3VA5 A;  4A3G H;  2KEN A;  1ZEQ X;  3P75 A;  1PH5 A;  1ODH A;  4DA2 A;  1WHR A;  1WD0 A;  1NBW A;  5FO9 B;  5GRO A;  3CPF A;  4YIJ A;  5IGE A;  4QUC A;  4JV5 H;  1B70 B;  1D5M C;  1E1T A;  2KEE A;  2CH4 A;  2JA6 H;  5CC4 A;  3J81 i;  5E1F A;  5D65 A;  5IIF A;  3TS0 A;  2EYH A;  4X3K A;  2G8Y A;  2B2W C;  3H15 A;  3ULJ A;  1XNQ H;  3UDX A;  1E24 A;  1HZ9 A;  4KN7 C;  4JI1 H;  5A2Q L;  2DN8 A;  1VS0 A;  2VL6 A;  1EYC A;  4ILW A;  4GKK H;  4MIU A;  4HIM A;  1O78 A;  4WAN A;  3PMF A;  4CDC C;  4CDE C;  3Q23 A;  4KHV A;  4JI5 L;  2JEA I;  1PXU A;  4BY7 B;  2L0C A;  3Q0A A;  1ZYR C;  2K03 A;  1PH2 A;  4OCH A;  1C0A A;  3M4Q A;  2AWN A;  3LWE A;  1Q1B A;  4NW2 A;  1DZ1 A;  4DR6 Q;  1VQA A;  2QW7 A;  3OHX C;  4OX9 L;  3CCU A;  2RKS A;  1OXV A;  1IBK Q;  3JC6 6;  4Y7N H;  2E5L H;  4IJL A;  4PZ8 A;  4QCL A;  3NQT A;  3MWY W;  5IT9 L;  3J7Z C;  3CAM A;  5H1S E;  4P71 A;  4MHE A;  4RKB A;  2F4I A;  3T16 A;  5CBE E;  2FMM A;  4A75 A;  4ZLT F;  1S20 A;  1IYV A;  4YWK A;  4DR5 H;  1YJN A;  1STN A;  3H0G H;  2E2I H;  2UXD Q;  4JI3 H;  4C3I H;  1L1O B;  1X3Q A;  3IRB A;  3CPW A;  3OIP A;  2AQ3 B;  3BU2 A;  1SMY D;  1PFM A;  1XRH A;  4CKC A;  1S5F D;  3D3R A;  1WTQ A;  4TRD A;  4G08 A;  3AB9 A;  2OF1 A;  4K5X A;  1VQD A;  5DM6 3;  1LV9 A;  3AQQ A;  4JW0 A;  3HEJ A;  4UP8 A;  3S16 B;  2JA5 B;  1PRT B;  2K75 A;  3G48 A;  4DR3 Q;  4BWG B;  4A3C G;  2UXB Q;  5AJ3 L; 
#chains in the Genus database with same CATH homology
 1XPO A;  1XPU A;  3K7A H;  1IBK L;  1EYG A;  1OXX K;  2UXC Q;  2R92 G;  1YHB A;  2OQ0 A;  2CTK A;  4B3R Q;  2HQL A;  3HOV G;  4LF7 L;  1HH2 P;  5LMU L;  4JI6 Q;  3CP0 A;  1K73 C;  3OYY A;  1YZ6 A;  3I2Z A;  3HOX G;  4DV5 L;  2UUB Q;  4X65 Q;  4DR7 Q;  4X64 L;  3AFQ A;  5GQO A;  5M5Y H;  1IZ6 A;  3CCV A;  4DK6 C;  3M85 A;  2VUM G;  4DAY B;  1BBW A;  1HNZ L;  1LYL A;  2D0P A;  3ER0 A;  3PF5 A;  1UE7 A;  3K7U C;  2F4V Q;  1U0L A;  2Y0S E;  5C0X G;  2KCT A;  2YTV A;  2HIV A;  3CMA A;  2RCN A;  4JI0 Q;  1VQ6 A;  4B3S L;  2LSS A;  4AYB G;  4BA2 I;  2KHJ A;  3F8T A;  1XNR L;  5C4X H;  3PUW A;  1IBL L;  2PQA A;  2CWP A;  1PH8 A;  1GM5 A;  1QUQ A;  4A3B G;  3WWV A;  2UUC Q;  4TQU S;  4GNX A;  3S2H H;  1P8L A;  2D62 A;  3CW2 C;  1K8G A;  1B8A A;  3J81 c;  1VQE A;  2JQO A;  4GS3 A;  3TEH B;  5FJ8 H;  2Z6K C;  4NPS A;  2NVQ H;  1Q81 C;  1J4W A;  2P2R A;  4XTC S;  1IXR A;  1OXU A;  1B7Y B;  2K52 A;  2WB1 G;  3DM3 A;  1Z9F A;  1NJI C;  4BBR H;  3BZC A;  1N34 Q;  4X62 L;  1Q82 C;  1PH9 A;  4DUZ L;  3GO5 A;  4DR2 L;  1VQ8 A;  4LF9 Q;  2LXK A;  3D31 A;  2IT1 A;  1VQN A;  5IT9 c;  3PGZ A;  5GAG C;  3HKZ G;  1NMF A;  3Q8D A;  1FGU A;  2JA7 H;  1VQG A;  4JI6 L;  1YHQ A;  2E5L L;  2UXB Q;  1XMO Q;  2ZM6 L;  3VKE A;  1KQS A;  3BJU A;  4X65 L;  5FLX c;  2UUA Q;  4IFD J;  2OPV A;  3GD7 A;  1PH7 A;  1H95 A;  2WP8 J;  3NEL A;  3VDY A;  1RIP A;  3U58 A;  4NXN Q;  1VQ5 A;  2JE6 I;  1JE5 A;  4TVA B;  4NXM L;  1Y14 B;  4ALP A;  4DR5 L;  3UDG A;  1K83 H;  2H5X A;  4GLV B;  4JG2 A;  3RN2 A;  1JT8 A;  2Q2I A;  2JA8 G;  3M9B A;  4YY3 L;  4POG A;  1QVG A;  1EC6 A;  4JI3 L;  1CUK A;  3FKI H;  2RHQ B;  2HHH Q;  1KRS A;  1D8L A;  4H02 A;  1HZC A;  1PH4 A;  3E9I A;  1AE3 A;  2I5H A;  1UE6 A;  4YHH Q;  5LMN W;  1WI5 A;  4DV7 Q;  4JI4 Q;  3PUV A;  2BH8 A;  1LTL A;  4DV0 Q;  1I94 Q;  3S16 H;  4JBJ A;  2I5L X;  4LW1 A;  1FJG L;  4LFC Q;  1VIG A;  1KC8 C;  1J5K A;  2R7F A;  4XIG S;  5FJ8 G;  4HJA A;  1YJ9 A;  4DV2 L;  1CKN A;  1GD7 A;  1BBU A;  1DGS A;  1J6Q A;  3CCE A;  4DV4 Q;  1X65 A;  4HIO A;  4A3M H;  2NVY H;  3I4O A;  1WOC A;  4BBR G;  4A93 H;  1D7Q A;  1JJC B;  4LF9 L;  4PMW A;  1KIX A;  3G6E A;  4BBS H;  4IPD A;  2Z0S A;  1K8A C;  3MEF A;  3T1Y Q;  1M90 C;  2VZA A;  1EQR A;  3HOY H;  3ICE A;  3ZJY C;  4P72 A;  4DV3 Q;  3RN5 A;  3HOZ H;  1YNX A;  3PUZ A;  4DV1 Q;  1ZZK A;  4JOI C;  5HGQ A;  2JA7 G;  3PIO A;  4LF6 L;  1X56 A;  1C7Y A;  2JK8 A;  3OTO Q;  4R4T A;  4UY8 C;  3S24 A;  1K1G A;  4BXX G;  3CME A;  4LIJ A;  1K3R A;  1Y1V H;  2FXQ A;  3S1R H;  3T1H L;  4OWW B;  2VQF L;  4L5R C;  3KYH C;  2ATW A;  4LUV A;  1N33 Q;  3CC7 A;  3I4N H;  3GDE A;  2Y0S G;  2JA6 G;  2GN5 A;  2MFI A;  2PI2 E;  1FVI A;  4JI2 L;  2YTX A;  4KLK A;  4O2D A;  4EQ5 A;  4KHP L;  5C44 H;  1M1K C;  2E2J H;  4QL5 A;  4UP7 A;  3CCQ A;  3FKI G;  3RLN A;  4A76 A;  4JVH A;  1HNX L;  4QMF B;  2CTE A;  2YQR A;  4A3L H;  1IBM L;  4JI4 L;  4DV0 L;  1JB7 A;  4A3E H;  3GTG H;  4DR4 L;  5IE8 A;  2F52 A;  1HJP A;  4AH6 A;  1VCI A;  3PF4 A;  2CTM A;  2NN6 I;  2JA5 G;  1K9M C;  5LMN Q;  3S14 H;  4JV5 Q;  1L1O C;  3OW2 A;  2BA0 A;  4JBW A;  4BY1 H;  2A1A A;  3MXN B;  4X66 Q;  4LF5 L;  3GTJ H;  3S2D H;  4JOI A;  3ERS X;  4FDB A;  4OWT B;  1WJJ A;  4P73 A;  5JEA J;  1I50 H;  2WFW A;  3L0O A;  4PZ7 A;  1JJ2 A;  1VQB A;  1VQ9 A;  1BVS A;  1OXS C;  4DR6 L;  4A93 G;  4QIW E;  4OXP A;  3PO2 H;  4LF4 Q;  1TWH H;  1E3P A;  1NY4 A;  2MQH A;  4DV3 L;  4BBS G;  3PO3 H;  4JYA Q;  1XNQ Q;  2D0O A;  4JC0 A;  4R4Q A;  3TQY A;  2E2H H;  1EIY B;  3PIP A;  3S17 H;  1YJW A;  5IP7 H;  4JI1 Q;  3SGI A;  4WJ4 A;  3HOZ G;  2CQO A;  1EFW A;  5IYD H;  3E0E A;  4KI0 A;  5IY0 A;  1XJV A;  4GKK Q;  2JA9 A;  1XTD A;  1VQ7 A;  1XMQ L;  2AMC B;  4PZ6 A;  2EIF A;  1UE1 A;  1PHJ A;  4GOP C;  4YWL A;  2N8N A;  4A3F H;  3KDF A;  3EIV A;  3M4P A;  4JI7 Q;  2NZH A;  1QZG A;  2ASB A;  4B3M L;  3RR5 A;  4AIM A;  4X6A H;  1AH9 A;  3KF6 B;  1VQ4 A;  3HFZ B;  2QGQ A;  1SRU A;  3CC2 A;  2IX0 A;  2UXD L;  4DNI A;  5C4J H;  1MIU A;  2AHO B;  3H0G G;  3RZD H;  3RLO A;  2R93 G;  2I5M X;  4DPG A;  4IPH A;  2IHE A;  1L1O A;  1SR3 A;  4APV A;  2NVX H;  1L2F A;  1YBY A;  1HR0 Q;  4IOA A;  1NMG A;  3E9H A;  4QGU A;  2R7Z H;  4A3L G;  3PV0 A;  4A3E G;  2ZJQ A;  2QEX A;  1DT4 A;  1PYS B;  5BR8 Q;  3GTP H;  5LMN L;  1Q46 A;  4JI8 L;  4DV6 L;  4NB3 A;  3CD6 A;  2DGR A;  4UPA A;  3GTL H;  2PNH A;  5FLM H;  2ZTD A;  5IYC H;  4B3T Q;  2EXD A;  1SMX A;  2OPU A;  2ID0 A;  4DR3 L;  1VQH A;  1PH1 A;  1KXL A;  2UXB L;  5JJL A;  2MO1 A;  1G51 A;  2IY5 B;  2PMZ E;  1EOV A;  4AQY Q;  3HOW H;  4DR1 Q;  4LFA Q;  2UXC L;  1YI2 A;  4GOP A;  2Q2H A;  1N36 Q;  3ULL A;  3PO2 G;  1Q86 C;  1MKH A;  2E3U A;  3PO3 G;  4B3R L;  1TUA A;  4LUO A;  1JMC A;  1HZB A;  4DK3 C;  3I7F A;  2FMR A;  5C3E H;  2UUB L;  3L7Z C;  4DR7 L;  3KFU A;  4IPG A;  4UP9 A;  3I56 A;  3CCL A;  3F2D A;  3PUX A;  3U4Z A;  2ALY B;  3A0J A;  5ELN A;  3S15 H;  4MZ9 A;  4A3F G;  1EQQ A;  2N78 A;  4LWC A;  4R4I A;  2F4V L;  3TRE A;  4C3J H;  4JI5 Q;  1Q1E A;  4LF8 Q;  3PSI A;  1T9H A;  2VNU D;  4O0A A;  4IOC A;  4JI0 L;  3F1Z A;  3LGJ A;  2IHF A;  1I6H H;  1SFO H;  1HNW Q;  2PQU A;  2CFM A;  1N9W A;  3KOJ A;  2IX1 A;  2Z6K A;  1JJG A;  1HZA A;  5IYB H;  2UUC L;  5C4X G;  5JJI A;  4OX9 Q;  5DLQ E;  1OTC A;  3V69 A;  1BKB A;  1TWC H;  1WVN A;  1PA6 A;  2BA1 A;  3CQZ H;  2B63 H;  2R7Z G;  2XGT A;  4DAM A;  3W5O A;  2JEB I;  4R4C A;  1GVP A;  5C0X J;  1VQL A;  2CCZ A;  3UDI A;  2WAQ E;  2XTI A;  4MTN A;  1N34 L;  2Q2T A;  4K0K Q;  3A5Z B;  5FLM G;  1N32 Q;  3B6Y A;  4BA1 I;  5IYC G;  2ZTC A;  2VQE Q;  1MJE A;  2GVA A;  1QVC A;  2UU9 Q;  1VQI A;  4QQB X;  3G71 A;  3GTO H;  1UE5 A;  1XMO L;  4JVY A;  1VQO A;  2RHS B;  2CWA A;  3GTQ H;  4DUY Q;  2UUA L;  2QA4 A;  4LFB Q;  1VQF A;  2VW9 A;  1S3O A;  4OO1 I;  1Y1W H;  1I3Q H;  1KHI A;  1TWA H;  4NXN L;  1ZZJ A;  1QZH A;  1IL2 A;  3RZO H;  1J5E Q;  4YCW A;  4P75 A;  2JJQ A;  2KHI A;  1A8V A;  5GAE C;  1CSP A;  3W1B A;  1HR0 W;  3UDF A;  2HHH L;  1WE8 A;  2NZO A;  2PI2 A;  2R92 H;  5AJ3 Q;  3L2P A;  1YIJ A;  1X4M A;  3GTM H;  1X6O A;  4YCV A;  4YHH L;  1N8R C;  3HOV H;  1AE2 A;  2HH2 A;  4DV7 L;  1CKM A;  3KJP A;  4R1J A;  2MNA A;  1I94 L;  3H3V I;  2RF4 A;  4ME3 A;  4LF7 Q;  4HID A;  4A3K H;  1WCM H;  4R4O A;  1EUJ A;  2GVB A;  4LFC L;  1R9T H;  2B63 G;  4NBQ A;  1Z47 A;  4DV5 Q;  4HJ9 A;  2CTF A;  1KL9 A;  3UE1 A;  4DV4 L;  2OQK A;  4X64 Q;  2HIX A;  2K5V A;  4K0K L;  4QJF A;  4A3M G;  1KRT A;  4POF A;  1GKH A;  3K81 C;  5M5W H;  1HNZ Q;  2PY9 A;  4KHZ A;  1QVF A;  3S1Q H;  3T1Y L;  4A3I H;  4GKJ Q;  1X4N A;  1UWV A;  2ES2 A;  2A19 A;  3W1G A;  1NE3 A;  2PQA B;  4DV1 L;  4B3S Q;  3KF8 B;  3HOY G;  3NEM A;  1QUQ B;  4RG1 A;  1XNR Q;  5M3M H;  3CCJ A;  1MJC A;  4RMF A;  4GNX B;  1IBL Q;  1V9P A;  3OTO L;  2OTL A;  3H3V H;  5JJK A;  2DUD A;  4LNQ A;  1OXT A;  3RLF A;  1Q8K A;  1DTJ A;  3DLL A;  3K8A A;  3JAM i;  1N33 L;  4A3D H;  3AYH B;  1Y1V G;  3J80 i;  5M5X H;  4HJ8 A;  1Y1W G;  4YCU A;  1X54 A;  3I4N G;  2AWO A;  2B29 A;  4GNX C;  3AEV A;  4JBK A;  3S1M H;  1X3G A;  3U1K A;  3NEN A;  4X62 Q;  4DUZ Q;  4DR2 Q;  1FL0 A;  2AXY A;  5C44 G;  1WFQ A;  2K14 A;  5E7N A;  3CCM A;  4L5S A;  3I4M H;  3F2C A;  5IWA Q;  3I55 A;  3PUY A;  3KJO A;  4MNO A;  2ZTE A;  3CC4 A;  3PCO B;  3S1N H;  2E5L Q;  2ZM6 Q;  4WJ3 M;  4GLX A;  4A3K G;  2WAQ G;  1WCM G;  2K50 A;  4OO1 G;  4JV5 L;  3U50 C;  1GO3 E;  4X66 L;  4HJ7 A;  1V1Q A;  1RL2 A;  1SN8 A;  1UEB A;  4B3T L;  4BY1 G;  3EBE A;  3U4V A;  1YEZ A;  4NXM Q;  1E1O A;  1PFS A;  2I0Q A;  2VS1 A;  2JA8 H;  4GKJ L;  4LF4 L;  4DR5 Q;  1A62 A;  4JYA L;  4GN5 A;  1A63 A;  4AM3 A;  2CTL A;  2ZJR A;  3KLW A;  3ULP A;  4A3I G;  1XNQ L;  3STB D;  4YY3 Q;  2NVT H;  3HOU H;  4JI3 Q;  1P16 A;  4JI1 L;  2BL5 A;  1EWI A;  2HH3 A;  2CTJ A;  2EQS A;  1X9N A;  1VQP A;  2JVZ A;  4GKK L;  4L5Q A;  5IYD G;  5M3M G;  5IP7 G;  1KAW A;  4BY7 H;  2KBN A;  4PG3 A;  1PYB A;  1Q12 A;  1VIH A;  3G4S A;  2NN6 G;  2ZJP A;  4JI7 L;  1C9O A;  3AFP A;  1CKN B;  2R6G A;  3CCR A;  1FJG Q;  4A3D G;  4HJ5 A;  2MJH A;  2B3G A;  4OON A;  3CXC A;  2K4K A;  4DV2 Q;  4LUZ A;  3KF6 A;  3F2B A;  2A8V A;  3UE0 A;  3A5U A;  3A74 A;  2K5N A;  3GTK H;  1SRO A;  5K36 G;  4GN3 B;  2C35 B;  1YIT A;  1PVO A;  5IWA L;  3K80 C;  4J15 A;  3J81 j;  1HR0 L;  4WAL A;  1YHA A;  2N49 A;  3I4M G;  1KHM A;  1TWF H;  2OCE A;  1EIF A;  2MO0 A;  1I5F A;  5BR8 L;  4BXX H;  1PH3 A;  4A3G H;  2KEN A;  5GAD C;  1PH5 A;  2QND A;  4LF6 Q;  1NBW A;  5GRO A;  3CPF A;  1ASY A;  4A3J H;  1B70 B;  1E1T A;  3T1H Q;  3D0F A;  2VQF Q;  1VQC A;  4IPC A;  2JA6 H;  3J81 i;  2OWO A;  1TWG H;  3TS0 A;  1O7I A;  1XPR A;  4AQY L;  2AKW B;  1PH6 A;  3TRZ A;  4DR1 L;  4DKA C;  4LFA L;  3CF5 A;  2N3S A;  1VQM A;  5ELO A;  1W2B A;  5IP9 H;  1N36 L;  2CPQ A;  4JI2 Q;  3H15 A;  3HOW G;  3ULJ A;  3UDX A;  1E24 A;  3HOU G;  4IFD I;  1HZ9 A;  4KHP Q;  4AYB E;  2YU9 H;  1VS0 A;  2VL6 A;  5JEA G;  5M3F H;  2BH2 A;  2E8G A;  2VY3 A;  1HNX Q;  1X3F A;  1IBM Q;  2F3I A;  4JCV E;  1K0R A;  1CKO A;  4HIM A;  4BY7 G;  1E22 A;  2JA5 H;  4DR4 Q;  5C3E G;  4A4I A;  4B8T A;  3TS2 A;  4WAN A;  1A0I A;  1E7Z A;  2DGY A;  1SLJ A;  4JI5 L;  1YVC A;  2JEA I;  1Q7Y C;  4IJH A;  4IO9 A;  4LF8 L;  1LUZ A;  2JZX A;  1ASZ A;  1U5K A;  2WB1 E;  1PH2 A;  2V1C C;  4LF5 Q;  1C0A A;  3M4Q A;  1W3S A;  5C0X I;  3EN2 A;  4A3C H;  2AWN A;  1HNW L;  1Q1B A;  1CSQ A;  3FHW A;  1L0W A;  4DR6 Q;  1VQA A;  1IYJ B;  4OX9 L;  3JAM c;  1G29 1;  3CCU A;  4JBM A;  1OXV A;  1IBK Q;  3J80 c;  2HT1 A;  5IYB G;  3JC6 6;  4Y7N H;  3HKZ E;  4IJL A;  4PZ8 A;  3M3Y H;  3HOX H;  1VQK A;  5J3B A;  3J7Z C;  1S40 A;  3CAM A;  5H1S E;  5EAY A;  5LMU Q;  1S72 A;  4A3G G;  4P71 A;  3KDF B;  5HY6 A;  1TXY A;  1XMQ Q;  2KCM A;  4OWX B;  3M4O H;  2ANR A;  2VUM H;  2YYZ A;  4P74 A;  4A3J G;  4QY7 A;  5GAH C;  1SE8 A;  4A75 A;  1N32 L;  1ZTG A;  3AEV B;  3CCS A;  1G6P A;  4B3M Q;  1ZZI A;  2VQE L;  4GLA C;  2UU9 L;  3RNU A;  2L15 A;  4YWK A;  3FP9 A;  3STB C;  3J7A 5;  3K0X A;  1YJN A;  3H0G H;  2R93 H;  2E2I H;  2UXD Q;  4YWM A;  4C3I H;  5IP9 G;  1L1O B;  1KD1 C;  3NBH B;  3IRB A;  4A3B H;  3CPW A;  2CKZ B;  1PV4 A;  3BZK A;  4DUY L;  3BU2 A;  4LFB L;  5M3F G;  2K5H A;  2YTY A;  1X55 A;  4C2M H;  2R7D A;  1X3E A;  4C3H H;  4HIK A;  1V43 A;  1VQJ A;  4JI8 Q;  4DV6 Q;  1J5E L;  2LXJ A;  1VQD A;  2YV5 A;  4Y52 H;  3M7N A;  2OTJ A;  4L5T A;  1NTG A;  3AQQ A;  3HKS A;  4UP8 A;  4EX5 A;  2Q2U A;  4IFD G;  2K75 A;  3G48 A;  1LM0 A;  4DR3 Q;  4GN4 B;  1WYD A;  2ANN A;  4A3C G;  4GOP B;  5AJ3 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...