3FAUA

Crystal structure of human small-muts related domain
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
80
structure length
71
Chain Sequence
b'SLDLHGLHVDEALEHLMRVLEKKTEEFKQNGGKPYLSVITGRRIKPAVIKYLISHSFRFSEIKPGCLKVML'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NEDD4-binding protein 2
publication title Strcutral Dynamincs of the Endonuclease Small-MutS Related Domains of BCL3 binding protein
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 21
structure length 71
sequence length 80
chains with identical sequence B, C, D
ec nomenclature ec 3.-.-.-:
pdb deposition date 2008-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01713 Smr Smr domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.110 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Ribosomal Protein S8; Chain: A, domain 1 3fauA00
3FAUA 2ZQEA 2D9IA 2VKCA 4OD6A 3QD7X 4OCHA
chains in the Genus database with same CATH superfamily
1HNWH 4JI1H 4X66H 2JEAI 2K1HA 5IT9W 1ZTGA 1IBMH 3VKEA 2CTJA 4JI0H 1DTJA 3GR5A 2VQFH 1VIGA 4NZTM 4JV5H 2UXDH 2PQUA 4OD6A 3J80W 1K1GA 4LF6H 2NN6G 4LFCH 2JA9A 2UUBH 4B3MH 1X4NA 1WTJA 4OO1G 2BA0A 3FAUA 5A2QW 2UU9H 1X4MA 4X64H 2M8WA 4DR1H 2M6QA 4DV6H 1ZZKA 1XMQH 1SEIA 1NXUA 2LTLA 4B3RH 4GKJH 2LF0A 2CPQA 2CTKA 2YQRA 2CPMA 1EC6A 4JVHA 1J4WA 2UUCH 4BA1I 2HH2A 1Z2IA 2ANNA 2D9IA 4DR6H 4QMFB 2HH3A 2MJHA 2AXYA 2UUAH 3KDKA 4NZRM 1J5KA 2JVZA 4X62H 2FPHX 1S03G 1X9ZA 1HR0H 3AEVB 4DR5H 2E5LH 4B3SH 1TUAA 4B3TH 1V8CA 4JI2H 2FMRA 3U1KA 4DV3H 4DV0H 1XNQH 4YY3H 4JI5H 2FFMA 5LMNH 1MSZA 4IFDG 4DR7H 4WALA 3T1HH 4DR2H 4YHHH 1ZZJA 4EC5A 4DR3H 1VIHA 1FKAH 4DUYH 1X0AA 1ODHA 4LF8H 1ZZIA 4GKKH 3GABA 4B8TA 2X06A 2CTFA 5JEAG 1XMOH 4DV2H 2UXCH 1WVNA 2JEBI 2Z0SA 1DT4A 2OPVA 1N32H 5BR8H 3L7ZC 4AM3A 4AIMA 4PDBA 2VQEH 2OPUA 4NXMH 4OX9H 1N34H 2VKCA 4JI3H 1WE8A 1F0XA 4LF5H 4DV1H 2LTMA 4LF7H 4NBQA 4FJSA 2LRRA 1IBKH 4E9JA 3SB1A 1XRHA 1V9NA 1HNXH 4LFAH 2E3UA 5IWAH 1I94H 4JI8H 2ANRA 4NXNH 1PQXA 2CTEA 4DUZH 1AN7A 5K36G 3T1YH 2ZQEA 4WANA 1FJGH 4X65H 3J81W 4JI4H 5LMUH 3NCVA 4DV4H 3KDGA 2P2RA 4LF9H 3J7AK 4FJUA 1I6UA 2O4CA 1XNRH 5DT9A 4DV5H 4OCHA 2PY9A 1HNZH 1S20A 4JYAH 3GKUA 4LIJA 2DGRA 2ZM6H 2JZXA 2QNDA 2Y3MA 5FLXW 4JI7H 4DV7H 4KHPH 5C0XG 2BL5A 4H8AA 2CTLA 2CTMA 2CWFA 3OTOH 1N36H 1J5EH 3I0PA 3OETA 4BA2I 3UOEA 2JE6I 3RF2A 4AQYH 2CWHA 1UG8A 4B8CD 2F4VH 3EZJA 5LL6b 4LFBH 4G08A 2G8YA 1KHMA 2HHHH 2UXBH 4JVYA 4DR4H 4LF4H 1N33H 3QD7X 3JAMW 4JI6H 2PT7G 2A1SA 1IBLH 3OSSD 3V69A 1WHRA 1VBIA 4K0KH
chains in the Genus database with same CATH topology
1HNWH 4JI1H 4X66H 5IT9W 1IBMH 4JI0H 3GR5A 2VQFH 4NZTM 4JV5H 2UXDH 4OD6A 3J80W 4LF6H 4LFCH 2UUBH 4B3MH 3FAUA 5A2QW 2UU9H 4X64H 4DR1H 4DV6H 1XMQH 1SEIA 4B3RH 4GKJH 2LF0A 2UUCH 2D9IA 4DR6H 2UUAH 3KDKA 4NZRM 4X62H 2FPHX 1S03G 1X9ZA 1HR0H 4DR5H 2E5LH 4B3SH 4B3TH 4JI2H 4DV3H 1XNQH 4YY3H 4JI5H 5LMNH 4DR7H 3T1HH 4DR2H 4YHHH 4EC5A 4DR3H 1FKAH 4DUYH 1ODHA 4LF8H 4GKKH 3GABA 1XMOH 4DV2H 2UXCH 1N32H 5BR8H 4PDBA 2VQEH 4NXMH 4OX9H 1N34H 2VKCA 4JI3H 1F0XA 4LF5H 4DV1H 4LF7H 1IBKH 4E9JA 3SB1A 1HNXH 3OSSD 5IWAH 1I94H 4LFAH 4JI8H 4NXNH 4DUZH 1AN7A 3T1YH 2ZQEA 1FJGH 4X65H 3J81W 4JI4H 5LMUH 3NCVA 4DV4H 3KDGA 4LF9H 3J7AK 1I6UA 2O4CA 1XNRH 4DV5H 4OCHA 1HNZH 4JYAH 2ZM6H 5FLXW 4JI7H 2Y3MA 4KHPH 4DV7H 3OTOH 1N36H 1J5EH 3OETA 3RF2A 4AQYH 4B8CD 2F4VH 3EZJA 5LL6b 4LFBH 4G08A 2UXBH 4DR4H 4LF4H 1N33H 3QD7X 3JAMW 4JI6H 2PT7G 1IBLH 5DT9A 2HHHH 4DV0H 4K0KH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FAU A;  2ZQE A;  2D9I A;  2VKC A;  4OD6 A;  3QD7 X;  4OCH A; 
#chains in the Genus database with same CATH topology
 1HNW H;  4JI1 H;  4X66 H;  2JEA I;  2K1H A;  5IT9 W;  1ZTG A;  1IBM H;  3VKE A;  2CTJ A;  4JI0 H;  1DTJ A;  3GR5 A;  2VQF H;  1VIG A;  4NZT M;  4JV5 H;  2UXD H;  2PQU A;  4OD6 A;  3J80 W;  1K1G A;  4LF6 H;  2NN6 G;  4LFC H;  2JA9 A;  2UUB H;  4B3M H;  1X4N A;  1WTJ A;  4OO1 G;  2BA0 A;  3FAU A;  5A2Q W;  2UU9 H;  1X4M A;  4X64 H;  2M8W A;  4DR1 H;  2M6Q A;  4DV6 H;  1ZZK A;  1XMQ H;  1SEI A;  1NXU A;  2LTL A;  4B3R H;  4GKJ H;  2LF0 A;  2CPQ A;  2CTK A;  2YQR A;  2CPM A;  1EC6 A;  4JVH A;  1J4W A;  2UUC H;  4BA1 I;  2HH2 A;  1Z2I A;  2ANN A;  2D9I A;  4DR6 H;  4QMF B;  2HH3 A;  2MJH A;  2AXY A;  2UUA H;  3KDK A;  4NZR M;  1J5K A;  2JVZ A;  4X62 H;  2FPH X;  1S03 G;  1X9Z A;  1HR0 H;  3AEV B;  4DR5 H;  2E5L H;  4B3S H;  1TUA A;  4B3T H;  1V8C A;  4JI2 H;  2FMR A;  3U1K A;  4DV3 H;  4DV0 H;  1XNQ H;  4YY3 H;  4JI5 H;  2FFM A;  5LMN H;  1MSZ A;  4IFD G;  4DR7 H;  4WAL A;  3T1H H;  4DR2 H;  4YHH H;  1ZZJ A;  4EC5 A;  4DR3 H;  1VIH A;  1FKA H;  4DUY H;  1X0A A;  1ODH A;  4LF8 H;  1ZZI A;  4GKK H;  3GAB A;  4B8T A;  2X06 A;  2CTF A;  5JEA G;  1XMO H;  4DV2 H;  2UXC H;  1WVN A;  2JEB I;  2Z0S A;  1DT4 A;  2OPV A;  1N32 H;  5BR8 H;  3L7Z C;  4AM3 A;  4AIM A;  4PDB A;  2VQE H;  2OPU A;  4NXM H;  4OX9 H;  1N34 H;  2VKC A;  4JI3 H;  1WE8 A;  1F0X A;  4LF5 H;  4DV1 H;  2LTM A;  4LF7 H;  4NBQ A;  4FJS A;  2LRR A;  1IBK H;  4E9J A;  3SB1 A;  1XRH A;  1V9N A;  1HNX H;  4LFA H;  2E3U A;  5IWA H;  1I94 H;  4JI8 H;  2ANR A;  4NXN H;  1PQX A;  2CTE A;  4DUZ H;  1AN7 A;  5K36 G;  3T1Y H;  2ZQE A;  4WAN A;  1FJG H;  4X65 H;  3J81 W;  4JI4 H;  5LMU H;  3NCV A;  4DV4 H;  3KDG A;  2P2R A;  4LF9 H;  3J7A K;  4FJU A;  1I6U A;  2O4C A;  1XNR H;  5DT9 A;  4DV5 H;  4OCH A;  2PY9 A;  1HNZ H;  1S20 A;  4JYA H;  3GKU A;  4LIJ A;  2DGR A;  2ZM6 H;  2JZX A;  2QND A;  2Y3M A;  5FLX W;  4JI7 H;  4DV7 H;  4KHP H;  5C0X G;  2BL5 A;  4H8A A;  2CTL A;  2CTM A;  2CWF A;  3OTO H;  1N36 H;  1J5E H;  3I0P A;  3OET A;  4BA2 I;  3UOE A;  2JE6 I;  3RF2 A;  4AQY H;  2CWH A;  1UG8 A;  4B8C D;  2F4V H;  3EZJ A;  5LL6 b;  4LFB H;  4G08 A;  2G8Y A;  1KHM A;  2HHH H;  2UXB H;  4JVY A;  4DR4 H;  4LF4 H;  1N33 H;  3QD7 X;  3JAM W;  4JI6 H;  2PT7 G;  2A1S A;  1IBL H;  3OSS D;  3V69 A;  1WHR A;  1VBI A;  4K0K H; 
#chains in the Genus database with same CATH homology
 1HNW H;  4JI1 H;  4X66 H;  5IT9 W;  1IBM H;  4JI0 H;  3GR5 A;  2VQF H;  4NZT M;  4JV5 H;  2UXD H;  4OD6 A;  3J80 W;  4LF6 H;  4LFC H;  2UUB H;  4B3M H;  3FAU A;  5A2Q W;  2UU9 H;  4X64 H;  4DR1 H;  4DV6 H;  1XMQ H;  1SEI A;  4B3R H;  4GKJ H;  2LF0 A;  2UUC H;  2D9I A;  4DR6 H;  2UUA H;  3KDK A;  4NZR M;  4X62 H;  2FPH X;  1S03 G;  1X9Z A;  1HR0 H;  4DR5 H;  2E5L H;  4B3S H;  4B3T H;  4JI2 H;  4DV3 H;  1XNQ H;  4YY3 H;  4JI5 H;  5LMN H;  4DR7 H;  3T1H H;  4DR2 H;  4YHH H;  4EC5 A;  4DR3 H;  1FKA H;  4DUY H;  1ODH A;  4LF8 H;  4GKK H;  3GAB A;  1XMO H;  4DV2 H;  2UXC H;  1N32 H;  5BR8 H;  4PDB A;  2VQE H;  4NXM H;  4OX9 H;  1N34 H;  2VKC A;  4JI3 H;  1F0X A;  4LF5 H;  4DV1 H;  4LF7 H;  1IBK H;  4E9J A;  3SB1 A;  1HNX H;  3OSS D;  5IWA H;  1I94 H;  4LFA H;  4JI8 H;  4NXN H;  4DUZ H;  1AN7 A;  3T1Y H;  2ZQE A;  1FJG H;  4X65 H;  3J81 W;  4JI4 H;  5LMU H;  3NCV A;  4DV4 H;  3KDG A;  4LF9 H;  3J7A K;  1I6U A;  2O4C A;  1XNR H;  4DV5 H;  4OCH A;  1HNZ H;  4JYA H;  2ZM6 H;  5FLX W;  4JI7 H;  2Y3M A;  4KHP H;  4DV7 H;  3OTO H;  1N36 H;  1J5E H;  3OET A;  3RF2 A;  4AQY H;  4B8C D;  2F4V H;  3EZJ A;  5LL6 b;  4LFB H;  4G08 A;  2UXB H;  4DR4 H;  4LF4 H;  1N33 H;  3QD7 X;  3JAM W;  4JI6 H;  2PT7 G;  1IBL H;  5DT9 A;  2HHH H;  4DV0 H;  4K0K H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...