3FAUA

Crystal structure of human small-muts related domain
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
80
structure length
71
Chain Sequence
SLDLHGLHVDEALEHLMRVLEKKTEEFKQNGGKPYLSVITGRRIKPAVIKYLISHSFRFSEIKPGCLKVML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NEDD4-binding protein 2
publication title Strcutral Dynamincs of the Endonuclease Small-MutS Related Domains of BCL3 binding protein
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 21
structure length 71
sequence length 80
chains with identical sequence B, C, D
ec nomenclature ec 3.-.-.-:
pdb deposition date 2008-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01713 Smr Smr domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.110 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 3fauA00
4OCHA 3FAUA 2VKCA 2D9IA 4OD6A 2ZQEA 3QD7X
chains in the Genus database with same CATH superfamily
2M6QA 3J81W 2LRRA 4NXMH 2JZXA 1PQXA 4DR4H 2Y3MA 4DV4H 1XMQH 2LF0A 4FJSA 1MSZA 2FMRA 1AN7A 1VIGA 4DV3H 3KDGA 4JI5H 4DUYH 2AXYA 2UUAH 4PDBA 2CTFA 1I6UA 2M8WA 4LF8H 3J7AK 4DR6H 2VKCA 2MJHA 1HNWH 2OPUA 4NZTM 4JV5H 1DT4A 4WANA 4JI0H 1X0AA 1X4NA 4LFBH 2BA0A 5IT9W 4DR1H 4DR7H 2A1SA 1F0XA 4JYAH 4H8AA 2LTMA 1J5KA 4JI4H 1Z2IA 2P2RA 1FKAH 4B3SH 4DV6H 1IBKH 3OTOH 2UUCH 2HHHH 3VKEA 4LF6H 1N32H 4JI3H 4DR5H 5LL6b 4WALA 1WTJA 5FLXW 2ZQEA 1XMOH 1WVNA 4FJUA 2ANRA 1I94H 4X66H 1SEIA 4NZRM 1HNZH 2CTEA 1XNRH 1S03G 1WHRA 3OETA 3NCVA 2CPQA 5A2QW 2PQUA 4X64H 2QNDA 5IWAH 2JE6I 1VIHA 4B3MH 4LF7H 2JEBI 1X4MA 1VBIA 2CTJA 3EZJA 4B8TA 2UUBH 3I0PA 4X65H 4B3TH 1XNQH 2ZM6H 1ODHA 4B3RH 3U1KA 5JEAG 4X62H 1ZZJA 2JA9A 2O4CA 2G8YA 3QD7X 5C0XG 4LF5H 2NN6G 2HH2A 4JI6H 2DGRA 1DTJA 2CWHA 2E3UA 1X9ZA 1HR0H 4DV2H 4JVYA 4DUZH 1IBMH 2F4VH 4EC5A 1WE8A 2PT7G 1V9NA 2Z0SA 4IFDG 4OO1G 2VQFH 1ZTGA 4LFAH 4AM3A 1TUAA 2PY9A 1FJGH 4DV7H 4OD6A 4JI2H 4DV5H 3AEVB 4LFCH 3V69A 4YHHH 3RF2A 4BA2I 5LMNH 3GR5A 1N34H 1K1GA 2UXCH 3KDKA 1NXUA 3T1HH 1IBLH 2OPVA 2UU9H 1XRHA 4DV0H 3T1YH 2CPMA 3J80W 3UOEA 4K0KH 4KHPH 2VQEH 1V8CA 4OCHA 4B8CD 4AQYH 4NXNH 5DT9A 1J5EH 1UG8A 3GKUA 1S20A 3L7ZC 4JI1H 4JI7H 4OX9H 2CTKA 2CTLA 3JAMW 1HNXH 2HH3A 5LMUH 4E9JA 4GKJH 4LIJA 1N33H 2ANNA 4JI8H 3GABA 4BA1I 4DV1H 2K1HA 4YY3H 4DR2H 4JVHA 2UXDH 2X06A 3FAUA 2UXBH 2FFMA 4QMFB 4AIMA 2E5LH 4GKKH 1KHMA 3SB1A 1EC6A 2FPHX 2JVZA 2YQRA 4NBQA 2CWFA 2BL5A 5BR8H 4DR3H 3OSSD 5K36G 4LF9H 1ZZIA 2D9IA 1ZZKA 4G08A 2JEAI 4LF4H 1J4WA 2LTLA 1N36H 2CTMA
chains in the Genus database with same CATH topology
3J81W 4NXMH 4DR4H 2Y3MA 4DV4H 1XMQH 2LF0A 1AN7A 4DV3H 3KDGA 4JI5H 4DUYH 4PDBA 2UUAH 1I6UA 4LF8H 3J7AK 4DR6H 2VKCA 1HNWH 4NZTM 4JV5H 4JI0H 4LFBH 5IT9W 4DR7H 1F0XA 4JYAH 4JI4H 1FKAH 4B3SH 4DV6H 1IBKH 3OTOH 2UUCH 2HHHH 4LF6H 1N32H 4JI3H 4DR5H 5LL6b 5FLXW 2ZQEA 1XMOH 1I94H 4X66H 1SEIA 4NZRM 1HNZH 1XNRH 1S03G 3OETA 3NCVA 5A2QW 4X64H 5IWAH 4B3MH 4LF7H 3EZJA 2UUBH 4X65H 1XNQH 4B3TH 2ZM6H 1ODHA 4B3RH 4X62H 2O4CA 3QD7X 4LF5H 4JI6H 1X9ZA 1HR0H 4DV2H 4DUZH 1IBMH 2F4VH 4EC5A 2PT7G 2VQFH 4LFAH 1FJGH 4DV7H 4OD6A 4JI2H 4DV5H 4LFCH 4YHHH 3RF2A 5LMNH 3GR5A 1N34H 2UXCH 3KDKA 3T1HH 1IBLH 2UU9H 4DV0H 3T1YH 3J80W 4K0KH 4KHPH 2VQEH 4OCHA 4B8CD 4AQYH 4NXNH 5DT9A 1J5EH 4JI1H 4JI7H 4OX9H 3JAMW 1HNXH 5LMUH 4E9JA 4GKJH 1N33H 4JI8H 3GABA 2UXDH 4YY3H 4DR2H 2UXBH 3FAUA 2E5LH 4GKKH 3SB1A 2FPHX 4DR3H 5BR8H 3OSSD 4LF9H 2D9IA 4G08A 4LF4H 4DV1H 1N36H 4DR1H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OCH A;  3FAU A;  2VKC A;  2D9I A;  4OD6 A;  2ZQE A;  3QD7 X; 
#chains in the Genus database with same CATH topology
 2M6Q A;  3J81 W;  2LRR A;  4NXM H;  2JZX A;  1PQX A;  4DR4 H;  2Y3M A;  4DV4 H;  1XMQ H;  2LF0 A;  4FJS A;  1MSZ A;  2FMR A;  1AN7 A;  1VIG A;  4DV3 H;  3KDG A;  4JI5 H;  4DUY H;  2AXY A;  2UUA H;  4PDB A;  2CTF A;  1I6U A;  2M8W A;  4LF8 H;  3J7A K;  4DR6 H;  2VKC A;  2MJH A;  1HNW H;  2OPU A;  4NZT M;  4JV5 H;  1DT4 A;  4WAN A;  4JI0 H;  1X0A A;  1X4N A;  4LFB H;  2BA0 A;  5IT9 W;  4DR1 H;  4DR7 H;  2A1S A;  1F0X A;  4JYA H;  4H8A A;  2LTM A;  1J5K A;  4JI4 H;  1Z2I A;  2P2R A;  1FKA H;  4B3S H;  4DV6 H;  1IBK H;  3OTO H;  2UUC H;  2HHH H;  3VKE A;  4LF6 H;  1N32 H;  4JI3 H;  4DR5 H;  5LL6 b;  4WAL A;  1WTJ A;  5FLX W;  2ZQE A;  1XMO H;  1WVN A;  4FJU A;  2ANR A;  1I94 H;  4X66 H;  1SEI A;  4NZR M;  1HNZ H;  2CTE A;  1XNR H;  1S03 G;  1WHR A;  3OET A;  3NCV A;  2CPQ A;  5A2Q W;  2PQU A;  4X64 H;  2QND A;  5IWA H;  2JE6 I;  1VIH A;  4B3M H;  4LF7 H;  2JEB I;  1X4M A;  1VBI A;  2CTJ A;  3EZJ A;  4B8T A;  2UUB H;  3I0P A;  4X65 H;  4B3T H;  1XNQ H;  2ZM6 H;  1ODH A;  4B3R H;  3U1K A;  5JEA G;  4X62 H;  1ZZJ A;  2JA9 A;  2O4C A;  2G8Y A;  3QD7 X;  5C0X G;  4LF5 H;  2NN6 G;  2HH2 A;  4JI6 H;  2DGR A;  1DTJ A;  2CWH A;  2E3U A;  1X9Z A;  1HR0 H;  4DV2 H;  4JVY A;  4DUZ H;  1IBM H;  2F4V H;  4EC5 A;  1WE8 A;  2PT7 G;  1V9N A;  2Z0S A;  4IFD G;  4OO1 G;  2VQF H;  1ZTG A;  4LFA H;  4AM3 A;  1TUA A;  2PY9 A;  1FJG H;  4DV7 H;  4OD6 A;  4JI2 H;  4DV5 H;  3AEV B;  4LFC H;  3V69 A;  4YHH H;  3RF2 A;  4BA2 I;  5LMN H;  3GR5 A;  1N34 H;  1K1G A;  2UXC H;  3KDK A;  1NXU A;  3T1H H;  1IBL H;  2OPV A;  2UU9 H;  1XRH A;  4DV0 H;  3T1Y H;  2CPM A;  3J80 W;  3UOE A;  4K0K H;  4KHP H;  2VQE H;  1V8C A;  4OCH A;  4B8C D;  4AQY H;  4NXN H;  5DT9 A;  1J5E H;  1UG8 A;  3GKU A;  1S20 A;  3L7Z C;  4JI1 H;  4JI7 H;  4OX9 H;  2CTK A;  2CTL A;  3JAM W;  1HNX H;  2HH3 A;  5LMU H;  4E9J A;  4GKJ H;  4LIJ A;  1N33 H;  2ANN A;  4JI8 H;  3GAB A;  4BA1 I;  4DV1 H;  2K1H A;  4YY3 H;  4DR2 H;  4JVH A;  2UXD H;  2X06 A;  3FAU A;  2UXB H;  2FFM A;  4QMF B;  4AIM A;  2E5L H;  4GKK H;  1KHM A;  3SB1 A;  1EC6 A;  2FPH X;  2JVZ A;  2YQR A;  4NBQ A;  2CWF A;  2BL5 A;  5BR8 H;  4DR3 H;  3OSS D;  5K36 G;  4LF9 H;  1ZZI A;  2D9I A;  1ZZK A;  4G08 A;  2JEA I;  4LF4 H;  1J4W A;  2LTL A;  1N36 H;  2CTM A; 
#chains in the Genus database with same CATH homology
 3J81 W;  4NXM H;  4DR4 H;  2Y3M A;  4DV4 H;  1XMQ H;  2LF0 A;  1AN7 A;  4DV3 H;  3KDG A;  4JI5 H;  4DUY H;  4PDB A;  2UUA H;  1I6U A;  4LF8 H;  3J7A K;  4DR6 H;  2VKC A;  1HNW H;  4NZT M;  4JV5 H;  4JI0 H;  4LFB H;  5IT9 W;  4DR7 H;  1F0X A;  4JYA H;  4JI4 H;  1FKA H;  4B3S H;  4DV6 H;  1IBK H;  3OTO H;  2UUC H;  2HHH H;  4LF6 H;  1N32 H;  4JI3 H;  4DR5 H;  5LL6 b;  5FLX W;  2ZQE A;  1XMO H;  1I94 H;  4X66 H;  1SEI A;  4NZR M;  1HNZ H;  1XNR H;  1S03 G;  3OET A;  3NCV A;  5A2Q W;  4X64 H;  5IWA H;  4B3M H;  4LF7 H;  3EZJ A;  2UUB H;  4X65 H;  1XNQ H;  4B3T H;  2ZM6 H;  1ODH A;  4B3R H;  4X62 H;  2O4C A;  3QD7 X;  4LF5 H;  4JI6 H;  1X9Z A;  1HR0 H;  4DV2 H;  4DUZ H;  1IBM H;  2F4V H;  4EC5 A;  2PT7 G;  2VQF H;  4LFA H;  1FJG H;  4DV7 H;  4OD6 A;  4JI2 H;  4DV5 H;  4LFC H;  4YHH H;  3RF2 A;  5LMN H;  3GR5 A;  1N34 H;  2UXC H;  3KDK A;  3T1H H;  1IBL H;  2UU9 H;  4DV0 H;  3T1Y H;  3J80 W;  4K0K H;  4KHP H;  2VQE H;  4OCH A;  4B8C D;  4AQY H;  4NXN H;  5DT9 A;  1J5E H;  4JI1 H;  4JI7 H;  4OX9 H;  3JAM W;  1HNX H;  5LMU H;  4E9J A;  4GKJ H;  1N33 H;  4JI8 H;  3GAB A;  2UXD H;  4YY3 H;  4DR2 H;  2UXB H;  3FAU A;  2E5L H;  4GKK H;  3SB1 A;  2FPH X;  4DR3 H;  5BR8 H;  3OSS D;  4LF9 H;  2D9I A;  4G08 A;  4LF4 H;  4DV1 H;  1N36 H;  4DR1 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...