1XRHA

Crystal structure of ureidoglycolate dehydrogenase from escherichia coli
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
343
structure length
343
Chain Sequence
SSKISRETLHQLIENKLCQAGLKREHAATVAEVLVYADARGIHSHGAVRVEYYAERISKGGTNREPEFRLEETGPCSAILHADNAAGQVAAKMGMEHAIKTAQQNGVAVVGISRMGHSGAISYFVQQAARAGFIGISMCQSDPMVVPFGGAEIYYGTNPLAFAAPGEGDEILTFDMATTVQAWGKVLDARSRNMSIPDTWAVDKNGVPTTDPFAVHALLPAAGPKGYGLMMMIDVLSGVLLGLPFGRQVSSMYDDLHAGRNLGQLHIVINPNFFSSSELFRQHLSQTMRELNAITPAPGFNQVYYPGQDQDIKQRKAAVEGIEIVDDIYQYLISDALYNTSYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Ureidoglycolate Dehydrogenase
publication title Crystal Structure of Ureidoglycolate Dehydrogenase from Escherichia Coli
rcsb
source organism Escherichia coli
total genus 95
structure length 343
sequence length 343
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.1.1.350: Ureidoglycolate dehydrogenase (NAD(+)).
pdb deposition date 2004-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02615 Ldh_2 Malate/L-lactate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1530.10 Mainly Alpha Orthogonal Bundle Hypothetical Oxidoreductase Yiak; Chain: A, domain 1 Hypothetical Oxidoreductase Yiak; Chain: A, domain 1 1xrhA01
3.30.1370.60 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Hypothetical oxidoreductase yiak; domain 2 1xrhA02
1WTJA 2X06A 4FJUA 1XRHA 2CWHA 4FJSA 3UOEA 1X0AA 1NXUA 1VBIA 1V9NA 1Z2IA 3I0PA 2G8YA 4H8AA 2CWFA 1S20A
chains in the Genus database with same CATH superfamily
2K1HA 4LF7H 4B3SH 3KDGA 4JI8H 2CPMA 2FPHX 4DUYH 4DR7H 4LF9H 4DV3H 1IBKH 5FLXW 4DV7H 1FJGH 2HHHH 2JEAI 4AQYH 1HR0H 4DR6H 1TUAA 4WANA 2JA9A 3GR5A 2CTLA 4OCHA 2VQFH 4DR5H 2F4VH 1ZZKA 5C0XG 4B3TH 3T1YH 2CTEA 1I6UA 4QMFB 2CTFA 3GKUA 4K0KH 1FKAH 2PT7G 4NXMH 4JI1H 3FAUA 5IWAH 2PQUA 2Z0SA 2CTMA 2E5LH 4OD6A 1UG8A 1WE8A 4BA2I 2G8YA 4GKKH 2A1SA 2JE6I 4B3RH 3EZJA 2BL5A 4FJUA 1XNRH 5LL6b 4LFCH 2OPVA 3L7ZC 2UXDH 2FMRA 4NZTM 1J4WA 2M6QA 5LMNH 4JVYA 4JI7H 4NZRM 2PY9A 5K36G 2FFMA 4OO1G 4BA1I 2D9IA 2Y3MA 4DR3H 2LF0A 4KHPH 3I0PA 1NXUA 1ZZJA 4JVHA 3J81W 1X4MA 2JVZA 4AIMA 2OPUA 4FJSA 4LIJA 2UUBH 4AM3A 3V69A 4DV6H 1N34H 2ANRA 4LF5H 2CTKA 2MJHA 3J7AK 4E9JA 4DR4H 1N33H 2E3UA 2UU9H 1X4NA 4B8CD 1HNZH 4JI6H 1Z2IA 2O4CA 4X65H 1EC6A 1J5KA 1WVNA 2DGRA 2CWFA 1S20A 3J80W 4JV5H 1ZZIA 1MSZA 3QD7X 4X66H 1XMOH 1X0AA 1N36H 1V9NA 4JI2H 1ZTGA 4H8AA 3RF2A 4NXNH 4PDBA 3GABA 4GKJH 5LMUH 1N32H 1AN7A 1SEIA 2HH3A 3OETA 2LTLA 2QNDA 5JEAG 2CTJA 4NBQA 4IFDG 1HNWH 3NCVA 3SB1A 3AEVB 2ZQEA 4LFBH 2X06A 2LTMA 1K1GA 1IBLH 4LF4H 1XNQH 2CWHA 5DT9A 4YHHH 3U1KA 4DV5H 2VKCA 2BA0A 3KDKA 2YQRA 2M8WA 4YY3H 3OSSD 4DV1H 1XMQH 4DV2H 2UXBH 2VQEH 3OTOH 1WTJA 5BR8H 4G08A 4OX9H 1IBMH 1VIGA 4LF6H 1VIHA 2LRRA 1VBIA 2UXCH 2AXYA 4DR2H 4DR1H 2CPQA 2JEBI 1DT4A 1XRHA 1WHRA 2ANNA 2UUAH 4B8TA 4B3MH 4JI0H 3UOEA 4JI5H 4X62H 1S03G 4DV0H 4DV4H 1KHMA 4WALA 2JZXA 1PQXA 4JI4H 4JYAH 3T1HH 5IT9W 2ZM6H 1X9ZA 1J5EH 4DUZH 2HH2A 3JAMW 4X64H 2P2RA 1F0XA 4JI3H 3VKEA 4LF8H 2NN6G 4EC5A 1ODHA 4LFAH 2UUCH 1HNXH 5A2QW 1V8CA 1I94H 1DTJA
chains in the Genus database with same CATH topology
1WTJA 2X06A 4FJUA 1XRHA 2CWHA 4FJSA 3UOEA 1X0AA 1NXUA 1VBIA 1V9NA 1Z2IA 3I0PA 2G8YA 4H8AA 2CWFA 1S20A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WTJ A;  2X06 A;  4FJU A;  1XRH A;  2CWH A;  4FJS A;  3UOE A;  1X0A A;  1NXU A;  1VBI A;  1V9N A;  1Z2I A;  3I0P A;  2G8Y A;  4H8A A;  2CWF A;  1S20 A; 
#chains in the Genus database with same CATH topology
 2K1H A;  4LF7 H;  4B3S H;  3KDG A;  4JI8 H;  2CPM A;  2FPH X;  4DUY H;  4DR7 H;  4LF9 H;  4DV3 H;  1IBK H;  5FLX W;  4DV7 H;  1FJG H;  2HHH H;  2JEA I;  4AQY H;  1HR0 H;  4DR6 H;  1TUA A;  4WAN A;  2JA9 A;  3GR5 A;  2CTL A;  4OCH A;  2VQF H;  4DR5 H;  2F4V H;  1ZZK A;  5C0X G;  4B3T H;  3T1Y H;  2CTE A;  1I6U A;  4QMF B;  2CTF A;  3GKU A;  4K0K H;  1FKA H;  2PT7 G;  4NXM H;  4JI1 H;  3FAU A;  5IWA H;  2PQU A;  2Z0S A;  2CTM A;  2E5L H;  4OD6 A;  1UG8 A;  1WE8 A;  4BA2 I;  2G8Y A;  4GKK H;  2A1S A;  2JE6 I;  4B3R H;  3EZJ A;  2BL5 A;  4FJU A;  1XNR H;  5LL6 b;  4LFC H;  2OPV A;  3L7Z C;  2UXD H;  2FMR A;  4NZT M;  1J4W A;  2M6Q A;  5LMN H;  4JVY A;  4JI7 H;  4NZR M;  2PY9 A;  5K36 G;  2FFM A;  4OO1 G;  4BA1 I;  2D9I A;  2Y3M A;  4DR3 H;  2LF0 A;  4KHP H;  3I0P A;  1NXU A;  1ZZJ A;  4JVH A;  3J81 W;  1X4M A;  2JVZ A;  4AIM A;  2OPU A;  4FJS A;  4LIJ A;  2UUB H;  4AM3 A;  3V69 A;  4DV6 H;  1N34 H;  2ANR A;  4LF5 H;  2CTK A;  2MJH A;  3J7A K;  4E9J A;  4DR4 H;  1N33 H;  2E3U A;  2UU9 H;  1X4N A;  4B8C D;  1HNZ H;  4JI6 H;  1Z2I A;  2O4C A;  4X65 H;  1EC6 A;  1J5K A;  1WVN A;  2DGR A;  2CWF A;  1S20 A;  3J80 W;  4JV5 H;  1ZZI A;  1MSZ A;  3QD7 X;  4X66 H;  1XMO H;  1X0A A;  1N36 H;  1V9N A;  4JI2 H;  1ZTG A;  4H8A A;  3RF2 A;  4NXN H;  4PDB A;  3GAB A;  4GKJ H;  5LMU H;  1N32 H;  1AN7 A;  1SEI A;  2HH3 A;  3OET A;  2LTL A;  2QND A;  5JEA G;  2CTJ A;  4NBQ A;  4IFD G;  1HNW H;  3NCV A;  3SB1 A;  3AEV B;  2ZQE A;  4LFB H;  2X06 A;  2LTM A;  1K1G A;  1IBL H;  4LF4 H;  1XNQ H;  2CWH A;  5DT9 A;  4YHH H;  3U1K A;  4DV5 H;  2VKC A;  2BA0 A;  3KDK A;  2YQR A;  2M8W A;  4YY3 H;  3OSS D;  4DV1 H;  1XMQ H;  4DV2 H;  2UXB H;  2VQE H;  3OTO H;  1WTJ A;  5BR8 H;  4G08 A;  4OX9 H;  1IBM H;  1VIG A;  4LF6 H;  1VIH A;  2LRR A;  1VBI A;  2UXC H;  2AXY A;  4DR2 H;  4DR1 H;  2CPQ A;  2JEB I;  1DT4 A;  1XRH A;  1WHR A;  2ANN A;  2UUA H;  4B8T A;  4B3M H;  4JI0 H;  3UOE A;  4JI5 H;  4X62 H;  1S03 G;  4DV0 H;  4DV4 H;  1KHM A;  4WAL A;  2JZX A;  1PQX A;  4JI4 H;  4JYA H;  3T1H H;  5IT9 W;  2ZM6 H;  1X9Z A;  1J5E H;  4DUZ H;  2HH2 A;  3JAM W;  4X64 H;  2P2R A;  1F0X A;  4JI3 H;  3VKE A;  4LF8 H;  2NN6 G;  4EC5 A;  1ODH A;  4LFA H;  2UUC H;  1HNX H;  5A2Q W;  1V8C A;  1I94 H;  1DTJ A; 
#chains in the Genus database with same CATH homology
 1WTJ A;  2X06 A;  4FJU A;  1XRH A;  2CWH A;  4FJS A;  3UOE A;  1X0A A;  1NXU A;  1VBI A;  1V9N A;  1Z2I A;  3I0P A;  2G8Y A;  4H8A A;  2CWF A;  1S20 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...