1XRHA

Crystal structure of ureidoglycolate dehydrogenase from escherichia coli
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
343
structure length
343
Chain Sequence
b'SSKISRETLHQLIENKLCQAGLKREHAATVAEVLVYADARGIHSHGAVRVEYYAERISKGGTNREPEFRLEETGPCSAILHADNAAGQVAAKMGMEHAIKTAQQNGVAVVGISRMGHSGAISYFVQQAARAGFIGISMCQSDPMVVPFGGAEIYYGTNPLAFAAPGEGDEILTFDMATTVQAWGKVLDARSRNMSIPDTWAVDKNGVPTTDPFAVHALLPAAGPKGYGLMMMIDVLSGVLLGLPFGRQVSSMYDDLHAGRNLGQLHIVINPNFFSSSELFRQHLSQTMRELNAITPAPGFNQVYYPGQDQDIKQRKAAVEGIEIVDDIYQYLISDALYNTSYE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ureidoglycolate Dehydrogenase
molecule tags Oxidoreductase
source organism Escherichia coli
publication title Crystal Structure of Ureidoglycolate Dehydrogenase from Escherichia Coli
rcsb
total genus 95
structure length 343
sequence length 343
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.1.1.350: Ureidoglycolate dehydrogenase (NAD(+)).
pdb deposition date 2004-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02615 Ldh_2 Malate/L-lactate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1530.10 Mainly Alpha Orthogonal Bundle Hypothetical Oxidoreductase Yiak; Chain: A, domain 1 Hypothetical Oxidoreductase Yiak; Chain: A, domain 1 1xrhA01
3.30.1370.60 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Hypothetical oxidoreductase yiak; domain 2 1xrhA02
1NXUA 3UOEA 1X0AA 1V9NA 2G8YA 4FJSA 1S20A 4FJUA 2CWFA 2CWHA 2X06A 1XRHA 3I0PA 4H8AA 1VBIA 1WTJA 1Z2IA
chains in the Genus database with same CATH superfamily
1NXUA 4LFCH 2Y3MA 4X65H 3EZJA 3RF2A 4DR7H 4DUZH 2LTLA 2FPHX 2M8WA 3KDKA 2CPMA 5LMNH 1V8CA 3T1YH 2F4VH 2D9IA 4JI6H 4LF4H 4OCHA 2E5LH 4AM3A 3U1KA 1F0XA 2JZXA 4LFBH 4X62H 4DUYH 4JVHA 1MSZA 2JVZA 4PDBA 3GABA 1ZZKA 2BL5A 2VKCA 1X0AA 2UUCH 2FFMA 2JA9A 4FJUA 4YHHH 4DV4H 3KDGA 4DV7H 4LF5H 4JI5H 1EC6A 1I6UA 5FLXW 4LF9H 1XNRH 4GKJH 4EC5A 1HR0H 4NZTM 1ODHA 4FJSA 1S20A 4BA2I 4JI3H 2QNDA 2CTLA 3J81W 4DR4H 3GR5A 4WALA 4DV3H 1N36H 3VKEA 2FMRA 1J5EH 1DT4A 1ZTGA 4OD6A 3JAMW 1V9NA 4X64H 4JI2H 2MJHA 3OSSD 1ZZJA 2CWFA 2X06A 1FKAH 1J5KA 1K1GA 2ANNA 5A2QW 1AN7A 4JI8H 2YQRA 2UUBH 2CTFA 2A1SA 2UXDH 2BA0A 4E9JA 4K0KH 1IBMH 3OTOH 4X66H 2Z0SA 4DR5H 4JI4H 2CTKA 2JE6I 1X4MA 3SB1A 1WHRA 2ZQEA 2CTMA 4AQYH 3T1HH 1WE8A 1VIGA 2M6QA 1SEIA 3NCVA 3QD7X 1FJGH 2HHHH 4DR6H 3V69A 4IFDG 2NN6G 4H8AA 4NBQA 2P2RA 2UUAH 1X4NA 2UXBH 3OETA 4B8TA 2HH3A 2K1HA 2CTJA 3GKUA 4OX9H 4YY3H 3J7AK 1TUAA 4JVYA 5LMUH 2JEAI 5K36G 5BR8H 1WTJA 4QMFB 2UU9H 4DR2H 1N32H 2AXYA 5IT9W 2CPQA 1VIHA 4NZRM 3UOEA 1X9ZA 2DGRA 2PT7G 4JI0H 3FAUA 2JEBI 1WVNA 2LTMA 2ZM6H 4B8CD 4DR3H 1S03G 3AEVB 1ZZIA 4JI1H 1VBIA 1UG8A 1XMOH 1HNXH 1N33H 2OPVA 3J80W 1KHMA 2O4CA 1J4WA 4LF6H 1HNZH 1N34H 2VQFH 4DV2H 4B3RH 1XRHA 2UXCH 4LF8H 3L7ZC 4DR1H 1XNQH 2OPUA 4JYAH 4KHPH 1HNWH 1DTJA 4NXNH 3I0PA 4LIJA 4B3TH 5DT9A 4OO1G 2VQEH 4DV1H 5IWAH 5LL6b 1IBLH 5C0XG 4JV5H 4DV5H 1PQXA 2LRRA 2G8YA 2CTEA 4BA1I 1I94H 2LF0A 2PQUA 1IBKH 4NXMH 4GKKH 2E3UA 4DV0H 4B3MH 4G08A 4DV6H 4AIMA 2HH2A 1XMQH 2ANRA 2PY9A 4WANA 4LFAH 2CWHA 4LF7H 4JI7H 5JEAG 1Z2IA 4B3SH
chains in the Genus database with same CATH topology
1NXUA 3UOEA 1X0AA 1V9NA 2G8YA 4FJSA 1S20A 4FJUA 2CWFA 2CWHA 2X06A 1XRHA 3I0PA 4H8AA 1VBIA 1WTJA 1Z2IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NXU A;  3UOE A;  1X0A A;  1V9N A;  2G8Y A;  4FJS A;  1S20 A;  4FJU A;  2CWF A;  2CWH A;  2X06 A;  1XRH A;  3I0P A;  4H8A A;  1VBI A;  1WTJ A;  1Z2I A; 
#chains in the Genus database with same CATH topology
 1NXU A;  4LFC H;  2Y3M A;  4X65 H;  3EZJ A;  3RF2 A;  4DR7 H;  4DUZ H;  2LTL A;  2FPH X;  2M8W A;  3KDK A;  2CPM A;  5LMN H;  1V8C A;  3T1Y H;  2F4V H;  2D9I A;  4JI6 H;  4LF4 H;  4OCH A;  2E5L H;  4AM3 A;  3U1K A;  1F0X A;  2JZX A;  4LFB H;  4X62 H;  4DUY H;  4JVH A;  1MSZ A;  2JVZ A;  4PDB A;  3GAB A;  1ZZK A;  2BL5 A;  2VKC A;  1X0A A;  2UUC H;  2FFM A;  2JA9 A;  4FJU A;  4YHH H;  4DV4 H;  3KDG A;  4DV7 H;  4LF5 H;  4JI5 H;  1EC6 A;  1I6U A;  5FLX W;  4LF9 H;  1XNR H;  4GKJ H;  4EC5 A;  1HR0 H;  4NZT M;  1ODH A;  4FJS A;  1S20 A;  4BA2 I;  4JI3 H;  2QND A;  2CTL A;  3J81 W;  4DR4 H;  3GR5 A;  4WAL A;  4DV3 H;  1N36 H;  3VKE A;  2FMR A;  1J5E H;  1DT4 A;  1ZTG A;  4OD6 A;  3JAM W;  1V9N A;  4X64 H;  4JI2 H;  2MJH A;  3OSS D;  1ZZJ A;  2CWF A;  2X06 A;  1FKA H;  1J5K A;  1K1G A;  2ANN A;  5A2Q W;  1AN7 A;  4JI8 H;  2YQR A;  2UUB H;  2CTF A;  2A1S A;  2UXD H;  2BA0 A;  4E9J A;  4K0K H;  1IBM H;  3OTO H;  4X66 H;  2Z0S A;  4DR5 H;  4JI4 H;  2CTK A;  2JE6 I;  1X4M A;  3SB1 A;  1WHR A;  2ZQE A;  2CTM A;  4AQY H;  3T1H H;  1WE8 A;  1VIG A;  2M6Q A;  1SEI A;  3NCV A;  3QD7 X;  1FJG H;  2HHH H;  4DR6 H;  3V69 A;  4IFD G;  2NN6 G;  4H8A A;  4NBQ A;  2P2R A;  2UUA H;  1X4N A;  2UXB H;  3OET A;  4B8T A;  2HH3 A;  2K1H A;  2CTJ A;  3GKU A;  4OX9 H;  4YY3 H;  3J7A K;  1TUA A;  4JVY A;  5LMU H;  2JEA I;  5K36 G;  5BR8 H;  1WTJ A;  4QMF B;  2UU9 H;  4DR2 H;  1N32 H;  2AXY A;  5IT9 W;  2CPQ A;  1VIH A;  4NZR M;  3UOE A;  1X9Z A;  2DGR A;  2PT7 G;  4JI0 H;  3FAU A;  2JEB I;  1WVN A;  2LTM A;  2ZM6 H;  4B8C D;  4DR3 H;  1S03 G;  3AEV B;  1ZZI A;  4JI1 H;  1VBI A;  1UG8 A;  1XMO H;  1HNX H;  1N33 H;  2OPV A;  3J80 W;  1KHM A;  2O4C A;  1J4W A;  4LF6 H;  1HNZ H;  1N34 H;  2VQF H;  4DV2 H;  4B3R H;  1XRH A;  2UXC H;  4LF8 H;  3L7Z C;  4DR1 H;  1XNQ H;  2OPU A;  4JYA H;  4KHP H;  1HNW H;  1DTJ A;  4NXN H;  3I0P A;  4LIJ A;  4B3T H;  5DT9 A;  4OO1 G;  2VQE H;  4DV1 H;  5IWA H;  5LL6 b;  1IBL H;  5C0X G;  4JV5 H;  4DV5 H;  1PQX A;  2LRR A;  2G8Y A;  2CTE A;  4BA1 I;  1I94 H;  2LF0 A;  2PQU A;  1IBK H;  4NXM H;  4GKK H;  2E3U A;  4DV0 H;  4B3M H;  4G08 A;  4DV6 H;  4AIM A;  2HH2 A;  1XMQ H;  2ANR A;  2PY9 A;  4WAN A;  4LFA H;  2CWH A;  4LF7 H;  4JI7 H;  5JEA G;  1Z2I A;  4B3S H; 
#chains in the Genus database with same CATH homology
 1NXU A;  3UOE A;  1X0A A;  1V9N A;  2G8Y A;  4FJS A;  1S20 A;  4FJU A;  2CWF A;  2CWH A;  2X06 A;  1XRH A;  3I0P A;  4H8A A;  1VBI A;  1WTJ A;  1Z2I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...