3FAUA

Crystal structure of human small-muts related domain
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
80
structure length
71
Chain Sequence
SLDLHGLHVDEALEHLMRVLEKKTEEFKQNGGKPYLSVITGRRIKPAVIKYLISHSFRFSEIKPGCLKVML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords NEDD4-binding protein 2
publication title Strcutral Dynamincs of the Endonuclease Small-MutS Related Domains of BCL3 binding protein
rcsb
source organism Homo sapiens
total genus 21
structure length 71
sequence length 80
chains with identical sequence B, C, D
ec nomenclature ec 3.-.-.-:
pdb deposition date 2008-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01713 Smr Smr domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.110 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 3fauA00
4OCHA 2D9IA 4OD6A 2VKCA 3FAUA 2ZQEA 3QD7X
chains in the Genus database with same CATH superfamily
2X06A 1IBMH 1J5KA 3V69A 1HNWH 1FJGH 2HH2A 2JEAI 4GKJH 4DV3H 4OX9H 3RF2A 2CPQA 2MJHA 5JEAG 2P2RA 2UUBH 4GKKH 4JI1H 4JV5H 2UUCH 2VKCA 2YQRA 2E3UA 1I94H 2JE6I 4X62H 2AXYA 2LTLA 4B8CD 4DV2H 4DUYH 4X66H 4KHPH 3I0PA 2UXBH 2CTFA 3JAMW 1EC6A 2CPMA 3L7ZC 4E9JA 4JVYA 2D9IA 2BL5A 4LF6H 2F4VH 1I6UA 2UXDH 5IWAH 4YY3H 4NXNH 4IFDG 3OETA 1XNRH 1XRHA 2LTMA 4LIJA 4DV7H 3VKEA 1N32H 4DV4H 2FFMA 4B3TH 1S03G 4JI5H 1WTJA 1XNQH 2M8WA 2NN6G 1S20A 1WHRA 1X4MA 1DT4A 2HH3A 4QMFB 2Y3MA 5DT9A 4OO1G 1XMOH 1MSZA 1ZZKA 1XMQH 4LF8H 2LF0A 1AN7A 4DR1H 2QNDA 4X65H 4DR2H 4NBQA 2LRRA 3GR5A 4FJSA 4JI6H 2JEBI 2ANRA 1VIGA 2HHHH 1X4NA 4EC5A 5LMUH 3OTOH 2PY9A 1ZZIA 4OD6A 1ZTGA 2UUAH 1HNZH 3NCVA 1IBKH 4H8AA 1N33H 2JA9A 2K1HA 4DR7H 3GABA 4FJUA 1X9ZA 5LL6b 4YHHH 1VIHA 4LFCH 2A1SA 4WALA 4JI7H 1V8CA 2PT7G 5LMNH 1FKAH 3J7AK 4JYAH 2UXCH 4K0KH 2JVZA 1PQXA 2JZXA 1TUAA 1V9NA 4AM3A 4WANA 4DR6H 2PQUA 4DR4H 4LF4H 2CTJA 2FMRA 3EZJA 4DV6H 3KDKA 5A2QW 4DR5H 4DR3H 3T1YH 1ZZJA 4LFAH 4NXMH 1HR0H 2O4CA 4LF9H 1J5EH 1F0XA 1HNXH 2FPHX 1N34H 2M6QA 3SB1A 2ZM6H 2DGRA 1WVNA 2VQFH 4B3MH 4JI3H 1KHMA 4NZTM 3U1KA 5C0XG 4DV0H 3OSSD 1ODHA 4X64H 4LFBH 1Z2IA 2G8YA 4DV1H 2BA0A 1UG8A 4LF7H 1NXUA 2CTLA 2CTKA 2Z0SA 4JI2H 4NZRM 5FLXW 2ZQEA 3UOEA 4DV5H 4B3RH 1SEIA 2OPVA 4AIMA 5K36G 1DTJA 4JVHA 1J4WA 1K1GA 2UU9H 2ANNA 4OCHA 4LF5H 4JI8H 1WE8A 2OPUA 4BA1I 1VBIA 2CTEA 4B3SH 2VQEH 3J81W 4DUZH 1N36H 4JI0H 2CWHA 3J80W 3FAUA 3QD7X 3AEVB 4PDBA 5IT9W 4G08A 3KDGA 4B8TA 2CWFA 1IBLH 3T1HH 4JI4H 5BR8H 4AQYH 4BA2I 2E5LH 3GKUA 1X0AA 2CTMA
chains in the Genus database with same CATH topology
1IBMH 1HNWH 1FJGH 4GKJH 4DV3H 4OX9H 3RF2A 2UUBH 4GKKH 4JI1H 4JV5H 2UUCH 2VKCA 1I94H 4X62H 4B8CD 4DV2H 4DUYH 4X66H 4KHPH 2UXBH 3JAMW 4E9JA 2D9IA 4LF6H 2F4VH 1I6UA 2UXDH 5IWAH 4YY3H 4NXNH 3OETA 1XNRH 4DV7H 1N32H 4DV4H 4B3TH 1S03G 4JI5H 1XNQH 5DT9A 2Y3MA 1XMOH 1XMQH 4LF8H 2LF0A 1AN7A 4DR1H 4JI6H 4X65H 4DR2H 3GR5A 2HHHH 4EC5A 5LMUH 3OTOH 4OD6A 2UUAH 1HNZH 3NCVA 1IBKH 1N33H 4DR7H 3GABA 1X9ZA 5LL6b 4YHHH 4LFCH 4JI7H 2PT7G 5LMNH 1FKAH 3J7AK 4JYAH 2UXCH 4K0KH 4DR6H 4DR4H 4LF4H 3EZJA 4DV6H 3KDKA 5A2QW 4DR5H 4DR3H 3T1YH 4LFAH 4NXMH 1HR0H 2O4CA 1J5EH 1F0XA 1HNXH 2FPHX 1N34H 3SB1A 2ZM6H 2VQFH 4B3MH 4JI3H 4NZTM 4DV0H 3OSSD 1ODHA 4X64H 4LFBH 4DV1H 4LF7H 4JI2H 4NZRM 5FLXW 2ZQEA 4DV5H 4B3RH 1SEIA 2UU9H 4OCHA 4LF5H 4JI8H 4B3SH 2VQEH 3J81W 4DUZH 1N36H 4JI0H 5IT9W 3J80W 3FAUA 3QD7X 4PDBA 4G08A 3KDGA 1IBLH 3T1HH 4JI4H 5BR8H 4AQYH 2E5LH 4LF9H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OCH A;  2D9I A;  4OD6 A;  2VKC A;  3FAU A;  2ZQE A;  3QD7 X; 
#chains in the Genus database with same CATH topology
 2X06 A;  1IBM H;  1J5K A;  3V69 A;  1HNW H;  1FJG H;  2HH2 A;  2JEA I;  4GKJ H;  4DV3 H;  4OX9 H;  3RF2 A;  2CPQ A;  2MJH A;  5JEA G;  2P2R A;  2UUB H;  4GKK H;  4JI1 H;  4JV5 H;  2UUC H;  2VKC A;  2YQR A;  2E3U A;  1I94 H;  2JE6 I;  4X62 H;  2AXY A;  2LTL A;  4B8C D;  4DV2 H;  4DUY H;  4X66 H;  4KHP H;  3I0P A;  2UXB H;  2CTF A;  3JAM W;  1EC6 A;  2CPM A;  3L7Z C;  4E9J A;  4JVY A;  2D9I A;  2BL5 A;  4LF6 H;  2F4V H;  1I6U A;  2UXD H;  5IWA H;  4YY3 H;  4NXN H;  4IFD G;  3OET A;  1XNR H;  1XRH A;  2LTM A;  4LIJ A;  4DV7 H;  3VKE A;  1N32 H;  4DV4 H;  2FFM A;  4B3T H;  1S03 G;  4JI5 H;  1WTJ A;  1XNQ H;  2M8W A;  2NN6 G;  1S20 A;  1WHR A;  1X4M A;  1DT4 A;  2HH3 A;  4QMF B;  2Y3M A;  5DT9 A;  4OO1 G;  1XMO H;  1MSZ A;  1ZZK A;  1XMQ H;  4LF8 H;  2LF0 A;  1AN7 A;  4DR1 H;  2QND A;  4X65 H;  4DR2 H;  4NBQ A;  2LRR A;  3GR5 A;  4FJS A;  4JI6 H;  2JEB I;  2ANR A;  1VIG A;  2HHH H;  1X4N A;  4EC5 A;  5LMU H;  3OTO H;  2PY9 A;  1ZZI A;  4OD6 A;  1ZTG A;  2UUA H;  1HNZ H;  3NCV A;  1IBK H;  4H8A A;  1N33 H;  2JA9 A;  2K1H A;  4DR7 H;  3GAB A;  4FJU A;  1X9Z A;  5LL6 b;  4YHH H;  1VIH A;  4LFC H;  2A1S A;  4WAL A;  4JI7 H;  1V8C A;  2PT7 G;  5LMN H;  1FKA H;  3J7A K;  4JYA H;  2UXC H;  4K0K H;  2JVZ A;  1PQX A;  2JZX A;  1TUA A;  1V9N A;  4AM3 A;  4WAN A;  4DR6 H;  2PQU A;  4DR4 H;  4LF4 H;  2CTJ A;  2FMR A;  3EZJ A;  4DV6 H;  3KDK A;  5A2Q W;  4DR5 H;  4DR3 H;  3T1Y H;  1ZZJ A;  4LFA H;  4NXM H;  1HR0 H;  2O4C A;  4LF9 H;  1J5E H;  1F0X A;  1HNX H;  2FPH X;  1N34 H;  2M6Q A;  3SB1 A;  2ZM6 H;  2DGR A;  1WVN A;  2VQF H;  4B3M H;  4JI3 H;  1KHM A;  4NZT M;  3U1K A;  5C0X G;  4DV0 H;  3OSS D;  1ODH A;  4X64 H;  4LFB H;  1Z2I A;  2G8Y A;  4DV1 H;  2BA0 A;  1UG8 A;  4LF7 H;  1NXU A;  2CTL A;  2CTK A;  2Z0S A;  4JI2 H;  4NZR M;  5FLX W;  2ZQE A;  3UOE A;  4DV5 H;  4B3R H;  1SEI A;  2OPV A;  4AIM A;  5K36 G;  1DTJ A;  4JVH A;  1J4W A;  1K1G A;  2UU9 H;  2ANN A;  4OCH A;  4LF5 H;  4JI8 H;  1WE8 A;  2OPU A;  4BA1 I;  1VBI A;  2CTE A;  4B3S H;  2VQE H;  3J81 W;  4DUZ H;  1N36 H;  4JI0 H;  2CWH A;  3J80 W;  3FAU A;  3QD7 X;  3AEV B;  4PDB A;  5IT9 W;  4G08 A;  3KDG A;  4B8T A;  2CWF A;  1IBL H;  3T1H H;  4JI4 H;  5BR8 H;  4AQY H;  4BA2 I;  2E5L H;  3GKU A;  1X0A A;  2CTM A; 
#chains in the Genus database with same CATH homology
 1IBM H;  1HNW H;  1FJG H;  4GKJ H;  4DV3 H;  4OX9 H;  3RF2 A;  2UUB H;  4GKK H;  4JI1 H;  4JV5 H;  2UUC H;  2VKC A;  1I94 H;  4X62 H;  4B8C D;  4DV2 H;  4DUY H;  4X66 H;  4KHP H;  2UXB H;  3JAM W;  4E9J A;  2D9I A;  4LF6 H;  2F4V H;  1I6U A;  2UXD H;  5IWA H;  4YY3 H;  4NXN H;  3OET A;  1XNR H;  4DV7 H;  1N32 H;  4DV4 H;  4B3T H;  1S03 G;  4JI5 H;  1XNQ H;  5DT9 A;  2Y3M A;  1XMO H;  1XMQ H;  4LF8 H;  2LF0 A;  1AN7 A;  4DR1 H;  4JI6 H;  4X65 H;  4DR2 H;  3GR5 A;  2HHH H;  4EC5 A;  5LMU H;  3OTO H;  4OD6 A;  2UUA H;  1HNZ H;  3NCV A;  1IBK H;  1N33 H;  4DR7 H;  3GAB A;  1X9Z A;  5LL6 b;  4YHH H;  4LFC H;  4JI7 H;  2PT7 G;  5LMN H;  1FKA H;  3J7A K;  4JYA H;  2UXC H;  4K0K H;  4DR6 H;  4DR4 H;  4LF4 H;  3EZJ A;  4DV6 H;  3KDK A;  5A2Q W;  4DR5 H;  4DR3 H;  3T1Y H;  4LFA H;  4NXM H;  1HR0 H;  2O4C A;  1J5E H;  1F0X A;  1HNX H;  2FPH X;  1N34 H;  3SB1 A;  2ZM6 H;  2VQF H;  4B3M H;  4JI3 H;  4NZT M;  4DV0 H;  3OSS D;  1ODH A;  4X64 H;  4LFB H;  4DV1 H;  4LF7 H;  4JI2 H;  4NZR M;  5FLX W;  2ZQE A;  4DV5 H;  4B3R H;  1SEI A;  2UU9 H;  4OCH A;  4LF5 H;  4JI8 H;  4B3S H;  2VQE H;  3J81 W;  4DUZ H;  1N36 H;  4JI0 H;  5IT9 W;  3J80 W;  3FAU A;  3QD7 X;  4PDB A;  4G08 A;  3KDG A;  1IBL H;  3T1H H;  4JI4 H;  5BR8 H;  4AQY H;  2E5L H;  4LF9 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...