3FAUA

Crystal structure of human small-muts related domain
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
80
structure length
71
Chain Sequence
SLDLHGLHVDEALEHLMRVLEKKTEEFKQNGGKPYLSVITGRRIKPAVIKYLISHSFRFSEIKPGCLKVML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Strcutral Dynamincs of the Endonuclease Small-MutS Related Domains of BCL3 binding protein
rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords NEDD4-binding protein 2
total genus 21
structure length 71
sequence length 80
chains with identical sequence B, C, D
ec nomenclature ec 3.-.-.-:
pdb deposition date 2008-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01713 Smr Smr domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.110 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 3fauA00
3FAUA 4OD6A 4OCHA 3QD7X 2D9IA 2ZQEA 2VKCA
chains in the Genus database with same CATH superfamily
2Y3MA 3GKUA 5IWAH 4AIMA 4JI5H 1FJGH 2NN6G 2CTMA 4LF4H 2UXCH 4JI1H 2X06A 4AM3A 4LFBH 4DV1H 4JV5H 1NXUA 4B8TA 1XNRH 2ZM6H 5LL6b 4DR1H 4DV4H 2JZXA 4EC5A 3AEVB 5K36G 2HH2A 1XMOH 1J4WA 4JI0H 3T1HH 5C0XG 4PDBA 2Z0SA 4NBQA 4DUYH 2HHHH 4JI8H 1VBIA 4B3SH 2VQEH 1ZZJA 3KDGA 4LFAH 4JI7H 1V8CA 4K0KH 1MSZA 1ZZKA 1DTJA 2PY9A 3J7AK 4B8CD 1WE8A 4H8AA 3UOEA 4DR3H 1HR0H 4JYAH 4FJUA 2PQUA 4DV5H 4DR5H 1EC6A 2ZQEA 4JI2H 4X64H 4GKJH 3L7ZC 4IFDG 1J5KA 1V9NA 1J5EH 4G08A 3GABA 4DV6H 4JI3H 3T1YH 2CPMA 1N34H 3JAMW 1K1GA 1F0XA 1PQXA 1TUAA 2E3UA 2QNDA 1X4NA 2CTJA 4BA2I 4OX9H 4BA1I 4JI4H 1VIHA 2PT7G 3FAUA 3SB1A 4X65H 3EZJA 3I0PA 2CTKA 2JEBI 4DV7H 1KHMA 4LF7H 1DT4A 3GR5A 2JEAI 4E9JA 2D9IA 2ANRA 4OCHA 1HNZH 1I6UA 2BA0A 4B3RH 1N33H 1WHRA 2UUBH 4X66H 5BR8H 2UUCH 3OTOH 2JVZA 1IBLH 4JVYA 1XMQH 4DV3H 1X0AA 4LF9H 1HNWH 5A2QW 2LRRA 2MJHA 5DT9A 2OPVA 4DR6H 2JE6I 1UG8A 2F4VH 4LF8H 3NCVA 2UXBH 3OETA 3V69A 1IBKH 4FJSA 2E5LH 4YY3H 4DUZH 1X9ZA 2DGRA 2UUAH 4QMFB 2P2RA 3VKEA 4LFCH 4WANA 5IT9W 2AXYA 2O4CA 1WVNA 4X62H 4YHHH 2VQFH 2BL5A 2FPHX 2VKCA 3U1KA 3J80W 2FFMA 4WALA 2UU9H 4B3MH 1ZZIA 1AN7A 4OO1G 2LF0A 1WTJA 4DR4H 2LTLA 2M8WA 1X4MA 4OD6A 2CWFA 1N36H 4NXNH 4LIJA 2CPQA 1HNXH 2ANNA 4AQYH 1ZTGA 1XNQH 1N32H 2K1HA 3RF2A 2OPUA 5LMUH 4DR2H 1S20A 4B3TH 2LTMA 2M6QA 4KHPH 1VIGA 1XRHA 2HH3A 3QD7X 5LMNH 4DV2H 3J81W 4DV0H 4JI6H 1S03G 2CWHA 2CTLA 2CTEA 2YQRA 2JA9A 1I94H 5FLXW 3KDKA 2FMRA 4NXMH 2CTFA 4NZRM 4GKKH 5JEAG 1Z2IA 3OSSD 1FKAH 2UXDH 2G8YA 1ODHA 4LF5H 1SEIA 2A1SA 4DR7H 1IBMH 4JVHA 4NZTM 4LF6H
chains in the Genus database with same CATH topology
2Y3MA 5IWAH 4JI5H 1FJGH 4LF4H 2UXCH 4JI1H 4LFBH 4DV1H 4JV5H 1XNRH 2ZM6H 5LL6b 4DR1H 4DV4H 4EC5A 1XMOH 4JI0H 3T1HH 4PDBA 4DUYH 2HHHH 4JI8H 4B3SH 2VQEH 3KDGA 4LFAH 4JI7H 4K0KH 3J7AK 4B8CD 4DR3H 1HR0H 4JYAH 4DV5H 4DR5H 2ZQEA 4JI2H 4X64H 4GKJH 1J5EH 4G08A 3GABA 4DV6H 4JI3H 3T1YH 1N34H 3JAMW 1F0XA 4OX9H 4JI4H 2PT7G 3SB1A 3FAUA 4X65H 3EZJA 4DV7H 4LF7H 3GR5A 4E9JA 2D9IA 4OCHA 1HNZH 1I6UA 1N33H 4B3RH 2UUBH 4X66H 5BR8H 2UUCH 3OTOH 1IBLH 1XMQH 4DV3H 4LF9H 1HNWH 5A2QW 5DT9A 4DR6H 2F4VH 4LF8H 3NCVA 2UXBH 3OETA 1IBKH 2E5LH 4YY3H 4DUZH 1X9ZA 2UUAH 5IT9W 4LFCH 2O4CA 4YHHH 4X62H 2VQFH 2FPHX 2VKCA 3J80W 2UU9H 4B3MH 1AN7A 2LF0A 4DR4H 4OD6A 1N36H 4NXNH 1HNXH 4AQYH 1XNQH 1N32H 3RF2A 5LMUH 4DR2H 4B3TH 4KHPH 3QD7X 5LMNH 4JI6H 4DV2H 1S03G 3J81W 4DV0H 1I94H 5FLXW 3KDKA 4NXMH 4NZRM 4GKKH 1FKAH 3OSSD 2UXDH 4LF5H 1ODHA 4DR7H 1SEIA 1IBMH 4NZTM 4LF6H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FAU A;  4OD6 A;  4OCH A;  3QD7 X;  2D9I A;  2ZQE A;  2VKC A; 
#chains in the Genus database with same CATH topology
 2Y3M A;  3GKU A;  5IWA H;  4AIM A;  4JI5 H;  1FJG H;  2NN6 G;  2CTM A;  4LF4 H;  2UXC H;  4JI1 H;  2X06 A;  4AM3 A;  4LFB H;  4DV1 H;  4JV5 H;  1NXU A;  4B8T A;  1XNR H;  2ZM6 H;  5LL6 b;  4DR1 H;  4DV4 H;  2JZX A;  4EC5 A;  3AEV B;  5K36 G;  2HH2 A;  1XMO H;  1J4W A;  4JI0 H;  3T1H H;  5C0X G;  4PDB A;  2Z0S A;  4NBQ A;  4DUY H;  2HHH H;  4JI8 H;  1VBI A;  4B3S H;  2VQE H;  1ZZJ A;  3KDG A;  4LFA H;  4JI7 H;  1V8C A;  4K0K H;  1MSZ A;  1ZZK A;  1DTJ A;  2PY9 A;  3J7A K;  4B8C D;  1WE8 A;  4H8A A;  3UOE A;  4DR3 H;  1HR0 H;  4JYA H;  4FJU A;  2PQU A;  4DV5 H;  4DR5 H;  1EC6 A;  2ZQE A;  4JI2 H;  4X64 H;  4GKJ H;  3L7Z C;  4IFD G;  1J5K A;  1V9N A;  1J5E H;  4G08 A;  3GAB A;  4DV6 H;  4JI3 H;  3T1Y H;  2CPM A;  1N34 H;  3JAM W;  1K1G A;  1F0X A;  1PQX A;  1TUA A;  2E3U A;  2QND A;  1X4N A;  2CTJ A;  4BA2 I;  4OX9 H;  4BA1 I;  4JI4 H;  1VIH A;  2PT7 G;  3FAU A;  3SB1 A;  4X65 H;  3EZJ A;  3I0P A;  2CTK A;  2JEB I;  4DV7 H;  1KHM A;  4LF7 H;  1DT4 A;  3GR5 A;  2JEA I;  4E9J A;  2D9I A;  2ANR A;  4OCH A;  1HNZ H;  1I6U A;  2BA0 A;  4B3R H;  1N33 H;  1WHR A;  2UUB H;  4X66 H;  5BR8 H;  2UUC H;  3OTO H;  2JVZ A;  1IBL H;  4JVY A;  1XMQ H;  4DV3 H;  1X0A A;  4LF9 H;  1HNW H;  5A2Q W;  2LRR A;  2MJH A;  5DT9 A;  2OPV A;  4DR6 H;  2JE6 I;  1UG8 A;  2F4V H;  4LF8 H;  3NCV A;  2UXB H;  3OET A;  3V69 A;  1IBK H;  4FJS A;  2E5L H;  4YY3 H;  4DUZ H;  1X9Z A;  2DGR A;  2UUA H;  4QMF B;  2P2R A;  3VKE A;  4LFC H;  4WAN A;  5IT9 W;  2AXY A;  2O4C A;  1WVN A;  4X62 H;  4YHH H;  2VQF H;  2BL5 A;  2FPH X;  2VKC A;  3U1K A;  3J80 W;  2FFM A;  4WAL A;  2UU9 H;  4B3M H;  1ZZI A;  1AN7 A;  4OO1 G;  2LF0 A;  1WTJ A;  4DR4 H;  2LTL A;  2M8W A;  1X4M A;  4OD6 A;  2CWF A;  1N36 H;  4NXN H;  4LIJ A;  2CPQ A;  1HNX H;  2ANN A;  4AQY H;  1ZTG A;  1XNQ H;  1N32 H;  2K1H A;  3RF2 A;  2OPU A;  5LMU H;  4DR2 H;  1S20 A;  4B3T H;  2LTM A;  2M6Q A;  4KHP H;  1VIG A;  1XRH A;  2HH3 A;  3QD7 X;  5LMN H;  4DV2 H;  3J81 W;  4DV0 H;  4JI6 H;  1S03 G;  2CWH A;  2CTL A;  2CTE A;  2YQR A;  2JA9 A;  1I94 H;  5FLX W;  3KDK A;  2FMR A;  4NXM H;  2CTF A;  4NZR M;  4GKK H;  5JEA G;  1Z2I A;  3OSS D;  1FKA H;  2UXD H;  2G8Y A;  1ODH A;  4LF5 H;  1SEI A;  2A1S A;  4DR7 H;  1IBM H;  4JVH A;  4NZT M;  4LF6 H; 
#chains in the Genus database with same CATH homology
 2Y3M A;  5IWA H;  4JI5 H;  1FJG H;  4LF4 H;  2UXC H;  4JI1 H;  4LFB H;  4DV1 H;  4JV5 H;  1XNR H;  2ZM6 H;  5LL6 b;  4DR1 H;  4DV4 H;  4EC5 A;  1XMO H;  4JI0 H;  3T1H H;  4PDB A;  4DUY H;  2HHH H;  4JI8 H;  4B3S H;  2VQE H;  3KDG A;  4LFA H;  4JI7 H;  4K0K H;  3J7A K;  4B8C D;  4DR3 H;  1HR0 H;  4JYA H;  4DV5 H;  4DR5 H;  2ZQE A;  4JI2 H;  4X64 H;  4GKJ H;  1J5E H;  4G08 A;  3GAB A;  4DV6 H;  4JI3 H;  3T1Y H;  1N34 H;  3JAM W;  1F0X A;  4OX9 H;  4JI4 H;  2PT7 G;  3SB1 A;  3FAU A;  4X65 H;  3EZJ A;  4DV7 H;  4LF7 H;  3GR5 A;  4E9J A;  2D9I A;  4OCH A;  1HNZ H;  1I6U A;  1N33 H;  4B3R H;  2UUB H;  4X66 H;  5BR8 H;  2UUC H;  3OTO H;  1IBL H;  1XMQ H;  4DV3 H;  4LF9 H;  1HNW H;  5A2Q W;  5DT9 A;  4DR6 H;  2F4V H;  4LF8 H;  3NCV A;  2UXB H;  3OET A;  1IBK H;  2E5L H;  4YY3 H;  4DUZ H;  1X9Z A;  2UUA H;  5IT9 W;  4LFC H;  2O4C A;  4YHH H;  4X62 H;  2VQF H;  2FPH X;  2VKC A;  3J80 W;  2UU9 H;  4B3M H;  1AN7 A;  2LF0 A;  4DR4 H;  4OD6 A;  1N36 H;  4NXN H;  1HNX H;  4AQY H;  1XNQ H;  1N32 H;  3RF2 A;  5LMU H;  4DR2 H;  4B3T H;  4KHP H;  3QD7 X;  5LMN H;  4JI6 H;  4DV2 H;  1S03 G;  3J81 W;  4DV0 H;  1I94 H;  5FLX W;  3KDK A;  4NXM H;  4NZR M;  4GKK H;  1FKA H;  3OSS D;  2UXD H;  4LF5 H;  1ODH A;  4DR7 H;  1SEI A;  1IBM H;  4NZT M;  4LF6 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...