1XRHA

Crystal structure of ureidoglycolate dehydrogenase from escherichia coli
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
343
structure length
343
Chain Sequence
b'SSKISRETLHQLIENKLCQAGLKREHAATVAEVLVYADARGIHSHGAVRVEYYAERISKGGTNREPEFRLEETGPCSAILHADNAAGQVAAKMGMEHAIKTAQQNGVAVVGISRMGHSGAISYFVQQAARAGFIGISMCQSDPMVVPFGGAEIYYGTNPLAFAAPGEGDEILTFDMATTVQAWGKVLDARSRNMSIPDTWAVDKNGVPTTDPFAVHALLPAAGPKGYGLMMMIDVLSGVLLGLPFGRQVSSMYDDLHAGRNLGQLHIVINPNFFSSSELFRQHLSQTMRELNAITPAPGFNQVYYPGQDQDIKQRKAAVEGIEIVDDIYQYLISDALYNTSYE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ureidoglycolate Dehydrogenase
publication title Crystal Structure of Ureidoglycolate Dehydrogenase from Escherichia Coli
rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 95
structure length 343
sequence length 343
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.1.1.350: Ureidoglycolate dehydrogenase (NAD(+)).
pdb deposition date 2004-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02615 Ldh_2 Malate/L-lactate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1530.10 Mainly Alpha Orthogonal Bundle Hypothetical Oxidoreductase Yiak; Chain: A, domain 1 Hypothetical Oxidoreductase Yiak; Chain: A, domain 1 1xrhA01
3.30.1370.60 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Hypothetical oxidoreductase yiak; domain 2 1xrhA02
1X0AA 4FJUA 1NXUA 1XRHA 2G8YA 1VBIA 2CWHA 3I0PA 3UOEA 4FJSA 4H8AA 1Z2IA 1WTJA 2X06A 1S20A 2CWFA 1V9NA
chains in the Genus database with same CATH superfamily
2BL5A 4LF9H 3QD7X 1HNWH 1KHMA 2LTMA 4G08A 3T1HH 2D9IA 3OTOH 4E9JA 4YY3H 4DV6H 1K1GA 4LF5H 3J81W 4JI1H 4JV5H 2BA0A 2FFMA 5C0XG 4KHPH 1WHRA 1ZTGA 2PQUA 4WANA 2VQFH 5LL6b 3AEVB 4JI3H 4DV5H 1X4NA 2JEAI 1DT4A 4B3MH 2A1SA 3VKEA 4YHHH 4LFBH 2CPQA 4NXNH 2ZQEA 2CTFA 1S03G 3KDKA 4NZRM 4FJUA 4EC5A 1XMQH 1XRHA 4JI2H 2K1HA 4OO1G 2UXCH 2VQEH 4X66H 4JVHA 1J5KA 1UG8A 4DV2H 2M8WA 4X64H 4JI0H 2FPHX 5FLXW 3OETA 2E3UA 1I6UA 1MSZA 2JVZA 1WE8A 2VKCA 2CTJA 4JI7H 2OPVA 2G8YA 3JAMW 1XNQH 1V9NA 4B8CD 2JEBI 5DT9A 1IBLH 2UUBH 1HNZH 1X0AA 3OSSD 4AQYH 4JVYA 1IBMH 1V8CA 4DR5H 4B3SH 1N36H 2JA9A 4DR3H 4DV4H 2LF0A 4B3TH 3J80W 4IFDG 1J5EH 1S20A 4DR4H 4X65H 5IT9W 2HHHH 4BA2I 2NN6G 4OX9H 5LMUH 1Z2IA 4DR7H 3J7AK 2ZM6H 2ANRA 2JZXA 1WVNA 1XNRH 1EC6A 2CPMA 2DGRA 1HNXH 2ANNA 4NZTM 4JI5H 3L7ZC 2FMRA 4DR6H 2CTKA 4OD6A 4GKJH 4DV7H 2AXYA 4JI6H 1VBIA 4JI4H 4DUZH 4OCHA 1HR0H 4LF8H 3RF2A 2JE6I 1ODHA 2MJHA 1X4MA 2E5LH 5K36G 4LFCH 2UXDH 4LFAH 4X62H 1VIGA 2CTMA 4H8AA 2Z0SA 2HH3A 3V69A 4DV3H 1ZZJA 1DTJA 1X9ZA 4LF7H 3EZJA 1FJGH 4PDBA 5JEAG 4LIJA 2YQRA 1N34H 1N33H 2LRRA 4DV1H 2Y3MA 1WTJA 2LTLA 3U1KA 4JYAH 3KDGA 4QMFB 4DUYH 1FKAH 4DV0H 3NCVA 2PY9A 2HH2A 2OPUA 1NXUA 1IBKH 1VIHA 2UU9H 4NXMH 1AN7A 2X06A 5A2QW 5BR8H 4AM3A 5IWAH 3T1YH 4AIMA 1TUAA 4B3RH 3GKUA 1I94H 4BA1I 3GABA 2PT7G 4K0KH 4JI8H 2F4VH 2P2RA 2CTLA 1F0XA 1XMOH 4B8TA 1ZZKA 4DR1H 3GR5A 4GKKH 2UUAH 1J4WA 4FJSA 2CTEA 2CWHA 2M6QA 4LF6H 2UXBH 1ZZIA 2UUCH 4WALA 5LMNH 4LF4H 3UOEA 3SB1A 3I0PA 2O4CA 3FAUA 4DR2H 1SEIA 1PQXA 2QNDA 2CWFA 1N32H 4NBQA
chains in the Genus database with same CATH topology
1X0AA 4FJUA 1NXUA 1XRHA 2G8YA 1VBIA 2CWHA 3I0PA 3UOEA 4FJSA 4H8AA 1Z2IA 1WTJA 2X06A 1S20A 2CWFA 1V9NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X0A A;  4FJU A;  1NXU A;  1XRH A;  2G8Y A;  1VBI A;  2CWH A;  3I0P A;  3UOE A;  4FJS A;  4H8A A;  1Z2I A;  1WTJ A;  2X06 A;  1S20 A;  2CWF A;  1V9N A; 
#chains in the Genus database with same CATH topology
 2BL5 A;  4LF9 H;  3QD7 X;  1HNW H;  1KHM A;  2LTM A;  4G08 A;  3T1H H;  2D9I A;  3OTO H;  4E9J A;  4YY3 H;  4DV6 H;  1K1G A;  4LF5 H;  3J81 W;  4JI1 H;  4JV5 H;  2BA0 A;  2FFM A;  5C0X G;  4KHP H;  1WHR A;  1ZTG A;  2PQU A;  4WAN A;  2VQF H;  5LL6 b;  3AEV B;  4JI3 H;  4DV5 H;  1X4N A;  2JEA I;  1DT4 A;  4B3M H;  2A1S A;  3VKE A;  4YHH H;  4LFB H;  2CPQ A;  4NXN H;  2ZQE A;  2CTF A;  1S03 G;  3KDK A;  4NZR M;  4FJU A;  4EC5 A;  1XMQ H;  1XRH A;  4JI2 H;  2K1H A;  4OO1 G;  2UXC H;  2VQE H;  4X66 H;  4JVH A;  1J5K A;  1UG8 A;  4DV2 H;  2M8W A;  4X64 H;  4JI0 H;  2FPH X;  5FLX W;  3OET A;  2E3U A;  1I6U A;  1MSZ A;  2JVZ A;  1WE8 A;  2VKC A;  2CTJ A;  4JI7 H;  2OPV A;  2G8Y A;  3JAM W;  1XNQ H;  1V9N A;  4B8C D;  2JEB I;  5DT9 A;  1IBL H;  2UUB H;  1HNZ H;  1X0A A;  3OSS D;  4AQY H;  4JVY A;  1IBM H;  1V8C A;  4DR5 H;  4B3S H;  1N36 H;  2JA9 A;  4DR3 H;  4DV4 H;  2LF0 A;  4B3T H;  3J80 W;  4IFD G;  1J5E H;  1S20 A;  4DR4 H;  4X65 H;  5IT9 W;  2HHH H;  4BA2 I;  2NN6 G;  4OX9 H;  5LMU H;  1Z2I A;  4DR7 H;  3J7A K;  2ZM6 H;  2ANR A;  2JZX A;  1WVN A;  1XNR H;  1EC6 A;  2CPM A;  2DGR A;  1HNX H;  2ANN A;  4NZT M;  4JI5 H;  3L7Z C;  2FMR A;  4DR6 H;  2CTK A;  4OD6 A;  4GKJ H;  4DV7 H;  2AXY A;  4JI6 H;  1VBI A;  4JI4 H;  4DUZ H;  4OCH A;  1HR0 H;  4LF8 H;  3RF2 A;  2JE6 I;  1ODH A;  2MJH A;  1X4M A;  2E5L H;  5K36 G;  4LFC H;  2UXD H;  4LFA H;  4X62 H;  1VIG A;  2CTM A;  4H8A A;  2Z0S A;  2HH3 A;  3V69 A;  4DV3 H;  1ZZJ A;  1DTJ A;  1X9Z A;  4LF7 H;  3EZJ A;  1FJG H;  4PDB A;  5JEA G;  4LIJ A;  2YQR A;  1N34 H;  1N33 H;  2LRR A;  4DV1 H;  2Y3M A;  1WTJ A;  2LTL A;  3U1K A;  4JYA H;  3KDG A;  4QMF B;  4DUY H;  1FKA H;  4DV0 H;  3NCV A;  2PY9 A;  2HH2 A;  2OPU A;  1NXU A;  1IBK H;  1VIH A;  2UU9 H;  4NXM H;  1AN7 A;  2X06 A;  5A2Q W;  5BR8 H;  4AM3 A;  5IWA H;  3T1Y H;  4AIM A;  1TUA A;  4B3R H;  3GKU A;  1I94 H;  4BA1 I;  3GAB A;  2PT7 G;  4K0K H;  4JI8 H;  2F4V H;  2P2R A;  2CTL A;  1F0X A;  1XMO H;  4B8T A;  1ZZK A;  4DR1 H;  3GR5 A;  4GKK H;  2UUA H;  1J4W A;  4FJS A;  2CTE A;  2CWH A;  2M6Q A;  4LF6 H;  2UXB H;  1ZZI A;  2UUC H;  4WAL A;  5LMN H;  4LF4 H;  3UOE A;  3SB1 A;  3I0P A;  2O4C A;  3FAU A;  4DR2 H;  1SEI A;  1PQX A;  2QND A;  2CWF A;  1N32 H;  4NBQ A; 
#chains in the Genus database with same CATH homology
 1X0A A;  4FJU A;  1NXU A;  1XRH A;  2G8Y A;  1VBI A;  2CWH A;  3I0P A;  3UOE A;  4FJS A;  4H8A A;  1Z2I A;  1WTJ A;  2X06 A;  1S20 A;  2CWF A;  1V9N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...